Vaccine formulation to protect against pertussis

11701417 · 2023-07-18

Assignee

Inventors

Cpc classification

International classification

Abstract

A vaccine composition for intranasal administration includes a Bordetella pertussis antigen, and an effective adjuvant amount of a high molecular weight glucose polymer. The high molecular weight glucose polymer may be a beta-glucan. The Bordetella pertussis antigen may be an extracellular toxin, an adhesion protein, an outer membrane protein, a receptor protein, a fragment thereof, or a mixture thereof.

Claims

1. A vaccine composition, comprising: a Bordetella pertussis antigen, wherein the Bordetella pertussis antigen comprises an extracellular pertussis toxoid (PT), the adhesion protein filamentous hemagglutinin (FHA), or a combination thereof; and an effective adjuvant amount of a 1,3-beta-glucan/1,6-beta-glucan copolymer derived from baker's yeast with a particle size of 3 μm to 4 μm.

2. A vaccine composition, comprising: a Bordetella pertussis antigen, wherein the Bordetella pertussis antigen comprises an extracellular pertussis toxoid (PT), the adhesion protein filamentous hemagglutinin (FHA), or a combination thereof; and an effective adjuvant amount of a beta-glucan polymer derived from baker's yeast with a particle size of 3 μm to 4 μm, wherein the beta-glucan polymer is a 1,3-beta-glucan polymer, a 1,3-beta-glucan/1,4-beta-glucan copolymer, a 1,3-beta-glucan/1,6-beta-glucan copolymer, or a mixture thereof.

3. The vaccine composition of claim 1, wherein the Bordetella pertussis antigen further comprises a compound selected from the group consisting of an extracellular toxoid, an adhesion protein, an outer membrane protein, a receptor protein, and mixtures thereof.

4. The vaccine composition of claim 1, wherein the Bordetella pertussis antigen further comprises at least one antigen selected from the group consisting of the adhesion protein fimbriae (FIM), the outer membrane protein pertactin (PRN), the siderophore receptor protein FauA, the xenosiderophore receptor protein BfeA, the hemophore receptor protein BhuR, and mixtures thereof.

5. The vaccine composition of claim 1, wherein the composition further includes an adenylate cyclase toxin (ACT) antigen.

6. The vaccine composition of claim 5, wherein the ACT antigen is a C-terminal repeats-in-toxin domain (RTX) of ACT.

7. The vaccine composition of claim 1, wherein the composition is formulated to induce a Th1/Th17 immune response.

8. The vaccine composition of claim 1, wherein the composition is formulated for intranasal administration.

9. The vaccine composition of claim 1, wherein the composition is formulated for parenteral administration by subcutaneous (SC) injection, transdermal administration, intramuscular (IM) injection, or intradermal (ID) injection.

10. The vaccine composition of claim 1, wherein the composition is formulated for non-parenteral administration by oral administration, intravaginal administration, pulmonary administration, ophthalmic administration, or rectal administration.

11. A method of immunizing a host against pertussis by administering the composition of claim 1 intranasally to the host.

12. The vaccine composition of claim 2, wherein the Bordetella pertussis antigen further comprises a compound selected from the group consisting of the adhesion protein fimbriae (FIM), the outer membrane protein pertactin (PRN), the siderophore receptor protein FauA, the xenosiderophore receptor protein BfeA, the hemophore receptor protein BhuR, and mixtures thereof.

13. The vaccine composition of claim 2, wherein the composition further includes an adenylate cyclase toxin (ACT) antigen.

14. The vaccine composition of claim 13, wherein the ACT antigen is a C-terminal repeats-in-toxin domain (RTX) of ACT.

15. The vaccine composition of claim 2, wherein the composition is formulated for intranasal administration.

16. The vaccine composition of claim 2, wherein the composition is formulated for parenteral administration by subcutaneous (SC) injection, transdermal administration, intramuscular (IM) injection, or intradermal (ID) injection.

17. The vaccine composition of claim 2, wherein the composition is formulated for non-parenteral administration by oral administration, intravaginal administration, pulmonary administration, ophthalmic administration, or rectal administration.

18. A vaccine composition, comprising a Bordetella pertussis antigen, and an effective adjuvant amount of a beta-glucan polymer, wherein the Bordetella pertussis antigen is selected from the group consisting of: a fragment of siderophore receptor protein FauA selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and combinations thereof; a fragment of xenosiderophore receptor protein BfeA selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, and combinations thereof; a fragment of hemophore receptor protein BhuR selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, and combinations thereof; and mixtures thereof.

19. A vaccine composition, comprising a Bordetella pertussis antigen, wherein the Bordetella pertussis antigen is selected from the group consisting of: a fragment of siderophore receptor protein FauA selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and combinations thereof; a fragment of xenosiderophore receptor protein BfeA selected from the group consisting of SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, and combinations thereof; a fragment of hemophore receptor protein BhuR selected from the group consisting of SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, and combinations thereof; and mixtures thereof.

20. The vaccine composition of claim 19, wherein the Bordetella pertussis antigen is selected from the group consisting of: a fragment of siderophore receptor protein FauA selected from the group consisting of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, and combinations thereof.

21. The vaccine composition of claim 2, wherein the beta-glucan polymer is a 1,3-beta-glucan polymer.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) In order to better understand various embodiments, reference is made to the accompanying drawings, wherein:

(2) FIG. 1 shows iron and heme acquisition in B. pertussis. The model based on B. pertussis alcaligin, enterobactin and heme acquisition systems, and their homologues in other bacterial species. OM/IM: outer/inner membrane. In parentheses: fold changes in expression in vivo vs. in vitro.

(3) FIG. 2A and FIG. 2B show structures of the xenosiderophore receptor BfeA and the hemophore receptor BhuR, respectively. Sequences corresponding to antigenic peptides of Table 1 are highlighted in color.

(4) FIG. 3 illustrates a model of curdlan-DTaP immunization leading to T cell polarization and production of antibodies that recognize and neutralize infecting B. pertussis.

(5) FIGS. 4A, 4B and 4C illustrate the synergistic improvement of DtaP administered by intraperitoneal injection (IP-DTaP) by inclusion of toxoid adenylate cyclase antigen (RTX) and show viable B. pertussis in lungs of mice at 3 days post challenge, enhanced production of anti-pertussis toxin due to inclusion of RTX, and decreased IL-6 due to inclusion of RTX, respectively.

(6) FIGS. 5A, 5B, 5C and 5D illustrate the bacterial burden, lung IL-6 production, lung neutrophil recruitment, and PT/FHA IL-17 production of splenocytes, respectively, in aP, wP, and IN-caP immunized mice.

(7) FIGS. 6A to 6F illustrate localization of acellular pertussis vaccine in the upper and lower respiratory system after IN vaccination. FIG. 6A shows a schematic of the vaccine tracking protocol. CD-1 mice were intranasally vaccinated with either fluorescent DTaP alone (IN-aP) or fluorescent DTaP with curdlan (IN-caP). Vaccine particle deposition in the lungs and nasal cavity was measured at 0, 6, 12, 24, and 48 h after immunization. FIG. 6B shows a representative image of Alexa Fluor labeled DTaP vaccine particles. FIG. 6C shows representative images of nasal cavity fluorescence at 6, 12, and 24 h after vaccination with IN-aP or IN-caP. The region of interest used for fluorescence quantification is shown in blue. FIG. 6D shows fluorescence measurements normalized to PBS control at 6, 12, and 24 h (n=4). Results shown as mean±SEM of total radiant efficiency, *P<0.05. P values were determined by multiple T-tests with Holm-Sidak post hoc test between IN-aP and IN-caP vaccinated mice. FIG. 6E shows representative plots at 12 h showing live, single cells that are CD11b.sup.+DTaP.sup.+. FIG. 6C shows flow cytometric analysis of CD11b.sup.+ cells from the lung that contain or are bound to DTaP particles at 6, 12, 24, and 48 h post immunization. Results shown as mean±SEM, *P<0.05, ***P<0.001, ****P<0.0001 (n=4). P values were determined by one-way ANOVA with Dunnett's post hoc test comparing IN-aP immunized mice to control mock vaccinated mice.

(8) FIGS. 7A to 7D show acellular pertussis vaccine particle localization. FIG. 7A shows representative images of flash frozen lung sections 6 h after immunization with IN-aP and IN-cap. Fluorescent particles were detected using a 660 laser. Samples were counter-stained with NucBlue (blue) and ActinGreen (green). FIG. 7B shows quantifying fluorescent DTaP particles in lung tissue by determining the percentage area of particles per field of view (n=3-4, with averages of three images per lung). Results are shown as mean±SEM, *P<0.05. FIG. 7C shows representative images of paraffin embedded nasal cavity sections 6 h after immunization with IN-aP or IN-caP. FIG. 7D shows quantifying fluorescent DTaP particles in nasal tissue by determining the percentage area of particles per field of view. (n=3-4, with averages of three images per lung). P values were determined by one-way ANOVA with Tukey's post hoc test.

(9) FIGS. 8A to 8D show production of anti-PT and anti-FHA IgG in serum induced by intranasal immunization. ELISAs were used to compare serological responses from mice immunized through IN or IP routes to mock vaccinated mice. Total IgG serum antibody titers from immunized and challenged mice were quantified at day 3 post challenge, where FIG. 8A and FIG. 8B show anti-PT and anti-FHA IgG production, respectively. Serum IgG1 and IgG2 antibody titers against B. pertussis (FIGS. 8C and 8D, respectively) were compared to mock vaccinated mice at day 3. Results are shown as mean±SEM, **P<0.01, ***P<0.001, ****P<0.0001 (n=3-8). P values were determined by one-way ANOVA with Dunnett's post hoc test compared to mock vaccinated mice.

(10) FIGS. 9A and 9B show that intranasal immunization induces production of anti-B. pertussis IgA in the respiratory system. ELISAs were performed using a lung homogenate supernatant (FIG. 9A) and a nasal lavage fluid (FIG. 9B) from vaccinated and challenged mice at day 3 post immunization. IgA titers were determined against whole-cell B. pertussis vaccine. Results are shown as averages of two independent experiments, represented on a log 10 scale for lung and linear scale of nasal lavage with mean±SEM (n=4-8). ****P<0.0001. P values were determined by one-way ANOVA with Dunnett's post hoc test compared to mock vaccinated mice.

(11) FIGS. 10A to 10D show that intranasal immunization decreases pulmonary pro-inflammatory cytokines during challenge. Analysis of cytokines from supernatant of lung homogenate at day 3 pc. Cytokines IL-6 (FIG. 10A), IFN-γ (FIG. 10B), IL-5 (FIG. 10C), and IL-17A (FIG. 10D) were quantified by electrochemiluminescence assay. Results shown as mean±SEM (n=4-8), *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001. P values were determined by one-way ANOVA with Dunnett's post hoc test compared to mock vaccinated mice. Bars connecting groups indicate values determined by two-tailed un-paired t-test. Upper and lower limits of detection shown as dash or dotted lines, respectively, if data points reached these limits.

(12) FIGS. 11A to 11C show that intranasal immunization reduced neutrophil accumulation in the lung and circulating neutrophils, but did not generate lung TRM population after B. pertussis challenge. FIG. 11A shows the percentage of live, CD11b+Gr-1hi neutrophils from a single cell suspension of the peripheral blood. FIG. 11B shows the percentages of CD11b+Gr-1hi neutrophils in single cell lung homogenates. FIG. 11C shows the percentage of CD4+ T cells that are CD62L-CD44+CD69+ isolated from the lung at day 3 pc. Results shown as means±SEM, *P<0.05 **P<0.01, ***P<0.001, ****P<0.0001 (n=4-8). P values were determined by one-way ANOVA with Dunnett's post hoc test compared to mock vaccinated mice.

(13) FIGS. 12A to 12F show that intranasal immunization reduced the respiratory B. pertussis bacterial burden. Analysis of bacterial burden was determined at days 1 and 3 pc. Bacteria were quantified by counting of serially diluted CFUs following immunization and challenge. CFU counts were determined from lung homogenate (FIGS. 12A and 12B), trachea homogenate (FIGS. 12C and 12D), and nasal lavage fluid (FIGS. 12E and 12F). Results are mean±SEM (n=4-8, with four averaged technical replicates) from two independent experiments. *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001. P values were determined by one-way ANOVA with Tukey's post hoc test compared to mock vaccinated mice, or between connected columns. The dashed line represents the lower limits of detection due to plating.

(14) FIGS. 13A and 13B show that Pertussis patients and mice immunized with FauA peptides have anti-FauA peptide antibodies. FIG. 13A shows ELISA detection of IgG anti-FauA in: convalescent patient sera (n=23). control patient sera (n=12). mice vaccinated with FauA peptides (n=4); and control mouse sera (n=4).

(15) FIG. 13B shows ELISA detection of IgG specific to various individual FauA peptides in convalescent or control patient sera. Each dot on the graph represents a different patient. Ctrl: control; ND: not detected; LDL: lower detection limit; UDL: upper detection limit.

(16) FIGS. 14A to 14C show bacterial load in vaccinated mice three days after challenge by infection with B. pertussis.

(17) FIGS. 15A to 15C show serum antibody titers in vaccinated mice three days after challenge by infection with B. pertussis. FIG. 15D shows IL-6 levels in vaccinated mice three days after challenge by infection with B. pertussis.

(18) FIG. 16 shows a protocol for testing long-term protection against pertussis by intranasal vaccination.

(19) FIG. 17 shows serum antibody titers in vaccinated mice from 1 to 5 months following vaccination.

(20) FIG. 18 shows serum antibody titers in vaccinated mice three days after challenge by infection with B. pertussis and 6 months after vaccination, where mice were vaccinated following the protocol of FIG. 16.

(21) FIG. 19A and FIG. 19B show the impact of intranasal vaccination with aP, aP-alum, aP-curdlan, and aP-β-glucan (shown as aP+IRI-1501) on the number of B. pertussis antibody-secreting cells in bone marrow.

(22) To facilitate understanding, identical reference numerals have been used to designate elements having substantially the same or similar structure or substantially the same or similar function.

DETAILED DESCRIPTION OF THE INVENTION

(23) The description and drawings presented herein illustrate various principles. It will be appreciated that those skilled in the art will be able to devise various arrangements that, although not explicitly described or shown herein, embody these principles and are included within the scope of this disclosure. As used herein, the term, “or” refers to a non-exclusive or (i.e., and/or), unless otherwise indicated (e.g., “or else” or “or in the alternative”). Additionally, the various embodiments described herein are not necessarily mutually exclusive and may be combined to produce additional embodiments that incorporate the principles described herein.

(24) Vaccine-induced protection in acellular pertussis vaccine (aP) immunized individuals has been associated with a robust antigen-specific IgG response to the components of the aP vaccines. Likewise, whole cell pertussis vaccine (wP) immunization also results in antigen-specific IgG responses; with the addition of a shift to a more diverse T cell response, inducing cell-mediated immunity. In the murine model, immunization through intramuscular (IM) and intraperitoneal (IP) administration has been well characterized demonstrating a Th1/Th17 response from wP immunized mice, and a Th2 with weak Th17 mediated response in aP immunized mice following B. pertussis challenge. However, these immunizations fail to induce the mucosal immune responses elicited from natural infection. Protection correlates with tissue resident memory T (T.sub.RM) cells in the lung and nasal cavity of convalescent mice, that produce interleukin-17 (IL-17) and interferon-gamma (IFN-γ), although T.sub.RM activity in pertussis is yet to be studied in humans. T.sub.RM cells have been shown to persist in the respiratory tissue and expand upon re-challenge of a convalescent mouse with B. pertussis, as well as decrease bacterial burden upon adoptive transfer to naïve mice. More recently the expansion of this population has been observed following immunization by wP, a live-attenuated wP vaccine, an outer membrane vesicle vaccine, and intranasal administration of an aP vaccine with TLR9 and stimulator of interferon genes (STING) agonists.

(25) The induction of a mucosal immune response to B. pertussis is associated with the production of secretory IgA antibodies (sIgA) in the nasal cavity. In humans previously infected with B. pertussis, IgA antibodies have been isolated from nasal secretions. B. pertussis-specific IgA antibodies isolated from convalescent patients have been shown to inhibit adherence of B. pertussis to respiratory epithelial cells in vitro, suggesting a protective role of IgA antibodies in mucosal immunity.

(26) Conventional aP or DTaP vaccine does not contain a strong pro-inflammatory adjuvant. This disclosure describes IN aP or DTaP immunization alone, or with an additional pro-inflammatory adjuvant. A suitable pro-inflammatory adjuvant is a high molecular weight glucose polymer, which may be a beta-glucan, e.g., curdlan. Vaccines containing the adjuvant curdlan, a 1,3-beta-glucan derived from Alcaligenes faecalis, were formulated. This polysaccharide has immunostimulatory properties and forms a “sticky” gel at a neutral pH, or at an acidic pH in the presence of CO.sub.2. The adjuvant has a relatively large particle size with dimensions sufficient to produce an inflammatory response. In certain embodiments, the high molecular weight glucose polymer may be a medium molecular weight glucan polymer with a molecular weight above 68 kDal, or between 68 kDal and 2MDal, or between 68 kDal and 680 kDal; this high molecular weight provides sufficient size for the inflammatory response from the soluble polymer. In various embodiments, the high molecular weight glucose polymer may be a whole glucan particle purified from a yeast. Such whole glucan particles typically have a particle size of 3 to 10 μm, 3.5 to 8 μm, or 4 to 6 μm, and may include residual proteins and/or lipids from yeast cells. The whole glucan particles may include 70% to 85%, 72% to 83%, or 75% to 80% 1,3-linked glucose units; 3% to 15%, or 5% to 10%, 1,6-linked glucose units; and 3% to 15%, or 5% to 10%, 1,3/1,6-linked glucose units. Whole glucan particles have sufficient size to trigger an inflammatory response from the polymer. In various embodiments, the glucose polymer may be conjugated to a protein, such as bovine serum albumin.

(27) In another embodiment, the adjuvant includes particles having a minimum dimension of 3 jam, such as aluminum oxide particles. In another embodiment the majority of the adjuvant particles were between 3 to 10 μm, 3.5 to 8 μm, or 4 to 6 μm.

(28) Curdlan and other β-glucan polymers has been shown to bind to dendritic cells through the ligand Dectin-1, thereby inducing expression of NF-xB leading to a Th1/Th17 mediated immune response as well as production of antigen-specific respiratory IgA antibodies and serum IgG antibodies. Dectin-1 is a receptor for β-glucans, which binds β-glucans and mediates the production of secretion of proinflammatory cytokines. Use of a β-glucan as an adjuvant may stimulate an immune response in a patient.

(29) As discussed in the present disclosure, the gel properties of curdlan facilitate aP or DTaP localization in the upper respiratory tract. A significant reduction in bacteria burden is found following administration of intranasally administered aP or DTaP vaccines. High serum and respiratory antibody responses were measured, following intranasal administration of aP or DtaP, with and without curdlan. Mucosal vaccination with acellular vaccine containing a beta-glucan may be a strategy for decreasing incidence of pertussis.

(30) It has now been found that immunization with B. pertussis antigens triggers a mucosal response similar to natural B. pertussis infection. Immunization may induce production of pertussis specific immunoglobulins that may: 1) mediate complement-dependent bacterial killing, 2) prevent colonization by blocking bacterial attachment, and 3) neutralize toxins at the site of infection. In some embodiments, a vaccine composition of the invention may provide a longer lasting and more effective form of the whooping cough vaccine, leading to decreased incidence of asymptomatic carriers and contraction by immune compromised and neonatal individuals.

(31) In various embodiments of the invention, the vaccine composition may include B. pertussis antigens selected from a group that includes extracellular pertussis toxin (PT), the adhesion proteins filamentous hemagglutinin (FHA) and fimbriae (FIM), pertactin (PRN), and combinations thereof. The vaccine composition may include fragments of B. pertussis antigens selected from a group that includes PT, FHA, FIM, pertactin, and combinations thereof.

(32) Additional proteins targeted for peptide vaccine development include the siderophore receptor FauA, the xenosiderophore receptor BfeA, and the hemophore receptor BhuR, and fragments thereof.

(33) Antigen proteins, including those described above, were selected for use in the vaccine composition based on the following criteria: They are present on the surface of the organism, allowing for surface recognition and opsonophagocytosis. They have conserved sequences, with the sequence of the corresponding gene having: at least 95% similarity across the clinical isolates tested, and 85% similarity, 90% similarity, 95% similarity, or 98% similarity to corresponding genes in other Bordetella species. They are highly up-regulated during infection by B. pertussis. They are important for virulence, in that mutation of the antigen proteins negatively affects bacterial growth and pathogenesis.

(34) For example, FIG. 1 shows iron and heme acquisition in B. pertussis. The model of FIG. 1 is based on B. pertussis alcaligin, enterobactin and heme acquisition systems. As seen in FIG. 1, FauA and BfeA are receptors for iron-carrying proteins, and BhuR is a receptor for a heme-carrying protein. These proteins are exposed on the outer membrane of B. pertussis, and are thus good candidates as antigens for a B. pertussis vaccine. Other proteins involved in iron or heme transport, like the transport protein TonB and the heme-transporting proteins BhuT, BhuU, and BhuV are less suitable antigen candidates, as they are not exposed on the outer membrane.

(35) Acellular pertussis vaccines include PRN, PT, and FHA antigens (aP). As PRN and FHA antigens are harvested from the whole bacteria, these antigens may contain the lipooligosaccharide (LOS) endotoxin from the bacteria. The LOS endotoxin, if present, may serve as an antigen, and induce formation of antibodies against the B. pertussis bacteria, enhancing the formation of antibodies by the aP vaccine. In various embodiments, the LOS antigen may be added to the aP vaccine as a fourth antigen to enhance formation of pertussis antibodies.

(36) The pertussis vaccine may be formulated with an adjuvant for administration. The adjuvant may be aluminum hydroxide (aP-alum), or a beta-glucan. In some cases, the beta-glucan may be a 1,3-beta-glucan (aP-beta-glucan) or curdlan (caP or aP-curdlan).

(37) As noted above fragments of B. pertussis proteins may be used as antigens. For example, extracellular regions of the proteins may be prepared and used as antigens. A bioinformatics pipeline may be used to identify the most immunogenic regions of proteins to be used as antigens for vaccination. A 3D protein structure analysis is performed. The structure analysis may use known crystal structures for a proposed antigen protein. Alternatively, the structure analysis may use a computational study to predict the protein structure. Structures of the xenosiderophore receptor BfeA and the hemophore receptor BhuR are shown in FIG. 2A and FIG. 2B, respectively.

(38) The extracellular regions of the proposed antigen proteins are identified, and their immunogenicity is predicted based on their hydrophobicity and B cell epitope predictions. Using this approach, the sequences of various potential immunogenic regions were identified. Antigenic fragments based on these sequences were prepared. The antigen fragment peptides may then be modified by adding a cysteine residue on the N-terminus, and by conjugating them to a carrier protein. The carrier protein may be, but is not limited to, Keyhole Limpet Hemocyanin (KLH), diphtheria toxoid Cross-Reactive Material 197 (CRM197), or recombinant tetanus toxoid (rTTHc). Based on this approach, multiple potential antigenic peptide fragments based on FauA, BfeA, and BhuR were identified. These peptide fragments are presented in Table 1.

(39) TABLE-US-00001 TABLE 1 Antigen Fragments based on FauA, BfeA, and BhuR. SEQ ID NO. Peptide name Peptide sequence  1 FauA peptide 1 (275-309) CHSNGFGSGFPLFYSDGSRTDFNRSVANNAPW ARQD  2 FauA peptide 2 (409-441) CYAMVGPAPAIGSFFDWRRAHIQEPSWADTLSP A  3 FauA peptide 3 (516-535) CFQPQNARDTSGGILPPIK  4 FauA peptide 4 (567-584) CQVIPGSSIPGFPNMQASR  5 FauA peptide 5 (617-633) CHFTTKDASGNPINTNHPRSLF  6 FauA peptide 6 (658-680) CWQSRMYQAAASPRGNVEVEQDSYAL  7 BfeA peptide 1 (226-257) CYNKTNPDARDINAGHANTSDNGNPSTAGRE GV  8 BfeA peptide 2 (287-313) CNLFAGDTMNNANSDFSDSLYGKFTNAM  9 BfeA peptide 3 (403-427) CAGTRQTYTGGAIGGTAPADRDPKSR 10 BfeA peptide 4 (342-368) CNARQREGLAGGPEGAPTAGGYDTARLK 11 BfeA peptide 5 (555-584) CDYRNKIVAGTDVQYRLANGARVLQWTNSGK 12 BfeA peptide 6 (487-533) CYKAPNLYQSNPNYLLYSRGNGCLASQTNTNG CYLVGNEDLSPETSVN 13 BfeA peptide 7 (650-677) CTYYGKQEGPSTNVRTGVELNGDGRQTIS 14 BfeA peptide 8 (701-729) CSNLFDKQLYREGNASSAGAATYNEPGRAY 15 BhuR peptide 1 (336-374) CEYFKRRADLDQMYQQGAGTSYQYGANRTHE ETTRKRVSL 16 BhuR peptide 2 (283-316) CAGTRNGHDLDNRADTGGYGSKRSQPSPEDY AQNN 17 BhuR peptide 3 (398-438) CRLRLDSSQDARRTRDGRAYARPGDPYFYGYPS GPYGRSNSI 18 BhuR peptide 4 (466-513) CEWYGNRTEQYSDGYDNCPAIPPGTPAPMGPR LCDMLHTNQADMPRVKG 19 BhuR peptide 5 (537-571) CLRYDHYEQKPQQGGGYQNNPNAGALPPSSS GGRFS 20 BhuR peptide 6 (591-639) CGFGYRAPSATELYTNYGGPGTYLRVGNPSLK PETSKGWELGARLGDDQL 21 BhuR peptide 7 (654-685) CIDKNVPLGKGSPQWQPAWDGQYPLGVTGLA NR 22 BhuR peptide 8 (754-799) CTRRDDVQYPEASASARYADFQAPGYG

(40) In one embodiment of the invention, the vaccine composition includes a B. pertussis antigen and an effective adjuvant amount of a high molecular weight polymer of glucose, such as β-glucan, dextran and the like. Preferred β-glucans include curdlan and baker's yeast beta-1,3/1,6-d-glucan. Curdlan is a bacterial and fungal β-1,3-glucan that binds to Dectin-1 receptors which are expressed on macrophages and dendritic cells.

(41) The term “effective adjuvant amount” will be well understood by those skilled in the art, and includes an amount of a high molecular weight glucose polymer which is capable of stimulating the immune response to nasally administered antigens, i.e. an amount that increases the immune response of a nasally administered antigen composition.

(42) In another embodiment, the vaccine composition of the invention may further be supplemented with an adenylate cyclase toxoid (ACT) which may improve efficacy of the vaccine composition by 1) generating anti-toxin antibodies against ACT, and 2) slowing vaccine-driven strain evolution. Suitable adenylate cyclase toxin antigens include purified repeats in the toxin domain (RTX antigen).

(43) The vaccine composition of the invention may also contain additional adjuvants such as aluminum hydroxide.

(44) The vaccine composition of the invention may be used as part of a prime-boost vaccine regimen. Conventional acellular pertussis vaccine (DTaP) is administered to human patients in five prime vaccinations at the following ages: 2 months, 4 months, 6 months, 15 to 18 months, 4 to 6 years. Periodic acellular pertussis vaccine boosts (TDaP) may be administered at age 11, and subsequently as needed. In a murine model, mice may be vaccinated with an aP vaccine as a prime, and then be given a boost vaccine 21 days later.

(45) In one embodiment, the vaccine composition of the invention may be formulated for intranasal administration.

(46) In other embodiments, the vaccine composition of the invention may be administered using alternative routes of administration including, without limitation, parenteral administration methods, such as subcutaneous (SC) injection, transdermal, intramuscular (IM), intradermal (ID), as well as non-parenteral, e.g., oral, intravaginal, pulmonary, ophthalmic and or rectal administration.

(47) Pertussis toxin (PT) is an essential virulence factor, responsible for multiple factors in the pathogenesis of B. pertussis. PT facilitates infection by aiding in adherence to ciliated airway epithelial cells and through disruption of host innate immune cell recruitment to the site of infection. In numerous studies it has been demonstrated that neutralization of PT alone ablates symptoms of the disease. Neutralization of pertussis toxin at the site of infection may inhibit the systemic long-range activity of PT before colonization of the respiratory tract. Intranasal immunization with pertussis antigens may prime a protective systemic and mucosal immune response. Furthermore, the gel-like properties of curdlan may have a beneficial role in increasing antigen uptake.

EXAMPLES

(48) The vaccines administered were prepared no longer than 1 h before administration. In Examples 1-3, INFANRIX (GSI) human vaccine (DTaP), and the National Institute for Biological Standards and Control WHO whole-cell pertussis vaccine (NIBSC code 94/532) were used as the aP acellular pertussis vaccine. The aP vaccine used in Examples 1-3 contains DTaP with formaldehyde killed pertussis toxoid. In Examples 4-8, genetically detoxified pertussis toxoid was used. The aP vaccine in Examples 4-8 contained PRN and PT antigens obtained from List Biologicals and FHA antigen obtained from ENZO bio. As the PRN and FHA antigens are harvested from B. pertussis bacteria, they may also contain the lipooligosaccharide (LOS) endotoxin from the bacteria.

(49) Vaccines administered with curdlan were diluted with PBS to 1/12.sup.th of the human dose (based on total antigen content). Curdlan adjuvant was administered at 200 μg per mouse. A vaccine dose of 1/12.sup.th the human dose was the highest concentration of vaccine that was possible to use due to volume of vaccine required for the solubility of curdlan.

(50) Curdlan (Invivogen, tlrl-curd) was prepared by dissolving 50 mg in 2.5 ml sterile purified water. Curdlan preparation was brought into solution by adding 100 μl 1N NaOH and vortexing. The curdlan suspension (20 mg/ml) was then sonicated for 10 mins and placed in 37° C. water bath until administration. At the time of vaccination, the vaccines containing curdlan were administered in a liquid form to reduce risk of choking due to excessive gel formation in the airway. IN administered mice recovered at the same rate as IP immunized mice. These experiments were conducted in accordance with the National Institutes of Health Guide for the care and use of laboratory animals. The protocols used were approved by West Virginia University Institutional Animal Care and Use Committees (WVU-ACUC protocol 1602000797). Curdlan, as used herein is a medium molecular weight glucan polymer, i.e., a polymer with a molecular weight of between 68 kDal and 680 kDal. The 1,3-β-glucan adjuvant, as used herein, is a whole glucan particle adjuvant having a particle size of 3 to 4 μm.

(51) As comparison models, a group of mice were mock vaccinated with phosphate buffered saline (PBS). The mock vaccinated group was divided into a control group (Control or NVNC) which was not infected with B. pertussis, and a group which was infected with B. pertussis (Mock Vac). A third group of mice included unvaccinated mice recovering from B. pertussis infection (Convalescent)

Example 1

(52) Development of a Model to Evaluate ACT as an Antigen for Inclusion in aP

(53) aP vaccine lots are validated based on using high doses such as ⅕.sup.th human dose with intranasal B. pertussis challenge. However, those doses are not physiologically relevant to a mouse. Consequently, high doses of DTaP or Tdap antigens do not afford the ability to determine if addition of new antigens to the “base” vaccine can improve protection. In order to circumvent these issues, an approach was designed that could identify antigens that synergistically improve a vaccine. In these studies, 30 variables of data per mouse are collected to determine the correlates of protection. Lung IL-6 levels are an indication of 1) inflammation due to presence of pathogen and 2) ACT activity is known to activate IL-6 secretion. The vaccine minimum protective dose was identified as 1/40.sup.th based on the viable bacteria (FIG. 4A). 1/80.sup.th was selected as the dose to test inclusion of RTX antigen because of the amounts of viable bacteria in the respiratory tract (FIG. 4A), high IL-6 (FIG. 4B), and low total anti-PT (FIG. 4C).

(54) Inclusion of RTX Antigen into the aP

(55) Mice immunized with RTX alone with aluminum hydroxide are not protected against Bp challenge. However, when the 1/80.sup.th aP vaccine was supplemented with RTX antigen (5 μg), a significant decrease in bacterial burden was observed at day 3 (FIG. 4A) compared to 1/80.sup.th IP-aP alone. RTX inclusion also decreased IL-6 (FIG. 4B) which suggests that immunization neutralizes AC toxin activity in the murine host. High amounts of serum IgG were also detected that recognizes RTX using ELISA, confirming the immunization induced RTX-specific antibody production. Surprisingly, it was observed that inclusion of RTX enhanced anti-PT production as well (FIG. 4C) demonstrating potential adjuvant effects of RTX.

Example 2

(56) Model of IN-caP Intranasal Immunization

(57) For the studies, curdlan was selected as an adjuvant in order to induce a Th1/Th17 response which would mimic the wP or convalescent immunity. By interacting with the Dectin-1 receptor, curdlan primes naïve CD4+ T cells to differentiate to Th1 and Th17 T cells. In addition to its excellent adjuvant properties, curdlan can form a gel in the presence of carbon dioxide and at acidic pH. Thus, intranasal immunization with curdlan allows the antigen to adhere to the airway to allow uptake of the antigens by antigen presenting cells.

(58) In the model presented in FIG. 3, curdlan encases the aP particles and facilitates their presentation to the mucosa as well as uptake of the antigens by antigen-presenting cells such as dendritic cells (DC).

(59) In order to observe if curdlan facilitates the localization of the vaccine to the upper airway, DTaP was fluorescently labeled with Alexa fluor 660 dye (FIG. 3). It was observed that when curdlan was added as the adjuvant, three-fold more fluorescent signal was detected in the nasal flushes of mice compared to immunization without curdlan. The data suggests that curdlan gel facilitates adherence of the vaccine in the upper airway.

(60) IN-caP Intranasal Immunization Protects Against B. pertussis Challenge in Mice

(61) Mice were immunized with curdlan alone (200 μg/dose) with no antigens added. When mice were challenged with Bp, no protection was observed (FIG. 3A; curdlan only group). A 1/12.sup.th human dose of DTaP (aP vaccine) was formulated and supplemented with curdlan (200 μg/dose). Intranasally administered curdlan-adjuvanted aP (IN-caP) immunized mice were then challenged with Bp. A decreased bacterial burden in the lung was observed 1 and 3 days post infection by over 3 logs (FIG. 5A). Limited protection was observed in the intranasally administered aP (IN-aP, aluminum hydroxide adjuvant), indicating that curdlan adjuvant facilitates induction of an adaptive response with IN immunization of aP. Compared to naïve mice, IN-caP immunized mice had reduced IL-6 (FIG. 5B) as well as low amounts of total neutrophils in the lung (FIG. 5C), which suggests that IN-caP immunization is protecting the mice from B. pertussis challenge.

(62) IN-caP Immunization Results in FHA/PT Antigen-Specific IL-17 Producing Splenocytes

(63) The IN-caP vaccine contained curdlan and aluminum hydroxide adjuvants. To determine the T-cell response, Elispot analysis was performed on splenocytes of the immunized mice. Splenocytes were stimulated with PT and FHA antigens and it was observed that mice immunized with IN-caP induced significantly more IL-17-producing splenocytes than wP immunized mice (FIG. 5D). The data suggests that IN-caP induces a Th1/Th17 response.

(64) TABLE-US-00002 TABLE 2 Analysis of antibody production in IN immunized mice. Bp FHA PT LOS Vaccine challenged IgG IgG IgG none NO − − − PBS YES − − − IP-aP (1/5th human dose) YES +++ +++ − IN-caP (1/12th human YES +++ +++ − dose) IP-wP (1/5th human dose) YES +++ − +++ YES IN-cwP (1/12th human YES + − ++ dose)

(65) To determine the antibody response triggered by IN-caP immunization, IgG production against FHA, PT, and lipooligosaccharide (LOS) antigens were measured in each vaccine group by ELISA. As seen in Table 2, both IP-aP and IN-caP induced production of FHA and PT IgGs, but did not induce production of LOS IgG. Intraperitoneally administered whole cell pertussis vaccine (IP-wP) and an intranasal whole cell pertussis vaccine containing curdlan (IN-cwP) induced production of FHA and LOS IgGs, but did not induce production of detectable anti-PT. Additionally, the immune response against FHA induced by IN-caP was stronger than the immune response against FHA induced by IN-cwP.

Example 3

(66) Vaccination of Mice for Vaccine Particle Tracking

(67) CD-1 (outbred; strain code 022) mice aged four weeks were obtained from Charles River Laboratories. At five weeks mice were anesthetized with 77 mg/kg ketamine and 7.7 mg/kg xylazine. Mice were administered 50 μl of vaccine or control, with 25 μl into each nostril (IN).

(68) Tracking of DTaP in Respiratory System

(69) DTaP vaccine particles were labeled using the Alexa Fluor 660 Protein Labeling Kit (Molecular Probes). Briefly, 0.5 ml of DTaP vaccine was added to 50 μl of 1 M sodium bicarbonate, then added to Alexa Fluor 660 dye stock. The mixture was incubated for 1 h at room temperature with agitation. The solution was concentrated by dialysis in phosphate-buffered saline overnight to remove unlabeled dye. Vaccine particles were examined using the Cy5 channel on an EVOS FL microscope. Particles were mounted on a slide and visualized using a 100× objective. Particle diameter was measured using ImageJ (version 1.52a) with the line segment tool in proportion to the scale bar. Four fields of view were measured to determine particle size and standard deviation. Labeled vaccine was used to immunize mice. At 0, 6, 12 and 24 h post vaccination, fluorescent signal was measured using an IVIS Spectrum (Xenogen), as shown in FIG. 6A. Mice were anesthetized using 3% isoflurane, mixed with oxygen prior to and throughout imaging. The following parameters were used: 1) A binning setting of 4 was kept constant for all images, 2) each image was quantified using the automatic image setting, 3) fluorescence photons were measured using total radiant efficiency of a common region of interest placed on the nasal cavity, and 4) measurements were normalized using Living Image (Xenogen ver. 2.5). Use of this quantification method accounted for variations in exposure between images.

(70) At 6, 12, 24, and 48 h post vaccination, animals were euthanized to quantify DTaP in lungs by flow cytometry analysis, as shown in FIG. 6A. Lungs were removed, and homogenized using gentleMACS C tubes (Miltenyi Biotec) with enzymatic lung dissociation kit (Miltenyi Biotec, 130-095-927). All samples were blocked using Fc Block (BD), then labelled with Alexa Fluor 700— conjugated CD11b (Biolegend, 101222), DTaP particles were detected with Cy5 channel. Following a 1 h dark incubation labeled samples were washed, then fixed using 0.4% w/v paraformaldehyde overnight. Samples were resuspended in PBS and analyzed on an LSR Fortessa flow cytometer (BD). DTaP containing myeloid cells were classified as CD11b.sup.+DTaP.sup.+ single, live cells.

(71) Detection of DTaP Particles in Lung and Nasal Cavity

(72) Detection of DTaP particles in the lung and nasal cavity were confirmed using confocal imaging. Mock vaccinated and challenged mice were euthanized at 6 h post challenge, as shown in FIG. 6A. Prior to homogenization, the post-caval lobe of the mouse lung was removed. The post-caval lobe was flash frozen in OCT medium (Tissue Plus, Fisher Healthcare), using liquid nitrogen. The samples were stored at −80° C. until sectioning. Sectioned samples (6 μm) were fixed in acetone, then stained with ActinGreen Ready Probes (Invitrogen) and NucBlue Ready Probes (Invitrogen), using manufacturer protocols.

(73) Skulls were removed from mouse, and the lower jawbone discarded. The skulls were fixed in formalin for 12 h at 4° C., then de-calcified at room temperature for 24 h, before samples were embedded in paraffin. Sectioned samples were de-paraffinized and rehydrated using xylene, and washes with decreasing ethanol concentrations (100 to 70%). An antigen retrieval step was performed using citrate buffer, where samples were heated to 98° C. for 20 mins. Samples were then stained as mentioned above. Samples were analyzed for DTaP particles in tissue and airway mucus using a Nikon confocal microscope. Images were acquired using DAPI, FITC, and Cy5 channels using a 100× oil immersion lens (100×/1.40 Nikon Plan Apo). DTaP particles were quantified using ImageJ. Briefly, the threshold tool was used to select only the fluorescent particles above background levels. Then, the threshold adjusted area was quantified using the analyze particles tool. Thus, the data is represented as the percentage of fluorescent particles per area of the total image field. Three image fields per sample were quantified and averaged per mouse.

(74) B. pertussis Strains and Growth Conditions

(75) B. pertussis strain UT25Sm1 was used for murine challenge in all experiments. UT25Sm1 was cultured on Bordet Gengou agar plus 15% defibrinated sheep's blood (Remel) with streptomycin 100 mg/ml. B. pertussis was incubated at 36° C. for 48h, then transferred to modified Stainer-Scholte liquid medium, without the cyclodextrin, heptakis. Liquid cultures were incubated for 24 h at 36° C., with shaking until reaching an OD.sub.600 of ˜0.6, at which time cultures were diluted for challenge dose.

(76) Vaccination and B. pertussis Challenge

(77) IN immunized mice received 50 μl of vaccine as described above. IP immunized mice received 2000 of vaccine injected into the peritoneal cavity. IN and IP immunized mice received the same antigen dose of 1/12.sup.th. Mice received a boost of the vaccines with the same concentrations twenty-one days after initial immunization. At thirty-five days post initial vaccination, mice were challenged with 2×10.sup.7 CFU B. pertussis administered in 20 μl through nostrils. At days 1 and 3 post challenge (pc), mice were euthanized, blood and respiratory tissue were isolated as previously described.

(78) Serological Analysis of B. pertussis Specific Antibodies

(79) Serological responses specific to B. pertussis antigens were quantified by ELISA. High-binding microtiter plates were coated with PT (50 ng/well) (LIST Biologicals) and FHA (50 ng/well)(Enzo Life Sciences), as described in Boehm et al. Serological responses against UT25Sm1 were cultured to an OD.sub.600 of 0.24 and microtiter plates coated with 50 μl of bacteria per well. Bound antibodies were detected using goat anti-mouse IgG, IgA, IgG2a, and IgG1 antibody conjugated to alkaline phosphatase (Southern Biotech). Positive antibody titers were determined using a baseline set at two times the average of blanks.

(80) Quantification of Pulmonary and Blood APCs

(81) To determine cell types infiltrating the lung and leukocytes present in peripheral blood, single cell suspensions from the tissues mentioned above were prepared. Briefly, lung tissue was homogenized by Dounce homogenizers, filtered with a 100 μm filter, and red blood cells were lysed for 2 min at 37° C. (Pharmlyse). Single cell populations were blocked by initial incubation with Fc Block (BD, 553141) for 15 min at 4° C. Cell populations were incubated in the dark with antibodies to cell surface markers for 1 h at 4° C. Neutrophil populations were identified using: PE-conjugated GR-1 (BD, 553128), Alexa Fluor 700-conjugated CD11b (Biolegend, 101222). Neutrophils were classified as CD11b.sup.+Gr-1.sup.hi single, live cells. TRM populations were determined using: APC-Cy7-conjugated CD4 (Biolegend, 100526), BB515-conjugated CD44 (BD, 564587), APC-conjugated CD62L (BD, 553152), and BV421-conjugated CD69 (BD, 562920).

(82) Lung Homogenate Cytokine Analysis

(83) To quantify inflammatory cytokines at the site of infection, lung homogenate supernatant was prepared and stored at −80° C., as described in prior work. Quantitative analysis of cytokines was performed using Meso Scale Discovery cytokine kits: V-PLEX pro-inflammatory panel (K15048D) and IL-17A V-PLEX (K152RFD), per the manufacturer's instructions.

(84) Statistical Analysis

(85) Experiments in the study were performed with 3 to 8 biological replicates. Data were analyzed using GraphPad Prism 7. ROUT method was used to removed outliers. Comparisons between groups were performed using one-way analysis of variance (ANOVA) with Dunnett's and Tukey's post hoc tests. Comparisons between groups with or without curdlan were analyzed by two-tailed unpaired t-test, when applicable multiple T-tests with Holm-Sidak post hoc test were applied to curdlan inclusion groups.

(86) Acellular Pertussis Vaccine was Retained in the Upper and Lower Respiratory Tract when Administered by Intranasal Administration.

(87) To determine if use of curdlan would increase vaccine retention in the respiratory system, CD-1 mice were intranasally (IN) vaccinated with commercially available DTaP (IN-aP), DTaP with curdlan (IN-caP), or phosphate-buffered saline (PBS; mock vaccinated) and the vaccine for up to 48 h after vaccination. The protocol is illustrated in FIG. 6A. To visualize vaccine presence in the respiratory system, DTaP vaccine particles were labeled with a fluorescent fluorophore (FIG. 6B). The size of the labeled particles was measured, and determined to be 1.52±0.76 μm, on average. Using in vivo animal imaging, we observed fluorescently labeled DTaP particles in the nasal cavity at 6, 12 and 24 h post-vaccination (FIG. 6C). At 12 h post-vaccination, significantly higher levels of fluorescence were detected in IN-caP vaccinated mice, compared to IN-aP mice (FIG. 6D). This suggests more DTaP particles were retained in the nasal cavity. This method resulted in the quantification of total particles in nasal cavity.

(88) To quantify DTaP particles that were bound to innate immune cells flow cytometry was utilized. Single-cell suspensions were prepared from homogenized lung tissue and antigen presenting cells (APCs) bound to DTaP were quantified as live, single cells positive for CD11b.sup.+DTaP.sup.+(FIG. 6E). A significant increase in CD11b.sup.+ cells that were bound to or contained DTaP particles was observed in IN-aP mice, compared to IN-caP (FIG. 6F). Together, these data suggest a higher deposition of DTaP in the lung with IN-aP when compared to IN-caP. Conversely, in the nasal cavity higher levels of DTaP was measured when mice were vaccinated with IN-caP, compared to IN-aP. These findings suggest that addition of curdlan to the DTaP vaccine causes retention in the nasal cavity, but without it, the vaccine components are more readily detected in the lung.

(89) To visualize the deposition of DTaP particles, sections from the lung and nasal cavity were imaged using confocal microscopy. Vaccinated mice were euthanized after 6 h. Lung tissue was flash frozen, and skulls were embedded in paraffin for sectioning. Sections from the lung and nasal cavity were counterstained with NucBlue and ActinGreen to visualize epithelial tissue and fluorescent DTaP particles (FIG. 7A and FIG. 7C). Vaccine particles were quantified by measuring the percentage of total image field emitting DTaP fluorescence. A significant increase of fluorescent particles in the lungs of mice that were vaccinated with IN-aP was detected, compared to mice vaccinated with IN-caP (FIG. 7B). Using microscopy, there was no significant difference in the number of particles detected in the nostrils when comparing mice vaccinated with IN-aP to mice vaccinated with IN-caP (FIG. 7D). Interestingly, DTaP particles from the IN-aP vaccinated mice were localized in the lumen of the nasal passages, while particles from IN-caP vaccinated mice were deposited into the epithelial cells (FIG. 7C). Overall, these data suggest curdlan impacts localization of DTaP in the airway.

Example 4

(90) Vaccination of Mice for with Genetically Detoxified Pertussis Toxoid

(91) This example, and all subsequent examples, were carried out with genetically detoxified pertussis toxoid vaccines. PRN and PT antigens were obtained from List Biologicals and FHA antigen was obtained from ENZO bio.

(92) The following vaccines were formulated: aP vaccine: PRN, PT, and FHA antigens. aP-alum: PRN, PT, and FHA antigens, with an aluminum hydroxide adjuvant. aP-curdlan: PRN, PT, and FHA antigens, with a curdlan adjuvant, where the curdlan adjuvant is a medium molecular weight glucose polymer. aP-β-glucan: PRN, PT, and FHA antigens, with a 1,3-β-glucan adjuvant, where the 1,3-β-glucan adjuvant is a whole glucan particle adjuvant having a particle size of 4 to 6 μm.

(93) In aP-alum, the aluminum hydroxide adjuvant is an aluminum hydroxide wet gel suspension. The aluminum hydroxide induces a Th2 response by improving the attraction and uptake of antigen by antigen-presenting cells (APCs). Aluminum hydroxide particles have a net positive electrical charge at pH 5-7, and are attracted to negatively charged antigens.

(94) CD-1 mice aged weeks were anesthetized with 77 mg/kg ketamine and 7.7 mg/kg xylazine. Mice were administered 50 μl of vaccine, with 25 μl into each nostril (IN). Four groups of mice (n=4) were vaccinated, with each group being vaccinated with one of the aP, aP-alum, aP-curdlan, and aP-β-glucan vaccines. Each vaccinated group of mice was given a boost vaccination 3 weeks later. At 10 weeks of age, the mice were challenged by exposure to B. pertussis. A fifth group of mice was mock-vaccinated with PBS, then challenged by exposure to B. pertussis. A sixth group of mice (NVNC) was mock-vaccinated with PBS, without being challenged by B. pertussis. Finally, a group of unvaccinated mice recovering from exposure to pertussis was examined (Convalescent mice).

(95) To determine if an IN-delivered pertussis vaccine would induce a systemic immune response, enzyme-linked immunosorbent assays (ELISAs) with serum from vaccinated and challenged mice against B. pertussis antigens found in the vaccine were performed. Pertussis toxin (PT) and filamentous hemagglutinin (FHA) antigens were tested. ELISAs were not performed against pertactin antigen, as 85% of current clinical isolates in the US do not express the protein. Serum anti-PT IgG titers were similar between mice immunized with IP-aP and those immunized through IN administration, as no significant differences were determined between IP-aP, IN-aP or IN-caP (FIG. 8A). A robust titer response to the bacterial adhesin FHA in IN vaccinated mice was observed. However, IN-aP serum anti-FHA titer was 7-fold higher than IN-caP (FIG. 8B). Induction of IgG1 antibodies (FIG. 8C) and IgG2a antibodies (FIG. 8D) by IN administration of DTaP (with or without curdlan) was studied to see if IN administration would lead to an increased Th1 immune response, resulting in a higher ratio of IgG2a compared to IgG1 antibodies. Neither the intranasal nor intraperitoneal route impacted the ratio of IgG2a to IgG1. Neither use of an aluminum hydroxide adjuvant (aP) nor a curdlan adjuvant (caP) impacted the ratio of IgG2a to IgG1.

(96) IgA antibodies and a local mucosal immune response in the lung and nasal cavity are important to B. pertussis immunization. The presence of IgA antibodies in the murine respiratory tissue due to IN immunization was measured. Using ELISAs, B. pertussis-specific IgA titers in homogenized lung tissue supernatant and nasal lavage fluid were measured. A robust IgA response was observed in the lung only when mice were immunized through the IN route (FIG. 9A). Similar results were not observed after intraperitoneal immunization. Antigen-specific IgA response was also not observed in mice immunized with curdlan alone. Detectable IgA B. pertussis-titer was observed in the nasal lavage fluid from both IN-aP and IN-caP vaccinated groups, although only IN-aP resulted in a significant increase compared to baseline levels (FIG. 9B). The presence of B. pertussis binding IgA in the lungs and nasal cavity suggests that IN DTaP is capable of priming a mucosal immune response in the upper and lower murine respiratory systems.

(97) Neutralization of PT and inhibition of bacterial adhesins associated with DTaP protection leads to a reduced pro-inflammatory environment at the site of infection when compared to a natural infection. Conversely, challenge in whole-cell protected animals resulted in a severe pro-inflammatory response, similar to the natural infection of B. pertussis. To determine whether the immunostimulatory properties of curdlan would induce a more pro-inflammatory response following challenge with B. pertussis compared to IP-aP, cytokine concentrations were determined from supernatant of lung homogenate at day 3 post challenge. There is a significant reduction of IL-6 in the lungs of either IN-aP or IN-caP immunized mice when compared to mock vaccinated or IN-curdlan control mice, as shown in FIG. 10A. IL-6 levels are comparable to levels observed in IP immunized groups. A similar reduction in the Th1-associated cytokine IFN-γ and the cytokine IL-17A was observed in the IN administered groups, IN-aP and IN-caP; however, these levels were higher in IN-caP immunized mice (FIGS. 10B and 10D). A significant increase in the Th2-associated cytokine interleukin-5 and IL-17A was observed in IP-wP immunized mice, compared to mock vaccinated mice (FIGS. 10C and 10D). The whole cell vaccine (wP) also did not significantly reduce IL-6 or IFN-γ.

(98) IN administration of curdlan, and moreover, vaccine administration through the IN route regardless of adjuvant has been shown to induce an increased IL-17 response. Levels of IL-17 in mice immunized with IN-caP were observed and compared to those in mice immunized with IN-aP or IP-aP. IL-17A in the lung supernatant was quantified, and significant increases of IL-17A with the addition of curdlan in IP-caP and IN-caP immunized mice were observed. When compared to IP-aP and IN-aP groups, IL-17A levels increased 4-fold and 14.9-fold, respectively (FIG. 10D). Furthermore, IN administration induced a significant increase in IL-17A compared to IP immunization. This IL-17A response was lower than the robust IL-17A induced by IP-wP (FIG. 10D).

(99) Natural infection with B. pertussis causes severe leukocytosis, which can be measured by elevated neutrophils in the peripheral blood. Following B. pertussis challenge, all vaccinated groups showed ameliorated symptoms of leukocytosis by day 3 pc; however, only the administration of DTaP either by IP or IN administration significantly reduced CD11b.sup.+Gr-1.sup.hi neutrophils in the peripheral blood (FIG. 11A). In the lungs, neutrophils were decreased in IN-aP, IN-caP, and IP-aP immunized groups compared to mock vaccinated mice (FIG. 11B).

(100) To determine if IN-aP or IN-caP could induce the expansion of a T.sub.RM population, population, CD4 T cells were isolated from the lung at day 3 pc, and were identified as T.sub.RM cells based on expression of surface markers: CD4+CD62L−CD44+CD69+. We did not observe a statistical difference of this population following challenge with either IP or IN administered vaccines. However, we did observe a slight increase in IP-wP, IP-caP, IN-aP and IN-caP compared to mock vaccinated mice (FIG. 6c). Taken together these data suggest that immunization with DTaP through the IN route reduces the pro-inflammatory environment of the murine lung during B. pertussis challenge in a manner similar to IP-aP-mediated protection.

(101) Lastly, the clearance of B. pertussis from the respiratory tract following IN immunization was examined. At days 1 and 3 pc, viable bacterial burden was quantified by counting of CFU in the lung, trachea, and nasal lavage fluid. A significant reduction in viable bacteria recovered from the lung was observed in all immunized groups by day 3 pc; however, these changes were not observed at day 1 pc (FIGS. 7A and 7B). In IN-aP and IN-caP immunized mice, bacterial burdens were reduced by 99.4% and 99.7%, respectively, compared to mock vaccinated mice. This reduction in viable bacterial burden was superior to that of mice immunized by IP-aP, an immunization that is known to be effective (FIG. 7B). This reduction in bacterial burden was not observed following immunization with the negative control (IN-curdlan), suggesting an antigen-specific response. Similar trends were observed in the trachea homogenate (FIGS. 7C and 7D), and in nasal lavage fluid (FIGS. 7E and 7F), as all immunized groups regardless of IP or IN delivery were significantly reduced compared to mock vaccinated mice. In summary, we observed similar clearance of B. pertussis from the respiratory tract of mice immunized intranasally, compared to mice immunized with vaccines known to be protective by the IP route.

Example 5

(102) Pertussis patients and mice immunized with FauA peptides have anti-FauA antibodies. Mice were vaccinated with a set of six FauA-derived peptides (n=4), specifically SEQ ID NOS. 1 to 6 of Table 1; the peptides were conjugated to CRM197, a non-toxic mutant of diphtheria toxin. A set of unvaccinated control mice (n=4) was also tested. FIG. 13A shows ELISA detection of IgG antibodies in mice vaccinated with FauA peptides (n=4), where the antibodies bind to peptides having one of SEQ ID NOS. 1 to 6. These antibodies are not found in unvaccinated control mice. FIG. 13A also shows that convalescent pertussis patients (n=23) have sera which contain FauA antibodies which recognize FauA-derived peptides having SEQ ID NOS. 1 to 6. Again, these antibodies are not found in sera from control patients (n=12).

(103) FIG. 13B shows ELISA detection of IgG which bind the individual FauA peptides of SEQ ID NOS. 1 to 6 in convalescent or control patient sera. The control patients did not have antibodies which recognized the FauA peptides. Antibodies which recognized each FauA peptide of Table 1 (SEQ ID NOS. 1 to 6) were detected in the convalescent patients.

Example 6

(104) Vaccination of Mice for Vaccine Particle Tracking

(105) CD-1 (outbred; strain code 022) mice aged four weeks were anesthetized with 77 mg/kg ketamine and 7.7 mg/kg xylazine. Mice were administered 50 μl of PBS control or an aP vaccine with PT, FHA, and PRN antigens, with 25 μl into each nostril (IN). After 21 days, a similar boost vaccine was administered into each nostril. Mice were divided into the following groups (n=4 for each group): NVNC: PBS Control; Mock-Vac: PBS Control; aP: aP vaccine;

(106) aP-alum: aP vaccine with an aluminum hydroxide adjuvant;

(107) aP-curdlan: aP vaccine with a curdlan adjuvant;

(108) aP-β-glucan: aP vaccine with a 1,3-beta-glucan adjuvant; and Convalescent: Unvaccinated mice recovering after a B. pertussis infection.
With the exception of the convalescent mice and NVNC mice, each group of mice was challenged by infection with B. pertussis 35 days after administration of the initial intranasal vaccination.

(109) Three days post challenge, the respiratory track bacterial burden was measured for each group of mice except the unchallenged NVNC mice. Burden was measured by nasal lavage, and in the lungs and trachea, using techniques described above. Results are shown in FIGS. 14A to 14C. Use of a curdlan or 1,3-beta-glucan adjuvant produced similar results to use of an alum adjuvant.

(110) Three days post challenge, total IgG serum titers to B. pertussis and IgG serum titers to the PT and FHA vaccine antigens were measured, and found to be significantly elevated after challenge in mice vaccinated intranasally with aP, aP-alum, aP-curdlan, and aP-β-glucan vaccines. Results are shown in FIGS. 15A, 15B, and 15C. Mice in the NVNC and Mock-Vac groups showed no antibodies to B. pertussis (FIG. 15A) or to the PT or FHA vaccine antigens (FIGS. 15B and 15C). Convalescent mice showed antibodies to B. pertussis, but to a lesser extent than any of the vaccinated groups (FIG. 15A). Convalescent mice showed no antibodies to the PT vaccine antigen (FIG. 15B), although they did show FHA antibodies.

(111) Three days post challenge, production of the cytokine IL-6 in mice vaccinated intranasally with aP, aP-alum, aP-curdlan, and aP-β-glucan vaccines was comparable to IL-6 production in the unchallenged NVNC mice, as shown in FIG. 15C. Production of the cytokine IL-6 in Mock-Vac and convalescent mice was substantially higher than in any of the vaccinated groups of mice.

Example 7: Long-Term Pertussis Protection

(112) A protocol for testing long-term protection against pertussis by intranasal vaccination is shown in FIG. 16. CD-1 (outbred; strain code 022) mice aged four weeks were anesthetized with 77 mg/kg ketamine and 7.7 mg/kg xylazine. Mice were administered 50 μl of PBS control or an aP vaccine with PT, FHA, and PRN antigens, with 25 μl into each nostril (IN). After 21 days, a similar boost vaccine was administered into each nostril. Levels of B. pertussis antibodies were measured 30 days after the initial prime vaccination, and at 30-day intervals thereafter (FIG. 17). Mice were divided into the following groups (n=4 for each group): NVNC: PBS Control; Mock-Vac: PBS Control; aP: aP vaccine; aP-alum: aP vaccine with an aluminum hydroxide adjuvant; aP-curdlan: aP vaccine with a curdlan adjuvant; aP-β-glucan: aP vaccine with a 1,3-beta-glucan adjuvant; and Convalescent: Unvaccinated mice recovering after a B. pertussis infection.

(113) As shown in FIG. 17, the prime-boost vaccination protocol significantly increased levels of antibodies against B. pertussis in intranasally vaccinated mice for at least five months post-vaccination, when compared to NVNC mice or Mock-Vac mice (NVNC and Mock-Vac lines overlap). The prime-boost vaccination protocol significantly increased levels of antibodies against B. pertussis in intranasally vaccinated mice to levels comparable to those in convalescent mice.

(114) Six months after the initial prime vaccination, mice in each group except convalescent mice and NVNC mice were challenged by B. pertussis infection. Three days post challenge, mice were euthanized, and the effect of the vaccine was tested, e.g., by flow cytometry or serology. As shown in FIG. 18, six months after vaccination, intranasal vaccination produced significant B. pertussis and PT antigen specific IgG titers in serum. These antibodies were not seen in NVNC mice or Mock-Vac mice. Convalescent mice did not show PT antigen specific antibodies, but did show B. pertussis antibodies.

(115) As seen in FIG. 18, exposure to an aP vaccine alone, or to an aP vaccine in combination with aluminum hydroxide or curdlan, increases antibodies to the PT antigen significantly (P<0.05, compared to mock-vaccinated mice). Exposure to an aP vaccine in combination with 1,3-beta-glucan has a greater impact on levels of antibodies to the PT antigen (P<0.01, compared to mock-vaccinated mice). Further, the increase in total B. pertussis antibody titers in convalescent mice is significant, when compared to mock-vaccinated mice (P<0.01). As seen in FIG. 18, the increase in total B. pertussis antibody titers in mice treated with aP, aP-alum, or aP-curdlan vaccines is significant; however, it is less significant that the increase in B. pertussis antibody titers in convalescent mice (P<0.05 for the aP vaccine; P<0.01 for the convalescent mice). The increase in total B. pertussis antibody titers in mice vaccinated with an aP vaccine in combination with 1,3-beta-glucan is highly significant, when compared to mock-vaccinated mice (P<0.001). Based on these results, it appears that administration of an aP vaccine in combination with 1,3-beta-glucan increases antibody production more than administration of an aP vaccine alone or with aluminum hydroxide or curdlan.

Example 8: Antibody-Expressing Cells in the Bone Marrow of Vaccinated Mice

(116) Antibody secreting cells (ASCs) are differentiated cells of the humoral immune response. ASCs differentiate from activated B cells in lymph nodes. Most of the circulating ASCs undergo apoptosis, but some ASCs migrate to the bone marrow (BM) and eventually mature into long-lived plasma cells (LLPCs). Accordingly, the bone marrow of mice vaccinated as in Example 6 was examined following euthanasia for the presence of ASCs which secrete B. pertussis antibodies.

(117) An enzyme-linked immune absorbent spot (ELISpot) analysis was used for detecting antibody-secreting cells in bone marrow tissue, in response to B. pertussis infection. Data were recorded 3 days (FIG. 19A) and 7 days (FIG. 19B) post-challenge, as number of IgG spots per 3×10.sup.5 cells. Intranasal vaccination with aP, aP-alum, and aP-β-glucan (shown as aP+IRI-1501) significantly increased the number of B. pertussis antibody-secreting cells in bone marrow. Moreover, intranasal vaccination with aP-alum and aP-β-glucan significantly increased the number of B. pertussis antibody-secreting cells in bone marrow by three days post-challenge, when compared to vaccination with the aP vaccine alone (FIG. 19A). By seven days post-challenge,

(118) Although the various embodiments have been described in detail with particular reference to certain aspects thereof, it should be understood that the invention is capable of other embodiments and its details are capable of modifications in various obvious respects. As is readily apparent to those skilled in the art, variations and modifications can be affected while remaining within the spirit and scope of the invention. Accordingly, the foregoing disclosure, description, and figures are for illustrative purposes only and do not in any way limit the invention, which is defined only by the claims.