Filovirus therapy

10519219 ยท 2019-12-31

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides antibodies, for use in the treatment, suppression prevention of Filovirus disease, particularly Ebola virus disease. Also provided immunogens for use in eliciting such antibodies.

Claims

1. A composition comprising ovine polyclonal antibodies in a form suitable for administration in treating, suppressing or preventing Ebola virus disease in a patient, wherein said antibodies bind to Ebola virus glycoprotein, wherein said ovine polyclonal antibodies are raised against a recombinant Ebola virus glycoprotein, and wherein said recombinant Ebola virus glycoprotein lacks the endogenous transmembrane domain.

2. The composition according to claim 1, wherein said composition comprises one or more additional therapeutics.

3. The composition according to claim 1, wherein said one or more additional therapeutics targets a different component of said Ebola virus from said antibody.

4. The composition according to claim 1, wherein said recombinant Ebola virus glycoprotein lacks the endogenous transmembrane domain and the endogenous membrane-proximal external region.

5. The composition according to claim 1, wherein the recombinant Ebola virus glycoprotein also lacks the endogenous signal peptide.

6. The composition according to claim 1, wherein the recombinant Ebola virus glycoprotein comprises or consists of an amino acid sequence having 70% or more identity to SEQ ID NO: 2 and comprises an epitope of SEQ ID NO: 2.

7. The composition according to claim 1, wherein the recombinant Ebola virus glycoprotein comprises a fragment of at least 7 consecutive amino acids of SEQ ID NO: 2, and comprises an epitope of SEQ ID NO: 2.

8. The composition according to claim 1, wherein the ovine polyclonal antibodies are produced by a method comprising: (i) administering to a sheep a recombinant Ebola virus glycoprotein, wherein said recombinant Ebola virus glycoprotein lacks the endogenous transmembrane domain, (ii) allowing sufficient time for the generation of antibodies in the sheep, and (iii) obtaining the antibodies from the sheep.

9. A method of treating, suppressing or preventing Ebola virus disease in a patient, said method comprising administering to a patient an antibody composition comprising ovine polyclonal antibodies, wherein said polyclonal antibodies bind to Ebola virus glycoprotein, and wherein said polyclonal antibodies do not substantially bind to the endogenous transmembrane domain of Ebola virus glycoprotein, and wherein said ovine polyclonal antibodies are raised against recombinant Ebola virus glycoprotein, wherein said recombinant Ebola virus glycoprotein lacks the endogenous transmembrane domain.

10. The method according to claim 9, wherein said treating, suppressing or preventing comprises intravenous administration of said composition to said patient, oral administration of said composition to said patient, intraperitoneal administration of said composition to said patient, or intramuscular administration of said composition to said patient.

11. The method according to claim 9, wherein said patient is a mammal.

12. The method according to claim 9, wherein said mammal is a human.

13. The method according to claim 9, wherein said treating or suppressing comprises administering the composition to the patient within 5 days of infection with Ebola virus, within 2 days of infection with Ebola virus, within 1 day of infection with Ebola virus, within 12 hours of infection with Ebola virus, or more than 5 days after infection with Ebola virus.

14. The method according to claim 9, wherein said preventing comprises administering the composition to the patient prior to infection with Ebola virus.

15. The method according to claim 9, wherein said treating, suppressing or preventing comprises administration of one or more additional therapeutics.

16. The method according to claim 9, wherein said one or more additional therapeutics targets a different component of said Ebola virus from said antibody.

17. The method according to claim 9, wherein said ovine polyclonal antibodies are raised against recombinant Ebola virus glycoprotein, wherein said recombinant Ebola virus glycoprotein lacks the endogenous transmembrane domain and the endogenous membrane-proximal external region.

18. The method according to claim 17, wherein the recombinant Ebola virus glycoprotein comprises or consists of an amino acid sequence having 70% or more identity to SEQ ID NO: 2 and comprises an epitope of SEQ ID NO: 2, or comprises a fragment of at least 7 consecutive amino acids of SEQ ID NO: 2, and comprises an epitope of SEQ ID NO: 2.

19. The method according to claim 17, wherein the ovine polyclonal antibodies are produced by a method comprising: (i) administering to a sheep the recombinant Ebola virus glycoprotein, wherein said recombinant Ebola virus glycoprotein lacks the endogenous transmembrane domain, (ii) allowing sufficient time for the generation of antibodies in the sheep, and (iii) obtaining the antibodies from the sheep.

Description

(1) There now follows a brief description of the Figures, which illustrate aspects and/or embodiments of the present invention.

(2) FIG. 1: Domain schematic of EBOV glycoprotein: SP, signal peptide; RBD, receptor-binding domain; mucin domain, mucin-like domain; and TM, transmembrane domain. The residue range used for the expressed sGP ectodomain construct rGP is indicated by the circled START at position 1 and the circled STOP at position 632.

(3) FIG. 2: ELISA showing 50% binding titres of pooled whole ovine anti-ebola virus glycoprotein serum, sampled at time points 6, 10 and 14 weeks post primary-immunisation

(4) FIG. 3: ELISA showing 50% binding titres of ovine IgG anti-ebola virus glycoprotein, pooled from whole serum, sampled at 7 & 14 weeks post primary-immunisation.

(5) FIG. 4: Schematic representation of passaging protocol.

(6) FIG. 5: Clinical data in the form of weight gain/loss and departure difference from EBOV-infected guinea pigs using virus that had been passaged from spleens harvested 7 days post infection. Weight changes compared to day of challenge, compared to control uninfected animals. Data points represent mean values from 10 animals up to day 7, and six animals up to day 14, with error bars denoting standard error.

(7) FIG. 6: Clinical data in the form of temperature difference from EBOV-infected guinea pigs using virus that had been passaged from spleens harvested 7 days post infection. Temperature changes compared to day of challenge, compared to control uninfected animals. Data points represent mean values from 10 animals up to day 7, and six animals up to day 14, with error bars denoting standard error.

(8) FIG. 7: Clinical data in the form of in vivo bodyweight results following challenge with EBOV. Guinea pigs were treated with (a) control, (b) compound E, (c) compound A and (d) EBOVIpAB with treatment starting 6 hours post-challenge. Curves represent bodyweight of individual Guinea pigs over time.

(9) FIG. 8: Clinical data in the form of in vivo temperature results following challenge with EBOV. Guinea pigs were treated with (a) control, (b) compound E, (c) compound A and (d) EBOVIpAB with treatment starting 6 hours post-challenge. Curves represent bodyweight of individual Guinea pigs over time.

(10) FIG. 9: Clinical data in the form of longer-term in vivo results (Guinea pigs) relating to (a) body weight; and (b) temperature, both compared to day of challenge. Guinea pigs were treated with (a) control, (b) compound E, (c) compound A and (d) EBOVIpAB with treatment starting 6 hours post-challenge.

(11) FIG. 10: In vivo survival results. Plot of % survival versus days post-challenge. Groups 1-4 (Guinea pigs) were treated with compound A, E, EBOVIpAB and controls, respectively, with treatment starting 6 hours post-challenge.

(12) FIG. 11: In vivo clinical scores (group means with standard error). Groups 1-4 (Guinea pigs) were treated with compound A, E, EBOIpiAB and controls, respectively, with treatment starting 6 hours post-challenge.

(13) FIG. 12: Clinical data in the form of survival and clinical observations of Guinea pigs which received EBOVIpAB treatment commencing 3, 4 or 5 days after challenge with EBOV. (A) Survival analysis between EBOVIpAB treated groups compared to untreated animals. (B) Weight changes, showing percentage differences from values on the day of challenge. (C) Temperature differences in animals compared to values on the day of challenge. (D) Clinical scores of animals after challenge. In panels B-D, mean results are shown for animals still surviving in all groups, with error bars denoting standard error.

(14) FIG. 13: EBOV viral genome copies in the blood of EBOV-challenged guinea pigs prior to administration of EBOVIpAB. Bars show mean results with error bars denoting standard error.

(15) FIG. 14: Clinical data in the form of in vivo survival results in a non-human primate model. EBOV was administered at D0. Group 1 non-human primates received daily injections of EBOVIpAB on D1-D5, D7, D9 and D11; Group 2 non-human primates received daily injections of EBOVIpAB on D2-D6, D8, D10 and D12; Group 3 non-human primates received daily injections of EBOVIpAB on D3-D7, D9, D11 and D13. Group 4 non-human primates acted as an untreated control. Plot of % survival versus days post-challenge.

(16) FIG. 15: Clinical data in the form of in vivo bodyweight results following challenge with EBOV in a non-human primate model. Group 1 non-human primates received daily injections of EBOVIpAB on D1-D5, D7, D9 and D11; Group 2 non-human primates received daily injections of EBOVIpAB on D2-D6, D8, D10 and D12; Group 3 non-human primates received daily injections of EBOVIpAB on D3-D7, D9, D11 and D13. Group 4 non-human primates acted as a positive control. Curves represent mean bodyweight of individual non-human primates in each group over time.

EXAMPLES

Example 1 Preparation of the EBOV Glycoprotein Antigen Lacking the Transmembrane Domain

(17) Studies were conducted with EBOV (a prototypical Filovirus) glycoprotein. The EBOV glycoprotein used to raise antibodies corresponds to the ectodomain with the transmembrane region and the membrane-proximal external region excludedthis recombinant EBOV glycoprotein corresponds to SEQ ID NO: 2, and is referred to hereinafter as rGP. SEQ ID NO: 2 corresponds to the full length glycoprotein (SEQ ID NO: 1), with the transmembrane domain and the membrane-proximal external region omitted. Since the EBOV glycoprotein used to raise antibodies was expressed in a eukaryotic cell (detailed below), the specific the EBOV glycoprotein used to raise antibodies corresponds to 133 to D632 of SEQ ID NO: 2, because the signal peptide was cleaved by signal peptidases in the eukaryotic cell.

(18) A schematic representation of rGP, showing the corresponding start and stop codons compared to SEQ ID NO: 1 is provided in FIG. 1.

(19) SEQ ID NO: 5 corresponds to the nucleic acid sequence used to express rGP. SEQ ID NO: 5 was modified relative to SEQ ID NO: 4 by removal of the endonuclease site (mutation of the sequence accggt to accggc). To avoid unwanted cleavage (i.e. premature termination), the inventors inserted an 8th A residue into the sequence, as can be seen in SEQ ID NO: 5. As background, the native EBOV genome contains 7 consecutive A residues at this positionin 20% of cases an additional 8th A is inserted by RNA editing, leading to the production of the full-length, membrane-inserted version of the protein. SEQ ID NOs: 3 and 4 also recite 8 consecutive A residues.

(20) To provide rGP, EBOV (prototypical Mayinga strain) DNA corresponding to the glycoprotein (SEQ ID NO: 2) was whole-gene synthesized (GeneArt), and cloned into the pHLsec vector (described by Aricescu et al. Acta Crystallogr D Biol Crystallogr. 2006 October; 62(Pt 10):1243-50). rGP was expressed with a C-terminal hexa-histidine tag. The rGP is composed of >50% oligosaccharides by weight, due the presence of N-linked glycosylation and a heavily glycosylated mucin-like domain.

(21) Large-scale expression of rGP was performed with human embryonic kidney (HEK) 293T cells using polyethyleneimine (PEI) as the transfection reagent. HEK cells were grown to 90% confluence in Dulbecco's Modified Eagles Medium (DMEM, Sigma Aldrich, Manchester, UK) containing 10% fetal calf serum (FCS) supplemented with L-glutamine and non-essential amino acids (Invitrogen, Paisley, UK). For all transfections, a DNA to PEI mass ratio of 1:2 was used. Cells were transiently transfected in expanded surface roller bottles (Greiner Bio One, Stonehouse, UK) with 2 mg purified rGP cDNA per 1 L of 90% confluent cells. Upon transfection, the concentration of FCS was reduced to 2%. Cells were transfected in roller bottles and were incubated at 37 C.

(22) Cell supernatant was harvested 4-5 days following transfection. Cell debris were spun down, the media sterile filtered through a 0.22 M membrane filter and diafiltrated against a buffer containing 10 mM Tris pH 8.0, 150 mM NaCl. rGP was purified from diafiltrated supernatant by immobilised metal affinity chromatography (IMAC) using Chelating Sepharose Fast Flow Ni.sup.2+-agarose columns (GE Healthcare, Buckinghamshire, UK). Following IMAC purification, rGP was desalted using a HiPrep 26/10 Desalting Column (GE Healthcare, Bukinghamshire, UK) against a buffer containing 10 mM Tris pH 8.0, 150 mM NaCl, concentrated, and sterile filtered for immunization. Protein purity was assessed by SDS-PAGE and Western blot analysis. High level of expression of rGP (1.5-2.5 mg/L cell culture) was obtained. Advantageously, this mammalian-expressed glycoprotein product contained authentic glycoprotein neutralising epitopes, and in sufficient quantities to induce a strong antibody response.

Example 2 Preparation of Antiserum (EBOVIpAb)

(23) 2 ml of buffer solution containing between 10 and 500 g of rGP antigen is mixed with 2.6 ml of Freund's adjuvant. The complete form of the adjuvant is used for the primary immunisation and incomplete Freund's adjuvant for all subsequent boosts. Mixing of the adjuvant is carried out for several minutes using a mechanical device to ensure a stable emulsion. About 4.2 ml of the rGP/adjuvant mixture is used to immunise each sheep by intramuscular injection and spread across 6 sites including the neck and all the upper limbs. This is repeated every 28 days. Blood samples are taken 14 days after each immunisation. Once adequate antibody levels are achieved, larger volumes are taken (10 ml/kg body weight) into sterile bags. The bags are rotated slowly to accelerate clotting, centrifuged for 30 min at 4500g and the serum removed under aseptic conditions and pooled. Any animal showing low titres to the desired rGP antigen is removed from the flock. This protocol provides specific antibody levels in excess of 4 g/litre of serum.

Example 3 Quantifying the Amount of Specific Antibody to rGP in Serum using Immunoaffinity Columns

(24) Column Preparation

(25) CNBr-activated Sepharose 4 Fast Flow (0.5 g dry weight) is weighed into a suitable clean container (glass or plastic). About 10 ml of diluted hydrochloric acid (1 mM) is added to swell the gel and, after 20-30 min, the gel is transferred to a 10-mL glass column and washed with a further 20 mL of HCl (1 mM), followed by 20 mL of coupling buffer (sodium bicarbonate, 100 mM, pH 8.3, containing 500 mM sodium chloride). rGP solution (1 mL) at a concentration of 1 mg/mL is diluted to 5 mL with coupling buffer and added to the column containing the activated gel and the contents mixed gently until the gel is re-suspended and rotated at room temperature overnight (16-18 hr). The column is then drained and 5 ml of blocking reagent (ethanolamine solution, 1M) added, mixed gently and rotated for 2 hr at room temperature. Next, the column is washed with 20 mL coupling buffer followed by 20 mL of elution buffer (glycine solution 100 mM, pH 2.5). This step is repeated twice. The column is finally washed with 20 mL of assay buffer (sodium phosphate buffer, 10 mM, pH 7.4 containing 500 mM sodium chloride and sodium azide at a final concentration of 1 g/L) and stored in 3-5 mL of assay buffer at 2-8 C. until used.

(26) Column Assessment

(27) The specific binding and non-specific capacity of the column is typically assessed prior to use. The column is removed from the refrigerator and allowed to equilibrate to room temperature and then washed with 25 mL of assay buffer. Increasing volumes of the product (whole antisera, purified IgG, Fab or F(ab).sub.2) are individually loaded onto the column and mixed end-over-end gently for 1 hr at room temperate. The unbound fraction is washed off with 25 mL of assay buffer and the bound fraction then eluted from the column with 20 ml of elution buffer (glycine buffer 100 mM, pH 2.5). The protein content of the eluted fraction is determined spectrophotometrically at 280 nm using an extinction coefficient relevant to the product namely 1.5 for sheep IgG (Curd et al., 1971) or 1.4 for sheep Fab and F(ab).sub.2 (Allen, 1996). A saturation curve is obtained by plotting the amount of eluted protein against the volume loaded.

(28) Affinity Column for Product Assessment

(29) The column is used for GMP/GLP assessment of in-process and final product viz whole antisera, purified IgG, Fab and F(ab).sub.2. It is also used to assess and monitor the immune response of the immunised animals.

(30) The column is removed from the refrigerator and allowed to equilibrate to room temperature when it is washed with 25 mL of assay buffer. Product (1 mL) is added to the column and mixed end-over-end gently for 1 hr at room temperature following which the unbound fraction is washed off with 25 mL of assay buffer (sodium phosphate buffer, 10 mM, pH 7.4 containing 500 mM sodium chloride and sodium azide at a final concentration of 1 g/L). The bound fraction is then eluted with 20 ml of elution buffer (glycine buffer 100 mM, pH 2.5) and its protein content determined spectrophotometrically at 280 nm using an extinction coefficient relevant to the product. FIG. 2 shows the binding analysis of pooled whole serum from sheep immunised with rGP. FIG. 3 shows the binding analysis of IgG purified from pooled whole serum from sheep immunised with rGP.

Example 4 In Vitro Screening of Candidate Compounds

(31) To achieve rapid down-selection of experimental therapies for EBOD, the inventors performed an in vitro screen of 20 candidate compounds, which were identified according to their Technology Readiness Score, their availability to make a difference to the current epidemic, and their likely efficacy against EBOV. EBOVIpAb was included in the screen. The effects of these 20 compounds on cells (toxicity) and viral amplification was assessed using MRC-5 and VeroE6 cells.

Example 5 In Vitro Assessment of Compounds

(32) Cells were assessed according to Ct differential, as a measure of change in viral load, and also cell appearance. A Ct differential of >2.9 corresponds to a 10-fold reduction. The results of the in vitro screen are provided in Table 2.

(33) TABLE-US-00002 TABLE 2 Ct and Cell appearance results. MRC-5 VeroE6 Ct Cell Ct Cell Compound difference appearance difference appearance 1 Compound A custom character custom character 2 EBOVIpAb 2.3 (CPE) custom character 3 Compound C custom character custom character 4 Compound D custom character 0.4 5 Compound E custom character 1.8 6 Compound F 2.1 custom character 7 Compound G 0.8 2.6 8 Compound H 0.5 2.0 9 Compound I 2.5 custom character 10 Compound J custom character custom character 11 Compound K custom character ? custom character ? 12 Compound L custom character ? custom character ? 15 Compound O custom character 2.5 16 Compound P 3.7 custom character 17 Compound Q 1.5 custom character 18 Compound R custom character custom character 19 Compound S 1.8 custom character 20 Compound T custom character custom character 21 Compound U 1.8 0.5 22 Compound V custom character 0.3 Ct values of >2.9 (10-fold reduction)in italics and bold font. CPE means cytopathic effect observed. Preferred compounds are indicated by asterisks.

(34) The lower dilutions of the compounds which showed activity were analysed to determine whether a dose response was evident (see Table 3).

(35) TABLE-US-00003 TABLE 3 Analysis of lower dilutions of the compounds to determine whether a dose response was evident. Number Name Activity (S.sub.Ct) 1 Compound A 4.7 uM-2 Ct 2 EBOVIpAb 1:32 = 1 Ct* 3 Compound C No data 4 Compound D >0.5 m 5 Compound E 3 M = 1.8- 3.7 Ct 7 Compound F >10 M 8 Compound H >7.5 M 9 Compound I >2 M 11 Compound K 20 g/ml = 5 Ct 12 Compound L >10 mg/ml 22 Compound V >2 M Ct values of >2.9 (10-fold reduction) in italics and bold font.

(36) To help identify a shortlist of candidate compounds, the inventors assessed the Ct scores and cell appearance at different compound dilutions (Table 4).

(37) TABLE-US-00004 TABLE 4 Detailed assessment of Ct scores cell appearance. Ct values of >2.9 (10-fold reduction) in italics and bold font. MRC-5 VeroE6 Ct Cell Ct Cell No. Compound Dilution difference appearance difference appearance 1 *Compound A* 1x custom character custom character 0.1x 2.1 custom character 0.02x 1.0 1.6 2 *EBOVIpAb* 1:8 2.3 (CPE) custom character 1:16 2.4 (CPE) 0.8 1:32 2.2 (CPE) 1.1 3 Compound C 1x custom character custom character 0.1x custom character 0.8 0.02x custom character 1.2 4 Compound D 1x custom character 0.4 0.1x custom character 0.7 0.02x custom character 1.4 5 *Compound E* 1x custom character 1.8 0.1x 0.9 2.2 0.02x 0.2 2.7 7 Compound G 1x 0.8 2.6 0.1x 1.9 1.0 0.02x 2.1 0.7 8 Compound H 1x 0.5 2.0 0.1x custom character custom character 0.02x custom character custom character 9 Compound I 1x 2.5 custom character 0.1x 0.9 1.6 0.02x 1.6 1.5 11 Compound K 1x custom character ? custom character ? 0.1x custom character ? custom character ? 0.02x custom character ? 1.7 ? 12 Compound L 1x custom character ? custom character ? 0.1x custom character ? custom character ? 0.02x custom character ? custom character ? 22 Compound V 1x custom character 0.3 0.1x 1.1 2.4 0.02x 2.2 custom character CPE means cytopathic effect observed. Preferred compounds are indicated by asterisks.

(38) The in vitro screening provided a refined list of Compound A, EBOVIpAb and Compound E for in vivo studies.

Example 6 In Vivo Forced Evolution of EBOV

(39) A forced evolution model was used to increase EBOV pathogenicity in guinea pigs [Dowall et al. (2014) Genome Biology 15:540]]. EBOV was sequentially passaged in vivo using a guinea pig model of infection. EBOV is initially non-pathogenic in guinea pigs, but becomes more virulent and adapted to replicating in this host.

(40) In more detail, Guinea pigs were infected with EBOV (ME718 strain) and the virus was serially passaged to develop uniform lethality in guinea pigs (FIG. 4).

(41) There were 10 guinea pigs per passage. Four animals were used for the preparation of spleen homogenate for subsequent virus infection (culled 7 days post challenge) and six were taken forward for measuring survival rates and clinical parameters (for up to 14 days post challenge). Adaptation of EBOV to growth in the guinea pigs was achieved with serial passage involving a subcutaneous injection of 10.sup.4 TCID.sub.50 EBOV, with spleens harvested 7 days post infection (as a source of progeny virus). Virus titre was determined and a new inoculum prepared before administering 10.sup.4 TCID.sub.50 EBOV to a new group of guinea pigs. This was repeated until there was clinical and virological evidence that the virus adapted to the guinea pig host. Animals were observed for 2 weeks post infection. Weight data indicated that guinea pigs showed a minimal response to the initial challenge, whereas with subsequent passages weight loss exceeding 10% was observed (FIG. 5).

(42) Similarly, with temperatures the same responses were observed, where only after initial passage in the guinea pigs were temperature increases of between 1 C. and 2.5 C. observed (FIG. 6).

(43) At passage two several animals that met humane clinical endpoints displayed symptoms of hypothermia prior to being euthanised. Hypothermia has been previously observed in Rhesus macaques experimentally infected with EBOV via the aerosol route. Six animals from each passage study that were scheduled to last 14 days post infection were used to assess mortality. By five passages, 75% mortality was observed with a challenge dose of 10.sup.4 TCID.sub.50. There was also no increase in viral titre in the spleen collected from animals culled at day 7 (Table 5) compared with the previous passage, indicating that the viral burden had peaked. The minimum lethal dose of the passaged virus was determined to be 10.sup.3 TCID.sub.50 (data not shown).

(44) TABLE-US-00005 TABLE 5 Virus titre from spleen preparations following passaging Virus titre from spleen preparation (TCID.sub.50) Passage 1 2.1 10.sup.4/spleen Passage 2 3.0 10.sup.7/spleen Passage 3 5.8 10.sup.7/spleen Passage 4 6.1 10.sup.7/spleen Passage 5 6.1 10.sup.7/spleen

(45) The titre of EBOV in the spleens isolated from four guinea pigs taken from each passage increased, and then reached a plateau indicating that the virus had become adapted to grow in the guinea pig model

(46) This method of adapting EBOV has been used by others and mortality was first shown to occur during passages three to four. Complete lethality was then detected soon after, but ranged from passage four to seven. While 50% lethality was seen in the second passage in the current study, this was most likely due to the low titres in the passage one material requiring a higher concentration of spleen homogenate to be delivered to the guinea pigs in order to achieve challenge with 10.sup.4 TCID.sub.50. This amount of material would have had adverse impacts due to lipid peroxidation, and protein oxidation and pro-apoptotic factors through cellular damage during preparation of the homogenate.

Example 7 In Vivo Evaluation of Lead Compounds

(47) Guinea pigs (approx. 300 g) were supplied with vascular catheter. Animals challenged (sc) with Ebola virus (Zaire strain) at a dose of 10.sup.3 TCID.sub.50 per 0.2 ml. Animals were treated with the respective compound 6 hours after administration of EBOV. In vivo protocol summaries are provided in Tables 6 and 7.

(48) TABLE-US-00006 TABLE 6 Summary of in vivo test compounds Test compound Mechanism Dose/route Compound A 33.75 mg/kg oral (1 ml) 2x daily Compound E Small molecule 44 mg/kg oral (1 ml) 2x daily inhibitor EBOVIpAb Ovine IgG 500 l of approx. 50 mg/ml (Micropharm) solution, iv every 3 days

(49) TABLE-US-00007 TABLE 7 Summary of in vivo study Day Activity Day 0 Challenge Monitor Administer test compounds Days 1-14 Administration of test compounds Weight and temperature monitored Clinical observations Day 8 Remove 0.5 ml blood via catheter RNA Day 14 Cull survivors Necropsy (liver/spleen) Samples for RNA, viral loads
Body Weight Analysis

(50) As shown in FIG. 7, Guinea pigs treated with control compound continued to gain weight until day 3, at which point weight began to plateaux. At day 6, control bodyweights were observed to decrease rapidly. With the exception of one Guinea pig (89228), Compound E also appeared to accelerate the decrease in bodyweight, compared to controls. Compound A appeared to accelerate the decrease in bodyweight, compared to controls, with a rapid loss of bodyweight at a day 4.

(51) Surprisingly, Guinea pigs treated with EBOVIpAb continued to gain weight at a consistent rate, even at the endpoint of the experiment, even at day 18 post-challenge (see FIG. 9a). This is particularly surprising in view of the highly stringent assay conditions, in which Guinea pigs were challenged 6 hours prior to treatment with EBOV.

(52) Body Temperature Analysis

(53) As shown in FIG. 8, Guinea pigs treated with control compound experienced an increase in body temperature from day 4. Body temperatures peaked at days 7-9, after which body temperatures decreased to levels slightly higher than that at time zero. Similar results were observed in Compound E-treated Guinea pigs, whereas Compound A appeared to accelerate the increase in body temperature, at day 3-4. However, this is likely due to the effect of oral gavage on food intake.

(54) Surprisingly, Guinea pigs treated with EBOVIpAb showed no increase in body temperature throughout the entire duration of the experiment, even at day 18 post-challenge (see FIG. 9b). As noted above, this is particularly surprising in view of the stringent assay conditions, in which Guinea pigs were challenged 6 hours prior to treatment with EBOVIpAb.

(55) Mortality Analysis

(56) As shown in FIG. 10, EBOV treatment of Guinea pig controls proved fatal at day 10. Compound A appeared to accelerate time to death, however, oral gavage twice daily likely exacerbated clinical symptoms with bleeding from upper GI tract and disrupted food intake. Compound E again appeared to a lesser extent, accelerate time to death, and inventors propose that the delivery-route may have contributed to this effect. Inventors note that there were individual improvements in the Compound E-treated Guinea pigs.

(57) Surprisingly, all of the Guinea pigs treated with EBOVIpAb survived challenge with EBOV, even at the endpoint of the experiment. As noted above, this is particularly surprising in view of the highly stringent assay conditions, in which Guinea pigs were challenged 6 hours prior to treatment with EBOVIpAb.

(58) Clinical Analysis

(59) FIG. 11 shows clinical scores of Guinea pigs following treatment with EBOV. Clinical scores were calculated according to signs, which were assigned a numerical value, as shown in Table 8:

(60) TABLE-US-00008 TABLE 8 Signs recorded were assigned a numerical value Sign Score Normal 0 Ruffled fur 2 Lethargy 3 Bloated 3 Pinched 3 Dehydrated 3 Hunched 3 Wasp wasted 3 Laboured breathing 5 Rapid breathing 5 Inactive 5 Immobile 10

(61) Administration of compound A led to a rapid increase in clinical score. Compound E again appeared to a lesser extent, to increase clinical scores, similar to controls.

(62) Surprisingly, the Guinea pigs treated with EBOVIpAb exhibited no clinical scores, even at the endpoint of the experiment.

(63) In conclusion, treatment with EBOVIpAb provided drastic improvements compared to controls. Surprisingly, treatment with EBOVIpAb resulted in no symptoms of EBOV, measured either by weight loss, temp increase or death, and zero clinical score.

Example 9 In Vivo Evaluation of EBOVIpAb Administered Post-challenge with EBOV (Guinea Pig Model)

(64) Efficacy of EBOVIpAb Treatment Beginning 3, 4 or 5 Days Post-EBOV Challenge.

(65) EBOVIpAb was first delivered to Guinea pigs 3, 4 or 5 days after infection with a lethal dose of EBOV, (corresponding to Groups 2-4, respectively). Group 2 received 0.5 ml (51 mg/ml) EBOVIpAb twice per day on days 3, 4, 5, 7, 9 and 10 post-challenge. Groups 3 and 4 received a similar EBOVIpAb dosage regime commencing 4 or 5 days after EBOV challenge, respectively.

(66) Mortality analysis showed that all untreated animals (Group 1, positive controls) met humane endpoints by day 11 (FIG. 12A). Surprisingly, EBOVIpAb treatment commencing 3, 4 or 5 days after challenge provided 83.3%, 50% and 33% survival respectively, representing a marked improvement over untreated positive controls. This is particularly surprising in view of the highly stringent assay conditions, in which Guinea pigs were shown to possess a high viral load at the time of EBOVIpAb administration (see Table 13, discussed below).

(67) As shown in FIG. 12(B)-(D), Guinea pigs treated with EBOVIpAb showed a marked improvement over positive controls in terms of retained body weight (FIG. 12(B)), reduced change in body temperature (FIG. 12(C)), and reduced or delayed increase in clinical score (FIG. 12(D)). As noted above, this is particularly surprising in view of the high viral load at the time of EBOVIpAb administration.

(68) These data confirm that patient outcome following EBOV infection may be drastically improved by the administration of EBOVIpAb.

(69) Presence of EBOV RNA in the Peripheral Circulation.

(70) Prior to the initial administration of EBOVIpAb on days 3, 4 or 5 post-challenge, blood was withdrawn from Guinea pigs and the presence of EBOV RNA detected by quantitative RT-PCR. Results indicated viremia in animals at day 3 post-challenge, which increased subsequently on day 4 and 5 post-challenge (FIG. 13).

(71) Blood samples were collected at day 21 from the animals still viable at the scheduled end of the study, and whose intravenous catheters still allowed withdrawal of blood (EBOVIpAb given at days 3, 4 and 5 post-challenge, n=3, n=2 and n=2, respectively). Surprisingly, no viral RNA was detected in any of the blood samples collected at 21 days post-challenge, indicating that administration of EBOVIpAb had successfully cleared EBOV from the peripheral circulation.

Example 10 In Vivo Evaluation of EBOVIpAb Administered Post-challenge with EBOV (Non-human Primate Model)

(72) Four groups of cynomolgus macaques (Macaca fascicularis) were tested. Groups 1-3 each consisted of four animals, and Group 4 consisted of 3 animals. Groups 1-3 were treated with 6 mL dose of EBOVIpAb (final concentration of 56.8 g/L) by intravenous infusion over a six minute period of a volume of 6 mL. Group 4 did not receive EBOVIpAb and served as an untreated control. All animals were challenged with a lethal dose of EBOV (corresponding to between 550 pfu and 220 pfu, by intramuscular administration). Groups 1-3 received five consecutive daily injections of EBOVIpAb, followed by alternating daily injections.

(73) Group 1 received their first daily injection of EBOVIpAb one day after EBOV challenge, and thus received injections on D1-D5, D7, D9 and D11.

(74) Group 2 received their first daily injection of EBOVIpAb two days after EBOV challenge, and thus received injections on D2-D6, D8, D10 and D12.

(75) Group 3 received their first daily injection of EBOVIpAb three days after EBOV challenge, and thus received injections on D3-D7, D9, D11 and D13.

(76) Mortality Analysis

(77) As shown in FIG. 14, EBOV treatment of non-human primate controls (Group 4) proved fatal at day 6-10. Surprisingly, all of the non-human primates treated with EBOVIpAb at D1 (Group 1) survived challenge with EBOV, even at the endpoint of the experiment. Groups 2 and 3 also exhibited a marked improvement over Group 4 animals, both in terms of survival at the endpoint of the experiment (50% and 25% survival respectively), and also the onset of mortality within the respective groups (extending from 6 days in Group 4 to 10 days in Groups 2 and 3).

(78) These advantageous results are particularly surprising in view of the highly stringent assay conditions, in which non-human primates were already infected with a lethal dose of EBOV prior to administration of EBOVIpAb.

(79) Bodyweight Analysis

(80) As shown in FIG. 15, EBOV treatment of non-human primate controls (Group 4) resulted in marked weight loss at 2-3 days post-challenge, which continued to decrease until mortality. Surprisingly, non-human primates treated with EBOVIpAb within one day of infection (Group 1) continued to gain weight until D2, followed by weight plateau until D3-D4, and then returning to a weight similar to D0. Groups 2 and 3 also exhibited a marked improvement in retained bodyweight, as compared to Group 4. These advantageous results are particularly surprising in view of the highly stringent assay conditions, in which non-human primates were already infected with a lethal dose of EBOV prior to administration of EBOVIpAb.

(81) Similar to the Guinea pig data described above, these non-human primate data also confirm that patient outcome following EBOV infection may be drastically improved by the administration of EBOVIpAb.

(82) Methods Section

(83) Animals

(84) Female Dunkin-Hartley guinea pigs were used for animal infection studies, with weights of 250 g to 350 g (Harlan Laboratories, UK). Before procedures involving the manipulation of animals, guinea pigs were anesthetised with 1.5% to 2% isofluorane in an induction change until full sedation was achieved. Animals infected with EBOV were housed within an isolator under climate-control conditions in an animal containment level 4 (CL4) room. Food and sterile water were available ad libitum. All procedures were undertaken according to the United Kingdom Animals (Scientific Procedures) Act 1986. A power calculation along with Fisher's exact test were performed using software G*Power ver.3.0.10 to determine group sizes for the experiments. A minimum group size of six met a power of 0.8 and alpha at 0.05. We also note that from previously published work in this area, that all animals become infected with EBOV at later passages. There were 10 guinea pigs depending on the group for each passage of the virus and a control group. From a practical standpoint of working at CL4 this number also represented the maximum number of animals that could be processed at the time. Of these animals, four were killed at day 7 post infection for preparation of virus and six to eight were carried on and used to measure clinical parameters. The study was performed under a UK Home Office Project License conforming to the Animal Procedures Act. Ethical review was performed by the Public Health England Animal Welfare and Ethical Review Board.

(85) Virus

(86) The EBOV Zaire ME718 strain was used in this work. This was originally isolated during an outbreak in October 1976 in Yambuku, Mongala Province in what is currently the northern Democratic Republic of the Congo, and it was simultaneously reported in three publications. Virus stocks used for this work were grown in VeroE6 cells (European Collection of Cell Cultures, UK) cultured in Leibovitz's L15 (L15) media containing 2% fetal calf serum (FCS), and aliquots were stored at 80 C. Virus titres were determined by 100-fold dilution with L15 media without any FCS added. A total of 100 L of each dilution was overlaid onto semi-confluent cell monolayers in four replicate 12.5 cm.sup.2 tissue culture flasks and left to absorb for 1 h. A volume of 5 mL media was then added and cells were incubated at 37 C. for 7 to 8 days. Cytopathic effects were determined by microscopy, and the results from each dilution were used to calculated 50% tissue culture infective dose (TCID.sub.50) using the Reed-Muench method.

(87) Animal Challenge

(88) EBOV stock was diluted in sterile PBS to prepare the relevant dose of virus in a 0.2 mL volume. For passaging experiments (required for virus adaptation), the dose delivered was 10.sup.4 TCID.sub.50. Surplus inoculation was made to confirm concentration via back titration in cell culture. Guinea pigs were sedated, and subcutaneously inoculated with the virus suspension in the lower right quadrant of the back, then returned to their cages and monitored for adverse effects caused by the injection of the anaesthetic until the animals fully recovered. Negative control groups were injected with the same volume of PBS.

(89) Observations and Monitoring

(90) Animals were monitored at least twice daily, and observations (swelling at injection site, movement, breathing, food intake, water intake and appearance) recorded for the duration of the study. A set of humane clinical end points were defined (20% weight loss, or 10% weight loss and a clinical symptom) which indicated that the animal would be euthanised to prevent any unnecessary suffering. Weights of the animals were taken daily, and temperatures recorded using a pre-inserted temperature chip.

(91) SEQ ID NOs:

(92) Where an initial Met amino acid residue or a corresponding initial codon is indicated in any of the following SEQ ID NOs, said residue/codon is optional.

(93) TABLE-US-00009 EbolavirusMayingaZaireglycoprotein SEQIDNO:1 MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDK LVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYE AGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGD FAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLR EPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTP QFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRK IRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAM VQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISE ATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPATTT SPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTR REAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHN QDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGT CHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGDNDNWWTGWRQ WIPAGIGVTGVIIAVIALFCICKFVF RecombinantEbolavirusMayingaZaireglycoprotein, lackingTransmembraneDomainandmembrane-proximal externalregion(rGP) SEQIDNO:2 MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDK LVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYE AGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGD FAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLR EPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTP QFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRK IRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAM VQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISE ATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPATTT SPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTR REAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHN QDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGT CHILGPDCCIEPHDWTKNITDKIDQIIHDFVD NucleicacidencodingthepolypeptideofSEQID NO:1 SEQIDNO:3 atgggcgttacaggaatattgcagttacctcgtgatcgattcaagaggac atcattctttctttgggtaattatccttttccaaagaacattttccatcc cacttggagtcatccacaatagcacattacaggttagtgatgtcgacaaa ctagtttgtcgtgacaaactgtcatccacaaatcaattgagatcagttgg actgaatctcgaagggaatggagtggcaactgacgtgccatctgcaacta aaagatggggcttcaggtccggtgtcccaccaaaggtggtcaattatgaa gctggtgaatgggctgaaaactgctacaatcttgaaatcaaaaaacctga cgggagtgagtgtctaccagcagcgccagacgggattcggggcttccccc ggtgccggtatgtgcacaaagtatcaggaacgggaccgtgtgccggagac tttgccttccataaagagggtgctttcttcctgtatgatcgacttgcttc cacagttatctaccgaggaacgactttcgctgaaggtgtcgttgcatttc tgatactgccccaagctaagaaggacttcttcagctcacaccccttgaga gagccggtcaatgcaacggaggacccgtctagtggctactattctaccac aattagatatcaggctaceggttttggaaccaatgagacagagtacttgt tcgaggttgacaatttgacctacgtccaacttgaatcaagattcacacca cagtttctgctccagctgaatgagacaatatatacaagtgggaaaaggag caataccacgggaaaactaatttggaaggtcaaccccgaaattgatacaa caatcggggagtgggccttctgggaaactaaaaaaaacctcactagaaaa attcgcagtgaagagttgtctttcacagttgtatcaaacggagccaaaaa catcagtggtcagagtccggcgcgaacttcttccgacccagggaccaaca caacaactgaagaccacaaaatcatggcttcagaaaattcctctgcaatg gttcaagtgcacagtcaaggaagggaagctgcagtgtcgcatctaacaac ccttgccacaatctccacgagtccccaatccctcacaaccaaaccaggtc cggacaacagcacccataatacacccgtgtataaacttgacatctctgag gcaactcaagttgaacaacatcaccgcagaacagacaacgacagcacagc ctccgacactccctctgccacgaccgcagccggacccccaaaagcagaga acaccaacacgagcaagagcactgacttcctggaccccgccaccacaaca agtccccaaaaccacagcgagaccgctggcaacaacaacactcatcacca agataccggagaagagagtgccagcagcgggaagctaggcttaattacca atactattgctggagtcgcaggactgatcacaggcgggagaagaactcga agagaagcaattgtcaatgctcaacccaaatgcaaccctaatttacatta ctggactactcaggatgaaggtgctgcaatcggactggcctggataccat atttcgggccagcagccgagggaatttacatagaggggctaatgcacaat caagatggtttaatctgtgggttgagacagctggccaacgagacgactca agctcttcaactgttcctgagagccacaactgagctacgcaccttttcaa tcctcaaccgtaaggcaattgatttcttgctgcagcgatggggcggcaca tgccacattctgggaccggactgctgtatcgaaccacatgattggaccaa gaacataacagacaaaattgatcagattattcatgattttgttgataaaa cccttccggaccagggggacaatgacaattggtggacaggatggagacaa tggataccggcaggtattggagttacaggcgttataattgcagttatcgc tttattctgtatatgcaaatttgtcttttag NucleicacidencodingthepolypeptideofSEQID NO:2 SEQIDNO:4 atgggcgttacaggaatattgcagttacctcgtgatcgattcaagaggac atcattctttctttgggtaattatccttttccaaagaacattttccatcc cacttggagtcatccacaatagcacattacaggttagtgatgtcgacaaa ctagtttgtcgtgacaaactgtcatccacaaatcaattgagatcagttgg actgaatctcgaagggaatggagtggcaactgacgtgccatctgcaacta aaagatggggcttcaggtccggtgtcccaccaaaggtggtcaattatgaa gctggtgaatgggctgaaaactgctacaatcttgaaatcaaaaaacctga cgggagtgagtgtctaccagcagcgccagacgggattcggggcttccccc ggtgccggtatgtgcacaaagtatcaggaacgggaccgtgtgccggagac tttgccttccataaagagggtgctttcttcctgtatgatcgacttgcttc cacagttatctaccgaggaacgactttcgctgaaggtgtcgttgcatttc tgatactgccccaagctaagaaggacttcttcagctcacaccccttgaga gagccggtcaatgcaacggaggacccgtctagtggctactattctaccac aattagatatcaggctaccggttttggaaccaatgagacagagtacttgt tcgaggttgacaatttgacctacgtccaacttgaatcaagattcacacca cagtttctgctccagctgaatgagacaattatacaagtgggaaaaggagc aataccacgggaaaactaatttggaaggtcaaccccgaaattgatacaac aatcggggagtgggccttctgggaaactaaaaaaaacctcactagaaaaa ttcgcagtgaagagttgtctttcacagttgtatcaaacggagccaaaaac atcagtggtcagagtccggcgcgaacttcttccgacccagggaccaacac aacaactgaagaccacaaaatcatggcttcagaaaattcctctgcaatgg ttcaagtgcacagtcaaggaagggaagctgcagtgtcgcatctaacaacc cttgccacaatctccacgagtccccaatccctcacaaccaaaccaggtcc ggacaacagcacccataatacacccgtgtataaacttgacatctctgagg caactcaagttgaacaacatcaccgcagaacagacaacgacagcacagcc tccgacactccctctgccacgaccgcagccggacccccaaaagcagagaa caccaacacgagcaagagcactgacttcctggaccccgccaccacaacaa gtccccaaaaccacagcgagaccgctggcaacaacaacactcatcaccaa gataccggagaagagagtgccagcagcgggaagctaggcttaattaccaa tactattgctggagtcgcaggactgatcacaggcgggagaagaactcgaa gagaagcaattgtcaatgctcaacccaaatgcaaccctaatttacattac tggactactcaggatgaaggtgctgcaatcggactggcctggataccata tttcgggccagcagccgagggaatttacatagaggggctaatgcacaatc aagatggtttaatctgtgggttgagacagctggccaacgagacgactcaa gctcttcaactgttcctgagagccacaactgagctacgcaccttttcaat cctcaaccgtaaggcaattgatttcttgctgcagcgatggggcggcacat gccacattctgggaccggactgctgtatcgaaccacatgattggaccaag aacataacagacaaaattgatcagattattcatgattttgttgat Optimisednucleicacidencodingthepolypeptideof SEQIDNO:2 SEQIDNO:5 atgggcgttacaggaatattgcagttacctcgtgatcgattcaagaggac atcattctttctttgggtaattatccttttccaaagaacattttccatcc cacttggagtcatccacaatagcacattacaggttagtgatgtcgacaaa ctagtttgtcgtgacaaactgtcatccacaaatcaattgagatcagttgg actgaatctcgaagggaatggagtggcaactgacgtgccatctgcaacta aaagatggggcttcaggtccggtgtcccaccaaaggtggtcaattatgaa gctggtgaatgggctgaaaactgctacaatcttgaaatcaaaaaacctga cgggagtgagtgtctaccagcagcgccagacgggattcggggcttccccc ggtgccggtatgtgcacaaagtatcaggaacgggaccgtgtgccggagac tttgccttccataaagagggtgctttcttcctgtatgatcgacttgcttc cacagttatctaccgaggaacgactttcgctgaaggtgtcgttgcatttc tgatactgccccaagctaagaaggacttcttcagctcacaccccttgaga gagccggtcaatgcaacggaggacccgtctagtggctactattctaccac aattagatatcaggctaccggctttggaaccaatgagacagagtacttgt tcgaggttgacaatttgacctacgtccaacttgaatcaagattcacacca cagtttctgctccagctgaatgagacaatatatacaagtgggaaaaggag caataccacgggaaaactaatttggaaggtcaaccccgaaattgatacaa caatcggggagtgggccttctgggaaactaaaaaaaacctcactagaaaa attcgcagtgaagagttgtctttcacagttgtatcaaacggagccaaaaa catcagtggtcagagtccggcgcgaacttcttccgacccagggaccaaca caacaactgaagaccacaaaatcatggcttcagaaaattcctctgcaatg gttcaagtgcacagtcaaggaagggaagctgcagtgtcgcatctaacaac ccttgccacaatctccacgagtccccaatccctcacaaccaaaccaggtc cggacaacagcacccataatacacccgtgtataaacttgacatctctgag gcaactcaagttgaacaacatcaccgcagaacagacaacgacagcacagc ctccgacactccctctgccacgaccgcagccggacccccaaaagcagaga acaccaacacgagcaagagcactgacttcctggaccccgccaccacaaca agtccccaaaaccacagcgagaccgctggcaacaacaacactcatcacca agataccggagaagagagtgccagcagcgggaagctaggcttaattacca atactattgctggagtcgcaggactgatcacaggcgggagaagaactcga agagaagcaattgtcaatgctcaacccaaatgcaaccctaatttacatta ctggactactcaggatgaaggtgctgcaatcggactggcctggataccat atttcgggccagcagccgagggaatttacatagaggggctaatgcacaat caagatggtttaatctgtgggttgagacagctggccaacgagacgactca agctcttcaactgttcctgagagccacaactgagctacgcaccttttcaa tcctcaaccgtaaggcaattgatttcttgctgcagcgatggggcggcaca tgccacattctgggaccggactgctgtatcgaaccacatgattggaccaa gaacataacagacaaaattgatcagattattcatgattttgttgat