METHODS OF STRATIFYING AND TREATING A SUB-POPULATION OF INFLAMMATORY BOWEL DISEASE PATIENTS
20230020356 · 2023-01-19
Inventors
Cpc classification
G16B25/10
PHYSICS
Y02A90/10
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
A61K45/00
HUMAN NECESSITIES
G16H10/40
PHYSICS
G16H50/20
PHYSICS
A61K31/00
HUMAN NECESSITIES
G16H20/10
PHYSICS
C12Q1/6883
CHEMISTRY; METALLURGY
C12Q2600/112
CHEMISTRY; METALLURGY
International classification
Abstract
Described herein are methods and systems for identifying subpopulations of patients having Crohn's disease, including populations at risk of developing structuring or other severe disease, and populations susceptible to success or failure with surgical intervention. Further provided are therapies useful for treating subpopulations of patients having Crohn's disease.
Claims
1. A method for processing or analyzing a biological sample from a subject, comprising: (a) obtaining the biological sample comprising gene expression products, wherein the subject has or is suspected of having Crohn's Disease (CD); (b) subjecting the biological sample to an assay to yield a data set including data corresponding to gene expression product levels; (c) in a programmed computer, inputting said data including said gene expression product levels from (b) to a trained algorithm to generate a classification of said sample as positive for a CD-PBmu subtype based detection of an expression profile comprising an increase in the gene expression levels compared to a reference expression profile, wherein the trained algorithm is trained with a plurality of training samples, and wherein said biological sample is independent of said plurality of training samples; and (d) electronically outputting a report that identifies the classification of the biological sample as positive for the CD-PBmu subtype, wherein optionally the biological sample comprises a blood sample or is purified from a blood sample of the subject.
2. The method of claim 1, wherein the gene expression products comprises RNA.
3. The method of claim 1, wherein the assay comprises using one or more of a microarray, sequencing, and qPCR.
4. The method of claim 1, wherein the trained algorithm is trained with one or more datasets of gene expression product levels obtained from the plurality of training samples.
5. The method of claim 1, wherein the gene expression products are expressed from genes comprising two or more of A disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1), Neutrophil gelatinase-associated lipocalin (LCN2), Disintegrin and metalloproteinase domain-containing protein 28 (ADAM28), Tryptase beta-2 (TPSB2), peptidylprolyl isomerase A pseudogene 30 (PPIAP30), glutamine-fructose-6-phosphate transaminase 2 (GFPT2), KIT proto-oncogene, receptor tyrosine kinase (KIT), phospholipid transfer protein (PLTP), major facilitator superfamily domain containing 2A (MFSD2A), interleukin 22 (IL22), LIM and cysteine rich domains 1 (LMCD1), interleukin 6 (IL6), TBC1 domain family member 9 (TBC1D9), ChaC glutathione specific gamma-glutamylcyclotransferase 1 (CHAC1), selenoprotein P (SEPP1), superoxide dismutase 3 (SOD3), RAB13, member RAS oncogene family (RAB13), lysozyme (LYZ), carboxypeptidase A3 (CPA3), serine dehydratase (SDS), dual specificity tyrosine phosphorylation regulated kinase 3 (DYRK3), DAB adaptor protein 2 (DAB2), TBC1 domain family member 8 (TBC1D8), crystallin alpha B (CRYAB), TBC1 domain family member 3 (TBC1D3), leucine rich repeat containing 32 (LRRC32), serpin family G member 1 (SERPING1), ubiquitin D (UBD), fatty acid binding protein 1 (FABP1), spleen associated tyrosine kinase (SYK), aldolase, fructose-bisphosphate B (ALDOB), semaphorin 6B (SEMA6B), NANOG neighbor homeobox (NANOGNB), dermatan sulfate epimerase (DSE), formyl peptide receptor 3 (FPR3), tenascin XB (TNXB), olfactory receptor family 4 subfamily A member 5 (OR4A5), decorin (DCN), carbohydrate sulfotransferase 15 (CHST15), ADAM like decysin 1 (ADAMDEC1), histidine decarboxylase (HDC), RRAD, Ras related glycolysis inhibitor and calcium channel regulator (RRAD), complement C1s (C1S), or phospholipase A2 group IIA (PLA2G2A), or a combination thereof.
6. The method of claim 5, wherein the gene expression products are expressed from genes comprising two or more of ADAMDEC1, ALDOB, CHST15, C1S, CRYAB, DAB2, DCN, DYRK3, FABP1, HDC, IL22, IL6, KIT, LMCD1, LRRC32, OR4A5, PLA2G2A, PLTP, RAB13, RRAD, SERPING1, SOD3, SYK, TBC1D3, TBC1D9, TPSB2, or UBD, or a combination thereof.
7. The method of claim 1, wherein the increase in the gene expression product levels is at least 2-fold greater than in the reference expression profile, wherein optionally the reference expression profile comprises expression levels of the one or more genes of one or more subjects that do not have CD.
8. (canceled)
9. (canceled)
10. The method of claim 1, further comprising (1) treating the subject by administering to the subject a therapeutic agent or (2) optimizing a therapeutic regimen of the subject comprising increasing or decreasing a dosage amount of a therapeutic agent administered to the subject for the treatment of the CD, based on the CD-PBmu subtype.
11. (canceled)
12. A method of treating Crohn's disease (CD) in a subject, the method comprising administering to the subject a therapeutically effective amount of a therapeutic agent, provided the subject is identified as having a CD-PBmu subtype by: (a) detecting an expression profile comprising an increase in a level of expression of one or more genes in the biological sample, relative to a reference expression profile; and (b) identifying the subject as having a CD-PBmu subtype based upon the expression profile that is detected in (b).
13. The method of claim 12, wherein the one or more genes comprises ADAMTS1, LCN2, ADAM28, TPSB2, PPIAP30, GFPT2, KIT, T PLTP, MFSD2A, IL22, LMCD1, IL6, TBC1D9, CHAC1, SEPP1, SOD3, RAB13, LYZ, CPA3, SDS, DYRK3, DAB2, TBC1D8, CRYAB, TBC1D3, LRRC32, SERPING1, UBD, FABP1, SYK, ALDOB, SEMA6B, NANOGNB, DSE, FPR3, TNXB, OR4A5, DCN, CHST15, ADAMDEC1, HDC, RRAD, C1S, or PLA2G2A, or a combination thereof.
14. The method of claim 13, wherein the one or more genes comprises ADAMDEC1, ALDOB, CHST15, C1S, CRYAB, DAB2, DCN, DYRK3, FABP1, HDC, IL22, IL6, KIT, LMCD1, LRRC32, OR4A5, PLA2G2A, PLTP, RAB13, RRAD, SERPING1, SOD3, SYK, TBC1D3, TBC1D9, TPSB2, or UBD, or a combination thereof.
15. The method of claim 14, wherein (1) the one or more genes comprises at least 10 of the one or more genes, or (2) the one or more genes comprises between about 10-27 of the one or more genes.
16. (canceled)
17. The method of claim 12, wherein the increase in the level of expression of the one or more genes in the biological sample is at least 2-fold greater than in the reference expression profile, wherein optionally the reference expression profile comprises expression levels of the one or more genes of one or more subjects that do not have CD.
18. (canceled)
19. The method of claim 12, wherein detecting the expression profile comprises detecting the increase in the level of expression of the one or more genes by: (a) contacting the biological sample with a nucleic acid primer and/or detectable nucleic acid probe; and (b) hybridizing the nucleic acid primer and/or detectable nucleic acid probe to a nucleic acid sequence of the one or more genes that is measured, wherein the detectable nucleic acid probe comprises a nucleic acid sequence comprising at least about 10 contiguous nucleic acids of the one of the one or more genes.
20. A method of determining a Crohn's Disease (CD) subtype in a subject having CD, the method comprising: (a) measuring a level of expression of one or more genes from Table 1A in a biological sample obtained from a subject having CD; (b) detecting an expression profile comprising an increase in the level of expression of the one or more genes in the biological sample, relative to a reference expression profile; and (b) identifying the subject as having a CD-PBmu subtype based upon the expression profile that is detected in (b), wherein optionally the biological sample comprises a blood sample or is purified from a blood sample of the subject.
21. The method of claim 20, provided that the one or more genes comprises ADAMTS1, LCN2, ADAM28, TPSB2, PPIAP30, GFPT2, KIT, T PLTP, MFSD2A, IL22, LMCD1, IL6, TBC1D9, CHAC1, SEPP1, SOD3, RAB13, LYZ, CPA3, SDS, DYRK3, DAB2, TBC1D8, CRYAB, TBC1D3, LRRC32, SERPING1, UBD, FABP1, SYK, ALDOB, SEMA6B, NANOGNB, DSE, FPR3, TNXB, OR4A5, DCN, CHST15, ADAMDEC1, HDC, RRAD, C1S, or PLA2G2A or a combination thereof.
22. The method of claim 21, wherein the one or more genes comprises ADAMDEC1, ALDOB, CHST15, C1S, CRYAB, DAB2, DCN, DYRK3, FABP1, HDC, IL22, IL6, KIT, LMCD1, LRRC32, OR4A5, PLA2G2A, PLTP, RAB13, RRAD, SERPING1, SOD3, SYK, TBC1D3, TBC1D9, TPSB2, or UBD, or a combination thereof.
23. The method of claim 21, wherein the one or more genes comprises at least 10 of the one or more genes.
24. The method of claim 20, wherein the increase in the level of expression of the one or more genes in the biological sample is at least 2-fold greater than in the reference expression profile, wherein optionally the reference expression profile comprises expression levels of the one or more genes of one or more subjects that do not have CD.
25. (canceled)
26. The method of claim 20, wherein measuring a level of expression of one or more genes comprises (1) utilizing an assay selected from the group consisting of an RNA sequencing method, a microarray method, and quantitative polymerase chain reaction (qPCR), or (2) (a) contacting the biological sample with a nucleic acid primer and/or detectable nucleic acid probe; and (b) hybridizing the nucleic acid primer and/or detectable nucleic acid probe to a nucleic acid sequence of the one or more genes that is measured, wherein the detectable nucleic acid probe comprises a nucleic acid sequence comprising at least about 10 contiguous nucleic acids of the one of the one or more genes.
27. (canceled)
28. The method of claim 20, further comprising (1) treating the subject by administering a therapeutic agent to the subject, or (2) optimizing a therapeutic regimen of the subject comprising increasing or decreasing a dosage amount of a therapeutic agent administered to the subject for the treatment of the CD, based on the CD-PBmu subtype.
29. (canceled)
30. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION OF THE INVENTION
[0046] The present disclosure provides methods and systems for characterizing and treating patients having Crohn's disease (CD). In particular embodiments, a CD patient is characterized as having or not having a mucosal-like CD expression signature (CD-PBmu) by transcriptomic profiling. Patients having the CD-PBmu profile may be suitable for subtype-specific treatment, including administration with a therapeutic agent that targets a biomolecule provided in Table 1A or 3, or a biomolecule in a biological pathway of a biomolecule provided in Table 1A or 3. In some embodiments, a CD patient is characterized as having or not having a particular monocyte profile, monocyte 2 subtype. Patients having the monocyte 2 subtype may have or become susceptive to having a more severe disease phenotype. As a non-limiting example, the subject with the monocyte 2 subtype has or is likely to fail treatment with anti-TNF, 6-mercaptopurine, and/or methotrexate. Patients having the particular monocyte profile may be suitable for subtype-specific treatment, including administration with a therapeutic agent that targets a biomolecule provided in Table 7A or 7B, or a biomolecule in a biological pathway of a biomolecule provided in Table 7A or 7B. In some cases, a subject may be treated with a modulator of a kinase selected from DNAPK, CDK4, ERK1, HIPK2, CDC2, MAPK1, MAPK3, ERK2, CSNK2A1, CK2ALPHA, JNK1, CDK1, MAPK14, PKR, and CDK2.
[0047] Further provided herein are methods and systems for characterizing and treating a patient having CD, wherein the patient is characterized as having or not having a CD-PBmu subtype, and having or not having a monocyte 2 subtype. The non-CD-PBmut subtype may be a PBT subtype. The non-monocyte 2 subtype may be a monocyte 1 subtype. The subtype characterization may be determined sequentially or concurrently. In some cases, a patient having a CD-PBmu subtype and monocyte 2 subtype is treated with a therapeutic agent that targets a biomolecule provided in Table 1A, 4, 7A, 7B, DNAPK, CDK4, ERK1, HIPK2, CDC2, MAPK1, MAPK3, ERK2, CSNK2A1, CK2ALPHA, JNK1, CDK1, MAPK14, PKR, or CDK2. In some cases, a patient having a CD-PBmu subtype and monocyte 2 subtype is not treated with anti-TNF, 6-mercaptopurine, or methotrexate. In some cases, a patient having a CD-PBmu subtype and monocyte 1 subtype is treated with a therapeutic agent that targets a biomolecule provided in Table 1A, 4, 7A, 7B, DNAPK, CDK4, ERK1, HIPK2, CDC2, MAPK1, MAPK3, ERK2, CSNK2A1, CK2ALPHA, JNK1, CDK1, MAPK14, PKR, or CDK2. In some cases, a patient having a CD-PBmu subtype and monocyte 1 subtype is not treated with anti-TNF, 6-mercaptopurine, or methotrexate. In some cases, a patient having a CD-PBT subtype and monocyte 2 subtype is treated with a therapeutic agent that targets a biomolecule provided in Table 1A, 4, 7A, 7B, DNAPK, CDK4, ERK1, HIPK2, CDC2, MAPK1, MAPK3, ERK2, CSNK2A1, CK2ALPHA, JNK1, CDK1, MAPK14, PKR, or CDK2. In some cases, a patient having a CD-PBT subtype and monocyte 2 subtype is not treated with anti-TNF, 6-mercaptopurine, or methotrexate. In some cases, a patient having a CD-PBT subtype and monocyte 1 subtype is treated with a therapeutic agent that targets a biomolecule provided in Table 1A, 4, 7A, 7B, DNAPK, CDK4, ERK1, HIPK2, CDC2, MAPK1, MAPK3, ERK2, CSNK2A1, CK2ALPHA, JNK1, CDK1, MAPK14, PKR, or CDK2. In some cases, a patient having a CD-PBT subtype and monocyte 1 subtype is not treated with anti-TNF, 6-mercaptopurine, or methotrexate.
[0048] In the following description, certain specific details are set forth in order to provide a thorough understanding of various embodiments. However, one skilled in the art will understand that the embodiments provided may be practiced without these details. Unless the context requires otherwise, throughout the specification and claims which follow, the word “comprise” and variations thereof, such as, “comprises” and “comprising” are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” As used in this specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the content clearly dictates otherwise. It should also be noted that the term “or” is generally employed in its sense including “and/or” unless the content clearly dictates otherwise. Further, headings provided herein are for convenience only and do not interpret the scope or meaning of the claimed embodiments.
[0049] As used herein, the terms “homologous,” “homology,” or “percent homology” when used herein to describe to an amino acid sequence or a nucleic acid sequence, relative to a reference sequence, can be determined using the formula described by Karlin and Altschul (Proc. Natl. Acad. Sci. USA 87: 2264-2268, 1990, modified as in Proc. Natl. Acad. Sci. USA 90:5873-5877, 1993). Such a formula is incorporated into the basic local alignment search tool (BLAST) programs of Altschul et al. (J Mol Biol. 1990 Oct. 5; 215(3):403-10; Nucleic Acids Res. 1997 Sep. 1; 25(17):3389-402). Percent homology of sequences can be determined using the most recent version of BLAST, as of the filing date of this application. Percent identity of sequences can be determined using the most recent version of BLAST, as of the filing date of this application.
Transcriptomic Signature and Profiling
[0050] In one aspect, provided herein are transcriptomic signatures associated with a subtype of IBD, including CD. In some cases, the transcriptomic signature comprises one or more genes of Table 1A. In some cases, the transcriptomic signature comprises about or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 90, 100, or more of the genes of Table 1A. In some cases, the transcriptomic signature comprises genes 1-44 of Table 1A. In some cases, the transcriptomic signature comprises genes 1-117 of Table 1A.
TABLE-US-00001 TABLE 1A Exemplary Biomarkers of a Transcriptomic Signature. No Biomarker Name EntrezID Accession UGCluster Ensembl 1 ADAM28 ADAM metallopeptidase domain 28 10863 NM_001304351 Hs.174030 ENSG00000042980 2 ADAMDEC1 ADAM-like, decysin 1 27299 NM_001145271 Hs.521459 ENSG00000134028 3 ADAMTS1 ADAM metallopeptidase with 9510 NM_006988 Hs.643357 ENSG00000154734 thrombospondin type 1 motif, 1 4 ALDOB aldolase B, fructose-bisphosphate 229 NM_000035 Hs.530274 ENSG00000136872 5 C1S complement component 1, s 716 NM_001734 Hs.458355 ENSG00000182326 subcomponent 6 CHAC1 ChaC glutathione-specific gamma- 79094 NM_001142776 Hs.155569 ENSG00000128965 glutamylcyclotransferase 1 7 CHST15 carbohydrate (N-acetylgalactosamine 51363 NM_00127076 Hs.287537 ENSG00000182022 4-sulfate 6-O) sulfotransferase 15 8 CPA3 carboxypeptidase A3 (mast cell) 1359 NM_001870 Hs.646 ENSG00000163751 9 CRYAB crystallin, alpha B 1410 NM_001289807 Hs.53454 ENSG00000109846 10 DAB2 Dab, mitogen-responsive 1601 NM_001244871 Hs.696631 ENSG00000153071 phosphoprotein, homolog 2 (Drosophila) 11 DCN decorin 1634 NM_001920 Hs.156316 ENSG00000011465 12 DSE dermatan sulfate epimerase 29940 NM_001080976 Hs.458358 ENSG00000111817 13 DYRK3 dual-specificity tyrosine-(Y)- 8444 NM_001004023 Hs.164267 ENSG00000143479 phosphorylation regulated kinase 3 14 FABP1 fatty acid binding protein 1, liver 2168 NM_001443 Hs.380135 ENSG00000163586 15 FPR3 formyl peptide receptor 3 2359 NM_002030 Hs.445466 ENSG00000187474 16 GFPT2 glutamine-fructose-6-phosphate 9945 NM-005110 Hs.696497 ENSG00000131459 transaminase 2 17 HDC histidine decarboxylase 3067 NM_001306146 Hs.1481 ENSG00000140287 18 IL22 interleukin 22 50616 NM_020525 Hs.287369 ENSG00000127318 19 IL6 interleukin 6 3569 NM_000600 Hs.654458 ENSG00000136244 20 KIT v-kit Hardy-Zuckerman 4 feline 3815 NM_000222 Hs.479754 ENSG00000157404 sarcoma viral oncogene homolog 21 LCN2 lipocalin 2 3934 NM_005564 Hs.204238 ENSG00000148346 22 LMCD1 LIM and cysteine-rich domains 1 29995 NM_001278233 Hs.475353 ENSG00000071282 23 LRRC32 leucine rich repeat containing 32 2615 NM_001128922 Hs.151641 ENSG00000137507 24 LYZ lysozyme 4069 NM_000239 Hs.524579 ENSG00000090382 25 MFSD2A major facilitator superfamily 84879 NM_001136493 Hs.655177 ENSG00000168389 domain containing 2A 26 NANOGNB NANOG neighbor homeobox 360030 NM_001145465 Hs.558004 ENSG00000205857 27 OR4A5 olfactory receptor, family 4, 81318 NM_001005272 Hs.554531 ENSG00000221840 subfamily A, member 5 28 PLA2G2A phospholipase A2, group IIA 5320 NM_000300 Hs.466804 ENSG00000188257 (platelets, synovial fluid) 29 PLTP phospholipid transfer protein 5360 NM_001242920 Hs.439312 ENSG00000100979 30 PPIAP30 peptidylprolyl isomerase A 100192204 NR_036506 Hs.714691 (cyclophilin A) pseudogene 30 31 RAB13 RAB13, member RAS oncogene 5872 NM_001272038 Hs.151536 ENSG00000143545 family 32 RRAD Ras-related associated with 6236 NM_001128850 Hs.1027 ENSG00000166592 diabetes 33 SDS serine dehydratase 10993 NM_006843 Hs.439023 ENSG00000135094 34 SEMA6B sema domain, transmembrane 10501 NM_020241 Hs.465642 ENSG00000167680 domain (TM), and cytoplasmic domain, (semaphorin) 6B 35 SEPP1 selenoprotein P, plasma, 1 6414 NM_001085486 Hs.275775 ENSG00000250722 36 SERPING1 serpin peptidase inhibitor, clade G 710 NM_000062 Hs.384598 ENSG00000149131 (C1 inhibitor), member 1 37 SOD3 superoxide dismutase 3, 6649 NM_003102 Hs.2420 ENSG00000109610 extracellular 38 SYK spleen tyrosine kinase 6850 NM_001135052 Hs.371720 ENSG00000165025 39 TBC1D3 TBC1 domain family, member 3 729873 NM_001123391 Hs.454716 ENSG00000274611 40 TBC1D8 TBC1 domain family, member 8 11138 NM_001102426 Hs.442657 ENSG00000204634 (with GRAM domain) 41 TBC1D9 TBC1 domain family, member 9 23158 NM_015130 Hs.480819 ENSG00000109436 (with GRAM domain) 42 TNXB tenascin XB 7148 NM_019105 Hs.485104 ENSG00000168477 43 TPSB2 tryptase beta 2 (gene/pseudogene) 64499 NM_024164 Hs.405479 ENSG00000197253 44 UBD ubiquitin D 10537 NM_006398 Hs.44532 ENSG00000213886 45 ABI3BP ABI family, member 3 (NESH) 25890 NM_015429 Hs.477015 ENSG00000154175 binding protein 46 ANKRD20A3 ankyrin repeat domain 20 family, 441425 NM_001012419 Hs.632663 ENSG00000276203 member A3 47 APOC1P1 apolipoprotein C-I pseudogene 1 342 NR_028412 Hs.110675 ENSG00000214855 48 AQP7P3 aquaporin 7 pseudogene 3 441432 NR_026558 Hs.743215 49 C11orf96 chromosome 11 open reading 387763 NM_001145033 Hs.530443 ENSG00000187479 frame 96 50 C1QB complement component 1, q 713 NM_000491 Hs.8986 ENSG00000173369 subcomponent, B chain 51 C1QC complement component 1, q 714 NM_001114101 Hs.467753 ENSG00000159189 subcomponent, C chain 52 C2orf27A chromosome 2 open reading 29798 NM_013310 Hs.635289 frame 27A 53 C8orf4 chromosome 8 open reading frame 4 56892 NM_020130 Hs.591849 ENSG00000176907 54 CKB creatine kinase, brain 1152 NM_001823 Hs.173724 ENSG00000166165 55 CLDN10 claudin 10 9071 NM_001160100 Hs.534377 ENSG00000134873 56 CLEC3B C-type lectin domain family 3, 7123 NM_001308394 Hs.476092 ENSG00000163815 member B 57 CLIC4 chloride intracellular channel 4 25932 NM_013943 Hs.440544 ENSG00000169504 58 COL1A1 collagen, type I, alpha 1 1277 NM_000088 Hs.172928 ENSG00000108821 59 COL1A2 collagen, type I, alpha 2 1278 NM_000089 Hs.489142 ENSG00000164692 60 COL5A1 collagen, type V, alpha 1 1289 NM_000093 Hs.210283 ENSG00000130635 61 CXCL13 chemokine (C-X-C motif) ligand 13 10563 NM_006419 Hs.100431 ENSG00000156234 62 CYCSP52 cytochrome c, somatic 360155 NR_001560 Hs.491808 ENSG00000235700 pseudogene 52 63 FAM138D family with sequence similarity 138, 677784 NR_026823 Hs.722487 ENSG00000249054 member D 64 FAM182B family with sequence similarity 182, 728882 NR_026714 Hs.682103 ENSG00000175170 member B 65 FAM222A family with sequence similarity 222, 84915 NM_032829 Hs.661785 ENSG00000139438 member A 66 FAM231A family with sequence similarity 231, 729574 NM_001282321 ENSG00000237847 member A 67 FAM27A 68 FSTL1 follistatin-like 1 11167 NM_007085 Hs.269512 ENSG00000163430 69 GAS7 growth arrest-specific 7 8522 NM_001130831 Hs.462214 ENSG00000007237 70 GEM GTP binding protein overexpressed 2669 NM_005261 Hs.654463 ENSG00000164949 in skeletal muscle 71 GOLGA6L5P golgin A6 family-like 5, pseudogene 374650 NM_198079 Hs.454625 72 GPNMB glycoprotein (transmembrane) nmb 10457 NM_001005340 Hs.190495 ENSG00000136235 73 GYPE glycophorin E (MNS blood group) 2996 NM_002102 Hs.654368 ENSG00000197465 74 HNRNPA1P33 heterogeneous nuclear 728643 NR_003277 Hs.711067 ENSG00000213412 ribonucleoprotein A1 pseudogene 33 75 HSPA2 heat shock 70 kDa protein 2 3306 NM_021979 Hs.432648 ENSG00000126803 76 HSPB6 heat shock protein, alpha- 126393 NM_144617 Hs.534538 ENSG00000004776 crystallin-related, B6 77 KGFLP2 keratinocyte growth factor- 654466 NM_001039113 Hs.536967 like protein 2 78 KRT20 keratin 20, type I 54474 NM_019010 Hs.84905 ENSG00000171431 79 LIMS3L LIM and senescent cell 100288695 NM_001205288 Hs.535619 ENSG00000256671 antigen-like domains 3-like 80 LINC00348 long intergenic non-protein 100885781 NR_047699 Hs.372660 ENSG00000226846 coding RNA 348 81 LINC00700 long intergenic non-protein 282980 NR_040253 Hs.576810 ENSG00000234962 coding RNA 700 82 LINC00857 long intergenic non-protein 439990 NR_038464 Hs.365566 ENSG00000237523 coding RNA 857 83 LINC01189 long intergenic non-protein 643648 NR_046203 Hs.640178 coding RNA 1189 84 LOC100129138 THAP domain containing, apoptosis 100129138 NR_033990 Hs.514487 ENSG00000215869 associated protein 3 pseudogene 85 LOC100507006 uncharacterized LOC100507006 100507006 NR_120420 Hs.442789 86 LOC100508046 uncharacterized LOC100508046 100508046 NR_110505 Hs.433218 ENSG00000275563 87 LOC101927123 uncharacterized LOC101927123 101927123 NR_110147 Hs.526761 ENSG00000244215 88 LOC101927905 uncharacterized LOC101927905 101927905 NR_120454 Hs.621425 ENSG00000215241 89 LOC101928163 uncharacterized LOC101928163 101928163 NR_110799 Hs.588761 90 LOC102724034 uncharacterized LOC102724034 102724034 NR_120378 Hs.694638 91 LOC642426 uncharacterized LOC642426 642426 NR_046104 Hs.578301 ENSG00000257504 92 LOC645166 lymphocyte-specific protein 1 645166 NR_027354 Hs.744183 ENSG00000232527 pseudogene 93 LOC646736 uncharacterized LOC646736 646736 NR_046102 Hs.712836 94 MIR663A microRNA 663a 724033 NR_030386 ENSG00000273684 95 MLLT10P1 myeloid/lymphoid or mixed- 140678 NR_045115 Hs.653099 lineage leukemia; translocated to, 10 pseudogene 1 96 MMP19 matrix metallopeptidase 19 4327 NM_001032360 Hs.591033 ENSG00000123342 97 NCOR1P1 nuclear receptor corepressor 1 149934 NM_001039379 Hs.711274 ENSG00000240108 pseudogene 1 98 PGM5-AS1 PGM5 antisense RNA 1 572558 NR_015423 Hs.552819 ENSG00000224958 99 PHLDB1 pleckstrin homology-like domain, 23187 NM_001144758 Hs.504062 ENSG00000019144 family B, member 1 100 PMP22 peripheral myelin protein 22 5376 NM_000304 Hs.372031 ENSG00000109099 101 PTENP1-AS PTENP1 antisense RNA 101243555 NR_103745 Hs.598470 ENSG00000281128 102 REG3A regenerating islet-derived 3 alpha 5068 NM_002580 Hs.567312 ENSG00000172016 103 RPSAP9 ribosomal protein SA pseudogene 9 653162 NR_026890 Hs.655646 ENSG00000234618 104 SEPSECS-AS1 SEPSECS antisense RNA 1 285540 NR_037934 Hs.732278 (head to head) 105 SEPT14 106 SLC9B1 solute carrier family 9, subfamily B 150159 NM_001100874 Hs.666728 ENSG00000164037 (NHA1, cation proton antiporter 1), member 1 107 SLCO4A1 solute carrier organic anion 28231 NM_016354 Hs.235782 ENSG00000101187 transporter family, member 4A1 108 SMOX spermine oxidase 54498 NM_001270691 Hs.433337 ENSG00000088826 109 SPARCL1 SPARC-like 1 (hevin) 8404 NM_001128310 Hs.62886 ENSG00000152583 110 SRC SRC proto-oncogene, non-receptor 6714 NM_005417 Hs.195659 ENSG00000197122 tyrosine kinase 111 ST13P4 suppression of tumorigenicity 13 145165 NM_153290 Hs.511834 (colon carcinoma) (Hsp70 interacting protein) pseudogene 4 112 TCF21 transcription factor 21 6943 NM_003206 Hs.78061 ENSG00000118526 113 TCF4 transcription factor 4 6925 NM_001083962 Hs.605153 ENSG00000196628 114 TMEM45B transmembrane protein 45B 120224 NM_138788 Hs.504301 ENSG00000151715 115 UBE2Q2L ubiquitin-conjugating enzyme E2Q 100505679 NM_001243531 Hs.726826 ENSG00000259511 family member 2-like 116 UBTFL1 upstream binding transcription factor, 642623 NM_001143975 Hs.719885 ENSG00000255009 RNA polymerase I-like 1 117 ZNF582-AS1 ZNF582 antisense RNA 1 386758 NR_037159 Hs.549564 ENSG00000267454 (head to head) 118 ADM adrenomedullin 133 NM_001124 Hs.441047 ENSG00000148926 119 ANPEP alanyl (membrane) aminopeptidase 290 NM_001150 Hs.1239 ENSG00000166825 120 AOAH-IT1 AOAH intronic transcript 1 100874264 NR_046764 Hs.690994 ENSG00000230539 121 ASB2 ankyrin repeat and SOCS box 51676 NM_001202429 Hs.510327 ENSG00000100628 containing 2 122 ATP5J2-PTCD1 ATP5J2-PTCD1 readthrough 100526740 NM_001198879 Hs.632313 ENSG00000248919 123 BASP1 brain abundant, membrane 10409 NM_001271606 Hs.201641 ENSG00000176788 attached signal protein 1 124 CCL11 chemokine (C-C motif) ligand 11 6356 NM_002986 Hs.54460 ENSG00000172156 125 CD68 CD68 molecule 968 NM_001040059 Hs.647419 ENSG00000129226 126 CSF2RB colony stimulating factor 2 receptor, 1439 NM_000395 Hs.592192 ENSG00000100368 beta, low-affinity (granulocyte- macrophage) 127 CTAGE8 CTAGE family, member 8 100142659 NM_001278507 Hs.661442 ENSG00000244693 128 CTGF connective tissue growth factor 1490 NM_001901 Hs.410037 ENSG00000118523 129 CXCL1 chemokine (C-X-C motif) ligand 1 2919 NM_001511 Hs.789 ENSG00000163739 (melanoma growth stimulating activity, alpha) 130 CXCL3 chemokine (C-X-C motif) ligand 3 2921 NM_002090 Hs.89690 ENSG00000163734 131 DEFA5 defensin, alpha 5, Paneth cell- 1670 NM_021010 Hs.655233 ENSG00000164816 specific 132 DEFA6 defensin, alpha 6, Paneth cell- 1671 NM_001926 Hs.711 ENSG00000164822 specific 133 DERL3 derlin 3 91319 NM_001002862 Hs.593679 ENSG00000099958 134 DNASE1L3 deoxyribonuclease I-like 3 1776 NM_001256560 Hs.476453 ENSG00000163687 135 DOK3 docking protein 3 79930 NM_001144875 Hs.720849 ENSG00000146094 136 EGR2 early growth response 2 1959 NM_000399 Hs.1395 ENSG00000122877 137 EGR3 early growth response 3 1960 NM_001199880 Hs.534313 ENSG00000179388 138 EMP1 epithelial membrane protein 1 2012 NM_001423 Hs.719042 ENSG00000134531 139 EPAS1 endothelial PAS domain protein 1 2034 NM_001430 Hs.468410 ENSG00000116016 140 FAM138A family with sequence similarity 138, 645520 NR_026818 Hs.569137 ENSG00000237613 member A 141 FAM138F family with sequence similarity 138, 641702 NR_026820 Hs.569137 ENSG00000282591 member F 142 FAM157B family with sequence similarity 157, 100132403 NM_001145249 Hs.741123 member B 143 FDCSP follicular dendritic cell secreted 260436 NM_152997 Hs.733448 ENSG00000181617 protein 144 FOSL1 FOS-like antigen 1 8061 NM_001300844 Hs.283565 ENSG00000175592 145 FSCN1 fascin actin-bundling protein 1 6624 NM_003088 Hs.118400 ENSG00000075618 146 FTH1P3 ferritin, heavy polypeptide 1 2498 NR_002201 Hs.658438 pseudogene 3 147 GAS6 growth arrest-specific 6 2621 NM_000820 Hs.646346 ENSG00000183087 148 GATA2 GATA binding protein 2 2624 NM_001145661 Hs.367725 ENSG00000179348 149 GPX3 glutathione peroxidase 3 2878 NM_002084 Hs.386793 ENSG00000211445 150 HES1 hes family bHLH transcription 3280 NM_005524 Hs.250666 ENSG00000114315 factor 1 151 HES4 hes family bHLH transcription 57801 NM_001142467 Hs.154029 ENSG00000188290 factor 4 152 HLA-L major histocompatibility complex, 3139 NR_027822 Hs.656020 ENSG00000243753 class I, L (pseudogene) 153 IGFBP7 insulin-like growth factor 3490 NM_001253835 Hs.479808 ENSG00000163453 binding protein 7 154 IL1RN interleukin 1 receptor antagonist 3557 NM_000577 Hs.81134 ENSG00000136689 155 IL21R-AS1 IL21R antisense RNA 1 283888 NR_037158 Hs.660935 ENSG00000259954 156 LINC01194 long intergenic non-protein 404663 NR_033383 Hs.552273 coding RNA 1194 157 LOC100240735 uncharacterized LOC100240735 100240735 NR_026658 Hs.635297 ENSG00000250654 158 LOC101927817 uncharacterized LOC101927817 101927817 NR_110931 Hs.667942 159 LOC284801 160 LOC285740 uncharacterized LOC285740 285740 NR_027113 Hs.432656 ENSG00000235740 161 LOC441242 uncharacterized LOC441242 441242 NM_001013464 Hs.373941 ENSG00000272693 162 LOC644172 mitogen-activated protein kinase 8 644172 NR_026901 Hs.448859 interacting protein 1 pseudogene 163 MAFF v-maf avian musculoaponeurotic 23764 NM_001161572 Hs.517617 ENSG00000185022 fibrosarcoma oncogene homolog F 164 MARCKS myristoylated alanine-rich 4082 NM_002356 Hs.519909 ENSG00000277443 protein kinase C substrate 165 MCTP1 multiple C2 domains, 79772 NM_001002796 Hs.591248 ENSG00000175471 transmembrane 1 166 MGP matrix Gla protein 4256 NM_000900 Hs.365706 ENSG00000111341 167 MIR548I1 microRNA 548i-1 100302204 NR_031687 ENSG00000221737 168 MIR663B microRNA 663b 100313824 NR_031608 ENSG00000221288 169 MMP9 matrix metallopeptidase 9 4318 NM_004994 Hs.297413 ENSG00000100985 170 MT1G metallothionein 1G 4495 NM_001301267 Hs.433391 ENSG00000125144 171 NPIPB9 nuclear pore complex interacting 100507607 NM_001287250 Hs.710214 ENSG00000196993 protein family, member B9 172 NUCB1-AS1 NUCB1 antisense RNA 1 100874085 NR_046633 Hs.569933 ENSG00000235191 173 OR4F21 olfactory receptor, family 4, 441308 NM_001005504 Hs.690459 ENSG00000176269 subfamily F, member 21 174 PHACTR1 phosphatase and actin regulator 1 221692 NM_001242648 Hs.436996 ENSG00000112137 175 PLEKHA4 pleckstrin homology domain 57664 NM_001161354 Hs.9469 ENSG00000105559 containing, family A (phosphoinositide binding specific) member 4 176 PLGLB1 plasminogen-like B1 5343 NM_001032392 Hs.652169 ENSG00000183281 177 POC1B-GALNT4 POC1B-GALNT4 readthrough 100528030 NM_001199781 Hs.25130 ENSG00000259075 178 PRKX-AS1 PRKX antisense RNA 1 100873944 NR_046643 ENSG00000236188 179 PTGS2 prostaglandin-endoperoxide 5743 NM_000963 Hs.196384 ENSG00000073756 synthase 2 (prostaglandin G/H synthase and cyclooxygenase) 180 RAB20 RAB20, member RAS oncogene 55647 NM_017817 Hs.743563 ENSG00000139832 family 181 REG1A regenerating islet-derived 1 alpha 5967 NM_002909 Hs.49407 ENSG00000115386 182 RNASE1 ribonuclease, RNase A family, 6035 NM_002933 Hs.78224 ENSG00000129538 1 (pancreatic) 183 SDC4 syndecan 4 6385 NM_002999 Hs.632267 ENSG00000124145 184 SEPT10 185 SIRPA signal-regulatory protein alpha 140885 NM_001040022 Hs.581021 ENSG00000198053 186 SNAI1 snail family zinc finger 1 6615 NM_005985 Hs.48029 ENSG00000124216 187 SPARC secreted protein, acidic, cysteine- 6678 NM_001309443 Hs.111779 ENSG00000113140 rich (osteonectin) 188 SPHK1 sphingosine kinase 1 8877 NM_001142601 Hs.68061 ENSG00000176170 189 SPINK4 serine peptidase inhibitor, Kazal 27290 NM_014471 Hs.555934 ENSG00000122711 type 4 190 STAB1 stabilin 1 23166 NM_015136 Hs.301989 ENSG00000010327 191 TMEM114 transmembrane protein 114 283953 NM_001146336 Hs.150849 ENSG00000232258 192 TNFAIP2 tumor necrosis factor, alpha- 7127 NM_006291 Hs.525607 ENSG00000185215 induced protein 2 193 TNFRSF12A tumor necrosis factor receptor 51330 NM_016639 Hs.355899 ENSG00000006327 superfamily, member 12A 194 TNFRSF13B tumor necrosis factor receptor 23495 NM_012452 Hs.158341 ENSG00000240505 superfamily, member 13B 195 TPSAB1 tryptase alpha/beta 1 7177 NM_003294 Hs.405479 ENSG00000172236 196 TREM1 triggering receptor expressed on 54210 NM_001242589 Hs.283022 ENSG00000124731 myeloid cells 1 197 TUBB6 tubulin, beta 6 class V 84617 NM_001303524 Hs.193491 ENSG00000176014 198 UGT2B10 UDP glucuronosyltransferase 2 7365 NM_001075 Hs.201634 ENSG00000109181 family, polypeptide B10 199 UPK3B uroplakin 3B 80761 NM_030570 Hs.488861 ENSG00000243566 200 VEGFA vascular endothelial growth factor A 7422 NM_001025366 Hs.73793 ENSG00000112715
[0051] Further provided are methods and compositions for characterizing a subtype of Crohn's Disease (CD) in a subject. A non-limiting subtype is CD-PBmu, which is associated with a mucosal-like expression profile. In some cases, the CD-PBmu subtype is associated with an altered composition of T-cell subsets, clinical disease severity markers, and decreased pro-inflammatory gene expression following surgery. The characterization methods provided include diagnosing the presence or absence of a CD subtype, prognosing whether a subject is predisposed to developing a particular CD subtype, prognosing a response of a patient with a particular CD subtype to a therapeutic treatment, and monitoring CD treatment.
[0052] In some embodiments, the methods involve detecting in a biological sample from a subject expression levels of one or more genes of a transcriptomic signature to obtain an expression profile comprising the expression levels of each of the one or more genes in the signature. In some embodiments, the transcriptomic signature comprises one or more biomarkers listed in Table 1A. In some embodiments, the transcriptomic signature comprises any combination of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 5, 60, 65, 70, 75, 80, 90, 100, or more of the genes of Table 1A. In some cases, the transcriptomic signature comprises genes 1-44 of Table 1A. In some cases, the transcriptomic signature comprises genes 1-117 of Table 1A.
[0053] In some embodiments, gene expression profiling may be used as a research tool to identify new markers for diagnosis and/or classification of an IBD disease or condition, to monitor the effect of drugs or candidate drugs on biological samples and/or patients, to uncover new pathways for IBD treatment, or any combination thereof.
[0054] In some embodiments, the transcriptomic signature comprises ADAMTS1. In some embodiments, the transcriptomic signature comprises LCN2. In some embodiments, the transcriptomic signature comprises ADAM28. In some embodiments, the transcriptomic signature comprises TPSB2. In some embodiments, the transcriptomic signature comprises PPIAP30. In some embodiments, the transcriptomic signature comprises GFPT2. In some embodiments, the transcriptomic signature comprises KIT. In some embodiments, the transcriptomic signature comprises PLTP. In some embodiments, the transcriptomic signature comprises MFSD2A. In some embodiments, the transcriptomic signature comprises IL22. In some embodiments, the transcriptomic signature comprises LMCD1. In some embodiments, the transcriptomic signature comprises IL6. In some embodiments, the transcriptomic signature comprises TBC1D9. In some embodiments, the transcriptomic signature comprises CHAC1. In some embodiments, the transcriptomic signature comprises SEPP1. In some embodiments, the transcriptomic signature comprises SOD3. In some embodiments, the transcriptomic signature comprises RAB13. In some embodiments, the transcriptomic signature comprises LYZ. In some embodiments, the transcriptomic signature comprises CPA3. In some embodiments, the transcriptomic signature comprises SDS. In some embodiments, the transcriptomic signature comprises DYRK3. In some embodiments, the transcriptomic signature comprises DAB2. In some embodiments, the transcriptomic signature comprises TBC1D8. In some embodiments, the transcriptomic signature comprises CRYAB. In some embodiments, the transcriptomic signature comprises TBC1D3. In some embodiments, the transcriptomic signature comprises LRRC32. In some embodiments, the transcriptomic signature comprises SERPING1. In some embodiments, the transcriptomic signature comprises UBD. In some embodiments, the transcriptomic signature comprises FABP1. In some embodiments, the transcriptomic signature comprises SYK. In some embodiments, the transcriptomic signature comprises ALDOB. In some embodiments, the transcriptomic signature comprises SEMA6B. In some embodiments, the transcriptomic signature comprises NANOGNB. In some embodiments, the transcriptomic signature comprises DSE. In some embodiments, the transcriptomic signature comprises FPR3. In some embodiments, the transcriptomic signature comprises TNXB. In some embodiments, the transcriptomic signature comprises OR4A5. In some embodiments, the transcriptomic signature comprises DCN. In some embodiments, the transcriptomic signature comprises CHST15. In some embodiments, the transcriptomic signature comprises ADAMDEC1. In some embodiments, the transcriptomic signature comprises HDC. In some embodiments, the transcriptomic signature comprises RRAD. In some embodiments, the transcriptomic signature comprises C1S. In some embodiments, the transcriptomic signature comprises PLA2G2A. In some embodiments, the transcriptomic signature comprises CYCSP52. In some embodiments, the transcriptomic signature comprises C11orf96. In some embodiments, the transcriptomic signature comprises SEPSECS-AS1. In some embodiments, the transcriptomic signature comprises C1QC. In some embodiments, the transcriptomic signature comprises SLC9B1. In some embodiments, the transcriptomic signature comprises MLLT10P1. In some embodiments, the transcriptomic signature comprises LOC102724034. In some embodiments, the transcriptomic signature comprises SMOX. In some embodiments, the transcriptomic signature comprises CKB. In some embodiments, the transcriptomic signature comprises NCOR1P1. In some embodiments, the transcriptomic signature comprises LOC646736. In some embodiments, the transcriptomic signature comprises CLEC3B. In some embodiments, the transcriptomic signature comprises SLCO4A1. In some embodiments, the transcriptomic signature comprises APOC1P1. In some embodiments, the transcriptomic signature comprises KGFLP2. In some embodiments, the transcriptomic signature comprises ABI3BP. In some embodiments, the transcriptomic signature comprises LINC01189. In some embodiments, the transcriptomic signature comprises SEPT14. In some embodiments, the transcriptomic signature comprises FSTL1. In some embodiments, the transcriptomic signature comprises GEM. In some embodiments, the transcriptomic signature comprises FAM27A. In some embodiments, the transcriptomic signature comprises PTENP1-AS. In some embodiments, the transcriptomic signature comprises LIMS3L. In some embodiments, the transcriptomic signature comprises ST13P4. In some embodiments, the transcriptomic signature comprises C1QB. In some embodiments, the transcriptomic signature comprises HNRNPA1P33. In some embodiments, the transcriptomic signature comprises MIR663A. In some embodiments, the transcriptomic signature comprises LOC101927123. In some embodiments, the transcriptomic signature comprises C2orf27A. In some embodiments, the transcriptomic signature comprises LOC645166. In some embodiments, the transcriptomic signature comprises ZNF582-AS1. In some embodiments, the transcriptomic signature comprises HSPA2. In some embodiments, the transcriptomic signature comprises COL1A1. In some embodiments, the transcriptomic signature comprises COL5A1. In some embodiments, the transcriptomic signature comprises GOLGA6L5P. In some embodiments, the transcriptomic signature comprises PGM5-AS1. In some embodiments, the transcriptomic signature comprises CLDN10. In some embodiments, the transcriptomic signature comprises UBE2Q2L. In some embodiments, the transcriptomic signature comprises LOC100129138. In some embodiments, the transcriptomic signature comprises COL1A2. In some embodiments, the transcriptomic signature comprises SPARCL1. In some embodiments, the transcriptomic signature comprises FAM222A. In some embodiments, the transcriptomic signature comprises LINC00857. In some embodiments, the transcriptomic signature comprises CLIC4. In some embodiments, the transcriptomic signature comprises FAM182B. In some embodiments, the transcriptomic signature comprises LOC642426. In some embodiments, the transcriptomic signature comprises GYPE. In some embodiments, the transcriptomic signature comprises C8orf4. In some embodiments, the transcriptomic signature comprises RPSAP9. In some embodiments, the transcriptomic signature comprises FAM231A. In some embodiments, the transcriptomic signature comprises LINC00700. In some embodiments, the transcriptomic signature comprises ANKRD20A3. In some embodiments, the transcriptomic signature comprises FAM138D. In some embodiments, the transcriptomic signature comprises KRT20. In some embodiments, the transcriptomic signature comprises UBTFL1. In some embodiments, the transcriptomic signature comprises GAS7. In some embodiments, the transcriptomic signature comprises GPNMB. In some embodiments, the transcriptomic signature comprises TCF4. In some embodiments, the transcriptomic signature comprises LINC00348. In some embodiments, the transcriptomic signature comprises SRC. In some embodiments, the transcriptomic signature comprises HSPB6. In some embodiments, the transcriptomic signature comprises LOC100507006. In some embodiments, the transcriptomic signature comprises TCF21. In some embodiments, the transcriptomic signature comprises TMEM45B. In some embodiments, the transcriptomic signature comprises LOC101927905. In some embodiments, the transcriptomic signature comprises CXCL13. In some embodiments, the transcriptomic signature comprises AQP7P3. In some embodiments, the transcriptomic signature comprises PMP22. In some embodiments, the transcriptomic signature comprises LOC101928163. In some embodiments, the transcriptomic signature comprises REG3A. In some embodiments, the transcriptomic signature comprises MMP19. In some embodiments, the transcriptomic signature comprises PHLDB1. In some embodiments, the transcriptomic signature comprises LOC100508046. In some embodiments, the transcriptomic signature comprises SPINK4. In some embodiments, the transcriptomic signature comprises HES4. In some embodiments, the transcriptomic signature comprises TREM1. In some embodiments, the transcriptomic signature comprises TNFRSF12A. In some embodiments, the transcriptomic signature comprises PRKX-AS1. In some embodiments, the transcriptomic signature comprises PLGLB1. In some embodiments, the transcriptomic signature comprises SNAI1. In some embodiments, the transcriptomic signature comprises NUCB1-AS1. In some embodiments, the transcriptomic signature comprises BASP1. In some embodiments, the transcriptomic signature comprises MGP. In some embodiments, the transcriptomic signature comprises ANPEP. In some embodiments, the transcriptomic signature comprises PHACTR1. In some embodiments, the transcriptomic signature comprises ADM. In some embodiments, the transcriptomic signature comprises DEFA6. In some embodiments, the transcriptomic signature comprises VEGFA. In some embodiments, the transcriptomic signature comprises EGR2. In some embodiments, the transcriptomic signature comprises DEFA5. In some embodiments, the transcriptomic signature comprises CXCL3. In some embodiments, the transcriptomic signature comprises SDC4. In some embodiments, the transcriptomic signature comprises TPSAB 1. In some embodiments, the transcriptomic signature comprises CD68. In some embodiments, the transcriptomic signature comprises EPAS1. In some embodiments, the transcriptomic signature comprises MARCKS. In some embodiments, the transcriptomic signature comprises TNFAIP2. In some embodiments, the transcriptomic signature comprises MIR663B. In some embodiments, the transcriptomic signature comprises TMEM114. In some embodiments, the transcriptomic signature comprises SIRPA. In some embodiments, the transcriptomic signature comprises GAS6. In some embodiments, the transcriptomic signature comprises IGFBP7. In some embodiments, the transcriptomic signature comprises ASB2. In some embodiments, the transcriptomic signature comprises HES1. In some embodiments, the transcriptomic signature comprises LOC284801. In some embodiments, the transcriptomic signature comprises TNFRSF13B. In some embodiments, the transcriptomic signature comprises MIR548I1. In some embodiments, the transcriptomic signature comprises DERL3. In some embodiments, the transcriptomic signature comprises SPARC. In some embodiments, the transcriptomic signature comprises EMP1. In some embodiments, the transcriptomic signature comprises LOC100240735. In some embodiments, the transcriptomic signature comprises LOC101927817. In some embodiments, the transcriptomic signature comprises STAB1. In some embodiments, the transcriptomic signature comprises UPK3B. In some embodiments, the transcriptomic signature comprises RAB20. In some embodiments, the transcriptomic signature comprises MMP9. In some embodiments, the transcriptomic signature comprises MT1G. In some embodiments, the transcriptomic signature comprises POC1B-GALNT4. In some embodiments, the transcriptomic signature comprises CSF2RB. In some embodiments, the transcriptomic signature comprises IL1RN. In some embodiments, the transcriptomic signature comprises PLEKHA4. In some embodiments, the transcriptomic signature comprises LOC644172. In some embodiments, the transcriptomic signature comprises MAFF. In some embodiments, the transcriptomic signature comprises FDCSP. In some embodiments, the transcriptomic signature comprises DNASE1L3. In some embodiments, the transcriptomic signature comprises PTGS2. In some embodiments, the transcriptomic signature comprises TUBB6. In some embodiments, the transcriptomic signature comprises LINC01194. In some embodiments, the transcriptomic signature comprises CTAGE8. In some embodiments, the transcriptomic signature comprises REG1A. In some embodiments, the transcriptomic signature comprises ATP5J2-PTCD1. In some embodiments, the transcriptomic signature comprises DOK3. In some embodiments, the transcriptomic signature comprises EGR3. In some embodiments, the transcriptomic signature comprises AOAH-IT1. In some embodiments, the transcriptomic signature comprises RNASE1. In some embodiments, the transcriptomic signature comprises CCL11. In some embodiments, the transcriptomic signature comprises OR4F21. In some embodiments, the transcriptomic signature comprises FAM157B. In some embodiments, the transcriptomic signature comprises GATA2. In some embodiments, the transcriptomic signature comprises CTGF. In some embodiments, the transcriptomic signature comprises CXCL1. In some embodiments, the transcriptomic signature comprises GPX3. In some embodiments, the transcriptomic signature comprises FAM138A. In some embodiments, the transcriptomic signature comprises FAM138F. In some embodiments, the transcriptomic signature comprises FOSL1. In some embodiments, the transcriptomic signature comprises FSCN1. In some embodiments, the transcriptomic signature comprises FTH1P3. In some embodiments, the transcriptomic signature comprises SPHK1. In some embodiments, the transcriptomic signature comprises LOC441242. In some embodiments, the transcriptomic signature comprises UGT2B10. In some embodiments, the transcriptomic signature comprises MCTP1. In some embodiments, the transcriptomic signature comprises IL21R-AS1. In some embodiments, the transcriptomic signature comprises LOC285740. In some embodiments, the transcriptomic signature comprises HLA-L. In some embodiments, the transcriptomic signature comprises NPIPB9. In some embodiments, the transcriptomic signature comprises SEPT10.
[0055] The expression profile of a transcriptomic signature in a subject may be determined by analyzing genetic material obtained from a subject. The subject may be human. In some embodiments, the genetic material is obtained from a subject having an inflammatory disease, such as inflammatory bowel disease, or specifically, Crohn's Disease. Although the methods described herein are generally referenced for use with Crohn's Disease patients, in some cases the methods and transcriptomic signatures are applicable to other inflammatory diseases, including, ulcerative colitis.
[0056] In some embodiments, the genetic material is obtained from blood, serum, plasma, sweat, hair, tears, urine, or tissue. Techniques for obtaining samples from a subject include, for example, obtaining samples by a mouth swab or a mouth wash, drawing blood, and obtaining a biopsy. In some cases, the genetic material is obtained from a biopsy, e.g., from the intestinal track of the subject. Isolating components of fluid or tissue samples (e.g., cells or RNA or DNA) may be accomplished using a variety of techniques. After the sample is obtained, it may be further processed to enrich for or purify genomic material.
[0057] In some embodiments, the expression level of a biomarker in a sample from a subject is compared to a reference expression level. In some cases, the reference expression level is from a subject that does not comprise IBD. In some cases, the reference expression level is from a subject that comprises a non-PBmu subtype of CD. In some cases, the reference expression level is from a subject that comprises a CD-PBmu subtype. In some cases, a patient having a CD-PBmu subtype has an expression level of one or more biomarkers at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, or 5-fold greater than the expression level of the one or more biomarkers in a reference subject (e.g., a subject who does not have IBD or has a non-PBmu CD subtype). Table 1B provides non-limiting examples of increased expression fold of biomarkers in a CD-PBmu subject as compared to a subject who does not have IBD (NL) or has a PBT CD subtype.
TABLE-US-00002 TABLE 1B Increased Expression of Biomarkers in CD-PBmu Subject Fold-change Fold change No. Biomarker PBmu vs PBT PBmu vs NL 1 ADAM28 2.43 2 ADAMDEC1 6.76 4.658 3 ADAMTS1 2.22 2.273 4 ALDOB 5.32 5.686 5 C1S 5.42 2.923 6 CHAC1 4.65 3.857 7 CHST15 3.18 2.211 8 CPA3 5.19 5.849 9 CRYAB 6.32 5.2 10 DAB2 2.29 11 DCN 8.23 7.66 12 DSE 2.01 2.04 13 DYRK3 3.79 3.357 14 FABP1 6.38 3.571 15 FPR3 4.35 4.133 16 GFPT2 2.69 17 HDC 5.99 5.357 18 IL22 4.37 19 IL6 4.78 4.756 20 KIT 2.36 2.167 21 LCN2 4.56 22 LMCD1 3.12 2.636 23 LRRC32 2.83 2.267 24 LYZ 2.07 1.842 25 MFSD2A 3.13 2.611 26 NANOGNB 5.73 5.22 27 OR4A5 11.69 6.429 28 PLA2G2A 7.93 3.429 29 PLTP 2.51 30 PPIAP30 3.01 3.258 31 RAB13 2.09 1.787 32 RRAD 6.91 3.425 33 SDS 3.87 5 34 SEMA6B 5.8 3.714 35 SEPP1 2.84 2.333 36 SERPING1 4.12 4.343 37 SOD3 5.11 3.929 38 SYK 2.34 1.761 39 TBC1D3 11.52 5.867 40 TBC1D8 2.01 2 41 TBC1D9 2.26 1.859 42 TNXB 2.79 2.295 43 TPSB2 4.12 3.5 44 UBD 6.82 4 45 ABI3BP 2.54 3.818 46 ANKRD20A3 5.07 4.409 47 APOC1P1 3.24 4.442 48 AQP7P3 16.67 13.553 49 C11orf96 3.99 3.621 50 C1QB 4.66 3.71 51 C1QC 4.19 6.14 52 C2orf27A 4.86 3.095 53 C8orf4 8.42 6.176 54 CKB 3.13 1.867 55 CLDN10 2.86 2.873 56 CLEC3B 4.85 2.55 57 CLIC4 2.19 1.714 58 COL1A1 5.31 4.028 59 COL1A2 5.99 5.172 60 COL5A1 2.69 2.529 61 CXCL13 8.3 6.038 62 CYCSP52 3.89 3.6 63 FAM138D 3.64 3.281 64 FAM182B 14.52 10.833 65 FAM222A 2.67 1.725 66 FAM231A 2.11 1.842 67 FAM27A 9.15 4.829 68 FSTL1 4.4 4.824 69 GAS7 2.21 1.591 70 GEM 4.97 5.542 71 GOLGA6L5P 3.44 2.067 72 GPNMB 6.33 4.59 73 GYPE 4.27 4.963 74 HNRNPA1P33 7.75 3.278 75 HSPA2 3.24 3.222 76 HSPB6 6.69 4.386 77 KGFLP2 2.6 2.083 78 KRT20 7.48 5 79 LIMS3L 2.07 2 80 LINC00348 3.85 2.932 81 LINC00700 3.68 2.879 82 LINC00857 2.26 1.907 83 LINC01189 6.85 5.931 84 LOC100129138 3.63 3.73 85 LOC100507006 2.14 1.372 86 LOC100508046 16.42 12.727 87 LOC101927123 6.44 88 LOC101927905 3.39 2.864 89 LOC101928163 5.48 4.151 90 LOC102724034 2.85 1.8 91 LOC642426 8.09 8.542 92 LOC645166 4.71 6.258 93 LOC646736 3.18 4.136 94 MIR663A 24.45 17.565 95 MLLT10P1 2.37 3.687 96 MMP19 7.06 4.066 97 NCOR1P1 7.48 10.482 98 PGM5-AS1 13.24 10.532 99 PHLDB1 2.95 2.286 100 PMP22 7.75 3.793 101 PTENP1-AS 5.08 5.882 102 REG3A 9.48 5.172 103 RPSAP9 4.16 3.734 104 SEPSECS-AS1 2.6 105 SEPT14 4.4 106 SLC9B1 2.43 2.175 107 SLCO4A1 2.78 2.684 108 SMOX 3.01 2.229 109 SPARCL1 5.83 4.561 110 SRC 2.42 2.418 111 ST13P4 5.79 5.857 112 TCF21 8.89 8.125 113 TCF4 2.67 2.5 114 TMEM45B 2.05 1.585 115 UBE2Q2L 3.7 2.33 116 UBTFL1 16.01 9.495 117 ZNF582-AS1 2.43 1.766 118 ADM 3.54 3.296 119 ANPEP 2.77 2.262 120 AOAH-IT1 5.73 3.767 121 ASB2 2.16 1.629 122 ATP5J2-PTCD1 8.72 2.679 123 BASP1 2.38 1.976 124 CCL11 7.01 4.242 125 CD68 2.07 1.656 126 CSF2RB 2.58 2.061 127 CTAGE8 3.47 2.03 128 CTGF 6.8 6.25 129 CXCL1 9.88 8.571 130 CXCL3 4.64 5.6 131 DEFA5 5.86 5.161 132 DEFA6 5.05 3.667 133 DERL3 2.1 2.054 134 DNASE1L3 5.79 3.167 135 DOK3 3.05 2.118 136 EGR2 2.12 3.57 137 EGR3 3.37 4.522 138 EMP1 3.72 3.056 139 EPAS1 2.26 2.611 140 FAM138A 5.18 3.225 141 FAM138F 5.18 3.225 142 FAM157B 3.21 4.365 143 FDCSP 5.69 3.333 144 FOSL1 3.85 3.851 145 FSCN1 2.65 2.902 146 FTH1P3 3.3 2.75 147 GAS6 2.24 2.315 148 GATA2 3.44 3.667 149 GPX3 2.01 1.92 150 HES1 4.07 4.9 151 HES4 2.62 3.667 152 HLA-L 2.06 2.014 153 IGFBP7 2.98 2.068 154 IL1RN 2.99 2.598 155 IL21R-AS1 2.27 2.828 156 LINC01194 6.64 2.952 157 LOC100240735 2.26 158 LOC101927817 2.05 2.297 159 LOC284801 2.66 4.337 160 LOC285740 2.22 2.321 161 LOC441242 2.11 1.901 162 LOC644172 9.36 7.364 163 MAFF 2.04 2.345 164 MARCKS 2.36 2.637 165 MCTP1 2.43 2.116 166 MGP 2.66 2.081 167 MIR548I1 6.27 5.586 168 MIR663B 15.79 30.76 169 MMP9 5.7 4.091 170 MT1G 7.38 171 NPIPB9 2.9 3.075 172 NUCB1-AS1 4.88 4.429 173 OR4F21 12.9 8.358 174 PHACTR1 2.26 2.211 175 PLEKHA4 2.88 2.278 176 PLGLB1 2.42 2.678 177 POC1B-GALNT4 6.4 5.075 178 PRKX-AS1 2.53 1.952 179 PTGS2 3.37 5.259 180 RAB20 2.32 2.349 181 REGI1A 6.54 6.818 182 RNASE1 7.97 3.263 183 SDC4 2.02 2.281 184 SEPT10 2.38 185 SIRPA 2.57 1.9 186 SNAI1 2.82 3.238 187 SPARC 2.61 2.013 188 SPHK1 4.35 3.226 189 SPINK4 4.27 190 STAB1 3.03 2.145 191 TMEM114 5.7 2.976 192 TNFAIP2 2.68 2.376 193 TNFRSF12A 3.31 4.062 194 TNFRSF13B 3.17 2.316 195 TPSAB1 3.89 3.667 196 TREM1 2.72 197 TUBB6 2.55 2.039 198 UGT2B10 11.04 10.69 199 UPK3B 2.08 200 VEGFA 2.58 2.531
[0058] In embodiments where more than one biomarker is detected, the differences in expression between a patient having a CD-PBmu subtype and a reference subject (e.g., non-IBD subject or subject with CD PBT) may be different for each marker, e.g., each of the biomarkers detected is at least about 1.1, about 1.2, about 1.3, about 1.4, about 1.5, about 1.6, about 1.7, about 1.8, about 1.9, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, or about 15 fold up-modulated as compared to the expression level of the respective biomarker in the reference non-CD-PBmu sample. In some cases, at least about 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% of the biomarkers detected in a transcriptomic signature is at least about 1.1, about 1.2, about 1.3, about 1.4, about 1.5, about 1.6, about 1.7, about 1.8, about 1.9, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, or about 15 fold up-modulated as compared to the expression level of the respective biomarker in the reference non-CD-PBmu sample.
Monocyte Signature and Profiling
[0059] In one aspect, provided herein are monocyte signatures associated with a subtype of IBD, including CD. In some cases, the monocyte signature comprises one or more genes of Table 7A. In some cases, the monocyte signature comprises about or at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 90, 100, or more of the genes of Table 7A.
[0060] Further provided are methods and compositions for characterizing a subtype of Crohn's Disease (CD) in a subject. Non-limiting examples of subtypes are monocyte 2 subtype and monocyte 1 subtype. The characterization methods provided include diagnosing the presence or absence of a CD subtype, prognosing whether a subject is predisposed to developing a particular CD subtype, prognosing a response of a patient with a particular CD subtype to a therapeutic treatment, and monitoring CD treatment.
[0061] In some embodiments, the methods involve detecting in a biological sample comprising monocytes from a subject expression levels of one or more genes of a monocyte signature to obtain an expression profile comprising the expression levels of each of the one or more genes in the signature. In some embodiments, the monocyte signature comprises one or more biomarkers listed in Table 7A. In some embodiments, the monocyte signature comprises any combination of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 90, 100, or more of the genes of Table 7A.
[0062] The expression profile of a monocyte signature in a subject may be determined by analyzing monocytes of a subject. The subject may be human. In some embodiments, the monocytes are obtained from a subject having an inflammatory disease, such as inflammatory bowel disease, or specifically, Crohn's Disease. Although the methods described herein are generally referenced for use with Crohn's Disease patients, in some cases the methods and monocyte signatures are applicable to other inflammatory diseases, including, ulcerative colitis.
[0063] In some embodiments, the expression level of a biomarker in a sample from a subject is compared to a reference expression level. In some cases, the reference expression level is from a subject that does not comprise IBD. In some cases, the reference expression level is from a subject that comprises a monocyte 1 subtype of CD. In some cases, the reference expression level is from a subject that comprises a monocyte 2 subtype of CD. In some cases, a patient having a monocyte 2 subtype has an expression level of one or more biomarkers at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, or 5-fold greater than the expression level of the one or more biomarkers in a reference subject (e.g., a subject who has a monocyte 1 subtype). In some cases, a patient having a monocyte 1 subtype has an expression level of one or more biomarkers at least 1.5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, or 5-fold greater than the expression level of the one or more biomarkers in a reference subject (e.g., a subject who has a monocyte 2 subtype). Table 7A provides non-limiting examples of expression fold of biomarkers in a monocyte 1 subtype as compared to a monocyte 2 subtype.
Expression and RNA Sequencing Methods
[0064] Any suitable method can be utilized to assess (directly or indirectly) the level of expression of a biomarker in a sample. Non-limiting examples of such methods include analyzing the sample using nucleic acid hybridization methods, nucleic acid reverse transcription methods, nucleic acid amplification methods, array analysis, and combinations thereof. In some embodiments, the level of expression of a biomarker in a sample is determined by detecting a transcribed polynucleotide, or portion thereof, e.g., mRNA, or cDNA, of the biomarker gene. RNA may be extracted from cells using RNA extraction techniques including, for example, using acid phenol/guanidine isothiocyanate extraction (RNAzol B; Biogenesis), RNeasy RNA preparation kits (Qiagen) or PAXgene (PreAnalytix, Switzerland). Typical assay formats utilizing ribonucleic acid hybridization include nuclear run-on assays, RT-PCR, quantitative PCR analysis, RNase protection assays, Northern blotting and in situ hybridization. Other suitable systems for RNA sample analysis include microarray analysis (e.g., using Affymetrix's microarray system or Illumina's BeadArray Technology).
[0065] Isolated RNA can be used in hybridization or amplification assays that include, but are not limited to, Southern or Northern analyses, polymerase chain reaction (PCR) analyses and probe arrays. An exemplary method for the determination of RNA levels involves contacting RNA with a nucleic acid molecule (e.g., probe) that can hybridize to the biomarker mRNA. The nucleic acid molecule can be, for example, a full-length cDNA, or a portion thereof, such as an oligonucleotide of at least about 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, or 50 nucleotides in length and sufficient to specifically hybridize under standard hybridization conditions to the biomarker genomic DNA. In some embodiments, the RNA is immobilized on a solid surface and contacted with a probe, for example by running the isolated RNA on an agarose gel and transferring the RNA from the gel to a membrane, such as nitrocellulose. In some embodiments, the probe(s) are immobilized on a solid surface, for example, in an Affymetrix gene chip array, and the probe(s) are contacted with RNA.
[0066] The level of expression of the biomarker in a sample can also be determined using methods that involve the use of nucleic acid amplification and/or reverse transcriptase, e.g., by RT-PCR, ligase chain reaction, self-sustained sequence replication, transcriptional amplification system, Q-Beta Replicase, rolling circle replication or any other nucleic acid amplification method, followed by the detection of the amplified molecules. These approaches may be useful for the detection of nucleic acid molecules if such molecules are present in very low numbers. In some embodiments, the level of expression of the biomarker is determined by quantitative fluorogenic RT-PCR (e.g., the TaqMan™ System). Such methods may utilize pairs of oligonucleotide primers that are specific for the biomarker.
[0067] In some embodiments, biomarker expression is determined by sequencing genetic material from the subject. Sequencing can be performed with any appropriate sequencing technology, including but not limited to single-molecule real-time (SMRT) sequencing, Polony sequencing, sequencing by ligation, reversible terminator sequencing, proton detection sequencing, ion semiconductor sequencing, nanopore sequencing, electronic sequencing, pyrosequencing, Maxam-Gilbert sequencing, chain termination (e.g., Sanger) sequencing, +S sequencing, or sequencing by synthesis. Sequencing methods also include next-generation sequencing, e.g., modern sequencing technologies such as Illumina sequencing (e.g., Solexa), Roche 454 sequencing, Ion torrent sequencing, and SOLiD sequencing. In some cases, next-generation sequencing involves high-throughput sequencing methods. Additional sequencing methods available to one of skill in the art may also be employed.
[0068] The expression levels of biomarker RNA can be monitored using a membrane blot (such as used in hybridization analysis such as Northern, Southern, dot, and the like), microwells, sample tubes, gels, beads, fibers, or any solid support comprising bound nucleic acids. The determination of biomarker expression level may also comprise using nucleic acid probes in solution.
[0069] In some embodiments, microarrays are used to detect the level of expression of a biomarker. DNA microarrays provide one method for the simultaneous measurement of the expression levels of large numbers of genes. Each array consists of a reproducible pattern of capture probes attached to a solid support. Labeled nucleic acid is hybridized to complementary probes on the array and then detected, e.g., by laser scanning Hybridization intensities for each probe on the array are determined and converted to a quantitative value representing relative gene expression levels. High-density oligonucleotide arrays may be useful for determining the gene expression profile for a large number of RNA's in a sample.
[0070] Expression of a biomarker can also be assessed at the protein level, using a detection reagent that detects the protein product encoded by the mRNA of the biomarker, directly or indirectly. For example, if an antibody reagent is available that binds specifically to a biomarker protein product to be detected, then such an antibody reagent can be used to detect the expression of the biomarker in a sample from the subject, using techniques, such as immunohistochemistry, ELISA, FACS analysis, and the like.
[0071] Other methods for detecting the biomarker at the protein level include methods such as electrophoresis, capillary electrophoresis, high performance liquid chromatography (HPLC), thin layer chromatography (TLC), hyperdiffusion chromatography, and the like, or various immunological methods such as fluid or gel precipitation reactions, immunodiffusion (single or double), immunoelectrophoresis, radioimmunoassay (RIA), enzyme-linked immunosorbent assays (ELISAs), immunofluorescent assays, and Western blotting. In some embodiments, antibodies, or antibody fragments, are used in methods such as Western blots or immunofluorescence techniques to detect the expressed proteins. The antibody or protein can be immobilized on a solid support for Western blots and immunofluorescence techniques. Suitable solid phase supports or carriers include any support capable of binding an antigen or an antibody. Exemplary supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
[0072] In some instances, a method of detecting an expression profile in a subject comprises contacting nucleic acids from a sample of the subject with a nucleic acid polymer that hybridizes to a region of a biomarker nucleic acid sequence. Hybridization may occur at standard hybridization temperatures, e.g., between about 35° C. and about 65° C. in a standard PCR buffer. In some cases, the biomarker nucleic acid sequence is a sequence comprising at least about 30, 40, 50, 60, 70, 80, 90, or 100 nucleobases of a biomarker listed in Table 1A or Table 7A. The nucleic acid polymer can comprise an oligonucleotide of at least or about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 75, 100 or more nucleobases in length and sufficient to specifically hybridize to a biomarker of Table 1A or Table 7A. In some instances, the nucleic acid polymer comprises between about 10 and about 100 nucleobases, between about 10 and about 75 nucleobases, between about 10 and about 50 nucleobases, between about 15 and about 100 nucleobases, between about 15 and about 75 nucleobases, between about 15 and about 50 nucleobases, between about 20 and about 100 nucleobases, between about 20 and about 75 nucleobases, between about 20 and about 50 nucleobases, between about 25 and about 100 nucleobases, between about 25 and about 75 nucleobases, or between about 25 and about 50 nucleobases.
[0073] Provided herein is a nucleic acid polymer that specifically hybridizes to ADAMTS1. Provided herein is a nucleic acid polymer that specifically hybridizes to LCN2. Provided herein is a nucleic acid polymer that specifically hybridizes to ADAM28. Provided herein is a nucleic acid polymer that specifically hybridizes to TPSB2. Provided herein is a nucleic acid polymer that specifically hybridizes to PPIAP30. Provided herein is a nucleic acid polymer that specifically hybridizes to GFPT2. Provided herein is a nucleic acid polymer that specifically hybridizes to KIT. Provided herein is a nucleic acid polymer that specifically hybridizes to PLTP. Provided herein is a nucleic acid polymer that specifically hybridizes to MFSD2A. Provided herein is a nucleic acid polymer that specifically hybridizes to IL22. Provided herein is a nucleic acid polymer that specifically hybridizes to LMCD1. Provided herein is a nucleic acid polymer that specifically hybridizes to IL6. Provided herein is a nucleic acid polymer that specifically hybridizes to TBC1D9. Provided herein is a nucleic acid polymer that specifically hybridizes to CHAC1. Provided herein is a nucleic acid polymer that specifically hybridizes to SEPP1. Provided herein is a nucleic acid polymer that specifically hybridizes to SOD3. Provided herein is a nucleic acid polymer that specifically hybridizes to RAB13. Provided herein is a nucleic acid polymer that specifically hybridizes to LYZ. Provided herein is a nucleic acid polymer that specifically hybridizes to CPA3. Provided herein is a nucleic acid polymer that specifically hybridizes to SDS. Provided herein is a nucleic acid polymer that specifically hybridizes to DYRK3. Provided herein is a nucleic acid polymer that specifically hybridizes to DAB2. Provided herein is a nucleic acid polymer that specifically hybridizes to TBC1D8. Provided herein is a nucleic acid polymer that specifically hybridizes to CRYAB. Provided herein is a nucleic acid polymer that specifically hybridizes to TBC1D3. Provided herein is a nucleic acid polymer that specifically hybridizes to LRRC32. Provided herein is a nucleic acid polymer that specifically hybridizes to SERPING1. Provided herein is a nucleic acid polymer that specifically hybridizes to UBD. Provided herein is a nucleic acid polymer that specifically hybridizes to FABP1. Provided herein is a nucleic acid polymer that specifically hybridizes to SYK. Provided herein is a nucleic acid polymer that specifically hybridizes to ALDOB. Provided herein is a nucleic acid polymer that specifically hybridizes to SEMA6B. Provided herein is a nucleic acid polymer that specifically hybridizes to NANOGNB. Provided herein is a nucleic acid polymer that specifically hybridizes to DSE. Provided herein is a nucleic acid polymer that specifically hybridizes to FPR3. Provided herein is a nucleic acid polymer that specifically hybridizes to TNXB. Provided herein is a nucleic acid polymer that specifically hybridizes to OR4A5. Provided herein is a nucleic acid polymer that specifically hybridizes to DCN. Provided herein is a nucleic acid polymer that specifically hybridizes to CHST15. Provided herein is a nucleic acid polymer that specifically hybridizes to ADAMDEC1. Provided herein is a nucleic acid polymer that specifically hybridizes to HDC. Provided herein is a nucleic acid polymer that specifically hybridizes to RRAD. Provided herein is a nucleic acid polymer that specifically hybridizes to C1S. Provided herein is a nucleic acid polymer that specifically hybridizes to PLA2G2A. Provided herein is a nucleic acid polymer that specifically hybridizes to CYCSP52. Provided herein is a nucleic acid polymer that specifically hybridizes to C11orf96. Provided herein is a nucleic acid polymer that specifically hybridizes to SEPSECS-AS1. Provided herein is a nucleic acid polymer that specifically hybridizes to C1QC. Provided herein is a nucleic acid polymer that specifically hybridizes to SLC9B1. Provided herein is a nucleic acid polymer that specifically hybridizes to MLLT10P1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC102724034. Provided herein is a nucleic acid polymer that specifically hybridizes to SMOX. Provided herein is a nucleic acid polymer that specifically hybridizes to CKB. Provided herein is a nucleic acid polymer that specifically hybridizes to NCOR1P1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC646736. Provided herein is a nucleic acid polymer that specifically hybridizes to CLEC3B. Provided herein is a nucleic acid polymer that specifically hybridizes to SLCO4A1. Provided herein is a nucleic acid polymer that specifically hybridizes to APOC1P1. Provided herein is a nucleic acid polymer that specifically hybridizes to KGFLP2. Provided herein is a nucleic acid polymer that specifically hybridizes to ABI3BP. Provided herein is a nucleic acid polymer that specifically hybridizes to LINC01189. Provided herein is a nucleic acid polymer that specifically hybridizes to SEPT14. Provided herein is a nucleic acid polymer that specifically hybridizes to FSTL1. Provided herein is a nucleic acid polymer that specifically hybridizes to GEM. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM27A. Provided herein is a nucleic acid polymer that specifically hybridizes to PTENP1-AS. Provided herein is a nucleic acid polymer that specifically hybridizes to LIMS3L. Provided herein is a nucleic acid polymer that specifically hybridizes to ST13P4. Provided herein is a nucleic acid polymer that specifically hybridizes to C1QB. Provided herein is a nucleic acid polymer that specifically hybridizes to HNRNPA1P33. Provided herein is a nucleic acid polymer that specifically hybridizes to MIR663A. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC101927123. Provided herein is a nucleic acid polymer that specifically hybridizes to C2orf27A. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC645166. Provided herein is a nucleic acid polymer that specifically hybridizes to ZNF582-AS1. Provided herein is a nucleic acid polymer that specifically hybridizes to HSPA2. Provided herein is a nucleic acid polymer that specifically hybridizes to COL1A1. Provided herein is a nucleic acid polymer that specifically hybridizes to COL5A1. Provided herein is a nucleic acid polymer that specifically hybridizes to GOLGA6L5P. Provided herein is a nucleic acid polymer that specifically hybridizes to PGM5-AS1. Provided herein is a nucleic acid polymer that specifically hybridizes to CLDN10. Provided herein is a nucleic acid polymer that specifically hybridizes to UBE2Q2L. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC100129138. Provided herein is a nucleic acid polymer that specifically hybridizes to COL1A2. Provided herein is a nucleic acid polymer that specifically hybridizes to SPARCL1. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM222A. Provided herein is a nucleic acid polymer that specifically hybridizes to LINC00857. Provided herein is a nucleic acid polymer that specifically hybridizes to CLIC4. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM182B. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC642426. Provided herein is a nucleic acid polymer that specifically hybridizes to GYPE. Provided herein is a nucleic acid polymer that specifically hybridizes to C8orf4. Provided herein is a nucleic acid polymer that specifically hybridizes to RPSAP9. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM231A. Provided herein is a nucleic acid polymer that specifically hybridizes to LINC00700. Provided herein is a nucleic acid polymer that specifically hybridizes to ANKRD20A3. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM138D. Provided herein is a nucleic acid polymer that specifically hybridizes to KRT20. Provided herein is a nucleic acid polymer that specifically hybridizes to UBTFL1. Provided herein is a nucleic acid polymer that specifically hybridizes to GAS7. Provided herein is a nucleic acid polymer that specifically hybridizes to GPNMB. Provided herein is a nucleic acid polymer that specifically hybridizes to TCF4. Provided herein is a nucleic acid polymer that specifically hybridizes to LINC00348. Provided herein is a nucleic acid polymer that specifically hybridizes to SRC. Provided herein is a nucleic acid polymer that specifically hybridizes to HSPB6. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC100507006. Provided herein is a nucleic acid polymer that specifically hybridizes to TCF21. Provided herein is a nucleic acid polymer that specifically hybridizes to TMEM45B. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC101927905. Provided herein is a nucleic acid polymer that specifically hybridizes to CXCL13. Provided herein is a nucleic acid polymer that specifically hybridizes to AQP7P3. Provided herein is a nucleic acid polymer that specifically hybridizes to PMP22. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC101928163. Provided herein is a nucleic acid polymer that specifically hybridizes to REG3A. Provided herein is a nucleic acid polymer that specifically hybridizes to MMP19. Provided herein is a nucleic acid polymer that specifically hybridizes to PHLDB1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC100508046. Provided herein is a nucleic acid polymer that specifically hybridizes to SPINK4. Provided herein is a nucleic acid polymer that specifically hybridizes to HES4. Provided herein is a nucleic acid polymer that specifically hybridizes to TREM1. Provided herein is a nucleic acid polymer that specifically hybridizes to TNFRSF12A. Provided herein is a nucleic acid polymer that specifically hybridizes to PRKX-AS1. Provided herein is a nucleic acid polymer that specifically hybridizes to PLGLB1. Provided herein is a nucleic acid polymer that specifically hybridizes to SNAI1. Provided herein is a nucleic acid polymer that specifically hybridizes to NUCB1-AS1. Provided herein is a nucleic acid polymer that specifically hybridizes to BASP1. Provided herein is a nucleic acid polymer that specifically hybridizes to MGP. Provided herein is a nucleic acid polymer that specifically hybridizes to ANPEP. Provided herein is a nucleic acid polymer that specifically hybridizes to PHACTR1. Provided herein is a nucleic acid polymer that specifically hybridizes to ADM. Provided herein is a nucleic acid polymer that specifically hybridizes to DEFA6. Provided herein is a nucleic acid polymer that specifically hybridizes to VEGFA. Provided herein is a nucleic acid polymer that specifically hybridizes to EGR2. Provided herein is a nucleic acid polymer that specifically hybridizes to DEFA5. Provided herein is a nucleic acid polymer that specifically hybridizes to CXCL3. Provided herein is a nucleic acid polymer that specifically hybridizes to SDC4. Provided herein is a nucleic acid polymer that specifically hybridizes to TPSAB 1. Provided herein is a nucleic acid polymer that specifically hybridizes to CD68. Provided herein is a nucleic acid polymer that specifically hybridizes to EPAS1. Provided herein is a nucleic acid polymer that specifically hybridizes to MARCKS. Provided herein is a nucleic acid polymer that specifically hybridizes to TNFAIP2. Provided herein is a nucleic acid polymer that specifically hybridizes to MIR663B. Provided herein is a nucleic acid polymer that specifically hybridizes to TMEM114. Provided herein is a nucleic acid polymer that specifically hybridizes to SIRPA. Provided herein is a nucleic acid polymer that specifically hybridizes to GAS6. Provided herein is a nucleic acid polymer that specifically hybridizes to IGFBP7. Provided herein is a nucleic acid polymer that specifically hybridizes to ASB2. Provided herein is a nucleic acid polymer that specifically hybridizes to HES1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC284801. Provided herein is a nucleic acid polymer that specifically hybridizes to TNFRSF13B. Provided herein is a nucleic acid polymer that specifically hybridizes to MIR548I1. Provided herein is a nucleic acid polymer that specifically hybridizes to DERL3. Provided herein is a nucleic acid polymer that specifically hybridizes to SPARC. Provided herein is a nucleic acid polymer that specifically hybridizes to EMP1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC100240735. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC101927817. Provided herein is a nucleic acid polymer that specifically hybridizes to STAB 1. Provided herein is a nucleic acid polymer that specifically hybridizes to UPK3B. Provided herein is a nucleic acid polymer that specifically hybridizes to RAB20. Provided herein is a nucleic acid polymer that specifically hybridizes to MMP9. Provided herein is a nucleic acid polymer that specifically hybridizes to MT1G. Provided herein is a nucleic acid polymer that specifically hybridizes to POC1B-GALNT4. Provided herein is a nucleic acid polymer that specifically hybridizes to CSF2RB. Provided herein is a nucleic acid polymer that specifically hybridizes to IL1RN. Provided herein is a nucleic acid polymer that specifically hybridizes to PLEKHA4. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC644172. Provided herein is a nucleic acid polymer that specifically hybridizes to MAFF. Provided herein is a nucleic acid polymer that specifically hybridizes to FDCSP. Provided herein is a nucleic acid polymer that specifically hybridizes to DNASE1L3. Provided herein is a nucleic acid polymer that specifically hybridizes to PTGS2. Provided herein is a nucleic acid polymer that specifically hybridizes to TUBB6. Provided herein is a nucleic acid polymer that specifically hybridizes to LINC01194. Provided herein is a nucleic acid polymer that specifically hybridizes to CTAGE8. Provided herein is a nucleic acid polymer that specifically hybridizes to REG1A. Provided herein is a nucleic acid polymer that specifically hybridizes to ATP5J2-PTCD1. Provided herein is a nucleic acid polymer that specifically hybridizes to DOK3. Provided herein is a nucleic acid polymer that specifically hybridizes to EGR3. Provided herein is a nucleic acid polymer that specifically hybridizes to AOAH-IT1. Provided herein is a nucleic acid polymer that specifically hybridizes to RNASE1. Provided herein is a nucleic acid polymer that specifically hybridizes to CCL11. Provided herein is a nucleic acid polymer that specifically hybridizes to OR4F21. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM157B. Provided herein is a nucleic acid polymer that specifically hybridizes to GATA2. Provided herein is a nucleic acid polymer that specifically hybridizes to CTGF. Provided herein is a nucleic acid polymer that specifically hybridizes to CXCL1. Provided herein is a nucleic acid polymer that specifically hybridizes to GPX3. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM138A. Provided herein is a nucleic acid polymer that specifically hybridizes to FAM138F. Provided herein is a nucleic acid polymer that specifically hybridizes to FOSL1. Provided herein is a nucleic acid polymer that specifically hybridizes to FSCN1. Provided herein is a nucleic acid polymer that specifically hybridizes to FTH1P3. Provided herein is a nucleic acid polymer that specifically hybridizes to SPHK1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC441242. Provided herein is a nucleic acid polymer that specifically hybridizes to UGT2B10. Provided herein is a nucleic acid polymer that specifically hybridizes to MCTP1. Provided herein is a nucleic acid polymer that specifically hybridizes to IL21R-AS1. Provided herein is a nucleic acid polymer that specifically hybridizes to LOC285740. Provided herein is a nucleic acid polymer that specifically hybridizes to HLA-L. Provided herein is a nucleic acid polymer that specifically hybridizes to NPIPB9. Provided herein is a nucleic acid polymer that specifically hybridizes to SEPT10.
[0074] Nucleic acid polymers include primers useful for amplifying a nucleic acid of biomarker provided in Table 1A or Table 5. For example, for use in an amplification assay such as qPCR. Nucleic acid polymers also include probes comprising a detectable label for detecting and/or quantifying a biomarker of Table 1A or Table 5. In some cases the probes are reporters that comprise a dye label on one end and a quencher on the other end. When the probes are hybridized to a biomarker nucleic acid, an added DNA polymerase may cleave those hybridized probes, separating the reporter dye from the quencher, and thus increasing fluorescence by the reporter. In some cases, provided is a probe comprising a nucleic acid polymer described herein.
[0075] Examples of molecules that are utilized as probes include, but are not limited to, RNA and DNA. In some embodiments, the term “probe” with regards to nucleic acids, refers to any molecule that is capable of selectively binding to a specifically intended target nucleic acid sequence. In some instances, probes are specifically designed to be labeled, for example, with a radioactive label, a fluorescent label, an enzyme, a chemiluminescent tag, a colorimetric tag, or other labels or tags. In some instances, the fluorescent label comprises a fluorophore. In some instances, the fluorophore is an aromatic or heteroaromatic compound. In some instances, the fluorophore is a pyrene, anthracene, naphthalene, acridine, stilbene, benzoxaazole, indole, benzindole, oxazole, thiazole, benzothiazole, canine, carbocyanine, salicylate, anthranilate, xanthenes dye, coumarin. Exemplary xanthene dyes include, e.g., fluorescein and rhodamine dyes. Fluorescein and rhodamine dyes include, but are not limited to 6-carboxyfluorescein (FAM), 2′7′-dimethoxy-4′5′-dichloro-6-carboxyfluorescein (JOE), tetrachlorofluorescein (TET), 6-carboxyrhodamine (R6G), N,N,N; N′-tetramethyl-6-carboxyrhodamine (TAMRA), 6-carboxy-X-rhodamine (ROX). Suitable fluorescent probes also include the naphthylamine dyes that have an amino group in the alpha or beta position. For example, naphthylamino compounds include 1-dimethylaminonaphthyl-5-sulfonate, 1-anilino-8-naphthalene sulfonate and 2-p-toluidinyl-6-naphthalene sulfonate, 5-(2′-aminoethyl)aminonaphthalene-1-sulfonic acid (EDANS). Exemplary coumarins include, e.g., 3-phenyl-7-isocyanatocoumarin; acridines, such as 9-isothiocyanatoacridine and acridine orange; N-(p-(2-benzoxazolyl)phenyl) maleimide; cyanines, such as, e.g., indodicarbocyanine 3 (Cy3), indodicarbocyanine 5 (Cy5), indodicarbocyanine 5.5 (Cy5.5), 34-carboxy-pentyl)-3′-ethyl-5,5′-dimethyloxacarbocyanine (CyA); 1H, 5H, 11H, 15H-Xantheno[2,3, 4-ij: 5,6, 7-i′j′]diquinolizin-18-ium, 9-[2 (or 4)-[[[6-[2,5-dioxo-1-pyrrolidinyl)oxy]-6-oxohexyl]amino]sulfonyl]-4 (or 2)-sulfophenyl]-2,3, 6,7, 12,13, 16,17-octahydro-inner salt (TR or Texas Red); or BODIPY™ dyes. In some cases, the probe comprises FAM as the dye label.
[0076] In some instances, primers and/or probes described herein for hybridization to a biomarker of Table 1A or Table 7A are used in an amplification reaction. In some instances, the amplification reaction is qPCR. An exemplary qPCR is a method employing a TaqMan™ assay.
[0077] In some instances, qPCR comprises using an intercalating dye. Examples of intercalating dyes include SYBR green I, SYBR green II, SYBR gold, ethidium bromide, methylene blue, Pyronin Y, DAPI, acridine orange, Blue View or phycoerythrin. In some instances, the intercalating dye is SYBR.
[0078] In one aspect, the methods provided herein for determining an expression profile in a subject comprise an amplification reaction such as qPCR. In an exemplary method, genetic material is obtained from a sample of a subject, e.g., a sample of blood or serum. In certain embodiments where nucleic acids are extracted, the nucleic acids are extracted using any technique that does not interfere with subsequent analysis. In certain embodiments, this technique uses alcohol precipitation using ethanol, methanol or isopropyl alcohol. In certain embodiments, this technique uses phenol, chloroform, or any combination thereof. In certain embodiments, this technique uses cesium chloride. In certain embodiments, this technique uses sodium, potassium or ammonium acetate or any other salt commonly used to precipitate DNA. In certain embodiments, this technique utilizes a column or resin based nucleic acid purification scheme such as those commonly sold commercially, one non-limiting example would be the GenElute Bacterial Genomic DNA Kit available from Sigma Aldrich. In certain embodiments, after extraction the nucleic acid is stored in water, Tris buffer, or Tris-EDTA buffer before subsequent analysis. In an exemplary embodiment, the nucleic acid material is extracted in water. In some cases, extraction does not comprise nucleic acid purification.
[0079] In an exemplary qPCR assay, the nucleic acid sample is combined with primers and probes specific for a biomarker nucleic acid that may or may not be present in the sample, and a DNA polymerase. An amplification reaction is performed with a thermal cycler that heats and cools the sample for nucleic acid amplification, and illuminates the sample at a specific wavelength to excite a fluorophore on the probe and detect the emitted fluorescence. For TaqMan™ methods, the probe may be a hydrolysable probe comprising a fluorophore and quencher that is hydrolyzed by DNA polymerase when hybridized to a biomarker nucleic acid.
Profile Analysis
[0080] The expression profile of a patient sample (test sample) may be compared to a reference sample, e.g., a sample from a subject who does not have IBD such as CD (normal sample), or a sample from a subject who has a non-CD-PBmu subtype. In some cases, a normal sample is that which is or is expected to be free of IBD disease or condition, or a sample that would test negative for any IBD disease or condition. The reference sample may be assayed at the same time, or at a different time from the test sample. In some cases, the expression profile of a reference sample is obtained and stored in a database for comparison to the test sample.
[0081] The results of an assay on the test sample may be compared to the results of the same assay on a reference sample. In some cases the results of the assay on the normal sample are from a database. In some cases, the results of the assay on the normal sample are a known or generally accepted value by those skilled in the art. In some cases the comparison is qualitative. In other cases the comparison is quantitative. In some cases, qualitative or quantitative comparisons may involve but are not limited to one or more of the following: comparing fluorescence values, spot intensities, absorbance values, chemiluminescent signals, histograms, critical threshold values, statistical significance values, gene product expression levels, gene product expression level changes, alternative exon usage, changes in alternative exon usage, protein levels, DNA polymorphisms, coy number variations, indications of the presence or absence of one or more DNA markers or regions, and/or nucleic acid sequences.
[0082] In some embodiments, the gene expression profile of a test sample is evaluated using methods for correlating gene product expression levels with a specific phenotype of CD, such as the CD-PBmu subtype described herein. In some cases, a specified statistical confidence level may be determined in order to provide a diagnostic confidence level. For example, it may be determined that a confidence level of greater than 90% may be a useful predictor of CD-PBmu. In other embodiments, more or less stringent confidence levels may be chosen. For example, a confidence level of approximately 70%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, 99.5%, or 99.9% may be chosen as a useful phenotypic predictor. The confidence level provided may in some cases be related to the quality of the sample, the quality of the data, the quality of the analysis, the specific methods used, and the number of gene expression products analyzed. The specified confidence level for providing a diagnosis may be chosen on the basis of the expected number of false positives or false negatives and/or cost. Methods for choosing parameters for achieving a specified confidence level or for identifying markers with diagnostic power include but are not limited to Receiver Operator Curve analysis (ROC), binormal ROC, principal component analysis, partial least squares analysis, singular value decomposition, least absolute shrinkage and selection operator analysis, least angle regression, and the threshold gradient directed regularization method.
[0083] Raw gene expression level data may in some cases be improved through the application of algorithms designed to normalize and or improve the reliability of the data. In some embodiments of the present invention the data analysis requires a computer or other device, machine or apparatus for application of the various algorithms described herein due to the large number of individual data points that are processed. A “machine learning algorithm” refers to a computational-based prediction methodology, also known as a “classifier”, employed for characterizing a gene expression profile. The signals corresponding to certain expression levels, which are obtained by, e.g., microarray-based hybridization assays or sequencing, are typically subjected to the algorithm in order to classify the expression profile. Supervised learning generally involves “training” a classifier to recognize the distinctions among classes and then “testing” the accuracy of the classifier on an independent test set. For test samples the classifier can be used to predict the class in which the samples belong.
[0084] In some cases, the robust multi-array Average (RMA) method may be used to normalize the raw data. The RMA method begins by computing background-corrected intensities for each matched cell on a number of microarrays. The background corrected values are restricted to positive values as described by Irizarry et al. Biostatistics 2003 Apr. 4 (2): 249-64. The back-ground corrected, log-transformed, matched intensity on each microarray is then normalized using the quantile normalization method in which for each input array and each probe expression value, the array percentile probe value is replaced with the average of all array percentile points, this method is more completely described by Bolstad et al. Bioinformatics 2003. Following quantile normalization, the normalized data may then be fit to a linear model to obtain an expression measure for each probe on each microarray. Tukey's median polish algorithm (Tukey, J. W., Exploratory Data Analysis. 1977) may then be used to determine the log-scale expression level for the normalized probe set data.
[0085] Data may further be filtered to remove data that may be considered suspect. In some embodiments, data deriving from microarray probes that have fewer than about 4, 5, 6, 7 or 8 guanosine+cytosine nucleotides may be considered to be unreliable due to their aberrant hybridization propensity or secondary structure issues. Similarly, data deriving from microarray probes that have more than about 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, or 22 guanosine+cytosine nucleotides may be considered unreliable due to their aberrant hybridization propensity or secondary structure issues.
[0086] In some cases, unreliable probe sets may be selected for exclusion from data analysis by ranking probe-set reliability against a series of reference datasets. For example, RefSeq or Ensembl (EMBL) are considered very high quality reference datasets. Data from probe sets matching RefSeq or Ensembl sequences may in some cases be specifically included in microarray analysis experiments due to their expected high reliability. Similarly data from probe-sets matching less reliable reference datasets may be excluded from further analysis, or considered on a case by case basis for inclusion. In some cases, the Ensembl high throughput cDNA (HTC) and/or mRNA reference datasets may be used to determine the probe-set reliability separately or together. In other cases, probe-set reliability may be ranked. For example, probes and/or probe-sets that match perfectly to all reference datasets such as for example RefSeq, HTC, and mRNA, may be ranked as most reliable (1). Furthermore, probes and/or probe-sets that match two out of three reference datasets may be ranked as next most reliable (2), probes and/or probe-sets that match one out of three reference datasets may be ranked next (3) and probes and/or probe sets that match no reference datasets may be ranked last (4). Probes and or probe-sets may then be included or excluded from analysis based on their ranking. For example, one may choose to include data from category 1, 2, 3, and 4 probe-sets; category 1, 2, and 3 probe-sets; category 1 and 2 probe-sets; or category 1 probe-sets for further analysis. In another example, probe-sets may be ranked by the number of base pair mismatches to reference dataset entries. It is understood that there are many methods understood in the art for assessing the reliability of a given probe and/or probe-set for molecular profiling and the methods of the present invention encompass any of these methods and combinations thereof.
[0087] The results of the expression profile may be analyzed to classify a subject as having or lacking an IBD disease or condition, such as a CD-PBmu subtype. In some cases, a diagnostic result may indicate a certain molecular pathway involved in the IBD disease or condition, or a certain grade or stage of a particular IBD disease or condition. In some cases, a diagnostic result may inform an appropriate therapeutic intervention, such as a specific drug regimen like a molecule that targets a biomolecule in a pathway of any biomarker in Table 1A or 3, or a surgical intervention. In some cases, a diagnostic result indicates suitability or non-suitability of a patient for treatment with anti-TNFα.
[0088] In some embodiments, results are classified using a trained algorithm. Trained algorithms include algorithms that have been developed using a reference set of samples with a known IBD phenotype, such as PBT and CD-PBmu. Algorithms suitable for categorization of samples include but are not limited to k-nearest neighbor algorithms, concept vector algorithms, naive bayesian algorithms, neural network algorithms, hidden markov model algorithms, genetic algorithms, and mutual information feature selection algorithms or any combination thereof. In some cases, trained algorithms may incorporate data other than gene expression such as DNA polymorphism data, sequencing data, scoring or diagnosis by cytologists or pathologists, information provided by the pre-classifier algorithm, or information about the medical history of the subject.
Compositions and Methods of Treatment
[0089] Provided herein are compositions and methods of treating an individual having an inflammatory disease or condition. Non-limiting examples of inflammatory diseases include diseases of the gastrointestinal tract, liver, and/or gallbladder, including Crohn's disease (CD) and ulcerative colitis, systemic lupus erythematosus (SLE), and rheumatoid arthritis. Compositions include any therapeutic agent that modulates expression and/or activity of a biomolecule in a pathway of one or more markers in Table 4. In some embodiments, the therapeutic agent is am odulator of Adenylate cyclase type 7 (ADCY7), G protein-coupled receptor 65 (GPR65), intercellular adhesion molecule 3 (ICAM3), interferon gamma (IFNGMitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4), E2 receptor EP4 subtype (PTGER4), Receptor-interacting serine/threonine-protein kinase 2 (RIPK2), Ribonuclease T2 (RNASET2), or Tumor necrosis factor ligand superfamily member 15 (TNFSF15). In some implementations, the therapeutic agent is administered to a patient determined to have a CD-PBmu subtype as determined by a method provided herein.
[0090] In certain embodiments, described herein are methods for evaluating an effect of a treatment described herein. In some instances, the treatment comprises administration with a therapeutic agent provided herein, and optionally one or more additional therapeutic agents. In some instances, the treatment is monitored by evaluating the gene expression profile of a subject for expression of one or more genes in Table 1A or Table 7A. The gene expression profile may be determined prior to and/or after administration of a therapeutic agent. Gene expression profiling may also be used to ascertain the potential efficacy of a specific therapeutic intervention prior to administering to a subject.
[0091] In some embodiments, a therapeutic agent modulates expression and/or activity of ADAMTS1. In some embodiments, a therapeutic agent modulates expression and/or activity of LCN2. In some embodiments, a therapeutic agent modulates expression and/or activity of ADAM28. In some embodiments, a therapeutic agent modulates expression and/or activity of TPSB2. In some embodiments, a therapeutic agent modulates expression and/or activity of PPIAP30. In some embodiments, a therapeutic agent modulates expression and/or activity of GFPT2. In some embodiments, a therapeutic agent modulates expression and/or activity of KIT. In some embodiments, a therapeutic agent modulates expression and/or activity of PLTP. In some embodiments, a therapeutic agent modulates expression and/or activity of MFSD2A. In some embodiments, a therapeutic agent modulates expression and/or activity of IL22. In some embodiments, a therapeutic agent modulates expression and/or activity of LMCD1. In some embodiments, a therapeutic agent modulates expression and/or activity of IL6. In some embodiments, a therapeutic agent modulates expression and/or activity of TBC1D9. In some embodiments, a therapeutic agent modulates expression and/or activity of CHAC1. In some embodiments, a therapeutic agent modulates expression and/or activity of SEPP1. In some embodiments, a therapeutic agent modulates expression and/or activity of SOD3. In some embodiments, a therapeutic agent modulates expression and/or activity of RAB13. In some embodiments, a therapeutic agent modulates expression and/or activity of LYZ. In some embodiments, a therapeutic agent modulates expression and/or activity of CPA3. In some embodiments, a therapeutic agent modulates expression and/or activity of SDS. In some embodiments, a therapeutic agent modulates expression and/or activity of DYRK3. In some embodiments, a therapeutic agent modulates expression and/or activity of DAB2. In some embodiments, a therapeutic agent modulates expression and/or activity of TBC1D8. In some embodiments, a therapeutic agent modulates expression and/or activity of CRYAB. In some embodiments, a therapeutic agent modulates expression and/or activity of TBC1D3. In some embodiments, a therapeutic agent modulates expression and/or activity of LRRC32. In some embodiments, a therapeutic agent modulates expression and/or activity of SERPING1. In some embodiments, a therapeutic agent modulates expression and/or activity of UBD. In some embodiments, a therapeutic agent modulates expression and/or activity of FABP1. In some embodiments, a therapeutic agent modulates expression and/or activity of SYK. In some embodiments, a therapeutic agent modulates expression and/or activity of ALDOB. In some embodiments, a therapeutic agent modulates expression and/or activity of SEMA6B. In some embodiments, a therapeutic agent modulates expression and/or activity of NANOGNB. In some embodiments, a therapeutic agent modulates expression and/or activity of DSE. In some embodiments, a therapeutic agent modulates expression and/or activity of FPR3. In some embodiments, a therapeutic agent modulates expression and/or activity of TNXB. In some embodiments, a therapeutic agent modulates expression and/or activity of OR4A5. In some embodiments, a therapeutic agent modulates expression and/or activity of DCN. In some embodiments, a therapeutic agent modulates expression and/or activity of CHST15. In some embodiments, a therapeutic agent modulates expression and/or activity of ADAMDEC1. In some embodiments, a therapeutic agent modulates expression and/or activity of HDC. In some embodiments, a therapeutic agent modulates expression and/or activity of RRAD. In some embodiments, a therapeutic agent modulates expression and/or activity of C1S. In some embodiments, a therapeutic agent modulates expression and/or activity of PLA2G2A. In some embodiments, a therapeutic agent modulates expression and/or activity of CYCSP52. In some embodiments, a therapeutic agent modulates expression and/or activity of C11orf96. In some embodiments, a therapeutic agent modulates expression and/or activity of SEPSECS-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of C1QC. In some embodiments, a therapeutic agent modulates expression and/or activity of SLC9B1. In some embodiments, a therapeutic agent modulates expression and/or activity of MLLT10P1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC102724034. In some embodiments, a therapeutic agent modulates expression and/or activity of SMOX. In some embodiments, a therapeutic agent modulates expression and/or activity of CKB. In some embodiments, a therapeutic agent modulates expression and/or activity of NCOR1P1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC646736. In some embodiments, a therapeutic agent modulates expression and/or activity of CLEC3B. In some embodiments, a therapeutic agent modulates expression and/or activity of SLCO4A1. In some embodiments, a therapeutic agent modulates expression and/or activity of APOC1P1. In some embodiments, a therapeutic agent modulates expression and/or activity of KGFLP2. In some embodiments, a therapeutic agent modulates expression and/or activity of ABI3BP. In some embodiments, a therapeutic agent modulates expression and/or activity of LINC01189. In some embodiments, a therapeutic agent modulates expression and/or activity of SEPT14. In some embodiments, a therapeutic agent modulates expression and/or activity of FSTL1. In some embodiments, a therapeutic agent modulates expression and/or activity of GEM. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM27A. In some embodiments, a therapeutic agent modulates expression and/or activity of PTENP1-AS. In some embodiments, a therapeutic agent modulates expression and/or activity of LIMS3L. In some embodiments, a therapeutic agent modulates expression and/or activity of ST13P4. In some embodiments, a therapeutic agent modulates expression and/or activity of C1QB. In some embodiments, a therapeutic agent modulates expression and/or activity of HNRNPA1P33. In some embodiments, a therapeutic agent modulates expression and/or activity of MIR663A. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC101927123. In some embodiments, a therapeutic agent modulates expression and/or activity of C2orf27A. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC645166. In some embodiments, a therapeutic agent modulates expression and/or activity of ZNF582-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of HSPA2. In some embodiments, a therapeutic agent modulates expression and/or activity of COL1A1. In some embodiments, a therapeutic agent modulates expression and/or activity of COL5A1. In some embodiments, a therapeutic agent modulates expression and/or activity of GOLGA6L5P. In some embodiments, a therapeutic agent modulates expression and/or activity of PGM5-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of CLDN10. In some embodiments, a therapeutic agent modulates expression and/or activity of UBE2Q2L. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC100129138. In some embodiments, a therapeutic agent modulates expression and/or activity of COL1A2. In some embodiments, a therapeutic agent modulates expression and/or activity of SPARCL1. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM222A. In some embodiments, a therapeutic agent modulates expression and/or activity of LINC00857. In some embodiments, a therapeutic agent modulates expression and/or activity of CLIC4. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM182B. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC642426. In some embodiments, a therapeutic agent modulates expression and/or activity of GYPE. In some embodiments, a therapeutic agent modulates expression and/or activity of C8orf4. In some embodiments, a therapeutic agent modulates expression and/or activity of RPSAP9. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM231A. In some embodiments, a therapeutic agent modulates expression and/or activity of LINC00700. In some embodiments, a therapeutic agent modulates expression and/or activity of ANKRD20A3. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM138D. In some embodiments, a therapeutic agent modulates expression and/or activity of KRT20. In some embodiments, a therapeutic agent modulates expression and/or activity of UBTFL1. In some embodiments, a therapeutic agent modulates expression and/or activity of GAS7. In some embodiments, a therapeutic agent modulates expression and/or activity of GPNMB. In some embodiments, a therapeutic agent modulates expression and/or activity of TCF4. In some embodiments, a therapeutic agent modulates expression and/or activity of LINC00348. In some embodiments, a therapeutic agent modulates expression and/or activity of SRC. In some embodiments, a therapeutic agent modulates expression and/or activity of HSPB6. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC100507006. In some embodiments, a therapeutic agent modulates expression and/or activity of TCF21. In some embodiments, a therapeutic agent modulates expression and/or activity of TMEM45B. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC101927905. In some embodiments, a therapeutic agent modulates expression and/or activity of CXCL13. In some embodiments, a therapeutic agent modulates expression and/or activity of AQP7P3. In some embodiments, a therapeutic agent modulates expression and/or activity of PMP22. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC101928163. In some embodiments, a therapeutic agent modulates expression and/or activity of REG3A. In some embodiments, a therapeutic agent modulates expression and/or activity of MMP19. In some embodiments, a therapeutic agent modulates expression and/or activity of PHLDB1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC100508046. In some embodiments, a therapeutic agent modulates expression and/or activity of SPINK4. In some embodiments, a therapeutic agent modulates expression and/or activity of HES4. In some embodiments, a therapeutic agent modulates expression and/or activity of TREM1. In some embodiments, a therapeutic agent modulates expression and/or activity of TNFRSF12A. In some embodiments, a therapeutic agent modulates expression and/or activity of PRKX-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of PLGLB1. In some embodiments, a therapeutic agent modulates expression and/or activity of SNAI1. In some embodiments, a therapeutic agent modulates expression and/or activity of NUCB1-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of BASP1. In some embodiments, a therapeutic agent modulates expression and/or activity of MGP. In some embodiments, a therapeutic agent modulates expression and/or activity of ANPEP. In some embodiments, a therapeutic agent modulates expression and/or activity of PHACTR1. In some embodiments, a therapeutic agent modulates expression and/or activity of ADM. In some embodiments, a therapeutic agent modulates expression and/or activity of DEFA6. In some embodiments, a therapeutic agent modulates expression and/or activity of VEGFA. In some embodiments, a therapeutic agent modulates expression and/or activity of EGR2. In some embodiments, a therapeutic agent modulates expression and/or activity of DEFA5. In some embodiments, a therapeutic agent modulates expression and/or activity of CXCL3. In some embodiments, a therapeutic agent modulates expression and/or activity of SDC4. In some embodiments, a therapeutic agent modulates expression and/or activity of TPSAB 1. In some embodiments, a therapeutic agent modulates expression and/or activity of CD68. In some embodiments, a therapeutic agent modulates expression and/or activity of EPAS1. In some embodiments, a therapeutic agent modulates expression and/or activity of MARCKS. In some embodiments, a therapeutic agent modulates expression and/or activity of TNFAIP2. In some embodiments, a therapeutic agent modulates expression and/or activity of MIR663B. In some embodiments, a therapeutic agent modulates expression and/or activity of TMEM114. In some embodiments, a therapeutic agent modulates expression and/or activity of SIRPA. In some embodiments, a therapeutic agent modulates expression and/or activity of GAS6. In some embodiments, a therapeutic agent modulates expression and/or activity of IGFBP7. In some embodiments, a therapeutic agent modulates expression and/or activity of ASB2. In some embodiments, a therapeutic agent modulates expression and/or activity of HES1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC284801. In some embodiments, a therapeutic agent modulates expression and/or activity of TNFRSF13B. In some embodiments, a therapeutic agent modulates expression and/or activity of MIR548I1. In some embodiments, a therapeutic agent modulates expression and/or activity of DERL3. In some embodiments, a therapeutic agent modulates expression and/or activity of SPARC. In some embodiments, a therapeutic agent modulates expression and/or activity of EMP1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC100240735. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC101927817. In some embodiments, a therapeutic agent modulates expression and/or activity of STAB 1. In some embodiments, a therapeutic agent modulates expression and/or activity of UPK3B. In some embodiments, a therapeutic agent modulates expression and/or activity of RAB20. In some embodiments, a therapeutic agent modulates expression and/or activity of MMP9. In some embodiments, a therapeutic agent modulates expression and/or activity of MT1G. In some embodiments, a therapeutic agent modulates expression and/or activity of POC1B-GALNT4. In some embodiments, a therapeutic agent modulates expression and/or activity of CSF2RB. In some embodiments, a therapeutic agent modulates expression and/or activity of IL1RN. In some embodiments, a therapeutic agent modulates expression and/or activity of PLEKHA4. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC644172. In some embodiments, a therapeutic agent modulates expression and/or activity of MAFF. In some embodiments, a therapeutic agent modulates expression and/or activity of FDCSP. In some embodiments, a therapeutic agent modulates expression and/or activity of DNASE1L3. In some embodiments, a therapeutic agent modulates expression and/or activity of PTGS2. In some embodiments, a therapeutic agent modulates expression and/or activity of TUBB6. In some embodiments, a therapeutic agent modulates expression and/or activity of LINC01194. In some embodiments, a therapeutic agent modulates expression and/or activity of CTAGE8. In some embodiments, a therapeutic agent modulates expression and/or activity of REG1A. In some embodiments, a therapeutic agent modulates expression and/or activity of ATP5J2-PTCD1. In some embodiments, a therapeutic agent modulates expression and/or activity of DOK3. In some embodiments, a therapeutic agent modulates expression and/or activity of EGR3. In some embodiments, a therapeutic agent modulates expression and/or activity of AOAH-IT1. In some embodiments, a therapeutic agent modulates expression and/or activity of RNASE1. In some embodiments, a therapeutic agent modulates expression and/or activity of CCL11. In some embodiments, a therapeutic agent modulates expression and/or activity of OR4F21. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM157B. In some embodiments, a therapeutic agent modulates expression and/or activity of GATA2. In some embodiments, a therapeutic agent modulates expression and/or activity of CTGF. In some embodiments, a therapeutic agent modulates expression and/or activity of CXCL1. In some embodiments, a therapeutic agent modulates expression and/or activity of GPX3. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM138A. In some embodiments, a therapeutic agent modulates expression and/or activity of FAM138F. In some embodiments, a therapeutic agent modulates expression and/or activity of FOSL1. In some embodiments, a therapeutic agent modulates expression and/or activity of FSCN1. In some embodiments, a therapeutic agent modulates expression and/or activity of FTH1P3. In some embodiments, a therapeutic agent modulates expression and/or activity of SPHK1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC441242. In some embodiments, a therapeutic agent modulates expression and/or activity of UGT2B10. In some embodiments, a therapeutic agent modulates expression and/or activity of MCTP1. In some embodiments, a therapeutic agent modulates expression and/or activity of IL21R-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of LOC285740. In some embodiments, a therapeutic agent modulates expression and/or activity of HLA-L. In some embodiments, a therapeutic agent modulates expression and/or activity of NPIPB9. In some embodiments, a therapeutic agent modulates expression and/or activity of SEPT10. In some embodiments, a therapeutic agent modulates expression and/or activity of DNAPK. In some embodiments, a therapeutic agent modulates expression and/or activity of CDK4. In some embodiments, a therapeutic agent modulates expression and/or activity of ERK1. In some embodiments, a therapeutic agent modulates expression and/or activity of HIPK2. In some embodiments, a therapeutic agent modulates expression and/or activity of CDC2. In some embodiments, a therapeutic agent modulates expression and/or activity of MAPK1. In some embodiments, a therapeutic agent modulates expression and/or activity of MAPK3. In some embodiments, a therapeutic agent modulates expression and/or activity of ERK2. In some embodiments, a therapeutic agent modulates expression and/or activity of CSNK2A1. In some embodiments, a therapeutic agent modulates expression and/or activity of CK2ALPHA. In some embodiments, a therapeutic agent modulates expression and/or activity of JNK1. In some embodiments, a therapeutic agent modulates expression and/or activity of CDK1. In some embodiments, a therapeutic agent modulates expression and/or activity of MAPK14. In some embodiments, a therapeutic agent modulates expression and/or activity of PKR. In some embodiments, a therapeutic agent modulates expression and/or activity of CDK2.
[0092] In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ADAMTS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LCN2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ADAM28. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TPSB2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PPIAP30. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GFPT2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising KIT. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PLTP. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MFSD2A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising IL22. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LMCD1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising IL6. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TBC1D9. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CHAC1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SEPP1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SOD3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising RAB13. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LYZ. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CPA3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SDS. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DYRK3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DAB2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TBC1D8. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CRYAB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TBC1D3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LRRC32. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SERPING1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising UBD. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FABP1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SYK. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ALDOB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SEMA6B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising NANOGNB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DSE. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FPR3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TNXB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising OR4A5. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DCN. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CHST15. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ADAMDEC1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HDC. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising RRAD. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising C1S. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PLA2G2A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CYCSP52. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising C11orf96. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SEPSECS-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising C1QC. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SLC9B1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MLLT10P1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC102724034. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SMOX. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CKB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising NCOR1P1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC646736. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CLEC3B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SLCO4A1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising APOC1P1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising KGFLP2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ABI3BP. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LINC01189. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SEPT14. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FSTL1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GEM. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM27A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PTENP1-AS. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LIMS3L. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ST13P4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising C1QB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HNRNPA1P33. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MIR663A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC101927123. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising C2orf27A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC645166. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ZNF582-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HSPA2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising COL1A1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising COL5A1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GOLGA6L5P. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PGM5-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CLDN10. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising UBE2Q2L. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC100129138. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising COL1A2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SPARCL1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM222A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LINC00857. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CLIC4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM182B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC642426. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GYPE. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising C8orf4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising RPSAP9. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM231A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LINC00700. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ANKRD20A3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM138D. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising KRT20. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising UBTFL1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GAS7. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GPNMB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TCF4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LINC00348. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SRC. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HSPB6. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC100507006. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TCF21. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TMEM45B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC101927905. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CXCL13. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising AQP7P3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PMP22. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC101928163. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising REG3A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MMP19. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PHLDB1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC100508046. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SPINK4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HES4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TREM1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TNFRSF12A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PRKX-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PLGLB1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SNAI1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising NUCB1-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising BASP1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MGP. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ANPEP. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PHACTR1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ADM. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DEFA6. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising VEGFA. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising EGR2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DEFA5. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CXCL3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SDC4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TPSAB 1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CD68. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising EPAS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MARCKS. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TNFAIP2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MIR663B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TMEM114. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SIRPA. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GAS6. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising IGFBP7. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ASB2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HES1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC284801. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TNFRSF13B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MIR548I1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DERL3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SPARC. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising EMP1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC100240735. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC101927817. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising STAB 1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising UPK3B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising RAB20. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MMP9. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MT1G. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising POC1B-GALNT4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CSF2RB. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising IL1RN. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PLEKHA4. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC644172. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MAFF. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FDCSP. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DNASE1L3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising PTGS2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising TUBB6. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LINC01194. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CTAGE8. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising REG1A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising ATP5J2-PTCD1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising DOK3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising EGR3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising AOAH-IT1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising RNASE1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CCL11. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising OR4F21. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM157B. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GATA2. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CTGF. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising CXCL1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising GPX3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM138A. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FAM138F. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FOSL1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FSCN1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising FTH1P3. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SPHK1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC441242. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising UGT2B10. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising MCTP1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising IL21R-AS1. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising LOC285740. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising HLA-L. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising NPIPB9. In some embodiments, a therapeutic agent modulates expression and/or activity of a biomolecule in a pathway comprising SEPT10.
[0093] Adenylate Cyclase 7 (ADCY7) Modulators
[0094] Adenylate Cyclase 7 (ADCY7) (UniProtKB: P51828), and nucleic acids encoding ADCY7 (Entrez ID 113), is a membrane-bound adenylate cyclase that catalyzes the formation of adenosine monophosphate (cAMP) from adenosine triphosphate (ATP). ADCY7 functions in signaling cascades activated namely by thrombin and sphingosine 1-phosphate and mediates regulation of cAMP synthesis through synergistic action of the stimulatory G alpha protein with G Protein Subunit Alpha 13 (GNA13). Also, during inflammation, mediates zymosan-induced increase intracellular cAMP, leading to protein kinase A pathway activation in order to modulate innate immune responses through heterotrimeric GNA13/G Protein Subunit Alpha 12 (GNA12). ADCY7 also functions in signaling cascades activated namely by dopamine and C5 alpha chain and mediates regulation of cAMP synthesis through synergistic action of the stimulatory G protein with G beta:gamma complex. Through cAMP response regulation, ADCY7 keeps inflammation under control during bacterial infection by sensing the presence of serum factors, such as the bioactive lysophospholipid (LPA) that regulate LPS-induced TNF-alpha production.
[0095] Disclosed herein, in some embodiments, are therapeutic agents comprising modulators of Adenylate Cyclase 7 (ADCY7) useful for the treatment of a disease or condition, or symptom of the disease or condition, disclosed herein. In some embodiments, the therapeutic agent comprises a modulator, agonist, and/or antagonist of ADCY7. Disclosed herein, in some embodiments are methods of treating a disease or condition in a subject by administering a therapeutically effective amount of an agonist of ADCY7 to the subject, thereby increasing ADCY7 expression or activity. The agonist of ADCY7 expression or activity may be a direct agonist or indirect agonist. In some embodiments, the agonist of ADCY7 expression or activity comprises a complete agonist or a partial agonist. Non-limiting examples of an agonist of ADCY7 expression include RNA to protein ADCY7 translation agonists, antisense oligonucleotides targeting the ADCY7, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an agonist of ADCY7 activity include antagonists to the ADCY7 antigen, and antagonists to gene expression products involved in ADCY7 mediated disease. Agonists as disclosed herein, may include, but are not limited to, an ADCY7 antibody, an ADCY7-binding antibody fragment, recombinant polypeptide, or a small molecule. The small molecule may be a small molecule that binds to ADCY7 or binding partners to ADCY7. The ADCY7 antibody may be monoclonal or polyclonal. The ADCY7 antibody may be humanized or chimeric. The ADCY7 antibody may be a fusion protein. The ADCY7 antibody may be a blocking ADCY7 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the ADCY7 blocking antibody binds to a binding partner of ADCY7. In some cases, the ADCY7 antibody is an ADCY7 antibody that specifically binds to ADCY7. In some cases, the ADCY7 is naturally occurring. In some embodiments, the ADCY7 agonists comprise one or more small molecule compounds that are pan-activators of adenylyl cyclases (ACs). Non-limiting examples of ADCY7 agonists that are pan-activators of ACs include forskolin, colforsin daropate, and analogs thereof.
[0096] Disclosed herein, in some embodiments are methods of treating a disease or condition in a subject by administering a therapeutically effective amount of an antagonist of ADCY7 to the subject, thereby decreasing ADCY7 expression or activity. The antagonist of ADCY7 expression or activity may be a direct antagonist or indirect antagonist. In some embodiments, the antagonist of ADCY7 expression or activity comprises a complete antagonist or a partial antagonist. Non-limiting examples of an antagonist of ADCY7 expression include RNA to protein ADCY7 translation antagonists, antisense oligonucleotides targeting the ADCY7C, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an antagonist of ADCY7 activity include antagonists to the ADCY7 antigen, and antagonists to gene expression products involved in ADCY7 mediated disease. Antagonists as disclosed herein, may include, but are not limited to, an ADCY7 antibody, an ADCY7-binding antibody fragment, recombinant polypeptide, or a small molecule. The small molecule may be a small molecule that binds to ADCY7 or binding partners to ADCY7. The ADCY7 antibody may be monoclonal or polyclonal. The ADCY7 antibody may be humanized or chimeric. The ADCY7 antibody may be a fusion protein. The ADCY7 antibody may be a blocking ADCY7 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the ADCY7 blocking antibody binds to a binding partner of ADCY7. In some cases, the ADCY7 antibody is an ADCY7 antibody that specifically binds to ADCY7. In some cases, the ADCY7 is naturally occurring. In some embodiments, the ADCY7 antagonists comprise one or more small molecule compounds. In some embodiments, the small molecule comprises antagonist that are inverse agonists.
[0097] Disclosed herein, in some embodiments are methods of treating a disease or condition in a subject by administering a therapeutically effective amount of an allosteric modulator of ADCY7 activity or expression to the subject, thereby decreasing or increasing ADCY7 expression or activity. In some embodiments, the allosteric modulator of ADCY7 is a positive allosteric modulator (PAM) effective to enhance or potentiate a ligand of ADCY7. In some embodiments, the allosteric modulator of ADCY7 is a negative allosteric modulator (NAM) effective to reduce the effect of a primary ligand of ADCY7. In some embodiments, the allosteric modulator binds to a non-orthosteric binding site of ADCY7. In some embodiments, the modulator of ADCY7 affects a conformation of the orthosteric binding site of ADCY7 effective decrease or increase activity of ADCY7. In some embodiments, the modulator of ADCY7 is effective to increase or decrease a rate of catalysis of cyclic adenosine monophosphate (cAMP) from adenosine triphosphate (ATP) by ADCY7. In some embodiments, the modulator of ADCY7 is effective to reduce or enhance the inhibition of ADCY7 activity by calcium. Non-limiting examples of ligands that activate ADCY7 include G protein alpha subunit, G protein beta and gamma subunit complex, G Protein Subunit Alpha 13 (GNA13), G Protein Subunit Alpha 12 (GNA12), and ethanol. A non-limiting example of a ligand that inhibits ADCY7 includes lithium.
[0098] G Protein-Coupled Receptor 65 (GPR65) Modulators
[0099] G Protein-Coupled Receptor 65 (GPR65) (Entrez Gene: 8477) encodes Psychosine receptor (UniProtKB: Q81YL9) which is a receptor for the glycosphingolipid psychosine (PSY) and several related glycosphingolipids. GPR65 plays a role in immune response by maintaining lysosome function and supporting phagocytosis-mediated intracellular bacteria clearance.
[0100] In some embodiments, modulator of GPR65 is an agonist of GPR56 activity or expression. In some cases, the GPR65 agonist increases GPR65 expression or activity. The agonist of GPR65 expression or activity may be a direct agonist or indirect agonist. In some embodiments, the agonist of GPR65 expression or activity comprises a complete agonist or a partial agonist. Non-limiting examples of an agonist of GPR65 expression include RNA to protein GPR65 translation agonists, antisense oligonucleotides targeting the GPR65, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an agonist of GPR65 activity include antagonists to the GPR65 antigen, and antagonists to gene expression products involved in GPR65 mediated disease. Agonists as disclosed herein, may include, but are not limited to, a GPR65 antibody, a GPR65-binding antibody fragment, recombinant polypeptide, or a small molecule. The small molecule may be a small molecule that binds to GPR65 or binding partners to GPR65. The GPR65 antibody may be monoclonal or polyclonal. The GPR65 antibody may be humanized or chimeric. The GPR65 antibody may be a fusion protein. The GPR65 antibody may be a blocking GPR65 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the GPR65 blocking antibody binds to a binding partner of GPR65. In some cases, the GPR65 antibody is a GPR65 antibody that specifically binds to GPR65. In some cases, the GPR65 is naturally occurring. In some embodiments, the agonist of GPR65 comprises a polypeptide. In some instances, the polypeptide is recombinant. In some instances, the antagonist of GPR65 is an allosteric agonist. In some instances the agonist of GPR65 comprises BTB09089 (3-[(2,4-dichlorophenyl)methylsulfanyl]-1,6-dimethylpyridazino[4,5-e][1,3,4]thiadiazin-5-one).
[0101] In some embodiments, the GPR65 modulator is a antagonist of GPR65 activity or expression. The antagonist of GPR65 expression or activity may be a direct antagonist or indirect antagonist. In some embodiments, the antagonist of GPR65 expression or activity comprises a complete antagonist or a partial antagonist. Non-limiting examples of an antagonist of GPR65 expression include RNA to protein GPR65 translation antagonists, antisense oligonucleotides targeting the GPR65, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an antagonist of GPR65 activity include antagonists to the GPR65 antigen, and antagonists to gene expression products involved in GPR65 mediated disease. Antagonists as disclosed herein, may include, but are not limited to, a GPR65 antibody, a GPR65-binding antibody fragment, recombinant polypeptide, or a small molecule. The small molecule may be a small molecule that binds to GPR65 or binding partners to GPR65. The GPR65 antibody may be monoclonal or polyclonal. The GPR65 antibody may be humanized or chimeric. The GPR65 antibody may be a fusion protein. The GPR65 antibody may be a blocking GPR65 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the GPR65 blocking antibody binds to a binding partner of GPR65. In some cases, the GPR65 antibody is a GPR65 antibody that specifically binds to GPR65. In some cases the GPR65 is naturally occurring. In some embodiments, the GPR65 antagonists comprise one or more small molecule compounds. In some embodiments, the small molecule comprises antagonist that are inverse agonists. In some instances, the antagonist of GPR65 comprises a negative allosteric modulator (NAM). In some instances, the antagonist of GPR65 comprises ZINC62678696 ([(S)-phenyl(pyridin-4-yl)methyl]4-methyl-2-pyrimidin-2-yl-1,3-thiazole-5-carboxylate).
[0102] In some instances, the GPR56 modulator is an allosteric modulator acts as an antagonist, an agonist of GPR65. In some embodiments, the allosteric modulator of GPR65 is a positive allosteric modulator (PAM) effective to enhance or potentiate a ligand of GPR65. In some instances, the GPR65 PAM comprises BTB09089. In some embodiments, the allosteric modulator of GPR65 is a negative allosteric modulator (NAM) effective to reduce the effect of a primary ligand of GPR65. In some instances, the GPR65 NAM comprises ZINC62678696. In some embodiments, the allosteric modulator binds to a non-orthosteric binding site of GPR65. In some embodiments, the modulator of GPR65 affects a conformation of the orthosteric binding site of GPR65 effective decrease or increase activity of GPR65. In some embodiments, the modulator of GPR65 is effective to increase or decrease a pH sensing activity of GPR65.
[0103] In some embodiments, the antagonist or agonist of GPR65 comprises a GPR65 polypeptide. In some embodiments, the GPR65 polypeptide comprises a human GPR65 protein (huGPR65), or a homolog thereof. In some embodiments, the GPR65 polypeptide comprises a recombinant GPR65 polypeptide. In some embodiments, the recombinant human Psychosine receptor protein (encoded by the gene GPR65) comprises SEQ ID NO: 1)(MNSTCIEEQHDLDHYLFPIVYIFVIIVSIPANIGSLCVSFLQAKKESELGIYLFSLSLSDLLYALTLPL WIDYTWNKDNWTFSPALCKGSAFLMYMNFYSSTAFLTCIAVDRYLAVVYPLKFFFLRTRRFALM VSLSIWILETIFNAVMLWEDETVVEYCDAEKSNFTLCYDKYPLEKWQINLNLFRTCTGYAIPLVTI LICNRKVYQAVRHNKATENKEKKRIIKLLVSITVTFVLCFTPFHVMLLIRCILEHAVNFEDHSNSG KRTYTMYRITVALTSLNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDT MELEVLE), which is the amino acid sequence of human GPR65 (NCBI Reference Sequence No. NP_095256-1). In some embodiments, the huGPR65 comprises an amino acid sequence about 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, or 90% homologous to SEQ ID NO: 1.
[0104] In some instances, the GPR65 polypeptide is truncated. In some instances, the truncation is an N-terminal deletion. In other instances, the truncation is a C-terminal deletion. In additional instances, the truncation comprises both N-terminal and C-terminal deletions. For example, the truncation can be a deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or more residues from either the N-terminus or the C-terminus, or both termini. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or more residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 2 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 3 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 4 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 5 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 6 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 7 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 8 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 9 residues. In some cases, the GPR65 polypeptide comprises an N-terminal deletion of at least or about 10 residues.
[0105] In some embodiments, the GPR65 polypeptide has an enhanced plasma half-life. In some instances, the plasma half-life comprises at least 30 minutes, 45 minutes, 60 minutes, 75 minutes, or 90 minutes, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 18 hours, 24 hours, 36 hours, 48 hours, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 14 days, 21 days, 28 days, 30 days, or longer than the plasma half-life of the wild-type GPR65 protein.
[0106] In some embodiments, the GPR65 polypeptide is a conjugate. In some embodiments, the GPR65 conjugate comprises a GPR65 polypeptide comprising at least one amino acid and a conjugating moiety bound to the at least one 1 amino acid. In some embodiments, the at least one amino acid is located proximal to the N-terminus (e.g., proximal to the N-terminal residue). For example, the at least one amino acid is located optionally within the first 10, 20, 30, 40, or 50 residues from the N-terminus. In some cases, the at least one amino acid is located at the N-terminus (i.e., the at least one amino acid is the N-terminal residue of the GPR65 polypeptide). In other embodiments, the at least one amino acid is located proximal to the C-terminus (e.g., proximal to the C-terminal residue). For example, the at least one amino acid is located optionally within the first 10, 20, 30, 40, or 50 residues from the C-terminus. In some cases, the at least one amino acid is located at the C-terminus (i.e., the at least one amino acid is the C-terminal residue of the GPR65 polypeptide). In some instances, the GPR65 conjugate has an enhanced plasma half-life, such as the half-lives described herein. In some embodiments, the GPR65 conjugate is functionally active (e.g., retains activity). In some embodiments, the GPR65 conjugate is not functionally active (e.g., devoid of activity). In some embodiments, the conjugating moiety comprises a polymer comprising Polyethylene glycol (PEG).
[0107] In some embodiments, the GPR65 polypeptide is fused with a second polypeptide. In some embodiments, the second polypeptide comprises a polypeptide with a long plasma half-life relative to the plasma half-life of the GPR65 polypeptide. In some embodiments, the second polypeptide comprises an antibody or antibody fragment. In some embodiments, the antibody or antibody fragment comprises an IgG1, IgG2, IgG4, IgG3, or IgE. In some embodiments, the IgG is an Fc. In some embodiments, the IgG Fc is human. In some instances, the long plasma half-life polypeptide comprises HSA, transferrin, IgA monomer, Retinol-binding protein, Factor H, Factor XIII, C-reactive protein, Factor IX, Fibrinogen, IFN-alpha, Pentameric IgM, IL-2, or Thyroglobulin.
[0108] Intercellular Adhesion Molecule 3 (ICAM3)
[0109] Intercellular adhesion molecule 3 (ICAM3) (Entrez Gene: 3385) encodes an intercellular adhesion molecule family protein, which is a type I transmembrane glycoprotein that binds to the leukocyte adhesion LFA-1 protein and initiates the immune response.
[0110] Disclosed herein, in some embodiments, are therapeutic agents comprising modulators of ICAM3 useful for the treatment of a disease or condition, or symptom of the disease or condition, disclosed herein. In some embodiments, the therapeutic agents comprise a modulator of ICAM3. In some cases, the modulator of ICAM3 is an antagonist, partial antagonist, agonist, or partial agonist. In some cases, the ICAM3 is an allosteric modular of ICAM3.
[0111] In some embodiments, modulator of ICAM3 is an agonist of ICAM3 activity or expression. In some cases, the ICAM3 agonist increases ICAM3 expression or activity. The agonist of ICAM3 expression or activity may be a direct agonist or indirect agonist. In some embodiments, the agonist of ICAM3 expression or activity comprises a complete agonist or a partial agonist. Non-limiting examples of an agonist of ICAM3 expression include RNA to protein ICAM3 translation agonists, antisense oligonucleotides targeting the ICAM3, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an agonist of ICAM3 activity include antagonists to the ICAM3 antigen, and antagonists to gene expression products involved in ICAM3 mediated disease. Agonists as disclosed herein, may include, but are not limited to, a ICAM3 antibody, a ICAM3-binding antibody fragment, recombinant polypeptide, or a small molecule. The small molecule may be a small molecule that binds to ICAM3 or binding partners to ICAM3. The ICAM3 antibody may be monoclonal or polyclonal. The ICAM3 antibody may be humanized or chimeric. The ICAM3 antibody may be a fusion protein. The ICAM3 antibody may be a blocking ICAM3 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the ICAM3 blocking antibody binds to a binding partner of ICAM3. In some cases, the ICAM3 antibody is an ICAM3 antibody that specifically binds to ICAM3. In some cases, the ICAM3 is naturally occurring. In some embodiments, the agonist of ICAM3 comprises a polypeptide. In some instances, the polypeptide is recombinant.
[0112] In some embodiments, the ICAM3 modulator is an antagonist of ICAM3 activity or expression. The antagonist of ICAM3 expression or activity may be a direct antagonist or indirect antagonist. In some embodiments, the antagonist of ICAM3 expression or activity comprises a complete antagonist or a partial antagonist. Non-limiting examples of an antagonist of ICAM3 expression include RNA to protein ICAM3 translation antagonists, antisense oligonucleotides targeting the ICAM3, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an antagonist of ICAM3 activity include antagonists to the ICAM3 antigen, and antagonists to gene expression products involved in ICAM3 mediated disease. Antagonists as disclosed herein, may include, but are not limited to, an ICAM3 antibody, an ICAM3-binding antibody fragment, recombinant polypeptide, or a small molecule. The small molecule may be a small molecule that binds to ICAM3 or binding partners to ICAM3. The ICAM3 antibody may be monoclonal or polyclonal. The ICAM3 antibody may be humanized or chimeric. The ICAM3 antibody may be a fusion protein. The ICAM3 antibody may be a blocking ICAM3 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the ICAM3 blocking antibody binds to a binding partner of ICAM3. In some cases, the ICAM3 antibody is a ICAM3 antibody that specifically binds to ICAM3. In some cases, the ICAM3 is naturally occurring. In some embodiments, the ICAM3 antagonists comprise one or more small molecule compounds. In some embodiments, the small molecule comprises antagonist that are inverse agonists. In some instances, the antagonist of ICAM3 comprises a negative allosteric modulator (NAM).
[0113] In some instances, the GPR56 modulator is an allosteric modulator acts as an antagonist, an agonist of ICAM3. In some embodiments, the allosteric modulator of ICAM3 is a positive allosteric modulator (PAM) effective to enhance or potentiate a ligand of ICAM3. In some embodiments, the allosteric modulator of ICAM3 is a negative allosteric modulator (NAM) effective to reduce the effect of a primary ligand of ICAM3. In some embodiments, the allosteric modulator binds to a non-orthosteric binding site of ICAM3. In some embodiments, the modulator of ICAM3 affects a conformation of the orthosteric binding site of ICAM3 effective decrease or increase activity of ICAM3. In some embodiments, the modulator of ICAM3 is effective to increase or decrease a pH sensing activity of ICAM3.
[0114] In some embodiments, the antagonist or agonist of ICAM3 comprises a ICAM3 polypeptide. In some embodiments, the ICAM3 polypeptide comprises a human ICAM3 protein (huICAM3), or a homolog thereof. In some embodiments, the ICAM3 polypeptide comprises a recombinant ICAM3 polypeptide. In some embodiments, the recombinant Intercellular adhesion molecule 3 (encoded by the gene ICAM3) comprises SEQ ID NO: 2 (MGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQV EDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVN TSAPRQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNH GDTLTATATATARADQEGAREIVCNVTLGGERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVS CMAGARVQVTLDGVPAAAPGQPAQLQLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLY GPKIDRATCPQHLKWKDKTRHVLQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQC QASSSRGKYTLVVVMDIEAGSSHFVPVFVAVLLTLGVVTIVLALMYVFREHQRSGSYHVREEST YLPLTSMQPTEAMGEEPSRAE), which is the amino acid sequence of human ICAM3 (NCBI Reference Sequence No. NP_001307535.1). In some embodiments, the huICAM3 comprises an amino acid sequence about 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, or 90% homologous to SEQ ID NO: 2.
[0115] In some instances, the ICAM3 polypeptide is truncated. In some instances, the truncation is an N-terminal deletion. In other instances, the truncation is a C-terminal deletion. In additional instances, the truncation comprises both N-terminal and C-terminal deletions. For example, the truncation can be a deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or more residues from either the N-terminus or the C-terminus, or both termini. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or more residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 2 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 3 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 4 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 5 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 6 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 7 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 8 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 9 residues. In some cases, the ICAM3 polypeptide comprises an N-terminal deletion of at least or about 10 residues.
[0116] In some embodiments, the ICAM3 polypeptide has an enhanced plasma half-life. In some instances, the plasma half-life comprises at least 30 minutes, 45 minutes, 60 minutes, 75 minutes, or 90 minutes, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 18 hours, 24 hours, 36 hours, 48 hours, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 14 days, 21 days, 28 days, 30 days, or longer than the plasma half-life of the wild-type ICAM3 protein.
[0117] In some embodiments, the ICAM3 polypeptide is a conjugate. In some embodiments, the ICAM3 conjugate comprises an ICAM3 polypeptide comprising at least one amino acid and a conjugating moiety bound to the at least one 1 amino acid. In some embodiments, the at least one amino acid is located proximal to the N-terminus (e.g., proximal to the N-terminal residue). For example, the at least one amino acid is located optionally within the first 10, 20, 30, 40, or 50 residues from the N-terminus. In some cases, the at least one amino acid is located at the N-terminus (i.e., the at least one amino acid is the N-terminal residue of the ICAM3 polypeptide). In other embodiments, the at least one amino acid is located proximal to the C-terminus (e.g., proximal to the C-terminal residue). For example, the at least one amino acid is located optionally within the first 10, 20, 30, 40, or 50 residues from the C-terminus. In some cases, the at least one amino acid is located at the C-terminus (i.e., the at least one amino acid is the C-terminal residue of the ICAM3 polypeptide). In some instances, the ICAM3 conjugate has an enhanced plasma half-life, such as the half-lives described herein. In some embodiments, the ICAM3 conjugate is functionally active (e.g., retains activity). In some embodiments, the ICAM3 conjugate is not functionally active (e.g., devoid of activity). In some embodiments, the conjugating moiety comprises a polymer comprising Polyethylene glycol (PEG). In some embodiments, the ICAM3 polypeptide is fused with a second polypeptide. In some embodiments, the second polypeptide comprises a polypeptide with a long plasma half-life relative to the plasma half-life of the ICAM3 polypeptide. In some embodiments, the second polypeptide comprises an antibody or antibody fragment. In some embodiments, the antibody or antibody fragment comprises an IgG1, IgG2, IgG4, IgG3, or IgE. In some embodiments, the IgG is an Fc. In some embodiments, the IgG Fc is human. In some instances, the long plasma half-life polypeptide comprises HSA, transferrin, IgA monomer, Retinol-binding protein, Factor H, Factor XIII, C-reactive protein, Factor IX, Fibrinogen, IFN-alpha, Pentameric IgM, IL-2, or Thyroglobulin.
[0118] Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4) Modulators
[0119] Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 (MAP4K4) refers to a peptide associated with one or more of the following reference sequences: HGNC: 6866, Entrez Gene: 9448, Ensembl: ENSG00000071054, OMIM: 604666, and UniProtKB: 095819.
[0120] Disclosed herein, in some embodiments, are therapeutic agents comprising modulators of MAP4K4 useful for the treatment of a disease or condition, or symptom of a disease or condition, disclosed herein. In some embodiments, the MAP4K4 modulator is a small molecule. In some embodiments, a small molecule has a molecular weight less than or equal to about 1000 Daltons. In some embodiments, a small molecule has a molecular weight less than or equal to about 900 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 800 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 700 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 600 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 500 Da. In some embodiments, the MAP4K4 modulator is an antagonist or inhibitor of MAP4K4.
[0121] Disclosed herein, in some embodiments, are therapeutic agents useful for the treatment of a disease or condition, or symptom of the disease or condition, disclosed herein. In some embodiments, the therapeutic agent comprises a modulator, agonist, and/or antagonist of MAP4K4.
[0122] In some embodiments, the MAP4K4 modulator is a compound of Formula (I):
##STR00001##
or a stereoisomers geometric isomer, tautomer, or a pharmaceutically acceptable salt thereof, wherein: [0123] A is CH or N; [0124] R.sub.1 and R.sub.2 are independently selected from: [0125] CN; [0126] C.sub.1-C.sub.12-alkyl which is unsubstituted or substituted by one or more substituents selected from the group consisting of cyano, halo, hydroxy, C.sub.1-C.sub.12-alkoxy, C.sub.3-C.sub.12-cycloalkyl, —NH.sub.2, —NH—C.sub.1-C.sub.12-alkyl, —NH—C.sub.2-C.sub.12-heteroaryl, —NHC(O)—C.sub.1-C.sub.12-alkyl, —NHC(O)—C.sub.3-C.sub.12-cycloalkyl, —NHC(O)—C.sub.6-C.sub.2O-aryl, —NHC(O)—C.sub.2-C.sub.12-heteroaryl, —NHC(O)NH—C.sub.1-C.sub.12-alkyl, —NHC(O)NH—C.sub.2-C.sub.12-heteroaryl, —NHS(O).sub.2—C.sub.1-C.sub.12-alkyl, and —HS(O).sub.2—C.sub.3-C.sub.12-cycloalkyl; [0127] C.sub.1-C.sub.12-alkoxy which is unsubstituted or substituted by halo; [0128] C.sub.3-C.sub.12-cycloalkyl which is unsubstituted or substituted by one or more substituents selected from the group consisting of cyano, halo, hydroxy, —NH.sub.2, C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, C.sub.3-C.sub.12-cycloalkyl, C.sub.2-C.sub.12-heterocyclyl, C.sub.6-C.sub.20-aryl, and C.sub.2-C.sub.12-heteroaryl, wherein said cycloalkyl, heterocyclyl, aryl, and heteroaryl can be unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, OH, CN, NH.sub.2, —NH(C.sub.1-C.sub.12-alkyl), —N(C.sub.1-C.sub.12-alkyl).sub.2, C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, C.sub.1-C.sub.12-haloalkyl, C.sub.1-C.sub.12-hydroxyalkyl, —C(O)C.sub.1-C.sub.12-alkyl, and —C(O)NHC.sub.1-C.sub.12-alkyl; [0129] —NHR.sup.a, wherein W is selected from the group consisting of: [0130] C.sub.3-C.sub.12-cycloalkyl, which is unsubstituted or substituted by one or more C.sub.1-C.sub.12-alkyl; [0131] —C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents, [0132] C.sub.1-C.sub.12-alkylenyl-C.sub.6-C.sub.2O-aryl, wherein the aryl is unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, C.sub.1-C.sub.12-alkyl and C.sub.2-C.sub.12-heterocyclyl; [0133] —C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy-C.sub.6-C.sub.20-aryl, wherein the aryl is unsubstituted or substituted by halo; and —C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heteroaryl, wherein the heteroaryl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; [0134] —C(O)—C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: C.sub.1-C.sub.12-alkyl, —C.sub.1-C.sub.12-hydroxyalkyl, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —NH—C(O)—C.sub.1-C.sub.12-alkyl, —NH—C(O)—C.sub.3-C.sub.12-cycloalkyl, and —N(C(O)—C.sub.3-C.sub.12-cycloalkyl).sub.2; [0135] —C(O)OH; [0136] —C(O)—C.sub.1-C.sub.12-alkoxy; [0137] —C(O)NR.sup.bR.sup.c, wherein R.sup.b and R.sup.c are independently selected from the group consisting of: [0138] H; —C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by one or more substituent selected from the group consisting of: [0139] —OH, —CN, —NH.sub.2, —C.sub.3-C.sub.12-cycloalkyl, —C(O)—NH.sub.2, —C(O)—C.sub.2-C.sub.12-heterocyclyl, —N(H)(C(O)—C.sub.1-C.sub.12-alkyl), —N(H)(C.sub.1-C.sub.12-alkyl), —N(C.sub.1-C.sub.12-alkyl).sub.2, —NHC(O)—NH(C.sub.3-C.sub.12-cycloalkyl), —NHC(O)—NH(C.sub.1-C.sub.12-alkyl); [0140] C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of oxo, hydroxy and C.sub.1-C.sub.12-alkyl; [0141] —C(O)—C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of oxo, hydroxy and C.sub.1-C.sub.12-alkyl; [0142] —SO.sub.2—C.sub.2-C.sub.12-heterocyclyl; [0143] aryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-hydroxyalkyl, C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy, C.sub.1-C.sub.12-alkylenyl-NH.sub.2, and —O—C.sub.2-C.sub.12-heterocyclyl, which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0144] C.sub.2-C.sub.12-heteroaryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, and —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2; [0145] —C.sub.3-C.sub.12-cycloalkyl, which is unsubstituted or substituted by one ore more hydroxy; [0146] —C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: [0147] C.sub.1-C.sub.12-alkyl, —SO.sub.2—C.sub.1-C.sub.12-alkyl, —C(O)—C.sub.1-C.sub.12-alkyl, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)—C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)—C.sub.3-C.sub.12-cycloalkyl, and —C(O)NH—C.sub.3-C.sub.12-cycloalkyl; [0148] —C.sub.6-C.sub.2O-aryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, C1-C.sub.12-hydroxyalkyl, C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy, C.sub.1-C.sub.12-alkylenyl-NH.sub.2, and —O—C.sub.2-C.sub.12-heterocyclyl, which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0149] C.sub.6-C.sub.2O-heteroaryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-hydroxyalkyl, and —O—C.sub.2-C.sub.12-heterocyclyl which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; [0150] —O—C.sub.3-C.sub.12-cycloalkyl, —O—C.sub.2-C.sub.12-heterocyclyl, —O—C.sub.6-C.sub.20-aryl and —O—C.sub.6-C.sub.2O-heteroaryl, wherein the cycloalkyl, heterocyclyl, aryl and heteroaryl is unsubstituted or substituted by one or more substituent(s) selected from the group consisting of: halo, cyano, C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy and —C(O)NH.sub.2; [0151] C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: [0152] halo, oxo, —NH.sub.2; [0153] C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: OH, halo, C.sub.1-C.sub.12-alkoxy, —C(O)—NH—C.sub.1-C.sub.12-alkyl, and C.sub.2-C.sub.12-heteroaryl, which heteroaryl is unsubstituted or substituted by one or more substituents selected from the group consisting of: C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy and —N(C.sub.1-C.sub.12-alkyl).sub.2; [0154] C.sub.1-C.sub.12-alkoxy; [0155] —C(O)—R.sup.d, wherein R.sup.d is selected from the group consisting of C.sub.1-C.sub.12-alkyl, —C.sub.2-C.sub.12-heterocyclyl, —NH.sub.2, —NH—C.sub.3-C.sub.12-cycloalkyl, and —O—C.sub.1-C.sub.12-alkyl; [0156] —N(C.sub.1-C.sub.12-alkyl).sub.2; [0157] —N(C.sub.1-C.sub.12-alkyl)C(O)—C.sub.1-C.sub.12-alkyl; [0158] —NH(CO)—C.sub.1-C.sub.12-alkylenyl-N(C.sub.1-C.sub.12-alkyl).sub.2; [0159] —NH(CO)—C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy; [0160] —NH(CO)O—C.sub.1-C.sub.12-alkyl; [0161] —NH(CO)—C.sub.1-C.sub.12-alkylenyl-N(C.sub.1-C.sub.12-alkyl)-C(O)—C.sub.1-C.sub.12-alkyl; [0162] —NH(CO)—C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of: oxo, C.sub.1-C.sub.12-alkyl, —C(O)—C.sub.1-C.sub.12-alkyl and —S(O).sub.2—C.sub.1-C.sub.12-alkyl; [0163] —NH(CO)—C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of oxo, C.sub.1-C.sub.12-alkyl and —C(O)—C.sub.1-C.sub.12-alkyl; [0164] —NH(CO)—C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heteroaryl, wherein the heteroaryl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0165] C.sub.3-C.sub.12-cycloalkyl, C.sub.2-C.sub.12-heterocyclyl, C.sub.6-C.sub.20-aryl or C.sub.2-C.sub.12-heteroaryl wherein the cycloalkyl, heterocycloalkyl, aryl or heteroaryl is unsubstituted or substituted by one or more substituents selected from the group consisting of: OH, C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-haloalkyl, C.sub.1-C.sub.12-hydroxyalkyl, C.sub.1-C.sub.12-alkylenyl —C.sub.1-C.sub.12-alkoxy, —NH—C.sub.1-C.sub.12-alkyl, —N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)NH.sub.2, —C(O)NH—C.sub.1-C.sub.12-alkyl, —C(O)N(C.sub.1-C.sub.12-alkyl).sub.2 and —S(O).sub.2—C.sub.1-C.sub.12-alkyl; [0166] C.sub.6-C.sub.2O-aryl which is unsubstituted or substituted by one or more substituents selected from the group consisting of: halo; CN; OH; —NH.sub.2; C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: [0167] —NH(C.sub.1-C.sub.12-alkyl), wherein the alkyl is unsubstituted or substituted by OH or —N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)N(C.sub.1-C.sub.12-alkyl).sub.2, (C.sub.3-C.sub.12-cycloalkyl, C.sub.2-C.sub.12-heterocyclyl, which cycloalkyl or heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; [0168] —NH(C.sub.2-C.sub.12-heterocyclyl) which heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of: oxo and C.sub.1-C.sub.12-alkyl; [0169] —N(C.sub.1-C.sub.12-alkyl)(C.sub.2-C.sub.12-heterocyclyl) which heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of: oxo and C.sub.1-C.sub.12-alkyl; [0170] —N(C.sub.1-C.sub.12-alkyl)(C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy); [0171] —N(C.sub.1-C.sub.12-alkyl)-C(O)—C.sub.2-C.sub.12-heterocyclyl; [0172] —NH(C.sub.3-C.sub.12-cycloalkyl), wherein the cycloalkyl is unsubstituted or substituted by halo, C.sub.1-C.sub.12-hydroxyalkyl; [0173] C.sub.2-C.sub.12-heterocyclyl which is unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, oxo, OH, C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-hydroxyalkyl, alkoxy, C.sub.1-C.sub.12-alkylenlyl-C(O)—C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkylenyl-C(O)N(C.sub.1-C.sub.12-alkyl).sub.2, —N(C.sub.1-C.sub.12-alkyl).sub.2, —N(C.sub.1-C.sub.12-alkyl)-C(O)—C.sub.1-C.sub.12-alkyl, —C(O)NH.sub.2, —C(O)NH(C.sub.1-C.sub.12-alkyl), —C(O)NH(C.sub.1-C.sub.12-haloalkyl), —C(O)NH(C.sub.1-C.sub.12-hydroxyalkyl), —S(O).sub.2—C.sub.1-C.sub.12-alkyl, —S(O).sub.2—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)NH(C.sub.2-C.sub.12-heterocyclyl), —C(O)N(C.sub.1-C.sub.12-alkyl).sub.2, and —C(O)—C.sub.2-C.sub.12-heterocyclyl, which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl, —C(O)OH, —S(O).sub.2—C.sub.1-C.sub.12-alkyl, —S(O).sub.2—N(C.sub.1-C.sub.12-alkyl).sub.2, or C.sub.2-C.sub.12-heterocyclyl; and —C.sub.1-C.sub.12-alkoxy which is unsubstituted or substituted by one or more substituents selected from the group consisting of: halo and C.sub.2-C.sub.12-heterocyclyl; [0174] C.sub.1-C.sub.12-alkoxy which is unsubstituted or substituted by C.sub.2-C.sub.12-heterocyclyl; [0175] C.sub.1-C.sub.12-haloalkoxy; [0176] —NH—C.sub.1-C.sub.12-alkylenyl-N(C.sub.1-C.sub.12-alkyl).sub.2; [0177] —NH—C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heterocyclyl; [0178] —NH—C.sub.1-C.sub.12-alkylenyl-C.sub.6-C.sub.20-aryl, wherein the C.sub.6-C.sub.2O-aryl is unsubstituted or substituted by halo; [0179] —NH—C.sub.2-C.sub.12-heterocyclyl-C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heterocyclyl; [0180] —NHC(O)—C.sub.1-C.sub.12-alkyl, wherein the C.sub.1-C.sub.12-alkyl group is unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, C.sub.1-C.sub.12-alkoxy, —N(C.sub.1-C.sub.12-alkyl).sub.2, —C.sub.3-C.sub.12-cycloalkyl, and —C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by oxo; [0181] —NHC(O)—C.sub.1-C.sub.12-alkoxy; [0182] —NHC(O)—C.sub.3-C.sub.12-cycloalkyl, wherein the cycloalkyl is unsubstituted or substituted by halo; [0183] —NHC(O)—C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of: C.sub.1-C.sub.12-alkyl and —C(O)—C.sub.1-C.sub.12-alkyl; [0184] —NHC(O)NH—C.sub.3-C.sub.12-cycloalkyl, wherein the cycloalkyl is unsubstituted or substituted by OH; [0185] —NH(SO.sub.2)—C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; [0186] —NH(SO.sub.2)—C.sub.2-C.sub.12-heterocyclyl; [0187] —C(O)NH.sub.2; [0188] —C(O)NH—C.sub.1-C.sub.12-alkyl; [0189] —C(O)NH—C.sub.1-C.sub.12-alkylenyl-N(C.sub.1-C.sub.12-alkyl).sub.2; [0190] —C(O)NH—C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, —C(O)NH—C.sub.1-C.sub.12-hydroxyalkyl, and —C(O)NH—C.sub.3-C.sub.12-cycloalkyl; and [0191] C.sub.3-C.sub.12-cycloalkyl, C.sub.2-C.sub.12-heterocyclyl, C.sub.6-C.sub.2O-aryl; C.sub.2-C.sub.12-heteroaryl; and —O—C.sub.2-C.sub.12-heteroaryl wherein said cycloalkyl, heterocyclyl, aryl, and heteroaryl can be unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, oxo, OH, CN, NH.sub.2, —NH(C.sub.1-C.sub.12-alkyl), —N(C.sub.1-C.sub.12-alkyl).sub.2, C.sub.1-C.sub.12-alkoxy, C.sub.1-C.sub.12-haloalkyl, C.sub.1-C.sub.12-hydroxyalkyl, —C(O)C.sub.1-C.sub.12-alkyl, and —C(O)NHC.sub.1-C.sub.12-alkyl; and [0192] —C.sub.2-C.sub.12-heteroaryl which is unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, oxo, CN, —NH.sub.2—NH—C.sub.1-C.sub.12-alkylenyl-N(C.sub.1-C.sub.12-alkylenyl).sub.2, —NH—C.sub.1-C.sub.12-alkylenyl-C.sub.2-C.sub.12-heterocyclyl; [0193] C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of halo, —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, and —C.sub.2-C.sub.12-heterocyclyl, wherein the C.sub.2-C.sub.12-heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; [0194] —C(O)—NH.sub.2, [0195] —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), [0196] —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, and [0197] C.sub.3-C.sub.12-cycloalkyl, C.sub.2-C.sub.12-heterocyclyl, C.sub.6-C.sub.2O-aryl, C.sub.2-C.sub.12-heteroaryl wherein said cycloalkyl, heterocyclyl, aryl, and heteroaryl can be unsubstituted or substituted by one or more substituents selected from the group consisting of: halo, OH, CN, NH.sub.2, —NH(C.sub.1-C.sub.12-alkyl), —N(C.sub.1-C.sub.12-alkyl).sub.2, C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, C.sub.1-C.sub.12-haloalkyl, C.sub.1-C.sub.12-hydroxyalkyl, —C(O)C.sub.1-C.sub.12-alkyl, and —C(O)NHC.sub.1-C.sub.12-alkyl;
with the proviso that when A is CH, R.sup.1 is selected from phenyl that is unsubstituted or substituted by halo.
[0198] In some embodiments of the compound of Formula (I), A is CH or N; [0199] R.sup.1 is C.sub.6-C.sub.2O-aryl, which is unsubstituted or substituted by one or more halo, CN, C.sub.1-C.sub.12-haloalkoxy, —C(O)NH—C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by one or more halo; or [0200] C.sub.2-C.sub.12-heteroaryl which is unsubstituted or substituted by one or more substituents selected from the group consisting of halo and C.sub.1-C.sub.12-alkyl; [0201] R.sup.2 is: CN, C.sub.1-C.sub.12-alkyl which is unsubstituted or substituted by one or more substituents selected from the group consisting of cyano, halo, hydroxy, C.sub.1-C.sub.12-alkoxy, C.sub.3-C.sub.12-cycloalkyl, —NH.sub.2, —NH—C.sub.1-C.sub.12-alkyl, —NH—C.sub.2-C.sub.12-heteroaryl, —NHC(O)—C.sub.1-C.sub.12-alkyl, —NHC(O)—C.sub.3-C.sub.12-cycloalkyl, —NHC(O)—C.sub.6-C.sub.2O-aryl, —NHC(O)—C.sub.2-C.sub.12-heteroaryl, —NHC(O)NH—C.sub.1-C.sub.12-alkyl, —NHC(O)NH—C.sub.2-C.sub.12-heteroaryl, —NHS(O).sub.2—C.sub.1-C.sub.12-alkyl, and —NHS(O).sub.2—C.sub.3-C.sub.12-cycloalkyl; [0202] —C(O)—C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-hydroxyalkyl, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —NH—C(O)—C.sub.1-C.sub.12-alkyl, —NH—C(O)—C.sub.3-C.sub.12-cycloalkyl, and —N(C(O)—C.sub.3-C.sub.12-cycloalkyl).sub.2; [0203] —C(O)OH; [0204] —C(O)—C.sub.1-C.sub.12-alkoxy; [0205] —C(O)NR.sup.bR.sup.c, wherein R.sup.b and R.sup.c are independently selected from the group consisting of: H; —C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by one or more substituent selected from the group consisting of: [0206] OH, CN, NH.sub.2, —C.sub.3-C.sub.12-cycloalkyl, —C(O)—NH.sub.2, —C(O)—C.sub.2-C.sub.12-heterocyclyl, —N(H)(C(O)—C.sub.1-C.sub.12-alkyl), —N(H)(C.sub.1-C.sub.12-alkyl), —N(C.sub.1-C.sub.12-alkyl).sub.2, —NHC(O)—NH(C.sub.3-C.sub.12-cycloalkyl), —NHC(O)—NH(C.sub.1-C.sub.12-alkyl); [0207] C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of oxo, hydroxy and C.sub.1-C.sub.12-alkyl; [0208] —C(O)—C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of oxo, hydroxy and C.sub.1-C.sub.12-alkyl; [0209] —SO.sub.2—C.sub.2-C.sub.12-heterocyclyl; [0210] C.sub.6-C.sub.20-aryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-hydroxyalkyl, C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy; C.sub.1-C.sub.12-alkylenyl-NH.sub.2, and —O—C.sub.2-C.sub.12-heterocyclyl, which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0211] C.sub.2-C.sub.12-heteroaryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, and —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2; [0212] —C.sub.3-C.sub.12-cycloalkyl, which is unsubstituted or substituted by one or more hydroxy; —C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: C.sub.1-C.sub.12-alkyl, —SO.sub.2—C.sub.1-C.sub.12-alkyl, —C(O)—C.sub.1-C.sub.12-alkyl, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)—C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)—C.sub.3-C.sub.12-cycloalkyl, and —C(O)NH—C.sub.3-C.sub.12-cycloalkyl; [0213] C.sub.6-C.sub.2O-aryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-hydroxyalkyl, C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy; C.sub.1-C.sub.12-alkylenyl-NH.sub.2, and —O—C.sub.2-C.sub.12-heterocyclyl, which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0214] C.sub.6-C.sub.20-heteroaryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-hydroxyalkyl, and —O—C.sub.2-C.sub.12-heterocyclyl which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0215] C.sub.2-C.sub.12-heteroaryl which is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl, which alkyl is unsubstituted or substituted by one or more substituents selected from the group consisting of halo, —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, and —C.sub.2-C.sub.12-heterocyclyl, wherein the C.sub.2-C.sub.12-heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl;
with the proviso that when A is CH, R.sup.1 is selected from phenyl that is unsubstituted or substituted by halo.
[0216] In some embodiments of the compound of Formula (I), A is CH or N; [0217] R.sup.1 is C.sub.6-C.sub.2O-aryl substituted by one two or three halo; [0218] R.sup.2 is CN, C.sub.1-C.sub.12-alkyl which is unsubstituted or substituted by one or more substituents selected from the group consisting of —NH.sub.2, —NH—C.sub.1-C.sub.12-alkyl, —NHC(O)—C.sub.3-C.sub.12-cycloalkyl, —NHC(O)—C.sub.6-C.sub.2O-aryl, and —NHS(O).sub.2—C.sub.3-C.sub.12-cycloalkyl; [0219] —C(O)—C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: —C.sub.1-C.sub.12-hydroxyalkyl, —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —NH—C(O)—C.sub.1-C.sub.12-alkyl, —NH—C(O)—C.sub.3-C.sub.12-cycloalkyl, and —N(C(O)—C.sub.3-C.sub.12-cycloalkyl).sub.2; [0220] —C(O)OH; [0221] —C(O)—C.sub.1-C.sub.12-alkoxy; [0222] —C(O)NR.sup.bR.sup.c, wherein R.sup.b and R.sup.c are independently selected from the group consisting of: H; alkyl, which is unsubstituted or substituted by one or more substituent selected from the group consisting of: OH, CN, NH.sub.2, —C.sub.3-C.sub.12-cycloalkyl, —C(O)—NH.sub.2, —C(O)—C.sub.2-C.sub.12-heterocyclyl, —N(H)(C(O)—C.sub.1-C.sub.12-alkyl), —N(H)(C.sub.1-C.sub.12alkyl), —N(C.sub.1-C.sub.12-alkyl).sub.2, —NHC(O)—NH(C.sub.3-C.sub.12-cycloalkyl), —NHC(O)—NH(C.sub.1-C.sub.12-alkyl); [0223] C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by one or more substituents selected from the group consisting of oxo, hydroxy and C.sub.1-C.sub.12-alkyl; —C(O)—C.sub.2-C.sub.12-heterocyclyl; [0224] —SO.sub.2—C.sub.2-C.sub.12-heterocyclyl; [0225] C.sub.6-C.sub.2O-aryl, which is unsubstituted or substituted by C.sub.1-C.sub.12alkoxy; and [0226] C.sub.2-C.sub.12-heteroaryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), and —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2; [0227] —C.sub.3-C.sub.12-cycloalkyl, which is unsubstituted or substituted by one or more hydroxy; —C.sub.2-C.sub.12-heterocyclyl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of: C.sub.1-C.sub.12-alkyl, —SO.sub.2—C.sub.1-C.sub.12-alkyl, —C(O)—C.sub.1-C.sub.12-alkyl, —C(O)—NH.sub.2, —C(O)—N(H)(C.sub.1-C.sub.12-alkyl), —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)—C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-alkylenyl-C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, —C(O)—C.sub.3-C.sub.12-cycloalkyl and —C(O)NH—C.sub.3-C.sub.12-cycloalkyl; [0228] C.sub.6-C.sub.20-aryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, C.sub.1-C.sub.12-alkoxy, —C.sub.1-C.sub.12-hydroxyalkyl, C.sub.1-C.sub.12-alkylenyl-C.sub.1-C.sub.12-alkoxy; C.sub.1-C.sub.12-alkylenyl-NH.sub.2, and —O—C.sub.2-C.sub.12-heterocyclyl, which heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl; and [0229] C.sub.6-C.sub.20-heteroaryl, which is unsubstituted or substituted by one or more substituents selected from the group consisting of C.sub.1-C.sub.12-alkyl, which is unsubstituted or substituted by C.sub.2-C.sub.12-heterocyclyl, C.sub.1-C.sub.12-hydroxyalkyl, and —O—C.sub.2-C.sub.12-heterocyclyl which is unsubstituted or substituted by C alkyl; and C.sub.2-C.sub.12-heteroaryl which is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl, which alkyl is unsubstituted or substituted by one or more substituents selected from the group consisting of halo, —C(O)—N(C.sub.1-C.sub.12-alkyl).sub.2, and —C.sub.2-C.sub.12-heterocyclyl, wherein the heterocyclyl is unsubstituted or substituted by C.sub.1-C.sub.12-alkyl;
with the proviso that when A is CH, R.sup.1 is selected from phenyl that is unsubstituted or substituted by halo.
[0230] In some embodiments, the MAP4K4 is a compound selected from:
##STR00002## ##STR00003## ##STR00004## ##STR00005## ##STR00006## ##STR00007## ##STR00008## ##STR00009## ##STR00010## ##STR00011## ##STR00012## ##STR00013## ##STR00014## ##STR00015## ##STR00016## ##STR00017## ##STR00018## ##STR00019## ##STR00020##
[0231] In some embodiments, the MAP4K4 modulator is a compound of Formula (II):
##STR00021##
or a pharmaceutically acceptable salt, tautomer, or isomers thereof, wherein: [0232] t is 0, 1, 2, or 3; [0233] Z.sub.2 is N or CR.sup.12; [0234] Z.sub.6 is N or CR.sup.16; [0235] L.sub.4 is selected from the group consisting of —(CR.sup.10R.sup.11).sub.p—NR.sup.25—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—X—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—C(X)—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—S(O)—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.pS(O).sub.2—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—C(X)NR.sup.25—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—S(O).sub.2NR.sup.25—(CR.sup.10R.sup.11).sub.p—, —(CR.sup.10R.sup.11).sub.p—NR.sup.25C(X)—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—NR.sup.25S(O).sub.2—(CR.sup.10R.sup.11).sub.q—, —(CR.sup.10R.sup.11).sub.p—NR.sup.25C(X)NR.sup.25—(CR.sup.10R.sup.11).sub.q—, and —(CR.sup.10R.sup.11).sub.p—NR.sup.25S(O).sub.2NR.sup.25—(CR.sup.10R.sup.11).sub.q—; [0236] p and q are independently 0, 1, or 2 provided, however, that at least one of p and q is 0; [0237] R.sup.60 is selected from the group consisting of hydrogen, halogen, optionally substituted lower alkyl, optionally substituted lower alkenyl, optionally substituted lower alkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —NO.sub.2, —CR.sup.aR.sup.bR.sup.26, and -LR.sup.26; [0238] R.sup.61 is hydrogen, lower alkyl, or fluoro substituted lower alkyl; [0239] A is selected from the group consisting of —O—, —S—, —CR.sup.aR.sup.b—, —NR.sup.1—, —C(O)—, —C(S)—, —S(O)—, and —S(O).sub.2—; [0240] R.sup.a and R.sup.b at each occurrence are independently selected from the group consisting of hydrogen, fluoro, —OH, —NH.sub.2, lower alkyl, lower alkoxy, lower alkylthio, mono-alkylamino, di-alkylamino, and —NR.sup.8R.sup.9, wherein the alkyl chain(s) of lower alkyl, lower alkoxy, lower alkylthio, mono-alkylamino, or di-alkylamino are optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino, provided, however, that any substitution of the alkyl chain carbon bound to O of alkoxy, S of thioalkyl or N of mono- or di-alkylamino is fluoro; or [0241] R.sup.a and R.sup.b combine to form a 3-7 membered monocyclic cycloalkyl or 5-7 membered monocyclic heterocycloalkyl, wherein the monocyclic cycloalkyl or monocyclic heterocycloalkyl are optionally substituted with one or more substituents selected from the group consisting of halogen, —OH, —NH.sub.2, lower alkyl, fluoro substituted lower alkyl, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino; [0242] R.sup.1 is selected from the group consisting of hydrogen, lower alkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, —C(O)R.sup.7, —C(S)R.sup.7, —S(O).sub.2R.sup.7, —C(O)NHR.sup.7, —C(S)NHR.sup.7, and —S(O).sub.2NHR.sup.7, wherein lower alkyl is optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, lower alkylthio, mono-alkylamino, di-alkylamino, and —NR.sup.8R.sup.9, wherein the alkyl chain(s) of lower alkoxy, lower alkylthio, mono-alkylamino, or di-alkylamino are optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino, provided, however, that any substitution of the alkyl chain carbon bound to O of alkoxy, S of thioalkyl or N of mono- or di-alkylamino is fluoro, further provided that when R.sup.1 is lower alkyl, any substitution on the lower alkyl carbon bound to the N of —NR.sup.1— is fluoro, and wherein cycloalkyl, heterocycloalkyl, aryl or heteroaryl are optionally substituted with one or more substituents selected from the group consisting of halogen, —OH, —NH.sub.2, lower alkyl, fluoro substituted lower alkyl, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino; [0243] R.sup.7 is selected from the group consisting of lower alkyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl, wherein lower alkyl is optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, lower alkylthio, mono-alkylamino, di-alkylamino, and —NR.sup.8R.sup.9, provided, however, that any substitution of the alkyl carbon bound to the N of —C(O)NHR.sup.7, —C(S)NHR.sup.7 or —S(O).sub.2NHR.sup.7 is fluoro, wherein the alkyl chain(s) of lower alkoxy, lower alkylthio, mono-alkylamino, or di-alkylamino are optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino, provided, however, that any substitution of the alkyl chain carbon bound to O of alkoxy, S of thioalkyl or N of mono- or di-alkylamino is fluoro, and wherein cycloalkyl, heterocycloalkyl, aryl and heteroaryl are optionally substituted with one or more substituents selected from the group consisting of halogen, —OH, —NH.sub.2, lower alkyl, fluoro substituted lower alkyl, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino; [0244] each of R.sup.4, R.sup.5, R.sup.6, R.sup.12, R.sup.15, and R.sup.16, are independently selected from the group consisting of hydrogen, halogen, optionally substituted lower alkyl, optionally substituted lower alkenyl, optionally substituted lower alkynyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, optionally substituted heteroaryl, —CN, —NO.sub.2, —CR.sup.aR.sup.bR.sup.26, and -LR.sup.26; L at each occurrence is independently selected from the group consisting of -(alk).sub.a-X-(alk).sub.b-, -(alk).sub.a-NR.sup.25-(alk).sub.b-, -(alk).sub.a-C(X)-(alk).sub.b-, -(alk).sub.a-S(O)-(alk).sub.b-, -(alk).sub.a-S(O).sub.2-(alk).sub.b-, -(alk).sub.a-OC(X)-(alk).sub.b-, -(alk).sub.a-C(X)O-(alk).sub.b-, -(alk).sub.a-C(X)NR.sup.25-(alk).sub.b-, -(alk).sub.a-S(O).sub.2NR.sup.25-(alk).sub.b-, -(alk).sub.a-NR.sup.25C(X)-(alk).sub.b-, -(alk).sub.a-NR.sup.25S(O).sub.2-(alk).sub.b-, -(alk).sub.a-NR.sup.25C(X)O-(alk).sub.b-, -(alk).sub.a-OC(X)NR.sup.25-(alk).sub.b-, -(alk).sub.a-NR.sup.25C(X)NR.sup.25-(alk).sub.b-, and -(alk).sub.a-NR.sup.25S(O).sub.2NR.sup.25-(alk).sub.b-; [0245] a and b are independently 0 or 1; [0246] alk at each occurrence is independently C.sub.1-3 alkylene or C.sub.1-3 alkylene substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkyl, lower alkoxy, lower alkylthio, mono-alkylamino, di-alkylamino, and —NR.sup.8R.sup.9, wherein lower alkyl or the alkyl chain(s) of lower alkoxy, lower alkylthio, mono-alkylamino or di-alkylamino are optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino and cycloalkylamino, provided, however, that any substitution of the alkyl chain carbon bound to O of alkoxy, S of thioalkyl or N of mono- or di-alkylamino is fluoro; [0247] X at each occurrence is independently O or S; [0248] R.sup.25 at each occurrence is independently selected from the group consisting of hydrogen, optionally substituted lower alkyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, and optionally substituted heteroaryl; [0249] R.sup.26 at each occurrence is independently selected from the group consisting of hydrogen, provided, however, that hydrogen is not bound to any of S(O), S(O).sub.2, C(O) or C(S) of L, optionally substituted lower alkyl, optionally substituted lower alkenyl, provided, however, that when R.sup.26 is optionally substituted lower alkenyl, no alkene carbon thereof is bound to N, S, O, S(O), S(O).sub.2, C(O) or C(S) of L, optionally substituted lower alkynyl, provided, however, that when R.sup.26 is optionally substituted lower alkynyl, no alkyne carbon thereof is bound to N, S, O, S(O), S(O).sub.2, C(O) or C(S) of L, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, optionally substituted aryl, and optionally substituted heteroaryl; [0250] R.sup.10 and R.sup.11 at each occurrence are independently selected from the group consisting of hydrogen, fluoro, lower alkyl, and lower alkyl optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino; or any two of R.sup.10 and R.sup.11 on the same or adjacent carbon atoms combine to form a 3-7 membered monocyclic cycloalkyl or 5-7 membered monocyclic heterocycloalkyl, and any others of R.sup.10 and R.sup.11 are independently selected from the group consisting of hydrogen, fluoro, lower alkyl, and lower alkyl optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino, and wherein the monocyclic cycloalkyl or monocyclic heterocycloalkyl are optionally substituted with one or more substituents selected from the group consisting of halogen, —OH, —NH.sub.2, lower alkyl, fluoro substituted lower alkyl, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, fluoro substituted lower alkylthio, mono-alkylamino, di-alkylamino, and cycloalkylamino; [0251] R.sup.8 and R.sup.9 combine with the nitrogen to which they are attached to form a 5-7 membered heterocycloalkyl optionally substituted with one or more substituents selected from the group consisting of fluoro, —OH, —NH.sub.2, lower alkyl, fluoro substituted lower alkyl, lower alkoxy, fluoro substituted lower alkoxy, lower alkylthio, and fluoro substituted lower alkylthio; [0252] R.sup.17 is selected from the group consisting of hydrogen, halogen, optionally substituted lower alkyl and —OR.sup.18; and [0253] R.sup.18 is hydrogen or optionally substituted lower alkyl.
[0254] In some embodiments, the MAP4K4 modulator is the compound selected from: from 2-[5-Chloro-4-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-2-fluoro-phenoxymethyl]-1H-benzoimidazole, 2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-2,5-difluoro-phenoxymethyl]-1H-benzoimidazole, 2-[2,5-Difluoro-4-(5-methoxy-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole, 2-[3,5-Difluoro-4-(1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole,2-[5-Chloro-2-methoxy-4-(1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole, 2-[5-Chloro-4-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-2-methoxy-phenoxymethyl]-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-3,5-difluoro-phenoxymethyl]-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-1-methyl-1H-benzoimidazole,2-[4-(5-Bromo-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-2,5-difluoro-phenoxymethyl]-1H-benzoimidazole,2-{2,5-Difluoro-4-[5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl]-phenoxymethyl}-1H-benzoimidazole,2-{5-Chloro-2-fluoro-4-[5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl]-phenoxymethyl}-1H-benzoimidazole,2-{1-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxyl]-ethyl}-1H-benzoimidazole,6-Chloro-2-[4-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-1H-benzoimidazole,6-Chloro-2-[5-fluoro-2-methoxy-4-(1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole,2-[5-Fluoro-2-methoxy-4-(1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-6-methoxy-1H-benzoimidazole,2-[5-Chloro-2-fluoro-4-(5-methoxy-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole,2-[5-Fluoro-4-(5-fluoro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-2-methoxy-phenoxymethyl]-1H-benzoimidazole,2-[2-Chloro-5-fluoro-4-(5-methoxy-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole,2-{2-Chloro-5-fluoro-4-[5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl]-phenoxymethyl}-1H-benzoimidazole,2-{4-[(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)-methoxy-methyl]-5-fluoro-2-methoxy-phenoxymethyl}-1H-benzoimidazole,[4-(1H-Benzoimidazol-2-ylmethoxy)-2-fluoro-5-methoxy-phenyl]-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)-methanone,2-[2,5-Difluoro-4-(5-methanesulfonyl-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1H-benzoimidazole,3-[4-(1H-Benzoimidazol-2-ylmethoxy)-2-fluoro-5-methoxy-benzyl]-1H-pyrrolo[2,3-b]pyridine-5-carbonitrile,5,6-Dichloro-2-[4-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-1H-benzoimidazole-5-sulfonic acid dimethylamide,3-[4-(1H-Benzoimidazol-2-ylmethoxy)-2-fluoro-5-methoxy-benzyl]-1H-pyrrolo[2,3-b]pyridine-5-carboxylic acid methyl ester,3-[4-(1H-Benzoimidazol-2-ylmethoxy)-2-fluoro-5-methoxy-benzyl]-1H-pyrrolo[2,3-b]pyridine-5-carboxylic acid,2-{2,5-Difluoro-4-[5-(2-methoxy-ethoxy)-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl]-phenoxymethyl}-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-1-ethyl-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-5-trifluoromethyl-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-5-fluoro-1H-benzoimidazole,2-{2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxy]-ethyl}-1H-benzoimidazole,2-[4-(5-Bromo-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-1H-benzoimidazole,2-[4-(5-Chloro-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-5-fluoro-2-methoxy-phenoxymethyl]-5-methoxy-1H-benzoimidazole,5-Chloro-2-[5-fluoro-2-methoxy-4-(5-methyl-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-phenoxymethyl]-1-benzoimidazole,3-[4-(1H-Benzoimidazol-2-ylmethoxy)-2,5-difluoro-benzyl]-1H-pyrrolo[2,3-b]pyridine-5-carbonitrile, and 2-[5-Fluoro-4-(5-methanesulfonyl-1H-pyrrolo[2,3-b]pyridin-3-ylmethyl)-2-methoxy-phenoxymethyl]-1H-benzoimidazole, and all pharmaceutically acceptable salts, tautomers, and isomers thereof.
Prostaglandin E Receptor 4 (PTGER4) Modulators
[0255] Disclosed herein, in some embodiments, are therapeutic agents comprising Prostaglandin E Receptor 4 (PTGER4) Modulators useful for the treatment of a disease or condition, or symptom of the disease or condition, disclosed herein. In some embodiments, the therapeutic agent comprises a modulator, agonist, and/or antagonist of PTGER4 (e.g., a PTGER4 having a sequence set forth in SEQ ID NO: 3). In some embodiments, PTGER4 refers to a peptide associated with one or more of the following reference sequences: HGNC: 9596 Entrez Gene: 5734 Ensembl: ENSG00000171522 OMIM: 601586 UniProtKB: P35408.
[0256] In some instances, the therapeutic agent comprises a modulator of PTGER4 activity or expression. In some instances, the modulator of PTGER4 activity or expression comprises an agonist or a partial agonist of PTGER4. In some instances, the modulator of PTGER4 activity or expression comprises an antagonist or a partial antagonist of PTGER4. In some instances, the agonist or partial agonist comprises an inverse antagonist. In some instances, the agonist or partial agonist comprises a positive allosteric modulator (PAM). In some instances, the agonist or partial agonist comprises a negative allosteric modulator (NAM).
[0257] In some instances, the PTGER4 modulator is effective to increase PTGER4 expression or activity in the subject (e.g., an agonist of PTGER4). The agonist of PTGER4 expression or activity may be a direct agonist or indirect agonist. In some embodiments, the agonist of PTGER4 expression or activity comprises a complete agonist or a partial agonist. Non-limiting examples of an agonist of PTGER4 expression include RNA to protein PTGER4 translation agonists, antisense oligonucleotides targeting the PTGER4, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an agonist of PTGER4 activity include antagonists to the PTGER4 antigen, and antagonists to gene expression products involved in PTGER4 mediated disease.
[0258] In some instances, the PTGER4 modulator is effective to decrease PTGER4 expression or activity in the subject (e.g., an antagonist of PTGER4). The antagonist of PTGER4 expression or activity may be a direct antagonist or indirect antagonist. In some embodiments, the antagonist of PTGER4 expression or activity comprises a complete antagonist or a partial antagonist. Non-limiting examples of an antagonist of PTGER4 expression include RNA to protein PTGER4 translation antagonists, antisense oligonucleotides targeting the PTGER4, or homolog thereof, mRNA (such as miRNAs, or siRNA), epigenetic editing (such as post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an antagonist of PTGER4 activity include antagonists to the PTGER4 antigen, and antagonists to gene expression products involved in PTGER4 mediated disease.
[0259] In some instances, the modulator of PTGER4 activity or expression (e.g., PTGER antagonist or agonists described herein) comprises an antibody or antigen-binding fragment, peptide, or small molecule. In some embodiments, the PTGER4 modulator is a small molecule. In some instances, the small molecule may be a small molecule that binds to PTGER4 or binding partners to PTGER4. In some embodiments, a small molecule has a molecular weight less than or equal to about 1000 Daltons. In some embodiments, a small molecule has a molecular weight less than or equal to about 900 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 800 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 700 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 600 Da. In some embodiments, a small molecule has a molecular weight less than or equal to about 500 Da. In some embodiments, the modulator of PTGER4 activity or expression comprises a compound selected from grapiprant (CJ-023,423), ONO-AE3-208, GW627368X, AH23848, ONO-AE2-227, ONO-AE1-734, AGN205203, rivenprost (ONO-4819), CJ-023,423, and BGC20-1531.
[0260] In some instances, the PTGER4 modulator (e.g., PTGER antagonist or agonists described herein) is an antibody. In some instances, the PTGER4 antibody may be monoclonal or polyclonal. In some instances, the PTGER4 antibody may be humanized or chimeric. The PTGER4 antibody may be a fusion protein. The PTGER4 antibody may be a blocking PTGER4 antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. In a non-limiting example, the PTGER4 blocking antibody binds to a binding partner of PTGER4. In some cases, the PTGER4 antibody is an PTGER4 antibody that specifically binds to PTGER4.
Ribonuclease T2 (RNASET2) Modulators
[0261] In some embodiments, the therapeutic agent comprises a modulator, agonist, or partial agonist of Ribonuclease T2 (RNASET2). In some embodiments, the agonist of RNASET2 comprises an RNASET2 polypeptide. In some embodiments, the RNASET2 polypeptide comprises a human RNASET2 protein (huRNASET2). In some embodiments, the RNASET2 polypeptide comprises a recombinant RNASET2 polypeptide. In some embodiments, the recombinant huRNASET2 protein comprises SEQ ID NO: 4 (MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYW TIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVD ALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEE VQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH), which is the amino acid sequence of human RNASET2 (NCBI Reference Sequence No. NP_003721.2). In some embodiments, the huRNASET2 comprises an amino acid sequence about 99%, 98%, 97%, 96%, 95%, 94%, 93%, 92%, 91%, or 90% homologous to SEQ ID NO: 4.
[0262] In some instances, the RNASET2 polypeptide is truncated. In some instances, the truncation is an N-terminal deletion. In other instances, the truncation is a C-terminal deletion. In additional instances, the truncation comprises both N-terminal and C-terminal deletions. For example, the truncation can be a deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or more residues from either the N-terminus or the C-terminus, or both termini. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, or more residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 2 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 3 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 4 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 5 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 6 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 7 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 8 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 9 residues. In some cases, the RNASET2 polypeptide comprises an N-terminal deletion of at least or about 10 residues. In some embodiments, the truncated RNASET2 has reduced or ameliorated ribonucleolytic activity. Non-limiting examples of truncated RNASET2 polypeptides include hrtrRNASE-70 (MRAYWPDVIH SFPNRSRFWK HEWEKHGTCA AQVDALNSQK KYFGRSLELYRELDLNSVLL KLGIKPSINY YQVADFKDAL ARVYGVIPKI QCLPPSQDEEVQTIGQIELC LTKQDQQLQN CTEPGEQPSP KQEVWLANGA AESRGLRVCE DGPVFYPPPK KTKH; SEQ ID NO: 6), and hrtrRNASE-50 (EGCNRSWPFN LEEIKDLLPE MRAYWPDVIH SFPNRSRFWK HEWEKHGTCAAQVDALNSQK KYFGRSLELY RELDLNSVLL KLGIKPSINY YQVADFKDALARVYGVIPKI QCLPPSQDEE VQTIGQIELC LTKQDQQLQN CTEPGEQPSPKQEVWLANGA AESRGLRVCE DGPVFYPPPK KTKH; SEQ ID NO: 5). In some instances, the truncated RNASET2 has functionally active ribonucleolytic activity. In some instances, the RNASET2 polypeptide has an internal deletion or substitution.
[0263] In some embodiments, the RNASET2 polypeptide has an enhanced plasma half-life. In some instances, the plasma half-life comprises at least 30 minutes, 45 minutes, 60 minutes, 75 minutes, or 90 minutes, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 18 hours, 24 hours, 36 hours, 48 hours, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 14 days, 21 days, 28 days, 30 days, or longer than the plasma half-life of the wild-type RNASET2 protein.
[0264] In some embodiments, the RNASET2 polypeptide is a conjugate. In some embodiments, the RNASET2 conjugate comprises an RNASET2 polypeptide comprising at least one amino acid and a conjugating moiety bound to the at least one 1 amino acid. In some embodiments, the at least one amino acid is located proximal to the N-terminus (e.g., proximal to the N-terminal residue). For example, the at least one amino acid is located optionally within the first 10, 20, 30, 40, or 50 residues from the N-terminus. In some cases, the at least one amino acid is located at the N-terminus (i.e., the at least one amino acid is the N-terminal residue of the RNASET2 polypeptide). In other embodiments, the at least one amino acid is located proximal to the C-terminus (e.g., proximal to the C-terminal residue). For example, the at least one amino acid is located optionally within the first 10, 20, 30, 40, or 50 residues from the C-terminus. In some cases, the at least one amino acid is located at the C-terminus (i.e., the at least one amino acid is the C-terminal residue of the RNASET2 polypeptide). In some instances, the RNASET2 conjugate has an enhanced plasma half-life, such as the half-lifes described herein. In some embodiments, the RNASET2 conjugate is functionally active (e.g., retains ribonucleolytic activity). In some embodiments, the RNASET2 conjugate is not functionally active (e.g., devoid of ribonucleolytic activity). In some embodiments, the conjugating moiety comprises a polymer comprising Polyethylene glycol (PEG).
[0265] In some embodiments, the RNASET2 polypeptide is fused with a second polypeptide. In some embodiments, the second polypeptide comprises a polypeptide with a long plasma half-life relative to the plasma half-life of the RNASET2 polypeptide. In some embodiments, the second polypeptide comprises an antibody or antibody fragment. In some embodiments, the antibody or antibody fragment comprises an IgG1, IgG2, IgG4, IgG3, or IgE. In some embodiments, the IgG is an Fc. In some embodiments, the IgG Fc is human. In some instances, the long plasma half-life polypeptide comprises HSA, transferrin, IgA monomer, Retinol-binding protein, Factor H, Factor XIII, C-reactive protein, Factor IX, Fibrinogen, IFN-alpha, Pentameric IgM, IL-2, or Thyroglobulin. In some instances, the RNASET2-Fc comprises RSLV-132.
TNF Superfamily Member 15 (TL1A) TL1A Modulators
[0266] In some embodiments, the therapeutic agent comprises a modulator and/or antagonist of TNF Superfamily Member 15 (TL1A), or the gene encoding TL1A (TNFSF15). In some embodiments, the modulator of TL1A is an antagonist of TL1A. In some embodiments the therapeutic agent or the additional therapeutic agent comprises an inhibitor of TL1A expression or activity. In some embodiments the therapeutic agent comprises an inhibitor of TL1A expression or activity. In some cases, the inhibitor of TL1A expression or activity is effective to inhibit TL1A-DR3 binding. In some embodiments, the inhibitor of TL1A expression or activity comprises an allosteric modulator of TL1A. An allosteric modulator of TL1A may indirectly influence the effects TL1A on DR3, or TR6/DcR3 on TL1A or DR3. The inhibitor of TL1A expression or activity may be a direct inhibitor or indirect inhibitor. Non-limiting examples of an inhibitor of TL1A expression include RNA to protein TL1A translation inhibitors, antisense oligonucleotides targeting the TNFSF15 mRNA (such as miRNAs, or siRNA), epigenetic editing (such as targeting the DNA-binding domain of TNFSF15, or post-translational modifications of histone tails and/or DNA molecules). Non-limiting examples of an inhibitor of TL1A activity include antagonists to the TL1A receptors, (DR3 and TR6/DcR3), antagonists to TL1A antigen, and antagonists to gene expression products involved in TL1A mediated disease. Antagonists as disclosed herein, may include, but are not limited to, an anti-TL1A antibody, an anti-TL1A-binding antibody fragment, or a small molecule. The small molecule may be a small molecule that binds to TL1A or DR3. The anti-TL1A antibody may be monoclonal or polyclonal. The anti-TL1A antibody may be humanized or chimeric. The anti-TL1A antibody may be a fusion protein. The anti-TL1A antibody may be a blocking anti-TL1A antibody. A blocking antibody blocks binding between two proteins, e.g., a ligand and its receptor. Therefore, a TL1A blocking antibody includes an antibody that prevents binding of TL1A to DR3 or TR6/DcR3 receptors. In a non-limiting example, the TL1A blocking antibody binds to DR3. In another example, the TL1A blocking antibody binds to DcR3. In some cases, the anti-TL1A antibody is an anti-TL1A antibody that specifically binds to TL1A.
[0267] The anti-TL1A antibody may comprise one or more of the antibody sequences of Table 8. The anti-DR3 antibody may comprise an amino acid sequence that is at least 85% identical to any one of SEQ ID NOS: 358-370 and an amino acid sequence that is at least 85% identical to any one of SEQ ID NOS: 371-375. The anti-DR3 antibody may comprise an amino acid sequence comprising the HCDR1, HCDR2, HCDR3 domains of any one of SEQ ID NOS: 358-370 and the LCDR1, LCDR2, and LCDR3 domains of any one of SEQ ID NOS: 371-375.
[0268] In some embodiments, an anti-TL1A antibody comprises a heavy chain comprising three complementarity-determining regions: HCDR1, HCDR2, and HCDR3; and a light chain comprising three complementarity-determining regions: LCDR1, LCDR2, and LCDR3. In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 209, a HCDR2 comprising SEQ ID NO: 210, a HCDR3 comprising SEQ ID NO: 211, a LCDR1 comprising SEQ ID NO: 212, a LCDR2 comprising SEQ ID NO: 213, and a LCDR3 comprising SEQ ID NO: 214. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 215 and a light chain (LC) variable domain comprising SEQ ID NO: 216.
[0269] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 217, a HCDR2 comprising SEQ ID NO: 218, a HCDR3 comprising SEQ ID NO: 219, a LCDR1 comprising SEQ ID NO: 220, a LCDR2 comprising SEQ ID NO: 221, and a LCDR3 comprising SEQ ID NO: 222. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 223 and a light chain (LC) variable domain comprising SEQ ID NO: 224.
[0270] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 225, a HCDR2 comprising SEQ ID NO: 226, a HCDR3 comprising SEQ ID NO: 227, a LCDR1 comprising SEQ ID NO: 228, a LCDR2 comprising SEQ ID NO: 229, and a LCDR3 comprising SEQ ID NO: 230. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 231 and a light chain (LC) variable domain comprising SEQ ID NO: 232.
[0271] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 233, a HCDR2 comprising SEQ ID NO: 234, a HCDR3 comprising SEQ ID NO: 235, a LCDR1 comprising SEQ ID NO: 239, a LCDR2 comprising SEQ ID NO: 240, and a LCDR3 comprising SEQ ID NO: 241. In some cases, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 236, a HCDR2 comprising SEQ ID NO: 237, a HCDR3 comprising SEQ ID NO: 238, a LCDR1 comprising SEQ ID NO: 239, a LCDR2 comprising SEQ ID NO: 240, and a LCDR3 comprising SEQ ID NO: 241. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 242 and a light chain (LC) variable domain comprising SEQ ID NO: 243. In some cases, the anti-TL1A antibody comprises a heavy chain comprising SEQ ID NO: 244. In some cases, the anti-TL1A antibody comprises a light chain comprising SEQ ID NO: 245.
[0272] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 246, a HCDR2 comprising SEQ ID NO: 247, a HCDR3 comprising SEQ ID NO: 248, a LCDR1 comprising SEQ ID NO: 249, a LCDR2 comprising SEQ ID NO: 250, and a LCDR3 comprising SEQ ID NO: 251. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 252 and a light chain (LC) variable domain comprising SEQ ID NO: 253.
[0273] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 254, a HCDR2 comprising SEQ ID NO: 255, a HCDR3 comprising SEQ ID NO: 256, a LCDR1 comprising SEQ ID NO: 257, a LCDR2 comprising SEQ ID NO: 258, and a LCDR3 comprising SEQ ID NO: 259. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 260 and a light chain (LC) variable domain comprising SEQ ID NO: 261.
[0274] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 262, a HCDR2 comprising SEQ ID NO: 264, a HCDR3 comprising SEQ ID NO: 265, a LCDR1 comprising SEQ ID NO: 267, a LCDR2 comprising SEQ ID NO: 269, and a LCDR3 comprising SEQ ID NO: 270. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 275. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 276. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 277. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 278.
[0275] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 262, a HCDR2 comprising SEQ ID NO: 264, a HCDR3 comprising SEQ ID NO: 265, a LCDR1 comprising SEQ ID NO: 268, a LCDR2 comprising SEQ ID NO: 269, and a LCDR3 comprising SEQ ID NO: 270. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 279. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 280. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 281. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 271 and a light chain (LC) variable domain comprising SEQ ID NO: 282.
[0276] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 262, a HCDR2 comprising SEQ ID NO: 264, a HCDR3 comprising SEQ ID NO: 265, a LCDR1 comprising SEQ ID NO: 267, a LCDR2 comprising SEQ ID NO: 269, and a LCDR3 comprising SEQ ID NO: 270. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 275. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 276. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 277. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 278.
[0277] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 262, a HCDR2 comprising SEQ ID NO: 264, a HCDR3 comprising SEQ ID NO: 265, a LCDR1 comprising SEQ ID NO: 268, a LCDR2 comprising SEQ ID NO: 269, and a LCDR3 comprising SEQ ID NO: 270. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 279. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 280. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 281. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 272 and a light chain (LC) variable domain comprising SEQ ID NO: 282.
[0278] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 263, a HCDR2 comprising SEQ ID NO: 264, a HCDR3 comprising SEQ ID NO: 266, a LCDR1 comprising SEQ ID NO: 267, a LCDR2 comprising SEQ ID NO: 269, and a LCDR3 comprising SEQ ID NO: 270. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 275. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 276. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 277. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 278. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 279. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 280. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 281. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 273 and a light chain (LC) variable domain comprising SEQ ID NO: 282.
[0279] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 263, a HCDR2 comprising SEQ ID NO: 264, a HCDR3 comprising SEQ ID NO: 266, a LCDR1 comprising SEQ ID NO: 268, a LCDR2 comprising SEQ ID NO: 269, and a LCDR3 comprising SEQ ID NO: 270. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 279. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 280. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 281. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 282. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 275. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 276. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 277. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 274 and a light chain (LC) variable domain comprising SEQ ID NO: 278.
[0280] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 283, a HCDR2 comprising SEQ ID NO: 284, a HCDR3 comprising SEQ ID NO: 285, a LCDR1 comprising SEQ ID NO: 286, a LCDR2 comprising SEQ ID NO: 287, and a LCDR3 comprising SEQ ID NO: 288. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 289 and a light chain (LC) variable domain comprising SEQ ID NO: 294. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 289 and a light chain (LC) variable domain comprising SEQ ID NO: 295. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 289 and a light chain (LC) variable domain comprising SEQ ID NO: 296. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 289 and a light chain (LC) variable domain comprising SEQ ID NO: 297. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 290 and a light chain (LC) variable domain comprising SEQ ID NO: 294. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 290 and a light chain (LC) variable domain comprising SEQ ID NO: 295. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 290 and a light chain (LC) variable domain comprising SEQ ID NO: 296. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 290 and a light chain (LC) variable domain comprising SEQ ID NO: 297. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 291 and a light chain (LC) variable domain comprising SEQ ID NO: 294. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 291 and a light chain (LC) variable domain comprising SEQ ID NO: 295. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 291 and a light chain (LC) variable domain comprising SEQ ID NO: 296. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 291 and a light chain (LC) variable domain comprising SEQ ID NO: 297. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 292 and a light chain (LC) variable domain comprising SEQ ID NO: 294. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 292 and a light chain (LC) variable domain comprising SEQ ID NO: 295. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 292 and a light chain (LC) variable domain comprising SEQ ID NO: 296. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 292 and a light chain (LC) variable domain comprising SEQ ID NO: 297. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 293 and a light chain (LC) variable domain comprising SEQ ID NO: 294. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 293 and a light chain (LC) variable domain comprising SEQ ID NO: 295. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 293 and a light chain (LC) variable domain comprising SEQ ID NO: 296. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 293 and a light chain (LC) variable domain comprising SEQ ID NO: 297.
[0281] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 298, a HCDR2 comprising SEQ ID NO: 299, a HCDR3 comprising SEQ ID NO: 300, a LCDR1 comprising SEQ ID NO: 301, a LCDR2 comprising SEQ ID NO: 302, and a LCDR3 comprising SEQ ID NO: 303. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 304 and a light chain (LC) variable domain comprising SEQ ID NO: 305. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 306 and a light chain (LC) variable domain comprising SEQ ID NO: 307. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 308 and a light chain (LC) variable domain comprising SEQ ID NO: 309. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 310 and a light chain (LC) variable domain comprising SEQ ID NO: 311. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 312 and a light chain (LC) variable domain comprising SEQ ID NO: 313. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 314 and a light chain (LC) variable domain comprising SEQ ID NO: 315. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 316 and a light chain (LC) variable domain comprising SEQ ID NO: 317. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 318 and a light chain (LC) variable domain comprising SEQ ID NO: 319. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 320 and a light chain (LC) variable domain comprising SEQ ID NO: 321. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 322 and a light chain (LC) variable domain comprising SEQ ID NO: 323. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 324 and a light chain (LC) variable domain comprising SEQ ID NO: 325. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 326 and a light chain (LC) variable domain comprising SEQ ID NO: 327.
[0282] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 328, a HCDR2 comprising SEQ ID NO: 329, a HCDR3 comprising SEQ ID NO: 330, a LCDR1 comprising SEQ ID NO: 331, a LCDR2 comprising SEQ ID NO: 332, and a LCDR3 comprising SEQ ID NO: 333. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 334 and a light chain (LC) variable domain comprising SEQ ID NO: 335.
[0283] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 336, a HCDR2 comprising SEQ ID NO: 337, a HCDR3 comprising SEQ ID NO: 338, a LCDR1 comprising SEQ ID NO: 339, a LCDR2 comprising SEQ ID NO: 340, and a LCDR3 comprising SEQ ID NO: 341. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 342 and a light chain (LC) variable domain comprising SEQ ID NO: 343.
[0284] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 346, a HCDR2 comprising SEQ ID NO: 347, a HCDR3 comprising SEQ ID NO: 348, a LCDR1 comprising SEQ ID NO: 349, a LCDR2 comprising SEQ ID NO: 350, and a LCDR3 comprising SEQ ID NO: 351. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 344 and a light chain (LC) variable domain comprising SEQ ID NO: 345. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 352 and a light chain (LC) variable domain comprising SEQ ID NO: 353. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 354 and a light chain (LC) variable domain comprising SEQ ID NO: 355. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 356 and a light chain (LC) variable domain comprising SEQ ID NO: 357.
[0285] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 376, a HCDR2 comprising SEQ ID NO: 377, a HCDR3 comprising SEQ ID NO: 378, a LCDR1 comprising SEQ ID NO: 379, a LCDR2 comprising SEQ ID NO: 380, and a LCDR3 comprising SEQ ID NO: 381. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 382 and a light chain (LC) variable domain comprising SEQ ID NO: 383.
[0286] In some embodiments, the anti-TL1A antibody comprises a HCDR1 comprising SEQ ID NO: 384, a HCDR2 comprising SEQ ID NO: 385, a HCDR3 comprising SEQ ID NO: 386, a LCDR1 comprising SEQ ID NO: 387, a LCDR2 comprising SEQ ID NO: 388, and a LCDR3 comprising SEQ ID NO: 399. In some cases, the anti-TL1A antibody comprises a heavy chain (HC) variable domain comprising SEQ ID NO: 390 and a light chain (LC) variable domain comprising SEQ ID NO: 391.
[0287] In some embodiments, the anti-TL1A antibody comprises one or more of A101-A177 of Table 2. In some embodiments, the anti-TL1A antibody is A100. In some embodiments, the anti-TL1A antibody is A101. In some embodiments, the anti-TL1A antibody is A102. In some embodiments, the anti-TL1A antibody is A103. In some embodiments, the anti-TL1A antibody is A104. In some embodiments, the anti-TL1A antibody is A105. In some embodiments, the anti-TL1A antibody is A106. In some embodiments, the anti-TL1A antibody is A107. In some embodiments, the anti-TL1A antibody is A108. In some embodiments, the anti-TL1A antibody is A109. In some embodiments, the anti-TL1A antibody is A110. In some embodiments, the anti-TL1A antibody is A111. In some embodiments, the anti-TL1A antibody is A112. In some embodiments, the anti-TL1A antibody is A113. In some embodiments, the anti-TL1A antibody is A114. In some embodiments, the anti-TL1A antibody is A115. In some embodiments, the anti-TL1A antibody is A116. In some embodiments, the anti-TL1A antibody is A117. In some embodiments, the anti-TL1A antibody is A118. In some embodiments, the anti-TL1A antibody is A119. In some embodiments, the anti-TL1A antibody is A120. In some embodiments, the anti-TL1A antibody is A121. In some embodiments, the anti-TL1A antibody is A122. In some embodiments, the anti-TL1A antibody is A123. In some embodiments, the anti-TL1A antibody is A124. In some embodiments, the anti-TL1A antibody is A125. In some embodiments, the anti-TL1A antibody is A126. In some embodiments, the anti-TL1A antibody is A127. In some embodiments, the anti-TL1A antibody is A128. In some embodiments, the anti-TL1A antibody is A129. In some embodiments, the anti-TL1A antibody is A130. In some embodiments, the anti-TL1A antibody is A131. In some embodiments, the anti-TL1A antibody is A132. In some embodiments, the anti-TL1A antibody is A133. In some embodiments, the anti-TL1A antibody is A134. In some embodiments, the anti-TL1A antibody is A135. In some embodiments, the anti-TL1A antibody is A136. In some embodiments, the anti-TL1A antibody is A137. In some embodiments, the anti-TL1A antibody is A138. In some embodiments, the anti-TL1A antibody is A139. In some embodiments, the anti-TL1A antibody is A140. In some embodiments, the anti-TL1A antibody is A141. In some embodiments, the anti-TL1A antibody is A142. In some embodiments, the anti-TL1A antibody is A143. In some embodiments, the anti-TL1A antibody is A144. In some embodiments, the anti-TL1A antibody is A145. In some embodiments, the anti-TL1A antibody is A146. In some embodiments, the anti-TL1A antibody is A147. In some embodiments, the anti-TL1A antibody is A148. In some embodiments, the anti-TL1A antibody is A149. In some embodiments, the anti-TL1A antibody is A150. In some embodiments, the anti-TL1A antibody is A151. In some embodiments, the anti-TL1A antibody is A152. In some embodiments, the anti-TL1A antibody is A153. In some embodiments, the anti-TL1A antibody is A154. In some embodiments, the anti-TL1A antibody is A155. In some embodiments, the anti-TL1A antibody is A156. In some embodiments, the anti-TL1A antibody is A157. In some embodiments, the anti-TL1A antibody is A158. In some embodiments, the anti-TL1A antibody is A159. In some embodiments, the anti-TL1A antibody is A160. In some embodiments, the anti-TL1A antibody is A161. In some embodiments, the anti-TL1A antibody is A162. In some embodiments, the anti-TL1A antibody is A163. In some embodiments, the anti-TL1A antibody is A164. In some embodiments, the anti-TL1A antibody is A165. In some embodiments, the anti-TL1A antibody is A166. In some embodiments, the anti-TL1A antibody is A167. In some embodiments, the anti-TL1A antibody is A168. In some embodiments, the anti-TL1A antibody is A169. In some embodiments, the anti-TL1A antibody is A170. In some embodiments, the anti-TL1A antibody is A171. In some embodiments, the anti-TL1A antibody is A172. In some embodiments, the anti-TL1A antibody is A173. In some embodiments, the anti-TL1A antibody is A174. In some embodiments, the anti-TL1A antibody is A175. In some embodiments, the anti-TL1A antibody is A176. In some embodiments, the anti-TL1A antibody is A177.
[0288] In some embodiments, the anti-DR3 is A178. In some embodiments, the anti-DR3 is A179. In some embodiments, the anti-DR3 is A180. In some embodiments, the anti-DR3 is A181. In some embodiments, the anti-DR3 is A182. In some embodiments, the anti-DR3 is A183. In some embodiments, the anti-DR3 is A184. In some embodiments, the anti-DR3 is A185. In some embodiments, the anti-DR3 is A186. In some embodiments, the anti-DR3 is A187. In some embodiments, the anti-DR3 is A188. In some embodiments, the anti-DR3 is A189. In some embodiments, the anti-DR3 is A190. In some embodiments, the anti-DR3 is A191. In some embodiments, the anti-DR3 is A192. In some embodiments, the anti-DR3 is A193. In some embodiments, the anti-DR3 is A194. In some embodiments, the anti-DR3 is A195. In some embodiments, the anti-DR3 is A196. In some embodiments, the anti-DR3 is A197. In some embodiments, the anti-DR3 is A198. In some embodiments, the anti-DR3 is A199. In some embodiments, the anti-DR3 is A200. In some embodiments, the anti-DR3 is A201. In some embodiments, the anti-DR3 is A202. In some embodiments, the anti-DR3 is A203. In some embodiments, the anti-DR3 is A204. In some embodiments, the anti-DR3 is A205. In some embodiments, the anti-DR3 is A206. In some embodiments, the anti-DR3 is A207. In some embodiments, the anti-DR3 is A208. In some embodiments, the anti-DR3 is A209. In some embodiments, the anti-DR3 is A210. In some embodiments, the anti-DR3 is A211. In some embodiments, the anti-DR3 is A212. In some embodiments, the anti-DR3 is A213. In some embodiments, the anti-DR3 is A214. In some embodiments, the anti-DR3 is A215. In some embodiments, the anti-DR3 is A216. In some embodiments, the anti-DR3 is A217. In some embodiments, the anti-DR3 is A218. In some embodiments, the anti-DR3 is A219. In some embodiments, the anti-DR3 is A220. In some embodiments, the anti-DR3 is A221. In some embodiments, the anti-DR3 is A222. In some embodiments, the anti-DR3 is A223. In some embodiments, the anti-DR3 is A224. In some embodiments, the anti-DR3 is A225. In some embodiments, the anti-DR3 is A226. In some embodiments, the anti-DR3 is A227. In some embodiments, the anti-DR3 is A228. In some embodiments, the anti-DR3 is A229. In some embodiments, the anti-DR3 is A230. In some embodiments, the anti-DR3 is A231. In some embodiments, the anti-DR3 is A232. In some embodiments, the anti-DR3 is A233. In some embodiments, the anti-DR3 is A234. In some embodiments, the anti-DR3 is A235. In some embodiments, the anti-DR3 is A236. In some embodiments, the anti-DR3 is A237. In some embodiments, the anti-DR3 is A238. In some embodiments, the anti-DR3 is A239. In some embodiments, the anti-DR3 is A240. In some embodiments, the anti-DR3 is A241. In some embodiments, the anti-DR3 is A242.
TABLE-US-00003 TABLE 2 Non-Limiting Examples of anti-TL1A and anti-DR3 Antibodies Antibody HC Variable Domain LC Variable Domain Name (SEQ ID NO) (SEQ ID NO) A100 215 216 A101 223 224 A102 231 232 A103 242 243 A104 252 253 A105 260 261 A106 271 275 A107 271 276 A108 271 277 A109 271 278 A110 271 279 A111 271 280 A112 271 281 A113 271 282 A114 272 275 A115 272 276 A116 272 277 A117 272 278 A118 272 279 A119 272 280 A120 272 281 A121 272 282 A122 273 275 A123 273 276 A124 273 277
[0289] A therapeutic agent may be used alone or in combination with an additional therapeutic agent. In some cases, an “additional therapeutic agent” as used herein is administered alone. The therapeutic agents may be administered together or sequentially. The combination therapies may be administered within the same day, or may be administered one or more days, weeks, months, or years apart. In some cases, a therapeutic agent provided herein is administered if the subject is determined to be non-responsive to a first line of therapy, e.g., such as TNF inhibitor. Such determination may be made by treatment with the first line therapy and monitoring of disease state and/or diagnostic determination that the subject would be non-responsive to the first line therapy.
[0290] In some embodiments, the additional therapeutic agent comprises an anti-TNF therapy, e.g., an anti-TNFα therapy. In some embodiments, the additional therapeutic agent comprises a second-line treatment to an anti-TNF therapy. In some embodiments, the additional therapeutic agent comprises an immunosuppressant, or a class of drugs that suppress, or reduce, the strength of the immune system. In some embodiments, the immunosuppressant is an antibody. Non-limiting examples of immunosuppressant therapeutic agents include STELARA® (ustekinumab) azathioprine (AZA), 6-mercaptopurine (6-MP), methotrexate, cyclosporin A. (CsA).
[0291] In some embodiments, the additional therapeutic agent comprises a selective anti-inflammatory drug, or a class of drugs that specifically target pro-inflammatory molecules in the body. In some embodiments, the anti-inflammatory drug comprises an antibody. In some embodiments, the anti-inflammatory drug comprises a small molecule. Non-limiting examples of anti-inflammatory drugs include ENTYVIO (vedolizumab), corticosteroids, aminosalicylates, mesalamine, balsalazide (Colazal) and olsalazine (Dipentum).
[0292] In some embodiments, the additional therapeutic agent comprises a stem cell therapy. The stem cell therapy may be embryonic or somatic stem cells. The stem cells may be isolated from a donor (allogeneic) or isolated from the subject (autologous). The stem cells may be expanded adipose-derived stem cells (eASCs), hematopoietic stem cells (HSCs), mesenchymal stem (stromal) cells (MSCs), or induced pluripotent stem cells (iPSCs) derived from the cells of the subject. In some embodiments, the therapeutic agent comprises Cx601/Alofisel® (darvadstrocel).
[0293] In some embodiments, the additional therapeutic agent comprises a small molecule. The small molecule may be used to treat inflammatory diseases or conditions, or fibrostenonic or fibrotic disease. Non-limiting examples of small molecules include Otezla® (apremilast), alicaforsen, or ozanimod (RPC-1063).
[0294] In some embodiments, the additional therapeutic agent comprises an agonist or antagonist Janus Kinase 1 (JAK1). Non-limiting examples of JAK1 inhibitors include Ruxolitinib (INCB018424), S-Ruxolitinib (INCB018424), Baricitinib (LY3009104, INCB028050), Filgotinib (GLPG0634), Momelotinib (CYT387), Cerdulatinib (PRT062070, PRT2070), LY2784544, NVP-BSK805, 2HC1, Tofacitinib (CP-690550,Tasocitinib), XL019, Pacritinib (SB1518), or ZM 39923 HCl.
[0295] Pharmaceutical Compositions, Formulations, and Methods of Administration
[0296] In one aspect, methods of treating a subject, e.g., a subject having a CD-PBmu subtype, monocyte 2 subtype, monocyte 1 subtype, or any combination thereof, involve administration of a pharmaceutical composition comprising a therapeutic agent described herein, e.g., a modulatory of expression and/or activity of a biomarker in Table 4 or Table 7B, or of a biomolecule in a pathway of a biomarker in Table 4 or Table 7B, in therapeutically effective amounts to said subject. In some embodiments, a therapeutic agent described herein is used in the preparation of medicaments for treating an inflammatory disease, such as Crohn's Disease.
[0297] In certain embodiments, the compositions containing the therapeutic agent described herein are administered for prophylactic and/or therapeutic treatments. In certain therapeutic applications, the compositions are administered to a patient already suffering from a disease or condition, in an amount sufficient to cure or at least partially arrest at least one of the symptoms of the disease or condition. Amounts effective for this use depend on the severity and course of the disease or condition, previous therapy, the patient's health status, weight, and response to the drugs, and the judgment of the treating physician. Therapeutically effective amounts are optionally determined by methods including, but not limited to, a dose escalation clinical trial. In some cases, a therapeutic agent is administered to a patient suffering from an inflammatory disease such as CD, and optionally comprises a CD-PBmu subtype and/or monocyte 1 or 2 subtype.
[0298] In prophylactic applications, compositions containing a therapeutic agent described herein are administered to a patient susceptible to or otherwise at risk of a particular disease, disorder or condition, e.g., an inflammatory disease. Such an amount is defined to be a “prophylactically effective amount or dose.” In this use, the precise amounts also depend on the patient's state of health, weight, and the like. When used in a patient, effective amounts for this use will depend on the severity and course of the disease, disorder or condition, previous therapy, the patient's health status and response to the drugs, and the judgment of the treating physician.
[0299] In certain embodiments wherein the patient's condition does not improve, upon the doctor's discretion the administration of therapeutic agent is administered chronically, that is, for an extended period of time, including throughout the duration of the patient's life in order to ameliorate or otherwise control or limit the symptoms of the patient's disease or condition.
[0300] In certain embodiments wherein a patient's status does improve, the dose of therapeutic agent being administered may be temporarily reduced or temporarily suspended for a certain length of time (i.e., a “drug holiday”). In specific embodiments, the length of the drug holiday is between 2 days and 1 year, including by way of example only, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 15 days, 20 days, 28 days, or more than 28 days. The dose reduction during a drug holiday is, by way of example only, by 10%-100%, including by way of example only 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, and 100%.
[0301] In certain embodiments, the dose of drug being administered may be temporarily reduced or temporarily suspended for a certain length of time (i.e., a “drug diversion”). In specific embodiments, the length of the drug diversion is between 2 days and 1 year, including by way of example only, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 15 days, 20 days, 28 days, or more than 28 days. The dose reduction during a drug diversion is, by way of example only, by 10%-100%, including by way of example only 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, and 100%. After a suitable length of time, the normal dosing schedule is optionally reinstated.
[0302] In some embodiments, once improvement of the patient's conditions has occurred, a maintenance dose is administered if necessary. Subsequently, in specific embodiments, the dosage or the frequency of administration, or both, is reduced, as a function of the symptoms, to a level at which the improved disease, disorder or condition is retained. In certain embodiments, however, the patient requires intermittent treatment on a long-term basis upon any recurrence of symptoms.
[0303] The amount of a given therapeutic agent that corresponds to such an amount varies depending upon factors such as the particular therapeutic agent, disease condition and its severity, the identity (e.g., weight, sex, age) of the subject in need of treatment, but can nevertheless be determined according to the particular circumstances surrounding the case, including, e.g., the specific agent being administered, the route of administration, the condition being treated, and the subject or host being treated. In general, however, doses employed for adult human treatment are typically in the range of 0.01 mg-5000 mg per day. In one aspect, doses employed for adult human treatment are from about 1 mg to about 1000 mg per day. In one embodiment, the desired dose is conveniently presented in a single dose or in divided doses administered simultaneously (or over a short period of time) or at appropriate intervals, for example as two, three, four or more sub-doses per day.
[0304] In some embodiments, as a patient is started on a regimen of a therapeutic agent, the patient is also weaned off (e.g., step-wise decrease in dose) a second treatment regimen.
[0305] In one embodiment, the daily dosages appropriate for a therapeutic agent herein are from about 0.01 to about 10 mg/kg per body weight. In specific embodiments, an indicated daily dosage in a large mammal, including, but not limited to, humans, is in the range from about 0.5 mg to about 1000 mg, conveniently administered in divided doses, including, but not limited to, up to four times a day. In some embodiments, the daily dosage is administered in extended release form. In certain embodiments, suitable unit dosage forms for oral administration comprise from about 1 to 500 mg active ingredient. In some embodiments, the daily dosage or the amount of active in the dosage form are lower or higher than the ranges indicated herein, based on a number of variables in regard to an individual treatment regime. In various embodiments, the daily and unit dosages are altered depending on a number of variables including, but not limited to, the activity of the therapeutic agent used, the disease or condition to be treated, the mode of administration, the requirements of the individual subject, the severity of the disease or condition being treated, and the judgment of the practitioner.
[0306] Toxicity and therapeutic efficacy of such therapeutic regimens are determined by standard pharmaceutical procedures in cell cultures or experimental animals, including, but not limited to, the determination of the LD.sub.50 and the ED.sub.50. The dose ratio between the toxic and therapeutic effects is the therapeutic index and it is expressed as the ratio between LD.sub.50 and ED.sub.50. In certain embodiments, the data obtained from cell culture assays and animal studies are used in formulating the therapeutically effective daily dosage range and/or the therapeutically effective unit dosage amount for use in mammals, including humans. In some embodiments, the daily dosage amount of the therapeutic agent described herein lies within a range of circulating concentrations that include the ED.sub.50 with minimal toxicity. In certain embodiments, the daily dosage range and/or the unit dosage amount varies within this range depending upon the dosage form employed and the route of administration utilized.
[0307] Disclosed herein are therapeutic agents formulated into pharmaceutical compositions. Pharmaceutical compositions are formulated in a conventional manner using one or more pharmaceutically acceptable inactive ingredients that facilitate processing of the active therapeutic agent into preparations that can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen. A summary of pharmaceutical compositions described herein can be found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa. 1975; Liberman, H. A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams & Wilkins, 1999), herein incorporated by reference for such disclosure.
[0308] Provided herein are pharmaceutical compositions that include a therapeutic agent described herein, and at least one pharmaceutically acceptable inactive ingredient. In some embodiments, the therapeutic agents described herein are administered as pharmaceutical compositions in which the therapeutic agents are mixed with other active ingredients, as in combination therapy. In some embodiments, the pharmaceutical compositions include other medicinal or pharmaceutical agents, carriers, adjuvants, preserving, stabilizing, wetting or emulsifying agents, solution promoters, salts for regulating the osmotic pressure, and/or buffers. In some embodiments, the pharmaceutical compositions include other therapeutically valuable substances.
[0309] A pharmaceutical composition, as used herein, refers to a mixture of a therapeutic agent, with other chemical components (i.e. pharmaceutically acceptable inactive ingredients), such as carriers, excipients, binders, filling agents, suspending agents, flavoring agents, sweetening agents, disintegrating agents, dispersing agents, surfactants, lubricants, colorants, diluents, solubilizers, moistening agents, plasticizers, stabilizers, penetration enhancers, wetting agents, anti-foaming agents, antioxidants, preservatives, or one or more combination thereof. Optionally, the compositions include two or more therapeutic agent as discussed herein. In practicing the methods of treatment or use provided herein, therapeutically effective amounts of therapeutic agents described herein are administered in a pharmaceutical composition to a mammal having a disease, disorder, or condition to be treated, e.g., an inflammatory disease, fibrostenotic disease, and/or fibrotic disease. In some embodiments, the mammal is a human. A therapeutically effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the therapeutic agent used and other factors. The therapeutic agents can be used singly or in combination with one or more therapeutic agents as components of mixtures.
[0310] The pharmaceutical formulations described herein are administered to a subject by appropriate administration routes, including but not limited to, oral, parenteral (e.g., intravenous, subcutaneous, intramuscular), intranasal, buccal, topical, or transdermal administration routes. The pharmaceutical formulations described herein include, but are not limited to, aqueous liquid dispersions, self-emulsifying dispersions, solid solutions, liposomal dispersions, aerosols, solid dosage forms, powders, immediate release formulations, controlled release formulations, fast melt formulations, tablets, capsules, pills, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate and controlled release formulations.
[0311] Pharmaceutical compositions including a therapeutic agent are manufactured in a conventional manner, such as, by way of example only, by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or compression processes.
[0312] The pharmaceutical compositions may include at least a therapeutic agent as an active ingredient in free-acid or free-base form, or in a pharmaceutically acceptable salt form. In addition, the methods and pharmaceutical compositions described herein include the use of N-oxides (if appropriate), crystalline forms, amorphous phases, as well as active metabolites of these compounds having the same type of activity. In some embodiments, therapeutic agents exist in unsolvated form or in solvated forms with pharmaceutically acceptable solvents such as water, ethanol, and the like. The solvated forms of the therapeutic agents are also considered to be disclosed herein.
[0313] In some embodiments, a therapeutic agent exists as a tautomer. All tautomers are included within the scope of the agents presented herein. As such, it is to be understood that a therapeutic agent or a salt thereof may exhibit the phenomenon of tautomerism whereby two chemical compounds that are capable of facile interconversion by exchanging a hydrogen atom between two atoms, to either of which it forms a covalent bond. Since the tautomeric compounds exist in mobile equilibrium with each other they may be regarded as different isomeric forms of the same compound.
[0314] In some embodiments, a therapeutic agent exists as an enantiomer, diastereomer, or other steroisomeric form. The agents disclosed herein include all enantiomeric, diastereomeric, and epimeric forms as well as mixtures thereof.
[0315] In some embodiments, therapeutic agents described herein may be prepared as prodrugs. A “prodrug” refers to an agent that is converted into the parent drug in vivo. Prodrugs are often useful because, in some situations, they may be easier to administer than the parent drug. They may, for instance, be bioavailable by oral administration whereas the parent is not. The prodrug may also have improved solubility in pharmaceutical compositions over the parent drug. An example, without limitation, of a prodrug would be a therapeutic agent described herein, which is administered as an ester (the “prodrug”) to facilitate transmittal across a cell membrane where water solubility is detrimental to mobility but which then is metabolically hydrolyzed to the carboxylic acid, the active entity, once inside the cell where water-solubility is beneficial. A further example of a prodrug might be a short peptide (polyaminoacid) bonded to an acid group where the peptide is metabolized to reveal the active moiety. In certain embodiments, upon in vivo administration, a prodrug is chemically converted to the biologically, pharmaceutically or therapeutically active form of the therapeutic agent. In certain embodiments, a prodrug is enzymatically metabolized by one or more steps or processes to the biologically, pharmaceutically or therapeutically active form of the therapeutic agent.
[0316] Prodrug forms of the therapeutic agents, wherein the prodrug is metabolized in vivo to produce an agent as set forth herein are included within the scope of the claims. Prodrug forms of the herein described therapeutic agents, wherein the prodrug is metabolized in vivo to produce an agent as set forth herein are included within the scope of the claims. In some cases, some of the therapeutic agents described herein may be a prodrug for another derivative or active compound. In some embodiments described herein, hydrazones are metabolized in vivo to produce a therapeutic agent.
[0317] In certain embodiments, compositions provided herein include one or more preservatives to inhibit microbial activity. Suitable preservatives include mercury-containing substances such as merfen and thiomersal; stabilized chlorine dioxide; and quaternary ammonium compounds such as benzalkonium chloride, cetyltrimethylammonium bromide and cetylpyridinium chloride.
[0318] In some embodiments, formulations described herein benefit from antioxidants, metal chelating agents, thiol containing compounds and other general stabilizing agents. Examples of such stabilizing agents, include, but are not limited to: (a) about 0.5% to about 2% w/v glycerol, (b) about 0.1% to about 1% w/v methionine, (c) about 0.1% to about 2% w/v monothioglycerol, (d) about 1 mM to about 10 mM EDTA, (e) about 0.01% to about 2% w/v ascorbic acid, (f) 0.003% to about 0.02% w/v polysorbate 80, (g) 0.001% to about 0.05% w/v. polysorbate 20, (h) arginine, (i) heparin, (j) dextran sulfate, (k) cyclodextrins, (1) pentosan polysulfate and other heparinoids, (m) divalent cations such as magnesium and zinc; or (n) combinations thereof.
[0319] The pharmaceutical compositions described herein are formulated into any suitable dosage form, including but not limited to, aqueous oral dispersions, liquids, gels, syrups, elixirs, slurries, suspensions, solid oral dosage forms, aerosols, controlled release formulations, fast melt formulations, effervescent formulations, lyophilized formulations, tablets, powders, pills, dragees, capsules, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate release and controlled release formulations. In one aspect, a therapeutic agent as discussed herein, e.g., therapeutic agent is formulated into a pharmaceutical composition suitable for intramuscular, subcutaneous, or intravenous injection. In one aspect, formulations suitable for intramuscular, subcutaneous, or intravenous injection include physiologically acceptable sterile aqueous or non-aqueous solutions, dispersions, suspensions or emulsions, and sterile powders for reconstitution into sterile injectable solutions or dispersions. Examples of suitable aqueous and non-aqueous carriers, diluents, solvents, or vehicles include water, ethanol, polyols (propyleneglycol, polyethylene-glycol, glycerol, cremophor and the like), suitable mixtures thereof, vegetable oils (such as olive oil) and injectable organic esters such as ethyl oleate. Proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants. In some embodiments, formulations suitable for subcutaneous injection also contain additives such as preserving, wetting, emulsifying, and dispensing agents. Prevention of the growth of microorganisms can be ensured by various antibacterial and antifungal agents, such as parabens, chlorobutanol, phenol, sorbic acid, and the like. In some cases it is desirable to include isotonic agents, such as sugars, sodium chloride, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, such as aluminum monostearate and gelatin.
[0320] For intravenous injections or drips or infusions, a therapeutic agent described herein is formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline buffer. For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art. For other parenteral injections, appropriate formulations include aqueous or nonaqueous solutions, preferably with physiologically compatible buffers or excipients. Such excipients are known.
[0321] Parenteral injections may involve bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g., in ampoules or in multi-dose containers, with an added preservative. The pharmaceutical composition described herein may be in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents. In one aspect, the active ingredient is in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.
[0322] For administration by inhalation, a therapeutic agent is formulated for use as an aerosol, a mist or a powder. Pharmaceutical compositions described herein are conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebuliser, with the use of a suitable propellant, e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol, the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of, such as, by way of example only, gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the therapeutic agent described herein and a suitable powder base such as lactose or starch.
[0323] Representative intranasal formulations are described in, for example, U.S. Pat. Nos. 4,476,116, 5,116,817 and 6,391,452. Formulations that include a therapeutic agent are prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, fluorocarbons, and/or other solubilizing or dispersing agents known in the art. See, for example, Ansel, H. C. et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, Sixth Ed. (1995). Preferably these compositions and formulations are prepared with suitable nontoxic pharmaceutically acceptable ingredients. These ingredients are known to those skilled in the preparation of nasal dosage forms and some of these can be found in REMINGTON: THE SCIENCE AND PRACTICE OF PHARMACY, 21st edition, 2005. The choice of suitable carriers is dependent upon the exact nature of the nasal dosage form desired, e.g., solutions, suspensions, ointments, or gels. Nasal dosage forms generally contain large amounts of water in addition to the active ingredient. Minor amounts of other ingredients such as pH adjusters, emulsifiers or dispersing agents, preservatives, surfactants, gelling agents, or buffering and other stabilizing and solubilizing agents are optionally present. Preferably, the nasal dosage form should be isotonic with nasal secretions.
[0324] Pharmaceutical preparations for oral use are obtained by mixing one or more solid excipient with one or more of the therapeutic agents described herein, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients include, for example, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methylcellulose, microcrystalline cellulose, hydroxypropylmethylcellulose, sodium carboxymethylcellulose; or others such as: polyvinylpyrrolidone (PVP or povidone) or calcium phosphate. If desired, disintegrating agents are added, such as the cross-linked croscarmellose sodium, polyvinylpyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. In some embodiments, dyestuffs or pigments are added to the tablets or dragee coatings for identification or to characterize different combinations of active therapeutic agent doses.
[0325] In some embodiments, pharmaceutical formulations of a therapeutic agent are in the form of a capsules, including push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active therapeutic agent is dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In some embodiments, stabilizers are added. A capsule may be prepared, for example, by placing the bulk blend of the formulation of the therapeutic agent inside of a capsule. In some embodiments, the formulations (non-aqueous suspensions and solutions) are placed in a soft gelatin capsule. In other embodiments, the formulations are placed in standard gelatin capsules or non-gelatin capsules such as capsules comprising HPMC. In other embodiments, the formulation is placed in a sprinkle capsule, wherein the capsule is swallowed whole or the capsule is opened and the contents sprinkled on food prior to eating.
[0326] All formulations for oral administration are in dosages suitable for such administration. In one aspect, solid oral dosage forms are prepared by mixing a therapeutic agent with one or more of the following: antioxidants, flavoring agents, and carrier materials such as binders, suspending agents, disintegration agents, filling agents, surfactants, solubilizers, stabilizers, lubricants, wetting agents, and diluents. In some embodiments, the solid dosage forms disclosed herein are in the form of a tablet, (including a suspension tablet, a fast-melt tablet, a bite-disintegration tablet, a rapid-disintegration tablet, an effervescent tablet, or a caplet), a pill, a powder, a capsule, solid dispersion, solid solution, bioerodible dosage form, controlled release formulations, pulsatile release dosage forms, multiparticulate dosage forms, beads, pellets, granules. In other embodiments, the pharmaceutical formulation is in the form of a powder. Compressed tablets are solid dosage forms prepared by compacting the bulk blend of the formulations described above. In various embodiments, tablets will include one or more flavoring agents. In other embodiments, the tablets will include a film surrounding the final compressed tablet. In some embodiments, the film coating can provide a delayed release of a therapeutic agent from the formulation. In other embodiments, the film coating aids in patient compliance (e.g., Opadry® coatings or sugar coating). Film coatings including Opadry® typically range from about 1% to about 3% of the tablet weight. In some embodiments, solid dosage forms, e.g., tablets, effervescent tablets, and capsules, are prepared by mixing particles of a therapeutic agent with one or more pharmaceutical excipients to form a bulk blend composition. The bulk blend is readily subdivided into equally effective unit dosage forms, such as tablets, pills, and capsules. In some embodiments, the individual unit dosages include film coatings. These formulations are manufactured by conventional formulation techniques.
[0327] In another aspect, dosage forms include microencapsulated formulations. In some embodiments, one or more other compatible materials are present in the microencapsulation material. Exemplary materials include, but are not limited to, pH modifiers, erosion facilitators, anti-foaming agents, antioxidants, flavoring agents, and carrier materials such as binders, suspending agents, disintegration agents, filling agents, surfactants, solubilizers, stabilizers, lubricants, wetting agents, and diluents. Exemplary useful microencapsulation materials include, but are not limited to, hydroxypropyl cellulose ethers (HPC) such as Klucel® or Nisso HPC, low-substituted hydroxypropyl cellulose ethers (L-HPC), hydroxypropyl methyl cellulose ethers (HPMC) such as Seppifilm-LC, Pharmacoat®, Metolose SR, Methocel®-E, Opadry YS, PrimaFlo, Benecel MP824, and Benecel MP843, methylcellulose polymers such as Methocel®-A, hydroxypropylmethylcellulose acetate stearate Aqoat (HF-LS, HF-LG,HF-MS) and Metolose®, Ethylcelluloses (EC) and mixtures thereof such as E461, Ethocel®, Aqualon®-EC, Surelease®, Polyvinyl alcohol (PVA) such as Opadry AMB, hydroxyethylcelluloses such as Natrosol®, carboxymethylcelluloses and salts of carboxymethylcelluloses (CMC) such as Aqualon®-CMC, polyvinyl alcohol and polyethylene glycol co-polymers such as Kollicoat monoglycerides (Myverol), triglycerides (KLX), polyethylene glycols, modified food starch, acrylic polymers and mixtures of acrylic polymers with cellulose ethers such as Eudragit® EPO, Eudragit® L30D-55, Eudragit® FS 30D Eudragit® L100-55, Eudragit® L100, Eudragit® S100, Eudragit® RD100, Eudragit® E100, Eudragit® L12.5, Eudragit® S12.5, Eudragit® NE30D, and Eudragit® NE 40D, cellulose acetate phthalate, sepifilms such as mixtures of HPMC and stearic acid, cyclodextrins, and mixtures of these materials.
[0328] Liquid formulation dosage forms for oral administration are optionally aqueous suspensions selected from the group including, but not limited to, pharmaceutically acceptable aqueous oral dispersions, emulsions, solutions, elixirs, gels, and syrups. See, e.g., Singh et al., Encyclopedia of Pharmaceutical Technology, 2nd Ed., pp. 754-757 (2002). In addition to therapeutic agent the liquid dosage forms optionally include additives, such as: (a) disintegrating agents; (b) dispersing agents; (c) wetting agents; (d) at least one preservative, (e) viscosity enhancing agents, (f) at least one sweetening agent, and (g) at least one flavoring agent. In some embodiments, the aqueous dispersions further includes a crystal-forming inhibitor.
[0329] In some embodiments, the pharmaceutical formulations described herein are self-emulsifying drug delivery systems (SEDDS). Emulsions are dispersions of one immiscible phase in another, usually in the form of droplets. Generally, emulsions are created by vigorous mechanical dispersion. SEDDS, as opposed to emulsions or microemulsions, spontaneously form emulsions when added to an excess of water without any external mechanical dispersion or agitation. An advantage of SEDDS is that only gentle mixing is required to distribute the droplets throughout the solution. Additionally, water or the aqueous phase is optionally added just prior to administration, which ensures stability of an unstable or hydrophobic active ingredient. Thus, the SEDDS provides an effective delivery system for oral and parenteral delivery of hydrophobic active ingredients. In some embodiments, SEDDS provides improvements in the bioavailability of hydrophobic active ingredients. Methods of producing self-emulsifying dosage forms include, but are not limited to, for example, U.S. Pat. Nos. 5,858,401, 6,667,048, and 6,960,563.
[0330] Buccal formulations that include a therapeutic agent are administered using a variety of formulations known in the art. For example, such formulations include, but are not limited to, U.S. Pat. Nos. 4,229,447, 4,596,795, 4,755,386, and 5,739,136. In addition, the buccal dosage forms described herein can further include a bioerodible (hydrolysable) polymeric carrier that also serves to adhere the dosage form to the buccal mucosa. For buccal or sublingual administration, the compositions may take the form of tablets, lozenges, or gels formulated in a conventional manner.
[0331] For intravenous injections, a therapeutic agent is optionally formulated in aqueous solutions, preferably in physiologically compatible buffers such as Hank's solution, Ringer's solution, or physiological saline buffer. For transmucosal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. For other parenteral injections, appropriate formulations include aqueous or nonaqueous solutions, preferably with physiologically compatible buffers or excipients.
[0332] Parenteral injections optionally involve bolus injection or continuous infusion. Formulations for injection are optionally presented in unit dosage form, e.g., in ampoules or in multi dose containers, with an added preservative. In some embodiments, a pharmaceutical composition described herein is in a form suitable for parenteral injection as a sterile suspensions, solutions or emulsions in oily or aqueous vehicles, and contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Pharmaceutical formulations for parenteral administration include aqueous solutions of an agent that modulates the activity of a carotid body in water soluble form. Additionally, suspensions of an agent that modulates the activity of a carotid body are optionally prepared as appropriate, e.g., oily injection suspensions.
[0333] Conventional formulation techniques include, e.g., one or a combination of methods: (1) dry mixing, (2) direct compression, (3) milling, (4) dry or non-aqueous granulation, (5) wet granulation, or (6) fusion. Other methods include, e.g., spray drying, pan coating, melt granulation, granulation, fluidized bed spray drying or coating (e.g., wurster coating), tangential coating, top spraying, tableting, extruding and the like.
[0334] Suitable carriers for use in the solid dosage forms described herein include, but are not limited to, acacia, gelatin, colloidal silicon dioxide, calcium glycerophosphate, calcium lactate, maltodextrin, glycerine, magnesium silicate, sodium caseinate, soy lecithin, sodium chloride, tricalcium phosphate, dipotassium phosphate, sodium stearoyl lactylate, carrageenan, monoglyceride, diglyceride, pregelatinized starch, hydroxypropylmethylcellulose, hydroxypropylmethylcellulose acetate stearate, sucrose, microcrystalline cellulose, lactose, mannitol and the like.
[0335] Suitable filling agents for use in the solid dosage forms described herein include, but are not limited to, lactose, calcium carbonate, calcium phosphate, dibasic calcium phosphate, calcium sulfate, microcrystalline cellulose, cellulose powder, dextrose, dextrates, dextran, starches, pregelatinized starch, hydroxypropylmethycellulose (HPMC), hydroxypropylmethycellulose phthalate, hydroxypropylmethylcellulose acetate stearate (HPMCAS), sucrose, xylitol, lactitol, mannitol, sorbitol, sodium chloride, polyethylene glycol, and the like.
[0336] Suitable disintegrants for use in the solid dosage forms described herein include, but are not limited to, natural starch such as corn starch or potato starch, a pregelatinized starch, or sodium starch glycolate, a cellulose such as methylcrystalline cellulose, methylcellulose, microcrystalline cellulose, croscarmellose, or a cross-linked cellulose, such as cross-linked sodium carboxymethylcellulose, cross-linked carboxymethylcellulose, or cross-linked croscarmellose, a cross-linked starch such as sodium starch glycolate, a cross-linked polymer such as crospovidone, a cross-linked polyvinylpyrrolidone, alginate such as alginic acid or a salt of alginic acid such as sodium alginate, a gum such as agar, guar, locust bean, Karaya, pectin, or tragacanth, sodium starch glycolate, bentonite, sodium lauryl sulfate, sodium lauryl sulfate in combination starch, and the like.
[0337] Binders impart cohesiveness to solid oral dosage form formulations: for powder filled capsule formulation, they aid in plug formation that can be filled into soft or hard shell capsules and for tablet formulation, they ensure the tablet remaining intact after compression and help assure blend uniformity prior to a compression or fill step. Materials suitable for use as binders in the solid dosage forms described herein include, but are not limited to, carboxymethylcellulose, methylcellulose, hydroxypropylmethylcellulose, hydroxypropylmethylcellulose acetate stearate, hydroxyethylcellulose, hydroxypropylcellulose, ethylcellulose, and microcrystalline cellulose, microcrystalline dextrose, amylose, magnesium aluminum silicate, polysaccharide acids, bentonites, gelatin, polyvinylpyrrolidone/vinyl acetate copolymer, crospovidone, povidone, starch, pregelatinized starch, tragacanth, dextrin, a sugar, such as sucrose, glucose, dextrose, molasses, mannitol, sorbitol, xylitol, lactose, a natural or synthetic gum such as acacia, tragacanth, ghatti gum, mucilage of isapol husks, starch, polyvinylpyrrolidone, larch arabogalactan, polyethylene glycol, waxes, sodium alginate, and the like.
[0338] In general, binder levels of 20-70% are used in powder-filled gelatin capsule formulations. Binder usage level in tablet formulations varies whether direct compression, wet granulation, roller compaction, or usage of other excipients such as fillers which itself can act as moderate binder. Binder levels of up to 70% in tablet formulations is common.
[0339] Suitable lubricants or glidants for use in the solid dosage forms described herein include, but are not limited to, stearic acid, calcium hydroxide, talc, corn starch, sodium stearyl fumerate, alkali-metal and alkaline earth metal salts, such as aluminum, calcium, magnesium, zinc, stearic acid, sodium stearates, magnesium stearate, zinc stearate, waxes, Stearowet®, boric acid, sodium benzoate, sodium acetate, sodium chloride, leucine, a polyethylene glycol or a methoxypolyethylene glycol such as Carbowax™ PEG 4000, PEG 5000, PEG 6000, propylene glycol, sodium oleate, glyceryl behenate, glyceryl palmitostearate, glyceryl benzoate, magnesium or sodium lauryl sulfate, and the like.
[0340] Suitable diluents for use in the solid dosage forms described herein include, but are not limited to, sugars (including lactose, sucrose, and dextrose), polysaccharides (including dextrates and maltodextrin), polyols (including mannitol, xylitol, and sorbitol), cyclodextrins and the like.
[0341] Suitable wetting agents for use in the solid dosage forms described herein include, for example, oleic acid, glyceryl monostearate, sorbitan monooleate, sorbitan monolaurate, triethanolamine oleate, polyoxyethylene sorbitan monooleate, polyoxyethylene sorbitan monolaurate, quaternary ammonium compounds (e.g., Polyquat 10®), sodium oleate, sodium lauryl sulfate, magnesium stearate, sodium docusate, triacetin, vitamin E TPGS and the like.
[0342] Suitable surfactants for use in the solid dosage forms described herein include, for example, sodium lauryl sulfate, sorbitan monooleate, polyoxyethylene sorbitan monooleate, polysorbates, polaxomers, bile salts, glyceryl monostearate, copolymers of ethylene oxide and propylene oxide, e.g., Pluronic® (BASF), and the like.
[0343] Suitable suspending agents for use in the solid dosage forms described here include, but are not limited to, polyvinylpyrrolidone, e.g., polyvinylpyrrolidone K12, polyvinylpyrrolidone K17, polyvinylpyrrolidone K25, or polyvinylpyrrolidone K30, polyethylene glycol, e.g., the polyethylene glycol can have a molecular weight of about 300 to about 6000, or about 3350 to about 4000, or about 7000 to about 5400, vinyl pyrrolidone/vinyl acetate copolymer (S630), sodium carboxymethylcellulose, methylcellulose, hydroxy-propylmethylcellulose, polysorbate-80, hydroxyethylcellulose, sodium alginate, gums, such as, e.g., gum tragacanth and gum acacia, guar gum, xanthans, including xanthan gum, sugars, cellulosics, such as, e.g., sodium carboxymethylcellulose, methylcellulose, sodium carboxymethylcellulose, hydroxypropylmethylcellulose, hydroxyethylcellulose, polysorbate-80, sodium alginate, polyethoxylated sorbitan monolaurate, polyethoxylated sorbitan monolaurate, povidone and the like.
[0344] Suitable antioxidants for use in the solid dosage forms described herein include, for example, e.g., butylated hydroxytoluene (BHT), sodium ascorbate, and tocopherol.
[0345] It should be appreciated that there is considerable overlap between additives used in the solid dosage forms described herein. Thus, the above-listed additives should be taken as merely exemplary, and not limiting, of the types of additives that can be included in solid dosage forms of the pharmaceutical compositions described herein. The amounts of such additives can be readily determined by one skilled in the art, according to the particular properties desired.
[0346] In various embodiments, the particles of a therapeutic agents and one or more excipients are dry blended and compressed into a mass, such as a tablet, having a hardness sufficient to provide a pharmaceutical composition that substantially disintegrates within less than about 30 minutes, less than about 35 minutes, less than about 40 minutes, less than about 45 minutes, less than about 50 minutes, less than about 55 minutes, or less than about 60 minutes, after oral administration, thereby releasing the formulation into the gastrointestinal fluid.
[0347] In other embodiments, a powder including a therapeutic agent is formulated to include one or more pharmaceutical excipients and flavors. Such a powder is prepared, for example, by mixing the therapeutic agent and optional pharmaceutical excipients to form a bulk blend composition. Additional embodiments also include a suspending agent and/or a wetting agent. This bulk blend is uniformly subdivided into unit dosage packaging or multi-dosage packaging units.
[0348] In still other embodiments, effervescent powders are also prepared. Effervescent salts have been used to disperse medicines in water for oral administration.
[0349] In some embodiments, the pharmaceutical dosage forms are formulated to provide a controlled release of a therapeutic agent. Controlled release refers to the release of the therapeutic agent from a dosage form in which it is incorporated according to a desired profile over an extended period of time. Controlled release profiles include, for example, sustained release, prolonged release, pulsatile release, and delayed release profiles. In contrast to immediate release compositions, controlled release compositions allow delivery of an agent to a subject over an extended period of time according to a predetermined profile. Such release rates can provide therapeutically effective levels of agent for an extended period of time and thereby provide a longer period of pharmacologic response while minimizing side effects as compared to conventional rapid release dosage forms. Such longer periods of response provide for many inherent benefits that are not achieved with the corresponding short acting, immediate release preparations.
[0350] In some embodiments, the solid dosage forms described herein are formulated as enteric coated delayed release oral dosage forms, i.e., as an oral dosage form of a pharmaceutical composition as described herein which utilizes an enteric coating to affect release in the small intestine or large intestine. In one aspect, the enteric coated dosage form is a compressed or molded or extruded tablet/mold (coated or uncoated) containing granules, powder, pellets, beads or particles of the active ingredient and/or other composition components, which are themselves coated or uncoated. In one aspect, the enteric coated oral dosage form is in the form of a capsule containing pellets, beads or granules, which include a therapeutic agent that are coated or uncoated.
[0351] Any coatings should be applied to a sufficient thickness such that the entire coating does not dissolve in the gastrointestinal fluids at pH below about 5, but does dissolve at pH about 5 and above. Coatings are typically selected from any of the following: Shellac—this coating dissolves in media of pH>7; Acrylic polymers—examples of suitable acrylic polymers include methacrylic acid copolymers and ammonium methacrylate copolymers. The Eudragit series E, L, S, RL, RS and NE (Rohm Pharma) are available as solubilized in organic solvent, aqueous dispersion, or dry powders. The Eudragit series RL, NE, and RS are insoluble in the gastrointestinal tract but are permeable and are used primarily for colonic targeting. The Eudragit series E dissolve in the stomach. The Eudragit series L, L-30D and S are insoluble in stomach and dissolve in the intestine; Poly Vinyl Acetate Phthalate (PVAP)—PVAP dissolves in pH>5, and it is much less permeable to water vapor and gastric fluids. Conventional coating techniques such as spray or pan coating are employed to apply coatings. The coating thickness must be sufficient to ensure that the oral dosage form remains intact until the desired site of topical delivery in the intestinal tract is reached.
[0352] In other embodiments, the formulations described herein are delivered using a pulsatile dosage form. A pulsatile dosage form is capable of providing one or more immediate release pulses at predetermined time points after a controlled lag time or at specific sites. Exemplary pulsatile dosage forms and methods of their manufacture are disclosed in U.S. Pat. Nos. 5,011,692, 5,017,381, 5,229,135, 5,840,329 and 5,837,284. In one embodiment, the pulsatile dosage form includes at least two groups of particles, (i.e. multiparticulate) each containing the formulation described herein. The first group of particles provides a substantially immediate dose of a therapeutic agent upon ingestion by a mammal. The first group of particles can be either uncoated or include a coating and/or sealant. In one aspect, the second group of particles comprises coated particles. The coating on the second group of particles provides a delay of from about 2 hours to about 7 hours following ingestion before release of the second dose. Suitable coatings for pharmaceutical compositions are described herein or known in the art.
[0353] In some embodiments, pharmaceutical formulations are provided that include particles of a therapeutic agent and at least one dispersing agent or suspending agent for oral administration to a subject. The formulations may be a powder and/or granules for suspension, and upon admixture with water, a substantially uniform suspension is obtained.
[0354] In some embodiments, particles formulated for controlled release are incorporated in a gel or a patch or a wound dressing.
[0355] In one aspect, liquid formulation dosage forms for oral administration and/or for topical administration as a wash are in the form of aqueous suspensions selected from the group including, but not limited to, pharmaceutically acceptable aqueous oral dispersions, emulsions, solutions, elixirs, gels, and syrups. See, e.g., Singh et al., Encyclopedia of Pharmaceutical Technology, 2nd Ed., pp. 754-757 (2002). In addition to the particles of a therapeutic agent, the liquid dosage forms include additives, such as: (a) disintegrating agents; (b) dispersing agents; (c) wetting agents; (d) at least one preservative, (e) viscosity enhancing agents, (f) at least one sweetening agent, and (g) at least one flavoring agent. In some embodiments, the aqueous dispersions can further include a crystalline inhibitor.
[0356] In some embodiments, the liquid formulations also include inert diluents commonly used in the art, such as water or other solvents, solubilizing agents, and emulsifiers. Exemplary emulsifiers are ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propyleneglycol, 1,3-butyleneglycol, dimethylformamide, sodium lauryl sulfate, sodium doccusate, cholesterol, cholesterol esters, taurocholic acid, phosphotidylcholine, oils, such as cottonseed oil, groundnut oil, corn germ oil, olive oil, castor oil, and sesame oil, glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols, fatty acid esters of sorbitan, or mixtures of these substances, and the like.
[0357] Furthermore, pharmaceutical compositions optionally include one or more pH adjusting agents or buffering agents, including acids such as acetic, boric, citric, lactic, phosphoric and hydrochloric acids; bases such as sodium hydroxide, sodium phosphate, sodium borate, sodium citrate, sodium acetate, sodium lactate and tris-hydroxymethylaminomethane; and buffers such as citrate/dextrose, sodium bicarbonate and ammonium chloride. Such acids, bases and buffers are included in an amount required to maintain pH of the composition in an acceptable range.
[0358] Additionally, pharmaceutical compositions optionally include one or more salts in an amount required to bring osmolality of the composition into an acceptable range. Such salts include those having sodium, potassium or ammonium cations and chloride, citrate, ascorbate, borate, phosphate, bicarbonate, sulfate, thiosulfate or bisulfite anions; suitable salts include sodium chloride, potassium chloride, sodium thiosulfate, sodium bisulfite and ammonium sulfate.
[0359] Other pharmaceutical compositions optionally include one or more preservatives to inhibit microbial activity. Suitable preservatives include mercury-containing substances such as merfen and thiomersal; stabilized chlorine dioxide; and quaternary ammonium compounds such as benzalkonium chloride, cetyltrimethylammonium bromide and cetylpyridinium chloride.
[0360] In one embodiment, the aqueous suspensions and dispersions described herein remain in a homogenous state, as defined in The USP Pharmacists' Pharmacopeia (2005 edition, chapter 905), for at least 4 hours. In one embodiment, an aqueous suspension is re-suspended into a homogenous suspension by physical agitation lasting less than 1 minute. In still another embodiment, no agitation is necessary to maintain a homogeneous aqueous dispersion.
[0361] Examples of disintegrating agents for use in the aqueous suspensions and dispersions include, but are not limited to, a starch, e.g., a natural starch such as corn starch or potato starch, a pregelatinized starch, or sodium starch glycolate; a cellulose such as methylcrystalline cellulose, methylcellulose, croscarmellose, or a cross-linked cellulose, such as cross-linked sodium carboxymethylcellulose, cross-linked carboxymethylcellulose, or cross-linked croscarmellose; a cross-linked starch such as sodium starch glycolate; a cross-linked polymer such as crospovidone; a cross-linked polyvinylpyrrolidone; alginate such as alginic acid or a salt of alginic acid such as sodium alginate; a gum such as agar, guar, locust bean, Karaya, pectin, or tragacanth; sodium starch glycolate; bentonite; a natural sponge; a surfactant; a resin such as a cation-exchange resin; citrus pulp; sodium lauryl sulfate; sodium lauryl sulfate in combination starch; and the like.
[0362] In some embodiments, the dispersing agents suitable for the aqueous suspensions and dispersions described herein include, for example, hydrophilic polymers, electrolytes, Tween® 60 or 80, PEG, polyvinylpyrrolidone, and the carbohydrate-based dispersing agents such as, for example, hydroxypropylcellulose and hydroxypropyl cellulose ethers, hydroxypropyl methylcellulose and hydroxypropyl methylcellulose ethers, carboxymethylcellulose sodium, methylcellulose, hydroxyethylcellulose, hydroxypropylmethyl-cellulose phthalate, hydroxypropylmethyl-cellulose acetate stearate, noncrystalline cellulose, magnesium aluminum silicate, triethanolamine, polyvinyl alcohol (PVA), polyvinylpyrrolidone/vinyl acetate copolymer, 4-(1,1,3,3-tetramethylbutyl)-phenol polymer with ethylene oxide and formaldehyde (also known as tyloxapol), poloxamers; and poloxamines. In other embodiments, the dispersing agent is selected from a group not comprising one of the following agents: hydrophilic polymers; electrolytes; Tween® 60 or 80; PEG; polyvinylpyrrolidone (PVP); hydroxypropylcellulose and hydroxypropyl cellulose ethers; hydroxypropyl methylcellulose and hydroxypropyl methylcellulose ethers; carboxymethylcellulose sodium; methylcellulose; hydroxyethylcellulose; hydroxypropylmethyl-cellulose phthalate; hydroxypropylmethyl-cellulose acetate stearate; non-crystalline cellulose; magnesium aluminum silicate; triethanolamine; polyvinyl alcohol (PVA); 4-(1,1,3,3-tetramethylbutyl)-phenol polymer with ethylene oxide and formaldehyde; poloxamers; or poloxamines.
[0363] Wetting agents suitable for the aqueous suspensions and dispersions described herein include, but are not limited to, cetyl alcohol, glycerol monostearate, polyoxyethylene sorbitan fatty acid esters (e.g., the commercially available Tweens® such as e.g., Tween 20® and Tween 80®, and polyethylene glycols, oleic acid, glyceryl monostearate, sorbitan monooleate, sorbitan monolaurate, triethanolamine oleate, polyoxyethylene sorbitan monooleate, polyoxyethylene sorbitan monolaurate, sodium oleate, sodium lauryl sulfate, sodium docusate, triacetin, vitamin E TPGS, sodium taurocholate, simethicone, phosphotidylcholine and the like.
[0364] Suitable preservatives for the aqueous suspensions or dispersions described herein include, for example, potassium sorbate, parabens (e.g., methylparaben and propylparaben), benzoic acid and its salts, other esters of parahydroxybenzoic acid such as butylparaben, alcohols such as ethyl alcohol or benzyl alcohol, phenolic compounds such as phenol, or quaternary compounds such as benzalkonium chloride. Preservatives, as used herein, are incorporated into the dosage form at a concentration sufficient to inhibit microbial growth.
[0365] Suitable viscosity enhancing agents for the aqueous suspensions or dispersions described herein include, but are not limited to, methyl cellulose, xanthan gum, carboxymethyl cellulose, hydroxypropyl cellulose, hydroxypropylmethyl cellulose, Plasdon® S-630, carbomer, polyvinyl alcohol, alginates, acacia, chitosans and combinations thereof. The concentration of the viscosity enhancing agent will depend upon the agent selected and the viscosity desired.
[0366] Examples of sweetening agents suitable for the aqueous suspensions or dispersions described herein include, for example, acacia syrup, acesulfame K, alitame, aspartame, chocolate, cinnamon, citrus, cocoa, cyclamate, dextrose, fructose, ginger, glycyrrhetinate, Glycyrrhiza (licorice) syrup, monoammonium glyrrhizinate (MagnaSweet®), malitol, mannitol, menthol, neohesperidine DC, neotame, Prosweet® Powder, saccharin, sorbitol, Stevia, sucralose, sucrose, sodium saccharin, saccharin, aspartame, acesulfame potassium, mannitol, sucralose, tagatose, thaumatin, vanilla, xylitol, or any combination thereof.
[0367] In some embodiments, a therapeutic agent is prepared as transdermal dosage form. In some embodiments, the transdermal formulations described herein include at least three components: (1) a therapeutic agent; (2) a penetration enhancer; and (3) an optional aqueous adjuvant. In some embodiments the transdermal formulations include additional components such as, but not limited to, gelling agents, creams and ointment bases, and the like. In some embodiments, the transdermal formulation is presented as a patch or a wound dressing. In some embodiments, the transdermal formulation further include a woven or non-woven backing material to enhance absorption and prevent the removal of the transdermal formulation from the skin. In other embodiments, the transdermal formulations described herein can maintain a saturated or supersaturated state to promote diffusion into the skin.
[0368] In one aspect, formulations suitable for transdermal administration of a therapeutic agent described herein employ transdermal delivery devices and transdermal delivery patches and can be lipophilic emulsions or buffered, aqueous solutions, dissolved and/or dispersed in a polymer or an adhesive. In one aspect, such patches are constructed for continuous, pulsatile, or on demand delivery of pharmaceutical agents. Still further, transdermal delivery of the therapeutic agents described herein can be accomplished by means of iontophoretic patches and the like. In one aspect, transdermal patches provide controlled delivery of a therapeutic agent. In one aspect, transdermal devices are in the form of a bandage comprising a backing member, a reservoir containing the therapeutic agent optionally with carriers, optionally a rate controlling barrier to deliver the therapeutic agent to the skin of the host at a controlled and predetermined rate over a prolonged period of time, and means to secure the device to the skin.
[0369] In further embodiments, topical formulations include gel formulations (e.g., gel patches which adhere to the skin). In some of such embodiments, a gel composition includes any polymer that forms a gel upon contact with the body (e.g., gel formulations comprising hyaluronic acid, pluronic polymers, poly(lactic-co-glycolic acid (PLGA)-based polymers or the like). In some forms of the compositions, the formulation comprises a low-melting wax such as, but not limited to, a mixture of fatty acid glycerides, optionally in combination with cocoa butter which is first melted. Optionally, the formulations further comprise a moisturizing agent.
[0370] In certain embodiments, delivery systems for pharmaceutical therapeutic agents may be employed, such as, for example, liposomes and emulsions. In certain embodiments, compositions provided herein can also include an mucoadhesive polymer, selected from among, for example, carboxymethylcellulose, carbomer (acrylic acid polymer), poly(methylmethacrylate), polyacrylamide, polycarbophil, acrylic acid/butyl acrylate copolymer, sodium alginate and dextran.
[0371] In some embodiments, a therapeutic agent described herein may be administered topically and can be formulated into a variety of topically administrable compositions, such as solutions, suspensions, lotions, gels, pastes, medicated sticks, balms, creams or ointments. Such pharmaceutical therapeutic agents can contain solubilizers, stabilizers, tonicity enhancing agents, buffers and preservatives.
Kits
[0372] The disclosure also provides kits for detecting expression of one or more genes in Table 1A or Table 7A. Exemplary kits include nucleic acids configured for specific hybridization to one or more genes in Table 1A or Table 7A. In some cases a kit comprises a plurality of such nucleic acids immobilized on a substrate, such as a microarray, welled plate, chip, or other material suitable for microfluidic processing.
[0373] In some embodiments, the kit includes nucleic acid and/or polypeptide isolation reagents. In some embodiments, the kit includes one or more detection reagents, for example probes and/or primers for amplification of, or hybridization to, a gene in Table 1A or Table 7A. In some embodiments, the kit includes primers and probes for control genes, such as housekeeping genes. In some embodiments, the primers and probes for control genes are used, for example, in AG calculations. In some embodiments, the probes or primers are labeled with an enzymatic, florescent, or radionuclide label.
[0374] In some instances, a kit comprises a nucleic acid polymer (e.g., primer and/or probe) comprising at least about 10 contiguous nucleobases having at least about 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity or homology to a biomarker of Table 1A or Table 7A.
[0375] In some embodiments, kits include a carrier, package, or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) including one of the separate elements to be used in a method described herein. Suitable containers include, for example, bottles, vials, syringes, and test tubes. In other embodiments, the containers are formed from a variety of materials such as glass or plastic.
[0376] In some embodiments, a kit includes one or more additional containers, each with one or more of various materials (such as reagents, optionally in concentrated form, and/or devices) desirable from a commercial and user standpoint for use of described herein. Non-limiting examples of such materials include, but not limited to, buffers, primers, enzymes, diluents, filters, carrier, package, container, vial and/or tube labels listing contents and/or instructions for use and package inserts with instructions for use. A set of instructions is optionally included. In a further embodiment, a label is on or associated with the container. In yet a further embodiment, a label is on a container when letters, numbers or other characters forming the label are attached, molded or etched into the container itself; a label is associated with a container when it is present within a receptacle or carrier that also holds the container, e.g., as a package insert. In other embodiments a label is used to indicate that the contents are to be used for a specific therapeutic application. In yet another embodiment, a label also indicates directions for use of the contents, such as in the methods described herein.
Systems
[0377] Disclosed herein, in some embodiments, is a system for detecting a particular subtype of IBD or CD in a subject. In some embodiments, the subtype is CD-PBmu. In some embodiments, the subtype is CD PBT. In some embodiments, the subtype is monocyte 2 subtype. In some embodiments, the subtype is monocyte 1 subtype. The system is configured to implement the methods described in this disclosure, including, but not limited to, detecting the presence of a particular CD subtype to determine whether the subject is suitable for treatment with a particular therapy.
[0378] In some embodiments, disclosed herein is a system for detecting a IBD subtype in a subject, comprising: (a) a computer processing device, optionally connected to a computer network; and (b) a software module executed by the computer processing device to analyze a target nucleic acid sequence of a transcriptomic profile in a sample from a subject. In some instances, the system comprises a central processing unit (CPU), memory (e.g., random access memory, flash memory), electronic storage unit, computer program, communication interface to communicate with one or more other systems, and any combination thereof. In some instances, the system is coupled to a computer network, for example, the Internet, intranet, and/or extranet that is in communication with the Internet, a telecommunication, or data network. In some embodiments, the system comprises a storage unit to store data and information regarding any aspect of the methods described in this disclosure. Various aspects of the system are a product or article or manufacture.
[0379] One feature of a computer program includes a sequence of instructions, executable in the digital processing device's CPU, written to perform a specified task. In some embodiments, computer readable instructions are implemented as program modules, such as functions, features, Application Programming Interfaces (APIs), data structures, and the like, that perform particular tasks or implement particular abstract data types. In light of the disclosure provided herein, those of skill in the art will recognize that a computer program may be written in various versions of various languages.
[0380] The functionality of the computer readable instructions are combined or distributed as desired in various environments. In some instances, a computer program comprises one sequence of instructions or a plurality of sequences of instructions. A computer program may be provided from one location. A computer program may be provided from a plurality of locations. In some embodiment, a computer program includes one or more software modules. In some embodiments, a computer program includes, in part or in whole, one or more web applications, one or more mobile applications, one or more standalone applications, one or more web browser plug-ins, extensions, add-ins, or add-ons, or combinations thereof
Web Application
[0381] In some embodiments, a computer program includes a web application. In light of the disclosure provided herein, those of skill in the art will recognize that a web application may utilize one or more software frameworks and one or more database systems. A web application, for example, is created upon a software framework such as Microsoft®.NET or Ruby on Rails (RoR). A web application, in some instances, utilizes one or more database systems including, by way of non-limiting examples, relational, non-relational, feature oriented, associative, and XML database systems. Suitable relational database systems include, by way of non-limiting examples, Microsoft® SQL Server, mySQL™, and Oracle®. Those of skill in the art will also recognize that a web application may be written in one or more versions of one or more languages. In some embodiments, a web application is written in one or more markup languages, presentation definition languages, client-side scripting languages, server-side coding languages, database query languages, or combinations thereof. In some embodiments, a web application is written to some extent in a markup language such as Hypertext Markup Language (HTML), Extensible Hypertext Markup Language (XHTML), or eXtensible Markup Language (XML). In some embodiments, a web application is written to some extent in a presentation definition language such as Cascading Style Sheets (CSS). In some embodiments, a web application is written to some extent in a client-side scripting language such as Asynchronous Javascript and XML (AJAX), Flash® Actionscript, Javascript, or Silverlight®. In some embodiments, a web application is written to some extent in a server-side coding language such as Active Server Pages (ASP), ColdFusion®, Perl, Java™, JavaServer Pages (JSP), Hypertext Preprocessor (PHP), Python™, Ruby, Tcl, Smalltalk, WebDNA®, or Groovy. In some embodiments, a web application is written to some extent in a database query language such as Structured Query Language (SQL). A web application may integrate enterprise server products such as IBM® Lotus Domino®. A web application may include a media player element. A media player element may utilize one or more of many suitable multimedia technologies including, by way of non-limiting examples, Adobe® Flash®, HTML 5, Apple® QuickTime®, Microsoft® Silverlight®, Java™, and Unity®.
Mobile Application
[0382] In some instances, a computer program includes a mobile application provided to a mobile digital processing device. The mobile application may be provided to a mobile digital processing device at the time it is manufactured. The mobile application may be provided to a mobile digital processing device via the computer network described herein.
[0383] A mobile application is created by techniques known to those of skill in the art using hardware, languages, and development environments known to the art. Those of skill in the art will recognize that mobile applications may be written in several languages. Suitable programming languages include, by way of non-limiting examples, C, C++, C#, Featureive-C, Java™, Javascript, Pascal, Feature Pascal, Python™, Ruby, VB.NET, WML, and XHTML/HTML with or without CSS, or combinations thereof.
[0384] Suitable mobile application development environments are available from several sources. Commercially available development environments include, by way of non-limiting examples, AirplaySDK, alcheMo, Appcelerator®, Celsius, Bedrock, Flash Lite, .NET Compact Framework, Rhomobile, and WorkLight Mobile Platform. Other development environments may be available without cost including, by way of non-limiting examples, Lazarus, MobiFlex, MoSync, and Phonegap. Also, mobile device manufacturers distribute software developer kits including, by way of non-limiting examples, iPhone and iPad (iOS) SDK, Android™ SDK, BlackBerry® SDK, BREW SDK, Palm® OS SDK, Symbian SDK, webOS SDK, and Windows® Mobile SDK.
[0385] Those of skill in the art will recognize that several commercial forums are available for distribution of mobile applications including, by way of non-limiting examples, Apple® App Store, Android™ Market, BlackBerry® App World, App Store for Palm devices, App Catalog for webOS, Windows® Marketplace for Mobile, Ovi Store for Nokia® devices, Samsung® Apps, and Nintendo® DSi Shop.
[0386] Standalone Application
[0387] In some embodiments, a computer program includes a standalone application, which is a program that may be run as an independent computer process, not an add-on to an existing process, e.g., not a plug-in. Those of skill in the art will recognize that standalone applications are sometimes compiled. In some instances, a compiler is a computer program(s) that transforms source code written in a programming language into binary feature code such as assembly language or machine code. Suitable compiled programming languages include, by way of non-limiting examples, C, C++, Featureive-C, COBOL, Delphi, Eiffel, Java™, Lisp, Python™, Visual Basic, and VB NET, or combinations thereof. Compilation may be often performed, at least in part, to create an executable program. In some instances, a computer program includes one or more executable complied applications.
[0388] Web Browser Plug-in
[0389] A computer program, in some aspects, includes a web browser plug-in. In computing, a plug-in, in some instances, is one or more software components that add specific functionality to a larger software application. Makers of software applications may support plug-ins to enable third-party developers to create abilities which extend an application, to support easily adding new features, and to reduce the size of an application. When supported, plug-ins enable customizing the functionality of a software application. For example, plug-ins are commonly used in web browsers to play video, generate interactivity, scan for viruses, and display particular file types. Those of skill in the art will be familiar with several web browser plug-ins including, Adobe® Flash® Player, Microsoft® Silverlight®, and Apple® QuickTime®. The toolbar may comprise one or more web browser extensions, add-ins, or add-ons. The toolbar may comprise one or more explorer bars, tool bands, or desk bands.
[0390] In view of the disclosure provided herein, those of skill in the art will recognize that several plug-in frameworks are available that enable development of plug-ins in various programming languages, including, by way of non-limiting examples, C++, Delphi, Java™, PHP, Python™, and VB .NET, or combinations thereof.
[0391] In some embodiments, Web browsers (also called Internet browsers) are software applications, designed for use with network-connected digital processing devices, for retrieving, presenting, and traversing information resources on the World Wide Web. Suitable web browsers include, by way of non-limiting examples, Microsoft® Internet Explorer®, Mozilla® Firefox®, Google® Chrome, Apple® Safari®, Opera Software® Opera®, and KDE Konqueror. The web browser, in some instances, is a mobile web browser. Mobile web browsers (also called mircrobrowsers, mini-browsers, and wireless browsers) may be designed for use on mobile digital processing devices including, by way of non-limiting examples, handheld computers, tablet computers, netbook computers, subnotebook computers, smartphones, music players, personal digital assistants (PDAs), and handheld video game systems. Suitable mobile web browsers include, by way of non-limiting examples, Google Android® browser, RIM BlackBerry® Browser, Apple® Safari®, Palm® Blazer, Palm® WebOS® Browser, Mozilla® Firefox® for mobile, Microsoft® Internet Explorer® Mobile, Amazon® Kindle® Basic Web, Nokia® Browser, Opera Software® Opera® Mobile, and Sony® PSP™ browser.
[0392] Software Modules
[0393] The medium, method, and system disclosed herein comprise one or more softwares, servers, and database modules, or use of the same. In view of the disclosure provided herein, software modules may be created by techniques known to those of skill in the art using machines, software, and languages known to the art. The software modules disclosed herein may be implemented in a multitude of ways. In some embodiments, a software module comprises a file, a section of code, a programming feature, a programming structure, or combinations thereof. A software module may comprise a plurality of files, a plurality of sections of code, a plurality of programming features, a plurality of programming structures, or combinations thereof. By way of non-limiting examples, the one or more software modules comprise a web application, a mobile application, and/or a standalone application. Software modules may be in one computer program or application. Software modules may be in more than one computer program or application. Software modules may be hosted on one machine. Software modules may be hosted on more than one machine. Software modules may be hosted on cloud computing platforms. Software modules may be hosted on one or more machines in one location. Software modules may be hosted on one or more machines in more than one location.
[0394] Databases
[0395] The medium, method, and system disclosed herein comprise one or more databases, or use of the same. In view of the disclosure provided herein, those of skill in the art will recognize that many databases are suitable for storage and retrieval of geologic profile, operator activities, division of interest, and/or contact information of royalty owners. Suitable databases include, by way of non-limiting examples, relational databases, non-relational databases, feature oriented databases, feature databases, entity-relationship model databases, associative databases, and XML databases. In some embodiments, a database is internet-based. In some embodiments, a database is web-based. In some embodiments, a database is cloud computing-based. A database may be based on one or more local computer storage devices.
[0396] Data Transmission
[0397] The subject matter described herein, including methods for detecting a particular CD subtype, are configured to be performed in one or more facilities at one or more locations. Facility locations are not limited by country and include any country or territory. In some instances, one or more steps are performed in a different country than another step of the method. In some instances, one or more steps for obtaining a sample are performed in a different country than one or more steps for detecting the presence or absence of a particular CD subtype from a sample. In some embodiments, one or more method steps involving a computer system are performed in a different country than another step of the methods provided herein. In some embodiments, data processing and analyses are performed in a different country or location than one or more steps of the methods described herein. In some embodiments, one or more articles, products, or data are transferred from one or more of the facilities to one or more different facilities for analysis or further analysis. An article includes, but is not limited to, one or more components obtained from a subject, e.g., processed cellular material. Processed cellular material includes, but is not limited to, cDNA reverse transcribed from RNA, amplified RNA, amplified cDNA, sequenced DNA, isolated and/or purified RNA, isolated and/or purified DNA, and isolated and/or purified polypeptide. Data includes, but is not limited to, information regarding the stratification of a subject, and any data produced by the methods disclosed herein. In some embodiments of the methods and systems described herein, the analysis is performed and a subsequent data transmission step will convey or transmit the results of the analysis.
[0398] In some embodiments, any step of any method described herein is performed by a software program or module on a computer. In additional or further embodiments, data from any step of any method described herein is transferred to and from facilities located within the same or different countries, including analysis performed in one facility in a particular location and the data shipped to another location or directly to an individual in the same or a different country. In additional or further embodiments, data from any step of any method described herein is transferred to and/or received from a facility located within the same or different countries, including analysis of a data input, such as genetic or processed cellular material, performed in one facility in a particular location and corresponding data transmitted to another location, or directly to an individual, such as data related to the diagnosis, prognosis, responsiveness to therapy, or the like, in the same or different location or country.
[0399] Business Methods Utilizing a Computer
[0400] The gene expression profiling methods may utilize one or more computers. The computer may be used for managing customer and sample information such as sample or customer tracking, database management, analyzing molecular profiling data, analyzing cytological data, storing data, billing, marketing, reporting results, storing results, or a combination thereof. The computer may include a monitor or other graphical interface for displaying data, results, billing information, marketing information (e.g. demographics), customer information, or sample information. The computer may also include means for data or information input. The computer may include a processing unit and fixed or removable media or a combination thereof. The computer may be accessed by a user in physical proximity to the computer, for example via a keyboard and/or mouse, or by a user that does not necessarily have access to the physical computer through a communication medium such as a modem, an internet connection, a telephone connection, or a wired or wireless communication signal carrier wave. In some cases, the computer may be connected to a server or other communication device for relaying information from a user to the computer or from the computer to a user. In some cases, the user may store data or information obtained from the computer through a communication medium on media, such as removable media. It is envisioned that data relating to the methods can be transmitted over such networks or connections for reception and/or review by a party. The receiving party can be but is not limited to an individual, a health care provider or a health care manager. In one embodiment, a computer-readable medium includes a medium suitable for transmission of a result of an analysis of a biological sample, such as exosome bio-signatures. The medium can include a result regarding an exosome bio-signature of a subject, wherein such a result is derived using the methods described herein.
[0401] The entity obtaining a gene expression profile may enter sample information into a database for the purpose of one or more of the following: inventory tracking, assay result tracking, order tracking, customer management, customer service, billing, and sales. Sample information may include, but is not limited to: customer name, unique customer identification, customer associated medical professional, indicated assay or assays, assay results, adequacy status, indicated adequacy tests, medical history of the individual, preliminary diagnosis, suspected diagnosis, sample history, insurance provider, medical provider, third party testing center or any information suitable for storage in a database. Sample history may include but is not limited to: age of the sample, type of sample, method of acquisition, method of storage, or method of transport.
[0402] The database may be accessible by a customer, medical professional, insurance provider, or other third party. Database access may take the form of electronic communication such as a computer or telephone. The database may be accessed through an intermediary such as a customer service representative, business representative, consultant, independent testing center, or medical professional. The availability or degree of database access or sample information, such as assay results, may change upon payment of a fee for products and services rendered or to be rendered. The degree of database access or sample information may be restricted to comply with generally accepted or legal requirements for patient or customer confidentiality.
EXAMPLES
[0403] While preferred embodiments have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the embodiments provided. It should be understood that various alternatives to the embodiments described herein may be employed.
Example 1: Blood Based Pre-Surgical Transcriptomic Signature
[0404] RNA expression analysis was performed on purified CD3.sup.+ T-cells isolated from paired blood and mucosal tissue from 101 CD patients with severe disease who required surgical intervention for disease management and 17 individuals without IBD. Transcriptional profiles were analyzed by RNA-seq and T-cell subset composition using xCell bioinformatic tool. Unsupervised clustering of peripheral T cells (PBT) revealed 2 distinct transcriptomic signatures: 1) gene expression from a classified CD-PBT (63%) clustered tightly with non-IBD subjects, and 2) gene expression drifted from a peripheral toward a mucosal profile, classified as CD-PBmu(cosal) (37%) (
[0405] A defining hallmark for the CD-PBmu subtype, validated in an additional patient cohort (n=19), was profoundly downregulated expression of pro-inflammatory cytokines, chemokines and adhesion molecules following surgery (FIGS. 4A-4B, Table 4). As seen in
TABLE-US-00004 TABLE 3 Unique CD-PBmu vs CD-PBT signature attributes Differential Expression Differential Gene Expression of CD-PBmu vs CD-PBT 1566 transcripts, p = 9.91E−04, FDR < 0.002, fold > 2 Enriched in pathways mediating inflammatory response, leukocyte p = 9.9E−03-5.1E−07 adhesion, migration and integrin binding T Cell Subset composition and clinical associations NKT cell enrichment in CD-PBmu vs CD-PBT p = 2.8E−09 NKT cell enrichment in CD-PBmu, but not CD-PBT, is associated p = 2.5E−04 with stricturing disease NKT cell enrichment in CD-PBmu, but not CD-PBT, correlated with p = 3.3E−02 ASCA serological response levels Decreased CD4+/CD8+ T cells in CD-PBmu vs CD-PBT p = 6.1E−03-1.7E−07 Decreased CD4+ memory T cell is associated with increased length of p = 1.8E−02 bowel resection Serological quartile sum scores in CD-PBmu, but not CD-PBT, are p = 2.9E−02 associated with increased length of bowel resection Attenuated gene expression in CD-PBmu, but not in CD-PBT, 900 transcripts, p = 9.9E−04, following surgery FDR < 0.01, fold > 1.5
[0406] It was also found that the PBL (peripheral blood lymphocytes) cell population changes in CD-PBmu patients following surgery: There is a decrease in the elevated pre-surgery NKT (p=0.026) and enhancement in the levels of depleted pre-surgery Th1 cells (p=5e-03).
[0407] Findings were validated in independent datasets derived from either whole blood (isolated from CD patients who had failed anti-TNF therapy, n=204, (
[0408] The 44-gene panel correlated with T cell subsets: NKT, CD4+ memory, CD4+ native, CD8+, CD4+, CD4+ Tcm, CD4+ Tem, CD8+ Tem, CD8+ Tcm, and CD8+ naive, as shown in
[0409] The 44-gene biomarker panel includes A disintegrin and metalloproteinase with thrombospondin motifs 1 (ADAMTS1), Neutrophil gelatinase-associated lipocalin (LCN2), Disintegrin and metalloproteinase domain-containing protein 28 (ADAM28), Tryptase beta-2 (TPSB2), peptidylprolyl isomerase A pseudogene 30 (PPIAP30), glutamine-fructose-6-phosphate transaminase 2 (GFPT2), KIT proto-oncogene, receptor tyrosine kinase (KIT), phospholipid transfer protein (PLTP), major facilitator superfamily domain containing 2A (MFSD2A), interleukin 22 (IL22), LIM and cysteine rich domains 1 (LMCD1), interleukin 6 (IL6), TBC1 domain family member 9 (TBC1D9), ChaC glutathione specific gamma-glutamylcyclotransferase 1 (CHAC1), selenoprotein P (SEPP1), superoxide dismutase 3 (SOD3), RAB13, member RAS oncogene family (RAB13), lysozyme (LYZ), carboxypeptidase A3 (CPA3), serine dehydratase (SDS), dual specificity tyrosine phosphorylation regulated kinase 3 (DYRK3), DAB adaptor protein 2 (DAB2), TBC1 domain family member 8 (TBC1D8), crystallin alpha B (CRYAB), TBC1 domain family member 3 (TBC1D3), leucine rich repeat containing 32 (LRRC32), serpin family G member 1 (SERPING1), ubiquitin D (UBD), fatty acid binding protein 1 (FABP1), spleen associated tyrosine kinase (SYK), aldolase, fructose-bisphosphate B (ALDOB), semaphorin 6B (SEMA6B), NANOG neighbor homeobox (NANOGNB), dermatan sulfate epimerase (DSE), formyl peptide receptor 3 (FPR3), tenascin XB (TNXB), olfactory receptor family 4 subfamily A member 5 (OR4A5), decorin (DCN), carbohydrate sulfotransferase 15 (CHST15), ADAM like decysin 1 (ADAMDEC1), histidine decarboxylase (HDC), RRAD, Ras related glycolysis inhibitor and calcium channel regulator (RRAD), complement C1s (C1S), or phospholipase A2 group IIA (PLA2G2A).
[0410] CD patients with severe disease can be stratified into 2 sub-populations based on transcriptomic profiling of their peripheral T-cells. A mucosal-like expression profile defined the CD-PBmu subtype which was associated with an altered composition of T-cell subsets, clinical disease severity markers and decreased pro-inflammatory gene expression following surgery. These findings hold potential to identify targets for patient-subtype specific therapeutic development. Moreover, the 44-gene biomarker panel confirmed the CD-PBmu gene signature in multiple independent pediatric CD datasets, suggesting this may provide a unique tool to improve accuracy in predicting clinical progression and facilitate treatment stratification early in the disease process. In some cases, the
[0411] In some cases, the 44-gene biomarker panel can be narrowed to a 27-gene biomarker panel with similar predictive capability as the 44-gene biomarker panel. The 27-gene biomarker panel, in some cases is ADAMDEC1, ALDOB, CHST15, C1S, CRYAB, DAB2, DCN, DYRK3, FABP1, HDC, IL22, IL6, KIT, LMCD1, LRRC32, OR4A5, PLA2G2A, PLTP, RAB13, RRAD, SERPING1, SOD3, SYK, TBC1D3, TBC1D9, TPSB2, and UBD.
TABLE-US-00005 TABLE 4 Selected Cytokines, Chemokines and Adhesion Molecules Decreased in PB-mu Patient Subtype Following Surgery Molecule P value IL10 1.7E−03 IL11 4.0E−04 IL15 1.8E−03 IL18 1.9E−02 IL22 8.5E−03 IL6 1.0E−03 IL12RB1 4.0E−04 IL12RB2 1.1E−02 IL17RD 5.0E−04 IL1R1 2.2E−03 IL1RL1 7.9E−03 IL31RA 1.4E−03 TNFRSF9 7.0E−04 TNFSF14 3.3E−02 TNFSF15 5.7E−03 TNFAIP8L1 1.0E−03 TNFAIP8L3 4.7E−03 TNFRSF10A 4.6E−02 TNFRSF10B 6.2E−03 TNFRSF13B 2.9E−02 CCL11 1.1E−02 CCL16 2.2E−03 CCL21 2.7E−02 CCL22 7.0E−04 CCL28 5.5E−03 CCL5 2.0E−04 CCR6 7.6E−03 CCR9 4.0E−03 CXCL1 2.3E−02 CXCL12 1.9E−02 CXCL13 8.2E−03 CXCL14 8.0E−04 CXCL16 2.3E−02 CXCL3 3.4E−02 CXCL9 1.0E−04 CLDN10 3.4E−02 CLDN16 1.0E−03 CLDN19 2.0E−04 CLDN3 1.2E−03 ICAM4 4.0E−03 ITGAX 2.2E−02
Example 2. Transcriptomic Profiling
[0412] Expression levels of each of genes 1-44 in Table 1A are determined in a CD patient using RNA sequencing. The patient's expression levels are compared to reference expression levels from subjects who have a PBT subtype. All of the 44-genes from the patient have expression levels at least 2-fold higher than the PBT reference. The patient is characterized as having a CD-PBmu subtype.
Example 3. Identification of Therapeutic Agents
[0413] A library of compounds is screened for a subpopulation of compounds that modulate the activity and/or expression of one or more biomarkers of Table 5, or of a biomolecule in a pathway of the one or more biomarkers of Table 5. The subpopulation of compounds is screened for efficacy in an in vitro PBmu patient model to identify candidate therapeutic agents.
Example 4. Monocyte Signature
[0414] Peripheral and mucosal cells were obtained from untreated freshly isolated cells from 30 Crohn's disease (CD) subjects and 10 non-IBD subjects. RNA expression analysis was performed on peripheral CD3+ and monocyte cells, and mucosal CD3+ and CD13+ cells. Unsupervised clustering of CD monocytes revealed two signatures: monocyte 1 subtype (mono1) and monocyte 2 (mono2) subtype (
[0415] The CD mono2 subset was found to be associated with clinical and genetic parameters: ATG16L1 rs10210302 risk allele carriage (z score 2.2, p value 0.014), family history (z score 2.2, p value 0.014), IgG ASCA positive (z score 3, p value 0.0013), Serologic Quartile sum score (avg 11.4) (p value 0.049), failure on anti-TNF therapy (z score 1.8, p value 0.03), failure on 6-mercaptopurine/methotrexate (z score 3.4, p value 0.0004), and PBmu subjects (z score 1.4, p value 0.07).
Example 5. Identifying Therapeutic Agents of Particular Relevance to PBmu CD Subtype
[0416] A two-tailed test was performed, which measured the statistical significance of an association of the differential gene expression of a target of interstest in the PBmu patient subset. Table 5 provides a list of putative therapeutic targets, the differential expression of which, are statistically associated with the PBmu subtype.
TABLE-US-00006 TABLE 5 Therapeutic Targets for PBmu Subtype Gene Pbmu PBT Prob > |t| ADCY7 19.91897 24.43544 2.86E−03 GPR65 32.85385 18.49456 4.62E−05 GSDMB 8.521538 5.792059 2.07E−04 ICAM3 64.45026 84.52338 3.61E−06 MAP4K4 24.32692 27.24235 4.35E−02 PRKCQ 23.15692 28.36426 2.42E−04 PTGER4 23.70487 34.84235 7.49E−04 RNASET2 60.94795 77.84529 6.13E−04 TNFSF15 3.208718 1.245882 1.46E−03
[0417] The 44-biomarker panel is associated with kinases provided in
Example 6. Monocyte Profiling
[0418] The expression level of one or more genes from Table 5 is determined in a CD patient using RNA sequencing. The patient's expression levels are compared to reference expression levels from subjects who have a mono1 or mono2 subtype. If the patient's expression levels are comparable to reference subjects having a mono2 subtype, the patient is characterized as having the mono2 CD subtype.
Example 7. Treatment of Crohn's Disease Patient with PBmu Profile
[0419] The patient having the PBmu phenotype of Example 1 is treated with a candidate therapeutic agent of Example 3 or a therapeutic agent comprising a modulator of one or more of TL1A, ADCY7, GPR65, ICAM3, MAP4K4, PTGER4, RNASET2, TNFSF15.
Example 8. Treatment of Crohn's Disease Patient with Monocyte 2 Profile
[0420] The patient having the monocyte 2 subtype of Example 6 is treated with a candidate therapeutic agent targeting a kinase selected from: DNAPK, CDK4, ERK1, HIPK2, CDC2, MAPK1, MAPK3, ERK2, CSNK2A1, CK2ALPHA, JNK1, CDK1, MAPK14, PKR, and CDK2.
Example 9. Pathways Enriched that Overlap with GWAS DEG in CD-PBmu Subtype
[0421] 2616 genes potentially associated with IBD GWAS risk variant loci were identified. Of these genes, 1177 were not expressed in T cell data, 1429 were expressed in the T cell data, and 802 were differentially expressed between CD-PBmu and PBT subtypes (
[0422] While preferred embodiments have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will occur to those skilled in the art without departing from the scope of this application. Various alternatives to the embodiments described herein may be employed in practicing the scope of this application.
TABLE-US-00007 TABLE 6 Genes Associated with Transcriptomic Signature. fold predictor Pbmu/ fold post Pbmu/ surgery Entrez Gene PBT follow up Name ID Accession UGCluster Ensembl AADACL2-AS1 6.09 6.44 AADACL2 Antisense RNA 1 101928142 ENSG00000242908 AARS2 2.34 2.05 alanyl-tRNA synthetase 2, 57505 NM_020745 Hs.158381 ENSG00000124608 mitochondrial AASS 3.55 2.96 aminoadipate-semialdehyde synthase 10157 NM_005763 Hs.156738 ENSG00000008311 ABCB5 4.08 2.97 ATP-binding cassette, sub-family B 340273 NM_001163941 Hs.404102 ENSG00000004846 (MDR/TAP), member 5 ABCC9 4.77 3.61 ATP-binding cassette, sub-family C 10060 NM_005691 Hs.732701 ENSG00000069431 (CFTR/MRP), member 9 ABHD11 2.6 2.24 abhydrolase domain containing 11 83451 NM_001145363 Hs.647045 ENSG00000106077 ACADSB 2.65 2.32 acyl-CoA dehydrogenase, 36 NM_001609 Hs.81934 ENSG00000196177 short/branched chain ACBD4 2.62 2.72 acyl-CoA binding domain containing 4 79777 NM_001135704 Hs.110298 ENSG00000181513 ACBD7 4.58 3.42 acyl-CoA binding domain containing 7 414149 NM_001039844 Hs.644598 ENSG00000176244 ADAMTS4 3.64 3.21 ADAM metallopeptidase with 9507 NM_005099 Hs.211604 ENSG00000158859 thrombospondin type 1 motif, 4 ADAT1 2.23 2 adenosine deaminase, tRNA-specific 1 23536 NM_012091 Hs.729312 ENSG00000065457 ADRA1A 3.91 3.36 adrenoceptor alpha 1A 148 NM_000680 Hs.709175 ENSG00000120907 AFMID 3.83 3.03 arylformamidase 125061 NM_001010982 Hs.558614 ENSG00000183077 AICDA 4.43 3.46 activation-induced cytidine deaminase 57379 NM_020661 Hs.149342 ENSG00000111732 AIPL1 4.1 3.6 aryl hydrocarbon receptor 23746 NM_001033054 Hs.279887 ENSG00000129221 interacting protein-like 1 AK3 2.27 1.98 adenylate kinase 3 50808 NM_001199852 Hs.732022 ENSG00000147853 AKAP5 3.11 2.76 A kinase (PRKA) anchor protein 5 9495 NM_004857 Hs.656683 ENSG00000179841 AKIP1 3.7 2.86 A kinase (PRKA) interacting protein 1 56672 NM_001206645 Hs.131180 ENSG00000166452 ALDH6A1 3.37 2.79 aldehyde dehydrogenase 6 4329 NM_001278593 Hs.293970 ENSG00000119711 family, member A1 ALG1 2.74 2.19 ALG1, chitobiosyldiphosphodolichol 56052 NM_019109 Hs.592086 ENSG00000033011 beta-mannosyltransferase ALG1L 3.44 3.36 ALG1, chitobiosyldiphosphodolichol 200810 NM_001015050 Hs.591299 ENSG00000189366 beta-mannosyltransferase-like ALG1L9P 3.65 3.19 asparagine-linked glycosylation 1-like 285407 NR_073386 Hs.546711 ENSG00000248671 9, pseudogene ANKLE1 4.38 3.25 ankyrin repeat and LEM 126549 NM_001278443 Hs.721610 ENSG00000160117 domain containing 1 ANKRD20A9P 4.63 3.49 ankyrin repeat domain 20 family, 284232 NR_027995 Hs.679496 member A9, pseudogene ANP32A-IT1 3.07 2.55 ANP32A intronic transcript 1 80035 NM_001040150 Hs.662150 AP1S3 3.85 3.15 adaptor-related protein 130340 NM_001039569 Hs.632555 ENSG00000152056 complex 1, sigma 3 subunit AP4B1-AS1 3.41 2.86 AP4B1 antisense RNA 1 100287722 NR_037864 Hs.664669 ENSG00000226167 AP4S1 2.79 2.43 adaptor-related protein 11154 NM_001128126 Hs.293411 ENSG00000100478 complex 4, sigma 1 subunit APOBEC3A 4.49 3.41 apolipoprotein B mRNA editing 200315 NM_001270406 Hs.226307 ENSG00000128383 enzyme, catalytic polypeptide-like 3A APOBEC3B-AS1 4.84 3.26 APOBEC3B antisense RNA 1 100874530 NR_104187 Hs.626951 ENSG00000249310 APOL1 2.69 2.24 apolipoprotein L, 1 8542 NM_001136540 Hs.114309 ENSG00000100342 APOL4 4.11 3.23 apolipoprotein L, 4 80832 NM_030643 Hs.115099 ENSG00000100336 AQP6 4.2 3.48 aquaporin 6, kidney specific 363 NM_001652 Hs.54505 ENSG00000086159 ARGFX 3.85 2.97 arginine-fifty homeobox 503582 NM_001012659 Hs.224976 ENSG00000186103 ARHGEF26-AS1 4.74 3.55 ARHGEF26 antisense RNA 1 100507524 NR_037901 Hs.370221 ENSG00000243069 ARIH2OS 2.44 2.17 ariadne homolog 2 opposite strand 646450 NM_001123040 Hs.720727 ENSG00000221883 ARRDC3-AS1 3.78 2.91 ARRDC3 antisense RNA 1 100129716 NR_027435 Hs.116364 ENSG00000281357 ARSA 2.71 2.3 arylsulfatase A 410 NM_000487 Hs.88251 ENSG00000100299 ASTN2 4.05 3.07 astrotactin 2 23245 NM_001184734 Hs.601562 ENSG00000148219 ATAD3C 3.66 3.08 ATPase family, AAA 219293 NM_001039211 Hs.724767 ENSG00000215915 domain containing 3C ATCAY 4.24 3.42 ataxia, cerebellar, Cayman type 85300 NM_033064 Hs.418055 ENSG00000167654 B3GNT6 4.52 3.67 UDP-GlcNAc:betaGal beta-1,3-N- 192134 NM_138706 Hs.352622 ENSG00000198488 acetylglucosaminyltransferase 6 BAIAP2-AS1 3.08 2.86 BAIAP2 antisense RNA 1 440465 NM_001004336 Hs.448889 ENSG00000226137 (head to head) BBS5 4.12 3.56 Bardet-Biedl syndrome 5 129880 NM_152384 Hs.233398 ENSG00000163093 BCDIN3D 2.27 1.92 BCDIN3 domain containing 144233 NM_181708 Hs.142736 ENSG00000186666 BHMT2 3.9 3.18 betaine--homocysteine S- 23743 NM_001178005 Hs.114172 ENSG00000132840 methyltransferase 2 BIN3-IT1 2.99 2.57 BIN3 intronic transcript 1 80094 NM_025026 Hs.675917 BMP7 4.73 3.55 bone morphogenetic protein 7 655 NM_001719 Hs.473163 ENSG00000101144 BMS1P4 2.39 2.3 BMS1 ribosome biogenesis 729096 NR_026592 Hs.709171 ENSG00000271816 factor pseudogene 4 BMS1P5 2.6 2.44 BMS1 ribosome biogenesis 399761 NM_001040053 Hs.711898 ENSG00000204177 factor pseudogene 5 BMS1P6 2.03 2.31 BMS1 ribosome biogenesis 642826 NR_024495 Hs.463017 factor pseudogene 6 BNIPL 4.17 3.13 BCL2/adenovirus E1B 19 kD 149428 NM_001159642 Hs.591473 ENSG00000163141 interacting protein like BPNT1 2.68 2.19 3′(2′), 5′-bisphosphate 10380 NM_001286149 Hs.406134 ENSG00000162813 nucleotidase 1 BREA2 3.07 2.25 breast cancer estrogen- 286076 NM_001024610 Hs.178095 induced apoptosis 2 BRIP1 4.26 3.38 BRCA1 interacting protein 83990 NM_032043 Hs.128903 ENSG00000136492 C-terminal helicase 1 BSN-AS2 4.42 3.38 BSN antisense RNA 2 (head to head) 100132677 NR_038866 Hs.435651 ENSG00000226913 C12orf65 3.15 2.61 chromosome 12 open reading frame 65 91574 NM_001143905 Hs.319128 ENSG00000130921 C12orf77 4.03 3.21 chromosome 12 open reading frame 77 196415 NM_001101339 Hs.434453 C14orf105 3.8 3.53 chromosome 14 open reading frame 105 55195 NM_001283056 Hs.659706 ENSG00000100557 C14orf178 3.54 3.36 chromosome 14 open reading frame 178 283579 NM_001173978 Hs.375834 ENSG00000197734 C17orf75 3.56 2.87 chromosome 17 open reading frame 75 64149 NM_022344 Hs.655257 ENSG00000108666 C19orf35 5.46 5.13 chromosome 19 open reading frame 35 374872 NM_198532 Hs.511803 ENSG00000188305 C1orf174 2.88 2.45 chromosome 1 open reading frame 174 339448 NM_207356 Hs.103939 ENSG00000198912 C1orf210 4.09 3.15 chromosome 1 open reading frame 210 149466 NM_001164829 Hs.158963 ENSG00000253313 C1orf229 5.51 3.73 chromosome 1 open reading frame 229 388759 NM_207401 Hs.456511 C1QTNF6 2.67 2.39 C1q and tumor necrosis 114904 NM_031910 Hs.22011 ENSG00000133466 factor related protein 6 C21orf62 4.33 3.47 chromosome 21 open reading frame 62 56245 NM_001162495 Hs.517235 ENSG00000205929 C2orf91 5.18 4.02 chromosome 2 open reading frame 91 400950 NM_001242815 Hs.738713 ENSG00000205086 C3orf33 3 2.97 chromosome 3 open reading frame 33 285315 NM_001308229 Hs.350846 ENSG00000174928 C4orf19 3.63 3.26 chromosome 4 open reading frame 19 55286 NM_001104629 Hs.107527 ENSG00000154274 C4orf26 4.14 3.6 chromosome 4 open reading frame 26 152816 NM_001206981 Hs.24510 ENSG00000174792 C6orf25 2.81 2.48 chromosome 6 open reading frame 25 80739 NM_025260 Hs.247879 ENSG00000204420 C7orf55 3.94 3.41 chromosome 7 open reading frame 55 154791 NM_197964 Hs.718441 ENSG00000164898 C8orf44 3.44 3.16 chromosome 8 open reading frame 44 56260 NM_019607 Hs.661238 ENSG00000213865 C9orf3 2.69 2.13 chromosome 9 open reading frame 3 84909 NM_001193329 Hs.434253 ENSG00000148120 CABP4 3.24 3.29 calcium binding protein 4 57010 NM_001300895 Hs.143036 ENSG00000175544 CASC9 4.66 3.98 cancer susceptibility candidate 9 101805492 NR_103848 Hs.571424 (non-protein coding) CC2D2A 3.76 3.39 coiled-coil and C2 domain 57545 NM_001080522 Hs.590928 ENSG00000048342 containing 2A CCDC122 3.01 2.62 coiled-coil domain containing 122 160857 NM_144974 Hs.170849 ENSG00000151773 CCDC142 3.75 2.99 coiled-coil domain containing 142 84865 NM_032779 Hs.430199 ENSG00000135637 CCDC148 5.74 3.89 coiled-coil domain containing 148 130940 NM_001171637 Hs.668597 ENSG00000153237 CCDC30 3.52 2.99 coiled-coil domain containing 30 728621 NM_001080850 Hs.729640 ENSG00000186409 CCL22 3.73 3.09 chemokine (C-C motif) ligand 22 6367 NM_002990 Hs.534347 ENSG00000102962 CCL5 2.14 1.84 chemokine (C-C motif) ligand 5 6352 NM_001278736 Hs.514821 ENSG00000271503 CD24 4.3 2.67 CD24 molecule 100133941 NM_001291737 Hs.644105 ENSG00000272398 CD300LG 4.84 3.95 CD300 molecule-like family member g 146894 NM_001168322 Hs.147313 ENSG00000161649 CD3EAP 3.67 2.87 CD3e molecule, epsilon 10849 NM_001297590 Hs.710495 ENSG00000117877 associated protein CD82 3.21 2.56 CD82 molecule 3732 NM_001024844 Hs.527778 ENSG00000085117 CDH23 3.32 2.79 cadherin-related 23 64072 NM_001171930 Hs.656032 ENSG00000107736 CDKN2B-AS1 3.49 2.95 CDKN2B antisense RNA 1 100048912 NR_003529 Hs.493614 ENSG00000240498 CEACAM22P 4.41 3.57 carcinoembryonic antigen-related cell 388550 NR_027754 Hs.446909 ENSG00000230666 adhesion molecule 22, pseudogene CEACAM8 4.28 3.04 carcinoembryonic antigen-related cell 1088 NM_001816 Hs.41 ENSG00000124469 adhesion molecule 8 CENPBD1P1 2.78 2.54 CENPB DNA-binding domains 65996 NM_023939 Hs.541177 ENSG00000213753 containing 1 pseudogene 1 CENPN 2.66 2.18 centromere protein N 55839 NM_001100624 Hs.726537 ENSG00000166451 CEP41 3.09 2.44 centrosomal protein 41 kDa 95681 NM_001257158 Hs.368315 ENSG00000106477 CES3 5.51 4.61 carboxylesterase 3 23491 NM_001185176 Hs.268700 ENSG00000172828 CFLAR 2.01 1.87 CASP8 and FADD-like 8837 NM_001127183 Hs.390736 ENSG00000003402 apoptosis regulator CHP1 2.48 2.17 calcineurin-like EF-hand protein 1 11261 NM_007236 Hs.406234 ENSG00000187446 CHP2 3.66 2.96 calcineurin-like EF-hand protein 2 63928 NM_022097 Hs.178589 ENSG00000166869 CHRM3 4.65 3.87 cholinergic receptor, muscarinic 3 1131 NM_000740 Hs.7138 ENSG00000133019 CHRNB1 2.9 2.34 cholinergic receptor, 1140 NM_000747 Hs.330386 ENSG00000170175 nicotinic, beta 1 (muscle) CHST6 3.77 3.11 carbohydrate (N-acetylglucosamine 4166 NM_021615 Hs.655622 ENSG00000183196 6-O) sulfotransferase 6 CIITA 2.59 2.11 class II, major histocompatibility 4261 NM_000246 Hs.701991 ENSG00000179583 complex, transactivator CKMT2-AS1 2.71 2.28 CKMT2 antisense RNA 1 100131067 NR_034121 Hs.655855 ENSG00000247572 CMBL 4.29 3.43 carboxymethylenebutenolidase 134147 NM_138809 Hs.192586 ENSG00000164237 homolog (Pseudomonas) COA1 2.15 1.89 cytochrome c oxidase 55744 NM_018224 Hs.654779 ENSG00000106603 assembly factor 1 homolog COA7 3.1 2.43 cytochrome c oxidase 65260 NM_023077 Hs.349905 ENSG00000162377 assembly factor 7 (putative) COMMD2 2.34 1.97 COMM domain containing 2 51122 NM_016094 Hs.432729 ENSG00000114744 COX10-AS1 2.4 2.23 COX10 antisense RNA 1 100874058 NR_049718 Hs.720411 ENSG00000236088 COX18 2.38 2.1 COX18 cytochrome c 285521 NM_001033760 Hs.356697 ENSG00000163626 oxidase assembly factor COX6B2 4.89 4.27 cytochrome c oxidase subunit VIb 125965 NM_144613 Hs.550544 ENSG00000160471 polypeptide 2 (testis) CPB2-AS1 3.85 3.34 CPB2 antisense RNA 1 100509894 NR_046226 Hs.626139 ENSG00000235903 CPM 3.42 2.83 carboxypeptidase M 1368 NM_001005502 Hs.654387 ENSG00000135678 CPPED1 2.76 2.26 calcineurin-like phosphoesterase 55313 NM_001099455 Hs.460002 ENSG00000103381 domain containing 1 CRHR1-IT1 2.19 2.35 CRHR1 intronic transcript 1 147081 NM_152466 Hs.128813 ENSG00000204650 CRLF2 4.72 4.02 cytokine receptor-like factor 2 64109 NM_001012288 Hs.287729 ENSG00000205755 CRX 4.76 3.8 cone-rod homeobox 1406 NM_000554 Hs.617342 ENSG00000105392 CRYBB2P1 3.5 2.54 crystallin, beta B2 pseudogene 1 1416 NR_033733 Hs.571835 ENSG00000100058 CRYM-AS1 4.41 3.55 CRYM antisense RNA 1 400508 NM_001101368 Hs.578949 CSAD 3.09 2.47 cysteine sulfinic acid decarboxylase 51380 NM_001244705 Hs.279815 ENSG00000139631 CSTF3-AS1 4.09 3.38 CSTF3 antisense RNA 1 338739 NR_034027 Hs.423476 ENSG00000247151 (head to head) CTBP2 2.56 2.38 C-terminal binding protein 2 1488 NM_001083914 Hs.501345 ENSG00000175029 CTCFL 4.52 3.12 CCCTC-binding factor (zinc 140690 NM_001269040 Hs.131543 ENSG00000124092 finger protein)-like CXorf36 4.4 3.54 chromosome X open reading frame 36 79742 NM_024689 Hs.98321 ENSG00000147113 CXorf56 3.27 2.74 chromosome X open reading frame 56 63932 NM_001170569 Hs.248572 ENSG00000018610 CYB5D2 2.48 2.3 cytochrome b5 domain containing 2 124936 NM_001254755 Hs.513871 ENSG00000167740 CYP20A1 2.1 1.91 cytochrome P450, family 20, 57404 NM_020674 Hs.446065 ENSG00000119004 subfamily A, polypeptide 1 CYP4V2 2.25 2.04 cytochrome P450, family 4, 285440 NM_207352 Hs.587231 ENSG00000145476 subfamily V, polypeptide 2 CYP51A1 2.45 2.32 cytochrome P450, family 51, 1595 NM_000786 Hs.417077 ENSG00000001630 subfamily A, polypeptide 1 DAND5 4.28 3.4 DAN domain family member 199699 NM_152654 Hs.331981 ENSG00000179284 5, BMP antagonist DAPP1 2.61 1.93 dual adaptor of phosphotyrosine and 27071 NM_001306151 Hs.436271 ENSG00000070190 3-phosphoinositides DCUN1D2 4.15 3.39 DCN1, defective in cullin neddylation 55208 NM_001014283 Hs.682987 ENSG00000150401 1, domain containing 2 DDX51 2.06 2.08 DEAD (Asp-Glu-Ala-Asp) 317781 NM_175066 Hs.445168 ENSG00000185163 box polypeptide 51 DESI1 2.29 2.1 desumoylating isopeptidase 1 27351 NM_015704 Hs.570455 ENSG00000100418 DFFA 2.4 2.14 DNA fragmentation factor, 1676 NM_004401 Hs.484782 ENSG00000160049 45 kDa, alpha polypeptide DFFB 2.59 2.21 DNA fragmentation factor, 1677 NM_001004285 Hs.133089 ENSG00000169598 40 kDa, beta polypeptide (caspase-activated DNase) DHODH 2.44 2.15 dihydroorotate 1723 NM_001025193 Hs.654427 ENSG00000102967 dehydrogenase (quinone) DLEU2 3.35 2.69 deleted in lymphocytic leukemia 2 8847 NR_002612 Hs.547964 (non-protein coding) DLGAP1-AS2 4.82 3.67 DLGAP1 antisense RNA 2 84777 NM_032691 Hs.659053 DLK2 3.07 2.84 delta-like 2 homolog (Drosophila) 65989 NM_001286655 Hs.337251 ENSG00000171462 DMC1 4 3.5 DNA meiotic recombinase 1 11144 NM_001278208 Hs.339396 ENSG00000100206 DNAH17-AS1 3.55 2.95 DNAH17 antisense RNA 1 100996295 NR_102401 Hs.615304 DNAJC22 4.1 3.66 DnaJ (Hsp40) homolog, 79962 NM_001304944 Hs.659300 ENSG00000178401 subfamily C, member 22 DNAJC27-AS1 3.67 3.24 DNAJC27 antisense RNA 1 729723 NR_034113 Hs.436366 ENSG00000224165 DNAJC9-AS1 3.6 2.87 DNAJC9 antisense RNA 1 414245 NR_038373 Hs.661857 ENSG00000236756 DNAL1 2.89 2.54 dynein, axonemal, light chain 1 83544 NM_001201366 Hs.271270 ENSG00000119661 DNASE1 2.67 2.36 deoxyribonuclease I 1773 NM_005223 Hs.629638 ENSG00000213918 DNM1P46 2.57 2.24 dynamin 1 pseudogene 46 196968 NM_194295 Hs.567763 ENSG00000182397 DPH3P1 3.77 3.43 diphthamide biosynthesis 3 100132911 NM_080750 pseudogene 1 DPY19L1P1 2.75 3 DPY19L1 pseudogene 1 100129460 NR_036680 Hs.633705 DPY19L2P2 3.48 3.02 DPY19L2 pseudogene 2 349152 NM_182634 Hs.732579 ENSG00000170629 DSG2 4.49 3.32 desmoglein 2 1829 NM_001943 Hs.412597 ENSG00000046604 DSG3 3.99 3.27 desmoglein 3 1830 NM_001944 Hs.1925 ENSG00000134757 DTD2 2.58 2.22 D-tyrosyl-tRNA deacylase 2 (putative) 112487 NM_080664 Hs.116014 ENSG00000129480 DUXA 4.59 3.88 double homeobox A 503835 NM_001012729 Hs.585857 ENSG00000258873 DYDC1 3.82 3.41 DPY30 domain containing 1 143241 NM_001269053 Hs.407751 ENSG00000170788 DYNAP 5.01 3.36 dynactin associated protein 284254 NM_001307955 Hs.376146 ENSG00000178690 ECT2 3.62 2.68 epithelial cell transforming 2 1894 NM_001258315 Hs.518299 ENSG00000114346 EEF2K 2.06 1.87 eukaryotic elongation factor 2 kinase 29904 NM_013302 Hs.498892 ENSG00000103319 EFCAB11 3.61 3.02 EF-hand calcium binding domain 11 90141 NM_001284266 Hs.123232 ENSG00000140025 EGFEM1P 4.33 3.45 EGF-like and EMI domain 93556 NR_021485 Hs.478158 containing 1, pseudogene EID2B 2.85 2.44 EP300 interacting inhibitor 126272 NM_152361 Hs.135181 ENSG00000176401 of differentiation 2B ELMOD1 4.61 3.72 ELMO/CED-12 domain 55531 NM_001130037 Hs.495779 ENSG00000110675 containing 1 EMP2 3.97 3.43 epithelial membrane protein 2 2013 NM_001424 Hs.531561 ENSG00000213853 EMX2OS 4.29 3.68 EMX2 opposite strand/antisense RNA 196047 NR_002791 Hs.312592 ENSG00000229847 ENTPD1 3.56 2.8 ectonucleoside triphosphate 953 NM_001098175 Hs.576612 ENSG00000138185 diphosphohydrolase 1 ENTPD1-AS1 3.75 3.18 ENTPD1 antisense RNA 1 728558 NR_038444 Hs.538374 ENSG00000226688 EP300-AS1 5.34 3.95 EP300 antisense RNA 1 101927279 NR_110514 Hs.517517 EPGN 4.64 3.69 epithelial mitogen 255324 NM_001013442 Hs.401237 ENSG00000182585 EPHA10 4.57 3.81 EPH receptor A10 284656 NM_001004338 Hs.129435 ENSG00000183317 EPPIN 4.35 3.47 epididymal peptidase inhibitor 57119 NM_001302861 Hs.121084 ENSG00000101448 ERVK13-1 2.07 1.94 endogenous retrovirus group 100507321 NM_001012731 Hs.406976 K13, member 1 ERVV-1 4.55 4.02 endogenous retrovirus group 147664 NM_152473 Hs.44329 ENSG00000269526 V, member 1 ESRG 5.79 4.25 embryonic stem cell related 790952 NR_027122 Hs.720658 ENSG00000265992 (non-protein coding) EXD1 4.36 3.54 exonuclease 3′-5′ domain 161829 NM_001286441 Hs.307999 ENSG00000178997 containing 1 EXOC3L2 3.78 2.96 exocyst complex component 3-like 2 90332 NM_138568 Hs.337557 ENSG00000130201 EXPH5 3.01 2.73 exophilin 5 23086 NM_001144763 Hs.28540 ENSG00000110723 F5 2.55 1.87 coagulation factor V 2153 NM_000130 Hs.30054 ENSG00000198734 (proaccelerin, labile factor) FAIM 3.04 2.51 Fas apoptotic inhibitory molecule 55179 NM_001033030 Hs.173438 ENSG00000158234 FAM106A 4.01 3.81 family with sequence 80039 NM_024974 Hs.674403 ENSG00000213077 similarity 106, member A FAM114A1 4.04 2.87 family with sequence 92689 NM_138389 Hs.476517 ENSG00000197712 similarity 114, member A1 FAM122C 3.02 2.67 family with sequence similarity 122C 159091 NM_001170779 Hs.269127 ENSG00000156500 FAM153C 3.38 3.2 family with sequence similarity 153, 653316 NM_001079527 Hs.652193 ENSG00000204677 member C, pseudogene FAM231A 2.11 2.64 family with sequence similarity 231, 729574 NM_001282321 ENSG00000237847 member A FAM71F2 3.98 3.49 family with sequence similarity 71, 346653 NM_001012454 Hs.445236 ENSG00000205085 member F2 FAM73A 2.49 2.21 family with sequence similarity 73, 374986 NM_001270384 Hs.437755 ENSG00000180488 member A FAM74A3 4.26 3.66 family with sequence similarity 74, 728495 NM_001098718 Hs.723007 member A3 FAM83H-AS1 4.13 3.28 FAM83H antisense RNA 1 100128338 NR_033849 Hs.493171 ENSG00000203499 (head to head) FBLIM1 4.42 3.64 filamin binding LIM protein 1 54751 NM_001024215 Hs.530101 ENSG00000162458 FBLN1 5.56 4.26 fibulin 1 2192 NM_001996 Hs.24601 ENSG00000077942 FBXL18 3.27 2.48 F-box and leucine-rich repeat 80028 NM_024963 Hs.623974 ENSG00000155034 protein 18 FBXO17 4.71 3.73 F-box protein 17 115290 NM_024907 Hs.531770 ENSG00000269190 FBXO27 4.21 3.63 F-box protein 27 126433 NM_178820 Hs.187461 ENSG00000161243 FBXO45 2.56 2.08 F-box protein 45 200933 NM_001105573 Hs.169815 ENSG00000174013 FBXO6 2.95 2.66 F-box protein 6 26270 NM_018438 Hs.464419 ENSG00000116663 FCAR 4.27 3.38 Fc fragment of IgA receptor 2204 NM_002000 Hs.659872 ENSG00000275136 FDPSP2 4.04 3.16 farnesyl diphosphate 619190 NR_003262 Hs.609978 ENSG00000233980 synthase pseudogene 2 FEZ1 3.19 3.63 fasciculation and elongation 9638 NM_005103 Hs.224008 ENSG00000149557 protein zeta 1 (zygin I) FGD5P1 4.12 3.22 FYVE, RhoGEF and PH domain 100132526 NR_036481 Hs.637770 ENSG00000275340 containing 5 pseudogene 1 FGF5 3.97 3.16 fibroblast growth factor 5 2250 NM_001291812 Hs.37055 ENSG00000138675 FGFR1OP 2.9 2.36 FGFR1 oncogene partner 11116 NM_001278690 Hs.487175 ENSG00000213066 FILIP1 5.4 4 filamin A interacting protein 1 27145 NM_001289987 Hs.696158 ENSG00000118407 FKBP14 3.47 2.87 FK506 binding protein 14, 22 kDa 55033 NM_017946 Hs.390838 ENSG00000106080 FLCN 2.43 2.18 folliculin 201163 NM_144606 Hs.31652 ENSG00000154803 FLJ31104 3.77 3.06 uncharacterized LOC441072 441072 NR_102755 Hs.482141 ENSG00000227908 FLJ31356 4.5 3.72 uncharacterized protein FLJ31356 403150 NR_103831 Hs.562970 ENSG00000229951 FLJ31662 5.11 4.05 uncharacterized LOC440594 440594 NR_033966 Hs.514123 ENSG00000233907 FLJ42102 4.48 3.47 uncharacterized LOC399923 399923 NM_001001680 Hs.128191 ENSG00000172900 FRMD6-S1 53.64 71.46 FRMD6 antisense RNA 1 145438 NR_037676 Hs.645410 ENSG00000273888 FRRS1 5.18 4.33 ferric-chelate reductase 1 391059 NM_001013660 Hs.454779 ENSG00000156869 FRY-AS1 4.5 3.46 FRY antisense RNA 1 100507099 NR_103839 Hs.536364 FTX 2.53 2.33 FTX transcript, XIST regulator 100302692 NR_028379 Hs.349570 ENSG00000230590 (non-protein coding) FUT1 4.07 3.23 fucosyltransferase 1 (galactoside 2- 2523 NM_000148 Hs.69747 ENSG00000174951 alpha-L-fucosyltransferase, H blood group) FUT2 4.29 3.4 fucosyltransferase 2 (secretor 2524 NM_000511 Hs.579928 ENSG00000176920 status included) FUT6 3.68 3.11 fucosyltransferase 6 (alpha 2528 NM_000150 Hs.631846 ENSG00000156413 (1,3) fucosyltransferase) GAL3ST4 2.8 2.17 galactose-3-O-sulfotransferase 4 79690 NM_024637 Hs.44856 ENSG00000197093 GALNT15 3.4 3.03 polypeptide N- 117248 NM_054110 Hs.411308 ENSG00000131386 acetylgalactosaminyltransferase 15 GAS6-AS2 4.23 3.72 GAS6 antisense RNA 2 100506394 NR_044993 Hs.132168 ENSG00000272695 (head to head) GATAD1 2.19 2.09 GATA zinc finger domain 57798 NM_021167 Hs.21145 ENSG00000157259 containing 1 GDPD1 3.86 3.45 glycerophosphodiester 284161 NM_001165993 Hs.631744 ENSG00000153982 phosphodiesterase domain containing 1 GEMIN8 3.59 2.91 gem (nuclear organelle) 54960 NM_001042479 Hs.592237 ENSG00000046647 associated protein 8 GFOD2 3.21 2.57 glucose-fructose oxidoreductase 81577 NM_001243650 Hs.307084 ENSG00000141098 domain containing 2 GGT6 4.3 3.55 gamma-glutamyltransferase 6 124975 NM_001122890 Hs.130749 ENSG00000167741 GGT8P 4.96 3.97 gamma-glutamyltransferase 8 645367 NR_003503 Hs.650223 pseudogene GK5 2.43 2.21 glycerol kinase 5 (putative) 256356 NM_001039547 Hs.135904 ENSG00000175066 GLIPR1L2 5.27 3.7 GLI pathogenesis-related 1 like 2 144321 NM_001270396 Hs.406728 ENSG00000180481 GNB4 3.49 2.72 guanine nucleotide binding protein 59345 NM_021629 Hs.173030 ENSG00000114450 (G protein), beta polypeptide 4 GNE 3.01 2.47 glucosamine (UDP-N- 10020 NM_001128227 Hs.5920 ENSG00000159921 acetyl)-2-epimerase/N- acetylmannosamine kinase GNRHR2 4.67 3.52 gonadotropin-releasing hormone 114814 NM_057163 Hs.356873 ENSG00000211451 (type 2) receptor 2, pseudogene GOLGA2 2.53 2.02 golgin A2 2801 NM_004486 Hs.155827 ENSG00000167110 GOLGA6L22 5.03 3.86 golgin A6 family-like 22 440243 NM_001271664 ENSG00000274404 GOLGA6L6 4.6 3.28 golgin A6 family-like 6 727832 NM_001145004 Hs.569472 ENSG00000277322 GOSR1 3.08 2.61 golgi SNAP receptor 9527 NM_001007024 Hs.462680 ENSG00000108587 complex member 1 GPR1-AS 4.67 3.49 GPR1 antisense RNA 101669764 NR_104359 Hs.574781 ENSG00000279220 GPR37L1 4.34 3.11 G protein-coupled receptor 37 like 1 9283 NM_004767 Hs.132049 ENSG00000170075 GPR82 3.34 3.21 G protein-coupled receptor 82 27197 NM_080817 Hs.567457 ENSG00000171657 GREB1 4.84 3.69 growth regulation by 9687 NM_014668 Hs.467733 ENSG00000196208 estrogen in breast cancer 1 GRTP1 3.91 3.25 growth hormone regulated 79774 NM_001286732 Hs.745043 ENSG00000139835 TBC protein 1 GSDMA 3.59 3.02 gasdermin A 284110 NM_178171 Hs.448873 ENSG00000167914 GSG1 4.38 3.34 germ cell associated 1 83445 NM_001080554 Hs.240053 ENSG00000111305 GSTM3 3.45 2.8 glutathione S-transferase mu 3 (brain) 2947 NM_000849 Hs.2006 ENSG00000134202 GTF2E1 3.49 2.48 general transcription factor IIE, 2960 NM_005513 Hs.445272 ENSG00000153767 polypeptide 1, alpha 56 kDa GTF2H2 2.46 2.1 general transcription factor 2966 NM_001515 Hs.191356 ENSG00000145736 IIH, polypeptide 2, 44 kDa GUCA1B 4.5 3.03 guanylate cyclase activator 1B (retina) 2979 NM_002098 Hs.446529 ENSG00000112599 GUSBP3 2.42 2.31 glucuronidase, beta pseudogene 3 653188 NR_027386 Hs.631974 ENSG00000253203 H1FX-AS1 2.98 2.44 H1FX antisense RNA 1 339942 NM_001025468 Hs.450096 HCAR1 3.99 3.68 hydroxycarboxylic acid receptor 1 27198 NM_032554 Hs.610873 ENSG00000196917 HEATR5A 2.38 2.18 HEAT repeat containing 5A 25938 NM_015473 Hs.744979 ENSG00000129493 HES2 4.11 3.44 hes family bHLH transcription factor 2 54626 NM_019089 Hs.118727 ENSG00000069812 HHLA2 2.46 2.41 HERV-H LTR-associating 2 11148 NM_001282556 Hs.225968 ENSG00000114455 HILPDA 3.18 2.83 hypoxia inducible lipid 29923 NM_001098786 Hs.706124 ENSG00000135245 droplet-associated HIPK1-AS1 2.57 2.41 HIPK1 antisense RNA 1 101928846 NR_110725 Hs.232534 ENSG00000235527 HMGB3P1 4.77 4.13 high mobility group box 3 128872 NR_002165 Hs.558624 pseudogene 1 HNF1A-AS1 4.5 3.36 HNF1A antisense RNA 1 283460 NR_024345 Hs.612351 ENSG00000241388 HOGA1 4.32 3.68 4-hydroxy-2-oxoglutarate aldolase 1 112817 NM_001134670 Hs.180346 ENSG00000241935 HP09025 3.99 3.31 uncharacterized LOC100652929 100652929 NR_109783 Hs.559249 ENSG00000267719 HPSE 2.05 1.79 heparanase 10855 NM_001098540 Hs.44227 ENSG00000173083 HSD17B13 4.35 3.67 hydroxysteroid (17-beta) 345275 NM_001136230 Hs.284414 ENSG00000170509 dehydrogenase 13 HSP90AB4P 4.23 3.1 heat shock protein 90 kDa 664618 NR_002927 Hs.670224 alpha (cytosolic), class B member 4, pseudogene HTRA4 4.59 3.31 HtrA serine peptidase 4 203100 NM_153692 Hs.661014 ENSG00000169495 IAPP 3.94 3.28 islet amyloid polypeptide 3375 NM_000415 Hs.46835 ENSG00000121351 IBA57 2.85 2.58 IBA57 homolog, iron-sulfur 200205 NM_001010867 Hs.237017 ENSG00000181873 cluster assembly ICA1L 3.12 2.91 islet cell autoantigen 1.69 kDa-like 130026 NM_001288622 Hs.516629 ENSG00000163596 IDO1 5.13 4.37 indoleamine 2,3-dioxygenase 1 3620 NM_002164 Hs.840 ENSG00000131203 IFNLR1 4.24 3.59 interferon, lambda receptor 1 163702 NM_170743 Hs.221375 ENSG00000185436 IFT22 3.1 2.69 intraflagellar transport 22 64792 NM_001130820 Hs.389104 ENSG00000128581 IL10 4.12 3.83 interleukin 10 3586 NM_000572 Hs.193717 ENSG00000136634 IL15 3.25 2.56 interleukin 15 3600 NM_000585 Hs.168132 ENSG00000164136 IL17RD 3.95 3.23 interleukin 17 receptor D 54756 NM_017563 Hs.150725 ENSG00000144730 INE1 2.81 2.75 inactivation escape 1 (non- 8552 NM_003669 Hs.657350 ENSG00000224975 protein coding) INGX 4.56 3.7 inhibitor of growth family, 27160 NR_002226 Hs.721806 ENSG00000243468 X-linked, pseudogene INIP 2.46 1.99 INTS3 and NABP interacting protein 58493 NM_021218 Hs.658575 ENSG00000148153 INMT 4.25 3.37 indolethylamine N-methyltransferase 11185 NM_001199219 Hs.632629 ENSG00000241644 IPO5P1 2.4 2.1 importin 5 pseudogene 1 100132815 NR_103741 Hs.629249 IRGQ 3.27 2.78 immunity-related GTPase family, Q 126298 NM_001007561 Hs.6217 ENSG00000167378 ITIH5 4.34 3.6 inter-alpha-trypsin inhibitor heavy 80760 NM_001001851 Hs.498586 ENSG00000123243 chain family, member 5 JPX 3.59 3.15 JPX transcript, XIST activator 554203 NR_024582 Hs.648316 ENSG00000225470 (non-protein coding) KANTR 2.83 2.58 KDM5C adjacent non- 102723508 NR_110456 Hs.633244 coding transcript KBTBD12 4.43 3.83 kelch repeat and BTB (POZ) 166348 NM_207335 Hs.132087 ENSG00000187715 domain containing 12 KBTBD6 2.46 2.05 kelch repeat and BTB (POZ) 89890 NM_152903 Hs.534040 ENSG00000165572 domain containing 6 KCNA7 4.88 3.92 potassium channel, voltage gated 3743 NM_031886 Hs.306973 ENSG00000104848 shaker related subfamily A, member 7 KCNJ11 3.9 3.43 potassium channel, inwardly 3767 NM_000525 Hs.248141 ENSG00000187486 rectifying subfamily J, member 11 KCNJ5 4.19 3.57 potassium channel, inwardly 3762 NM_000890 Hs.444595 ENSG00000120457 rectifying subfamily J, member 5 KCNQ1OT1 4.08 3.18 KCNQ1 opposite strand/antisense 10984 NR_002728 Hs.604823 ENSG00000269821 transcript 1 (non-protein coding) KDELC2 2.63 2.33 KDEL (Lys-Asp-Glu-Leu) 143888 NM_153705 Hs.83286 ENSG00000178202 containing 2 KDM4A-S1 4.3 3.3 KDM4A antisense RNA 1 100132774 NR_033827 Hs.655569 KIAA0101 4.61 2.88 KIAA0101 9768 NM_001029989 Hs.81892 ENSG00000166803 KIAA1161 4.87 3.65 KIAA1161 57462 NM_020702 Hs.522083 ENSG00000164976 KIAA1324 2.42 2.31 KIAA1324 57535 NM_001267048 Hs.708190 ENSG00000116299 KIAA1456 4.71 3.43 KIAA1456 57604 NM_001099677 Hs.202521 ENSG00000250305 KIAA1614 3.66 2.84 KIAA1614 57710 NM_020950 Hs.734816 ENSG00000135835 KIAA1919 3.49 2.61 KIAA1919 91749 NM_153369 Hs.400572 ENSG00000173214 KIF18B 4.05 3.41 kinesin family member 18B 146909 NM_001080443 Hs.135094 ENSG00000186185 KIF1B 2.07 1.75 kinesin family member 1B 23095 NM_015074 Hs.97858 ENSG00000054523 KIF3A 2.18 1.94 kinesin family member 3A 11127 NM_001300791 Hs.43670 ENSG00000131437 KIR3DX1 3.74 3.28 killer cell immunoglobulin-like 90011 NM_001047605 Hs.288520 ENSG00000104970 receptor, three domains, X1 KLF3-AS1 2.34 2.48 KLF3 antisense RNA 1 79667 NM_024614 Hs.29725 ENSG00000231160 KLRD1 2.65 2.36 killer cell lectin-like receptor 3824 NM_001114396 Hs.562457 ENSG00000134539 subfamily D, member 1 KREMEN1 4.81 3.4 kringle containing 83999 NM_001039570 Hs.229335 ENSG00000183762 transmembrane protein 1 KRT18 2.8 2.75 keratin 18, type I 3875 NM_000224 Hs.406013 ENSG00000111057 KRT8 3.45 2.95 keratin 8, type II 3856 NM_001256282 Hs.533782 ENSG00000170421 L1TD1 4.64 3.67 LINE-1 type transposase 54596 NM_001164835 Hs.685462 ENSG00000240563 domain containing 1 L2HGDH 4.91 3.54 L-2-hydroxyglutarate dehydrogenase 79944 NM_024884 Hs.256034 ENSG00000087299 LAIR1 2.87 2.24 leukocyte-associated immunoglobulin- 3903 NM_001289023 Hs.572535 ENSG00000167613 like receptor 1 LARS2-AS1 3.66 2.87 LARS2 antisense RNA 1 100885795 NR_048543 Hs.641094 LDLR 2.41 2.26 low density lipoprotein receptor 3949 NM_000527 Hs.213289 ENSG00000130164 LGMN 3.31 2.67 legumain 5641 NM_001008530 Hs.18069 ENSG00000100600 LIFR-AS1 5.36 3.4 LIFR antisense RNA 1 100506495 NR_103553 Hs.657602 ENSG00000244968 LINC00092 2.59 2.33 long intergenic non-protein 100188953 NR_024129 Hs.434310 ENSG00000225194 coding RNA 92 LINC00260 2.91 2.68 long intergenic non-protein 84719 NM_032633 Hs.661178 coding RNA 260 LINC00294 3.93 3.15 long intergenic non-protein 283267 NR_015451 Hs.533701 ENSG00000280798 coding RNA 294 LINC00311 3.85 3.74 long intergenic non-protein 197196 NM_153238 Hs.679002 ENSG00000179219 coding RNA 311 LINC00346 5.19 3.87 long intergenic non-protein 283487 NM_178514 Hs.245390 ENSG00000255874 coding RNA 346 LINC00371 6.06 4.54 long intergenic non-protein 647166 NR_102431 Hs.195052 coding RNA 371 LINC00381 4.68 3.4 long intergenic non-protein 100874151 NR_047005 Hs.564552 ENSG00000226240 coding RNA 381 LINC00458 5.94 4.75 long intergenic non-protein 100507428 NR_108062 Hs.351262 ENSG00000234787 coding RNA 458 LINC00470 3.85 2.95 long intergenic non-protein 56651 NM_031416 Hs.541165 coding RNA 470 LINC00483 3.52 3.19 long intergenic non-protein 55018 NM_017928 Hs.389460 ENSG00000167117 coding RNA 483 LINC00485 7.11 5.02 long intergenic non-protein 283432 NR_033855 Hs.382110 ENSG00000258169 coding RNA 485 LINC00501 4.51 4.36 long intergenic non-protein 100820709 NR_047465 Hs.518409 ENSG00000203645 coding RNA 501 LINC00506 4.36 3.32 long intergenic non-protein 100846978 NR_047469 Hs.570649 ENSG00000281392 coding RNA 506 LINC00507 5.42 4.12 long intergenic non-protein 100862680 NR_046392 Hs.385496 ENSG00000256193 coding RNA 507 LINC00547 5.74 4.09 long intergenic non-protein 400121 NR_040244 Hs.558894 ENSG00000275226 coding RNA 547 LINC00578 4.72 3.66 long intergenic non-protein 100505566 NR_047568 Hs.581170 coding RNA 578 LINC00620 5.09 3.5 long intergenic non-protein 285375 NR_027103 Hs.319969 ENSG00000224514 coding RNA 620 LINC00649 2.97 2.45 long intergenic non-protein 400863 NM_001288961 Hs.729814 ENSG00000237945 coding RNA 649 LINC00652 4.41 3.52 long intergenic non-protein 29075 NM_014162 Hs.584899 coding RNA 652 LINC00663 4.14 3.4 long intergenic non-protein 284440 NR_026956 Hs.665307 coding RNA 663 LINC00665 3.09 2.84 long intergenic non-protein 100506930 NR_038278 Hs.595153 ENSG00000232677 coding RNA 665 LINC00670 4.75 3.48 long intergenic non-protein 284034 NR_034144 Hs.376614 ENSG00000179136 coding RNA 670 LINC00672 3.85 3 long intergenic non-protein 100505576 NR_038847 Hs.634043 ENSG00000263874 coding RNA 672 LINC00678 5.57 3.89 long intergenic non-protein 101410541 NR_102708 Hs.471439 ENSG00000254934 coding RNA 678 LINC00889 5.99 4.42 long intergenic non-protein 158696 NR_026935 Hs.558664 coding RNA 889 LINC00907 3.95 3.12 long intergenic non-protein 284260 NR_046174 Hs.652819 ENSG00000267586 coding RNA 907 LINC00910 3 2.48 long intergenic non-protein 100130581 NR_027412 Hs.546897 ENSG00000188825 coding RNA 910 LINC00923 2.84 2.56 long intergenic non-protein 91948 NR_024172 Hs.130423 ENSG00000251209 coding RNA 923 LINC00924 4.4 3.05 long intergenic non-protein 145820 NR_027132 Hs.652702 ENSG00000259134 coding RNA 924 LINC00941 3.79 3.38 long intergenic non-protein 100287314 NR_040245 Hs.355210 ENSG00000235884 coding RNA 941 LINC00958 4.91 3.92 long intergenic non-protein 100506305 NR_038904 Hs.153408 ENSG00000251381 coding RNA 958 LINC00963 2.8 2.51 long intergenic non-protein 100506190 NR_038955 Hs.529860 coding RNA 963 LINC00965 4.43 3.51 long intergenic non-protein 349196 NM_001025473 Hs.559040 coding RNA 965 LINC00970 4.24 3.32 long intergenic non-protein 101978719 NR_104091 Hs.517849 ENSG00000203601 coding RNA 970 LINC01012 3.13 2.69 long intergenic non-protein 100507173 NR_038292 Hs.635987 ENSG00000281706 coding RNA 1012 LINC01021 6.93 4.93 long intergenic non-protein 643401 NR_038848 Hs.533212 ENSG00000250337 coding RNA 1021 LINC01057 5.48 3.49 long intergenic non-protein 101928079 NR_104131 Hs.596857 ENSG00000224081 coding RNA 1057 LINC01087 5.01 3.44 long intergenic non-protein 101927994 NR_108087 Hs.635757 ENSG00000224559 coding RNA 1087 LINC01099 4.33 3.58 long intergenic non-protein 101928656 NR_108092 Hs.508131 ENSG00000251504 coding RNA 1099 LINC01160 4.12 3.22 long intergenic non-protein 100129269 NR_034126 Hs.689728 coding RNA 1160 LINC01204 4.02 3.25 long intergenic non-protein 101927528 NR_104644 Hs.550772 ENSG00000229563 coding RNA 1204 LINC01205 4.55 3.45 long intergenic non-protein 401082 NM_001145553 Hs.477089 ENSG00000228980 coding RNA 1205 LINC01207 4.05 3.59 long intergenic non-protein 100505989 NR_038834 Hs.328236 ENSG00000248771 coding RNA 1207 LINC01209 4.74 3.4 long intergenic non-protein 101928684 NR_110819 Hs.639352 ENSG00000228308 coding RNA 1209 LINC01212 3.81 3.27 long intergenic non-protein 101927152 NR_110000 Hs.382046 ENSG00000240405 coding RNA 1212 LINC01226 4.31 3.34 long intergenic non-protein 284551 NR_027085 Hs.658659 ENSG00000223907 coding RNA 1226 LINC01247 4.93 3.53 long intergenic non-protein 101929390 NR_110251 Hs.434407 ENSG00000227007 coding RNA 1247 LINC01252 4.11 2.85 long intergenic non-protein 338817 NR_033890 Hs.733066 ENSG00000247157 coding RNA 1252 LINC01299 3.88 3.19 long intergenic non-protein 286186 NR_033893 Hs.449427 ENSG00000254081 coding RNA 1299 LINC01356 4.31 3.22 long intergenic non-protein 100996702 NR_103746 Hs.632431 ENSG00000215866 coding RNA 1356 LOC100128233 4.52 3.88 uncharacterized LOC100128233 100128233 NR_103769 Hs.497323 ENSG00000255002 LOC100128288 4.28 3.38 uncharacterized LOC100128288 100128288 NR_024447 Hs.549913 LOC100128398 3.21 2.39 uncharacterized LOC100128398 100128398 NR_036508 Hs.655081 ENSG00000176593 LOC100128531 3.85 2.9 uncharacterized LOC100128531 100128531 NR_038941 Hs.662126 ENSG00000203280 LOC100128573 2.46 2.68 uncharacterized LOC100128573 100128573 NR_024491 Hs.465761 LOC100129940 3.73 3.44 uncharacterized LOC100129940 100129940 NM_001292023 Hs.685856 ENSG00000197301 LOC100130451 4.59 3.55 uncharacterized LOC100130451 100130451 NM_001242575 LOC100131257 4.35 3.29 zinc finger protein 655 pseudogene 100131257 NR_034022 Hs.551110 LOC100131564 2.81 2.26 uncharacterized LOC100131564 100131564 NR_034089 Hs.732666 LOC100131626 4.21 3.02 uncharacterized LOC100131626 100131626 NR_046369 Hs.721614 LOC100132077 3.76 3.1 uncharacterized LOC100132077 100132077 NR_033937 Hs.679111 ENSG00000232063 LOC100190986 2.12 2.25 uncharacterized LOC100190986 100190986 NR_024456 Hs.648439 LOC100268168 4 3.55 uncharacterized LOC100268168 100268168 NR_026682 Hs.519766 ENSG00000204758 LOC100287015 3.01 2.93 uncharacterized LOC100287015 100287015 NR_040040 Hs.156928 ENSG00000246089 LOC100287042 2.11 1.98 uncharacterized LOC100287042 100287042 NR_036520 Hs.514470 ENSG00000263843 LOC100287792 3.43 3.04 uncharacterized LOC100287792 100287792 NM_001001690 Hs.517026 ENSG00000204117 LOC100287846 4.08 2.69 patched 1 pseudogene 100287846 NR_037168 Hs.21550 LOC100335030 4.83 3.91 FGFR1 oncogene partner 2 100335030 NR_033267 Hs.687044 pseudogene LOC100420587 5.27 3.7 SHC SH2-domain binding 100420587 NR_110759 Hs.569956 ENSG00000267243 protein 1 pseudogene LOC100506023 3.79 2.76 uncharacterized LOC100506023 100506023 NR_037845 Hs.731284 LOC100506083 3.67 3.08 uncharacterized LOC100506083 100506083 NR_039997 Hs.635008 ENSG00000261777 LOC100506127 3.73 3.1 putative uncharacterized 100506127 NM_001013634 Hs.503319 ENSG00000179240 protein FLJ37770-like LOC100506472 3.36 2.68 uncharacterized LOC100506472 100506472 NR_040535 Hs.729080 LOC100506551 4.19 3.53 uncharacterized LOC100506551 100506551 NR_103809 Hs.657861 ENSG00000257279 LOC100506688 4.09 3.23 uncharacterized LOC100506688 100506688 NM_001242737 Hs.532063 ENSG00000215246 LOC100506746 3.32 2.75 uncharacterized LOC100506746 100506746 NR_038841 Hs.657766 ENSG00000163633 LOC100506990 2.84 2.36 uncharacterized LOC100506990 100506990 NR_040091 Hs.656893 LOC100996251 4 3.37 uncharacterized LOC100996251 100996251 NR_103777 Hs.382067 ENSG00000238198 LOC101409256 3.94 3.49 cell division cycle 42 pseudogene 101409256 NR_102424 LOC101926889 4.24 3.31 uncharacterized LOC101926889 101926889 NR_109994 Hs.585997 LOC101927181 2.82 2.67 uncharacterized LOC101927181 101927181 NR_108066 Hs.288853 ENSG00000136213 LOC101927257 3.78 3.16 uncharacterized LOC101927257 101927257 NR_109965 Hs.662725 ENSG00000232564 LOC101927274 4.46 3.67 uncharacterized LOC101927274 101927274 NR_110751 Hs.591168 ENSG00000249383 LOC101927374 4.86 3.64 uncharacterized LOC101927374 101927374 NR_110133 Hs.570644 LOC101927415 3.2 2.84 uncharacterized LOC101927415 101927415 NR_110049 Hs.636524 LOC101927476 4.99 4.19 uncharacterized LOC101927476 101927476 NR_110386 Hs.522607 ENSG00000236393 LOC101927575 4.56 3.2 uncharacterized LOC101927575 101927575 NR_110995 Hs.459826 ENSG00000227463 LOC101927740 4.04 3.36 uncharacterized LOC101927740 101927740 NR_109890 Hs.738721 ENSG00000245812 LOC101927797 3.21 2.79 uncharacterized LOC101927797 101927797 NR_109925 Hs.551743 LOC101927884 5.21 3.69 uncharacterized LOC101927884 101927884 NR_110281 Hs.671110 ENSG00000231172 LOC101928103 4.63 3.08 uncharacterized LOC101928103 101928103 NR_110292 Hs.665619 ENSG00000229267 LOC101928137 4.58 3.44 uncharacterized LOC101928137 101928137 NR_110130 Hs.694666 ENSG00000258123 LOC101928254 4.24 4.15 uncharacterized LOC101928254 101928254 NR_110182 Hs.571236 ENSG00000219445 LOC101928303 4.56 3.27 uncharacterized LOC101928303 101928303 NR_110698 Hs.375067 ENSG00000236155 LOC101928336 4.87 3.73 uncharacterized LOC101928336 101928336 NR_110396 ENSG00000230392 LOC101928372 3.85 3.11 uncharacterized LOC101928372 101928372 NR_110695 ENSG00000198358 LOC101928401 3.63 3.01 uncharacterized LOC101928401 101928401 NR_108099 Hs.385614 ENSG00000233288 LOC101928495 5.19 3.89 uncharacterized LOC101928495 101928495 NR_110409 Hs.545998 ENSG00000237208 LOC101928514 5.14 3.96 uncharacterized LOC101928514 101928514 NR_110837 Hs.617206 ENSG00000267065 LOC101928567 4.39 3.45 uncharacterized LOC101928567 101928567 NR_110839 Hs.569757 ENSG00000237057 LOC101928580 3.93 3.68 uncharacterized LOC101928580 101928580 NR_120556 Hs.569025 ENSG00000246211 LOC101928597 4.26 3.35 uncharacterized LOC101928597 101928597 NR_110091 Hs.638942 ENSG00000246394 LOC101928600 4.9 3.96 uncharacterized LOC101928600 101928600 NR_109904 Hs.694699 ENSG00000250127 LOC101928738 3.84 3.53 uncharacterized LOC101928738 101928738 NR_110851 Hs.399280 ENSG00000262188 LOC101928936 4.73 3.78 uncharacterized LOC101928936 101928936 NR_110867 Hs.533080 LOC101929181 3.42 2.44 uncharacterized LOC101929181 101929181 NR_104624 Hs.568616 ENSG00000235643 LOC101929224 4.44 3.84 uncharacterized LOC101929224 101929224 NR_110787 Hs.639369 ENSG00000260088 LOC101929259 4.17 3.67 uncharacterized LOC101929259 101929259 NR_120424 Hs.638490 LOC101929486 4.25 3.06 uncharacterized LOC101929486 101929486 NR_109868 Hs.548761 ENSG00000233048 LOC101929567 4.72 3.61 uncharacterized LOC101929567 101929567 NR_110257 Hs.634706 ENSG00000236008 LOC101929586 4.34 3.59 uncharacterized LOC101929586 101929586 NR_120363 Hs.569426 ENSG00000259175 LOC101929698 3.64 2.61 uncharacterized LOC101929698 101929698 NR_110619 Hs.638392 ENSG00000277301 LOC102467081 4.99 3.91 uncharacterized LOC102467081 102467081 NR_104662 LOC102723769 4.8 3.53 uncharacterized LOC102723769 102723769 NR_110761 Hs.652926 LOC102724927 4.39 3.7 uncharacterized LOC102724927 102724927 NR_120311 Hs.364739 ENSG00000262185 LOC143666 2.94 2.59 uncharacterized LOC143666 143666 NR_026967 Hs.337054 LOC150935 4.82 4.54 uncharacterized LOC150935 150935 NR_037808 Hs.555582 LOC151475 3.63 3.2 uncharacterized LOC151475 151475 NR_040038 Hs.528154 ENSG00000226125 LOC257396 3.45 2.42 uncharacterized LOC257396 257396 NR_034107 Hs.12326 ENSG00000247796 LOC283683 4.2 4 uncharacterized LOC283683 283683 NR_040057 Hs.534616 ENSG00000274253 LOC284023 3.54 2.88 uncharacterized LOC284023 284023 NR_024349 Hs.744470 ENSG00000179859 LOC284379 4.31 3.51 solute carrier family 7 (cationic amino 284379 NR_002938 Hs.631571 ENSG00000268864 acid transporter, y+ system), member 3 pseudogene LOC284412 6.66 4.68 uncharacterized LOC284412 284412 NR_029390 Hs.635932 LOC284454 4.32 3.54 uncharacterized LOC284454 284454 NR_036515 Hs.436426 ENSG00000267519 LOC284581 4.12 3.17 uncharacterized LOC284581 284581 NR_046097 LOC284865 4.37 3.67 uncharacterized LOC284865 284865 NR_038460 Hs.638498 ENSG00000249923 LOC284950 4.2 3.63 uncharacterized LOC284950 284950 NR_038888 Hs.570227 LOC285696 4.41 3.57 uncharacterized LOC285696 285696 NM_173669 Hs.646924 ENSG00000215196 LOC286437 4.49 3.29 uncharacterized LOC286437 286437 NR_039980 Hs.656786 LOC339166 3.75 2.65 uncharacterized LOC339166 339166 NR_040000 Hs.736088 ENSG00000179314 LOC339803 3.45 2.76 uncharacterized LOC339803 339803 NR_036496 Hs.252433 ENSG00000212978 LOC389641 3.53 2.91 uncharacterized LOC389641 389641 NR_033928 Hs.591835 ENSG00000246582 LOC400958 4.62 3.57 uncharacterized LOC400958 400958 NR_036586 Hs.591565 ENSG00000237638 LOC401052 4.04 3.52 uncharacterized LOC401052 401052 NM_001008737 Hs.662766 LOC440173 5.21 3.95 uncharacterized LOC440173 440173 NR_027471 Hs.127361 ENSG00000269994 LOC440300 3.9 3.42 chondroitin sulfate 440300 NR_033738 Hs.546565 ENSG00000259295 proteoglycan 4 pseudogene LOC441242 2.11 2.07 uncharacterized LOC441242 441242 NM_001013464 Hs.373941 ENSG00000272693 LOC643406 4.43 3.27 uncharacterized LOC643406 643406 NM_175877 Hs.431161 LOC644919 4.98 3.81 uncharacterized LOC644919 644919 NR_109757 Hs.434414 LOC646214 4.3 3.38 p21 protein (Cdc42/Rac)-activated 646214 NR_027053 Hs.510697 kinase 2 pseudogene LOC650293 6.38 3.67 seven transmembrane helix receptor 650293 NM_001040071 Hs.535167 LOC727896 3.8 2.72 cysteine and histidine-rich domain 727896 NR_026659 Hs.673126 (CHORD) containing 1 pseudogene LOC728613 2.3 2.03 programmed cell death 6 pseudogene 728613 NR_003713 Hs.720393 LOC728752 4.03 3.31 uncharacterized LOC728752 728752 NR_036504 Hs.729762 ENSG00000267309 LOC729603 4.36 3.16 calcineurin-like EF-hand 729603 NR_003288 Hs.674810 ENSG00000213073 protein 1 pseudogene LOC729732 3.63 2.93 uncharacterized LOC729732 729732 NR_047662 Hs.322761 LOC729987 4.36 3.05 uncharacterized LOC729987 729987 NR_046088 Hs.683961 ENSG00000226053 LOC731424 4.17 3.03 uncharacterized LOC731424 731424 NR_037867 Hs.427740 LOH12CR2 4.49 3.39 loss of heterozygosity, 12, 503693 NR_024061 Hs.67553 ENSG00000205791 chromosomal region 2 (non- protein coding) LPAL2 3.58 2.94 lipoprotein, Lp(a)-like 2, 80350 NM_024492 Hs.654503 ENSG00000213071 pseudogene LPCAT2 3.36 2.61 lysophosphatidylcholine 54947 NM_017839 Hs.460857 ENSG00000087253 acyltransferase 2 LPP 2.85 2.51 LIM domain containing preferred 4026 NM_001167671 Hs.720220 ENSG00000145012 translocation partner in lipoma LRPAP1 2.05 1.91 low density lipoprotein receptor- 4043 NM_002337 Hs.40966 ENSG00000163956 related protein associated protein 1 LRRC27 3.6 2.88 leucine rich repeat containing 27 80313 NM_001143757 Hs.119897 ENSG00000148814 LRRC57 3.77 3.17 leucine rich repeat containing 57 255252 NM_153260 Hs.234681 ENSG00000180979 LRRN4CL 4.42 4.03 LRRN4 C-terminal like 221091 NM_203422 Hs.427449 ENSG00000177363 LRTOMT 4.01 3.25 leucine rich transmembrane and O- 220074 NM_001145307 Hs.317243 ENSG00000184154 methyltransferase domain containing LUCAT1 5.28 4.95 lung cancer associated transcript 1 100505994 NR_103548 Hs.628363 ENSG00000248323 (non-protein coding) LYRM7 2.35 2.03 LYR motif containing 7 90624 NM_001293735 Hs.115467 ENSG00000186687 MAB21L3 4.04 3.19 mab-21-like 3 (C. elegans) 126868 NM_152367 Hs.376194 ENSG00000173212 MAGEA10 3.73 3.52 melanoma antigen family A10 4109 NM_001011543 Hs.18048 ENSG00000124260 MAN1B1-AS1 2.93 2.7 MAN1B1 antisense RNA 1 100289341 NR_027447 Hs.593896 ENSG00000268996 (head to head) MANEAL 6.55 4.78 mannosidase, endo-alpha-like 149175 NM_001031740 Hs.534562 ENSG00000185090 MAP1LC3C 5.17 3.96 microtubule-associated protein 1 440738 NM_001004343 Hs.534971 ENSG00000197769 light chain 3 gamma MAP3K13 2.6 2.25 mitogen-activated protein 9175 NM_001242314 Hs.591306 ENSG00000073803 kinase kinase kinase 13 MAP7D3 2.78 2.32 MAP7 domain containing 3 79649 NM_001173516 Hs.446275 ENSG00000129680 MARVELD3 4.25 3.45 MARVEL domain containing 3 91862 NM_001017967 Hs.513706 ENSG00000140832 MBOAT1 4.45 3.23 membrane bound O-acyltransferase 154141 NM_001080480 Hs.377830 ENSG00000172197 domain containing 1 MBOAT2 4.33 2.81 membrane bound O-acyltransferase 129642 NM_138799 Hs.467634 ENSG00000143797 domain containing 2 MCFD2 3.28 2.63 multiple coagulation factor 90411 NM_001171506 Hs.662152 ENSG00000180398 deficiency 2 MCUR1 2.23 1.92 mitochondrial calcium 63933 NM_001031713 Hs.214043 ENSG00000050393 uniporter regulator 1 MED15P9 4.39 3.57 mediator complex subunit 15 285103 NR_033903 Hs.570106 ENSG00000223760 pseudogene 9 MED18 3.5 2.65 mediator complex subunit 18 54797 NM_001127350 Hs.479911 ENSG00000130772 MEFV 4.22 3.28 Mediterranean fever 4210 NM_000243 Hs.632221 ENSG00000103313 METTL20 3.37 2.51 methyltransferase like 20 254013 NM_001135863 Hs.740628 ENSG00000139160 METTL21A 3.85 3.08 methyltransferase like 21A 151194 NM_001127395 Hs.664764 ENSG00000144401 METTL2A 2.57 2.09 methyltransferase like 2A 339175 NM_001005372 Hs.381204 ENSG00000087995 METTL2B 2.5 2.04 methyltransferase like 2B 55798 NM_018396 Hs.433213 ENSG00000165055 METTL8 3.18 2.57 methyltransferase like 8 79828 NM_024770 Hs.135146 ENSG00000123600 MFAP5 4.32 4.07 microfibrillar associated protein 5 8076 NM_001297709 Hs.512842 ENSG00000197614 MFSD11 2.35 2.09 major facilitator superfamily 79157 NM_001242532 Hs.73965 ENSG00000092931 domain containing 11 MGC27345 2.95 2.55 uncharacterized protein MGC27345 157247 NM_175880 Hs.552129 MIRLET7BHG 3.92 2.93 MIRLET7B host gene 400931 NM_207477 Hs.235838 ENSG00000197182 MLANA 3.42 3.21 melan-A 2315 NM_005511 Hs.154069 ENSG00000120215 MMD2 4.97 4.03 monocyte to macrophage 221938 NM_001100600 Hs.558694 ENSG00000136297 differentiation-associated 2 MMS22L 2.35 2.08 MMS22-like, DNA repair protein 253714 NM_198468 Hs.444292 ENSG00000146263 MOCS3 3.22 2.55 molybdenum cofactor synthesis 3 27304 NM_014484 Hs.159410 ENSG00000124217 MOG 4.36 3.37 myelin oligodendrocyte glycoprotein 4340 NM_001008228 Hs.141308 ENSG00000204655 MORN4 3.72 2.72 MORN repeat containing 4 118812 NM_001098831 Hs.217409 ENSG00000171160 MPPE1 2.83 2.35 metallophosphoesterase 1 65258 NM_001242904 Hs.712666 ENSG00000154889 MPV17L 3.24 2.81 MPV17 mitochondrial 255027 NM_001128423 Hs.720673 ENSG00000275543 membrane protein-like MPZL3 2.69 2.15 myelin protein zero-like 3 196264 NM_001286152 Hs.15396 ENSG00000160588 MREG 3.18 2.62 melanoregulin 55686 NM_018000 Hs.620391 ENSG0000011822 MRGPRX3 4.79 3.53 MAS-related GPR, member X3 117195 NM_054031 Hs.380177 ENSG00000179826 MS4A10 3.65 3 membrane-spanning 4-domains, 341116 NM_206893 Hs.591956 ENSG00000172689 subfamily A, member 10 MTFMT 3.44 2.79 mitochondrial methionyl- 123263 NM_139242 Hs.531615 ENSG00000103707 tRNA formyltransferase MTG2 2.51 2.02 mitochondrial ribosome- 26164 NM_015666 Hs.340636 ENSG00000101181 associated GTPase 2 MTRNR2L5 6.94 5.47 MT-RNR2-like 5 100463289 NM_001190478 Hs.727204 ENSG00000249860 MXRA7 2.44 2.12 matrix-remodelling associated 7 439921 NM_001008528 Hs.250723 ENSG00000182534 MYEOV2 0.48 0.51 myeloma overexpressed 2 150678 NM_001163424 Hs.293884 ENSG00000172428 MYLK3 3.77 3.22 myosin light chain kinase 3 91807 NM_001308301 Hs.130465 ENSG00000140795 NANOG 4.75 3.1 Nanog homeobox 79923 NM_001297698 Hs.635882 ENSG00000111704 NCRUPAR 4.14 3.71 non-protein coding RNA, 100302746 NR_028375 upstream of F2R/PAR1 NEK2 4.2 3.18 NIMA-related kinase 2 4751 NM_001204182 Hs.153704 ENSG00000117650 NEK8 2.71 2.3 NIMA-related kinase 8 284086 NM_178170 Hs.448468 ENSG00000160602 NEXN-AS1 3.79 3.32 NEXN antisense RNA 1 374987 NM_001039463 Hs.632414 ENSG00000235927 NLRP12 4.78 3.59 NLR family, pyrin domain 91662 NM_001277126 Hs.631573 ENSG00000142405 containing 12 NMNAT1 3.68 2.96 nicotinamide nucleotide 64802 NM_001297778 Hs.633762 ENSG00000173614 adenylyltransferase 1 NPFFR2 4.64 3.53 neuropeptide FF receptor 2 10886 NM_001144756 Hs.99231 ENSG00000056291 NPHS1 3.6 3.16 nephrosis 1, congenital, 4868 NM_004646 Hs.122186 ENSG00000161270 Finnish type (nephrin) NQO1 3.2 2.27 NAD(P)H dehydrogenase, quinone 1 1728 NM_000903 Hs.406515 ENSG00000181019 NRIP2 2.49 2.5 nuclear receptor interacting protein 2 83714 NM_031474 Hs.530816 ENSG00000053702 NRIP3 3.99 2.93 nuclear receptor interacting protein 3 56675 NM_020645 Hs.523467 ENSG00000175352 NT5DC3 3.57 2.85 5′-nucleotidase domain containing 3 51559 NM_001031701 Hs.48428 ENSG00000111696 NUBPL 3.17 2.32 nucleotide binding protein-like 80224 NM_001201573 Hs.288981 ENSG00000151413 NUGGC 2.57 2.48 nuclear GTPase, germinal 389643 NM_001010906 Hs.370129 ENSG00000189233 center associated NXN 4.95 3.79 nucleoredoxin 64359 NM_001205319 Hs.527989 ENSG00000167693 NXNL2 4.52 3.62 nucleoredoxin-like 2 158046 NM_001161625 Hs.734507 ENSG00000130045 NYAP2 3.86 3.11 neuronal tyrosine-phosphorylated 57624 NM_020864 Hs.224409 ENSG00000144460 phosphoinositide-3-kinase adaptor 2 OCLN 2.79 2.4 occludin 100506658 NM_001205254 Hs.592605 ENSG00000197822 ODF2L 4.02 3.1 outer dense fiber of sperm tails 2-like 57489 NM_001007022 Hs.149360 ENSG00000122417 OLAH 4.85 3.6 oleoyl-ACP hydrolase 55301 NM_001039702 Hs.24309 ENSG00000152463 OPHN1 4.66 3.31 oligophrenin 1 4983 NM_002547 Hs.128824 ENSG00000079482 OR11A1 4.75 3.53 olfactory receptor, family 11, subfamily 26531 NM_013937 Hs.676010 ENSG00000204694 A, member 1 OR7D2 3.8 3.11 olfactory receptor, family 7, subfamily 162998 NM_175883 Hs.531755 ENSG00000188000 D, member 2 OR7E91P 6.26 4.84 olfactory receptor, family 7, subfamily 79315 NR_002185 Hs.327033 ENSG00000205847 E, member 91 pseudogene ORAI2 3.08 2.65 ORAI calcium release- 80228 NM_001126340 Hs.363308 ENSG00000160991 activated calcium modulator 2 ORC4 4.42 3.38 origin recognition complex, subunit 4 5000 NM_001190879 Hs.558364 ENSG00000115947 ORC6 3.75 3.32 origin recognition complex, subunit 6 23594 NM_014321 Hs.49760 ENSG00000091651 OSBPL2 2.32 1.98 oxysterol binding protein-like 2 9885 NM_001001691 Hs.473254 ENSG00000130703 OSGEPL1-AS1 3.23 2.45 OSGEPL1 antisense RNA 1 101409258 NR_102429 Hs.738558 OTUD6A 5.09 4.14 OTU deubiquitinase 6A 139562 NM_207320 Hs.447381 ENSG00000189401 P2RX5- 3.14 2.64 P2RX5-TAX1BP3 readthrough 100533970 NR_037928 Hs.731607 ENSG00000257950 TAX1BP3 (NMD candidate) PABPC1P2 3.85 2.98 poly(A) binding protein, 728773 NR_026904 Hs.334462 cytoplasmic 1 pseudogene 2 PACS2 2.18 2.2 phosphofurin acidic cluster 23241 NM_001100913 Hs.525626 ENSG00000179364 sorting protein 2 PAQR7 3.26 2.65 progestin and adipoQ 164091 NM_178422 Hs.523652 ENSG00000182749 receptor family member VII PARD6G 4.04 3.5 par-6 family cell polarity 84552 NM_032510 Hs.654920 ENSG00000178184 regulator gamma PARK2 3.51 3 parkin RBR E3 ubiquitin protein ligase 5071 NM_004562 Hs.132954 ENSG00000185345 PART1 4.74 3.77 prostate androgen-regulated transcript 25859 NM_001039499 Hs.146312 ENSG00000152931 1 (non-protein coding) PAXBP1-AS1 4.11 3.3 PAXBP1 antisense RNA 1 100506215 NR_038879 Hs.657123 ENSG00000238197 PCAT18 4.34 3.61 prostate cancer associated transcript 18 728606 NR_024259 Hs.170599 ENSG00000265369 (non-protein coding) PCBD2 2.76 2.39 pterin-4 alpha-carbinolamine 84105 NM_032151 Hs.710014 ENSG00000132570 dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1)2 PCDH11X 4.44 3.85 protocadherin 11 X-linked 27328 NM_001168360 Hs.655673 ENSG00000102290 PCDH11Y 5.34 3.89 protocadherin 11 Y-linked 83259 NM_001278619 Hs.661308 ENSG00000099715 PCDHB9 4.21 3.51 protocadherin beta 9 56127 NM_019119 Hs.662726 ENSG00000177839 PDDC1 3.44 2.9 Parkinson disease 7 domain 347862 NM_182612 Hs.218362 ENSG00000177225 containing 1 PDE4C 4.64 3.82 phosphodiesterase 4C, cAMP-specific 5143 NM_000923 Hs.132584 ENSG00000105650 PDE6A 4.29 3.55 phosphodiesterase 6A, 5145 NM_000440 Hs.567314 ENSG00000132915 cGMP-specific, rod, alpha PDLIM5 2.84 2.51 PDZ and LIM domain 5 10611 NM_001011513 Hs.480311 ENSG00000163110 PDP2 3.15 2.47 pyruvate dehyrogenase phosphatase 57546 NM_020786 Hs.632214 ENSG00000172840 catalytic subunit 2 PEX13 2.2 1.9 peroxisomal biogenesis factor 13 5194 NM_002618 Hs.161377 ENSG00000162928 PGAM5 2.87 2.34 PGAM family member 5, 192111 NM_001170543 Hs.102558 ENSG00000247077 serine/threonine protein phosphatase, mitochondrial PGM2L1 2.47 2.14 phosphoglucomutase 2-like 1 283209 NM_173582 Hs.26612 ENSG00000165434 PGM5P2 4.87 3.76 phosphoglucomutase 5 pseudogene 2 595135 NR_002836 Hs.571593 ENSG00000277778 PHACTR4 2.21 1.9 phosphatase and actin regulator 4 65979 NM_001048183 Hs.225641 ENSG00000204138 PHAX 2.1 1.93 phosphorylated adaptor for 51808 NM_032177 Hs.555731 ENSG00000164902 RNA export PHYHD1 4.22 3.21 phytanoyl-CoA dioxygenase 254295 NM_001100876 Hs.709447 ENSG00000175287 domain containing 1 PIGX 2.62 2.3 phosphatidylinositol glycan 54965 NM_001166304 Hs.223296 ENSG00000163964 anchor biosynthesis, class X PIN4P1 3.8 3.03 protein (peptidylprolyl 728758 NR_003571 Hs.658099 cis/trans isomerase) NIMA- interacting, 4 pseudogene 1 PLCXD1 2.76 2.34 phosphatidylinositol-specific 55344 NM_018390 Hs.522568 ENSG00000182378 phospholipase C, X domain containing 1 PLEKHA5 3.35 2.56 pleckstrin homology domain 54477 NM_001143821 Hs.188614 ENSG00000052126 containing, family A member 5 PNMA2 3.78 2.97 paraneoplastic Ma antigen 2 10687 NM_007257 Hs.591838 ENSG00000240694 PNPO 3.15 2.5 pyridoxamine 5′-phosphate oxidase 55163 NM_018129 Hs.631742 ENSG00000108439 PNPT1 2.47 2.21 polyribonucleotide 87178 NM_033109 Hs.388733 ENSG00000138035 nucleotidyltransferase 1 POU2AF1 3.86 2.91 POU class 2 associating factor 1 5450 NM_006235 Hs.654525 ENSG00000110777 POU5F1 4.39 3.66 POU class 5 homeobox 1 5460 NM_001173531 Hs.249184 ENSG00000204531 PPARA 2.01 1.91 peroxisome proliferator- 5465 NM_001001928 Hs.103110 ENSG00000186951 activated receptor alpha PPFIBP1 2.93 2.51 PTPRF interacting protein, binding 8496 NM_001198915 Hs.172445 ENSG00000110841 protein 1 (liprin beta 1) PPIEL 3.32 2.92 peptidylprolyl isomerase E- 728448 NR_003929 Hs.472508 like pseudogene PPIL6 3.58 2.99 peptidylprolyl isomerase 285755 NM_001111298 Hs.32234 ENSG00000185250 (cyclophilin)-like 6 PPP1R3B 3.14 2.43 protein phosphatase 1, 79660 NM_001201329 Hs.458513 ENSG00000173281 regulatory subunit 3B PQLC2 3.19 3.02 PQ loop repeat containing 2 54896 NM_001040125 Hs.647620 ENSG00000040487 PRELID2 3.66 2.93 PRELI domain containing 2 153768 NM_138492 Hs.314261 ENSG00000186314 PRICKLE2-AS3 5.03 3.97 PRICKLE2 antisense RNA 3 100874243 NR_046702 Hs.670840 ENSG00000226017 PRKAR2A-AS1 3.81 3.22 PRKAR2A antisense RNA 1 100506637 NR_109996 Hs.634259 ENSG00000224424 PRNCR1 3.97 3.27 prostate cancer associated 101867536 NR_109833 Hs.652970 ENSG00000282961 non-coding RNA 1 PRR11 3.89 3.18 proline rich 11 55771 NM_018304 Hs.631750 ENSG00000068489 PRR7-AS1 2.95 2.56 PRR7 antisense RNA 1 340037 NR_038915 Hs.570879 PSPH 2.58 1.85 phosphoserine phosphatase 5723 NM_004577 Hs.512656 ENSG00000146733 PSTPIP2 3.42 2.89 proline-serine-threonine phosphatase 9050 NM_024430 Hs.567384 ENSG00000152229 interacting protein 2 PTCHD4 5.32 4.04 patched domain containing 4 442213 NM_001013732 Hs.659409 ENSG00000244694 PTCSC3 4.39 3.47 papillary thyroid carcinoma 100886964 NR_049735 Hs.742592 susceptibility candidate 3 (non-protein coding) PTGER4P2- 5.14 3.65 PTGER4P2-CDK2AP2P2 442421 NR_024496 Hs.585349 CDK2AP2P2 readthrough transcribed pseudogene PTGES2-AS1 2.85 2.88 PTGES2 antisense RNA 1 389791 NM_001013652 Hs.632678 ENSG00000232850 (head to head) PTK6 3.01 2.83 protein tyrosine kinase 6 5753 NM_001256358 Hs.51133 ENSG00000101213 PTOV1-AS1 2.32 2.25 PTOV1 antisense RNA 1 100506033 NR_040037 Hs.654814 ENSG00000268006 PTPRG-AS1 4.5 3.35 PTPRG antisense RNA 1 100506994 NR_038281 Hs.656620 ENSG00000241472 PXMP4 3.14 2.44 peroxisomal membrane 11264 NM_007238 Hs.654857 ENSG00000101417 protein 4.24 kDa QPCTL 3.58 3.17 glutaminyl-peptide 54814 NM_001163377 Hs.631556 ENSG00000011478 cyclotransferase-like QPRT 2.91 2.92 quinolinate phosphoribosyltransferase 23475 NM_014298 Hs.513484 ENSG00000103485 RAB36 3.79 3.16 RAB36, member RAS 9609 NM_004914 Hs.369557 ENSG00000100228 oncogene family RAB42 4.45 3.72 RAB42, member RAS 115273 NM_001193532 Hs.652321 ENSG00000188060 oncogene family RAMP2-AS1 5.2 3.97 RAMP2 antisense RNA 1 100190938 NR_024461 Hs.655265 ENSG00000197291 RASAL2-AS1 4.08 3.27 RASAL2 antisense RNA 1 100302401 NR_027982 Hs.736117 ENSG00000224687 RBBP5 2.29 1.81 retinoblastoma binding protein 5 5929 NM_001193272 Hs.519230 ENSG00000117222 RBBP9 2.52 2 retinoblastoma binding protein 9 10741 NM_006606 Hs.69330 ENSG00000089050 RBM34 2.81 2.35 RNA binding motif protein 34 23029 NM_001161533 Hs.535224 ENSG00000188739 RBMS2 3.36 2.82 RNA binding motif, single 5939 NM_002898 Hs.505729 ENSG00000076067 stranded interacting protein 2 RDH10 2.61 2.36 retinol dehydrogenase 10 (all-trans) 157506 NM_172037 Hs.244940 ENSG00000121039 RFT1 2.28 2.1 RFT1 homolog 91869 NM_052859 Hs.631910 ENSG00000163933 RHBG 3.7 3.21 Rh family, B glycoprotein 57127 NM_001256395 Hs.131835 ENSG00000132677 (gene/pseudogene) RHD 2.91 2.68 Rh blood group, D antigen 6007 NM_001127691 Hs.449968 ENSG00000187010 RIPPLY3 4.26 3.28 ripply transcriptional repressor 3 53820 NM_018962 Hs.254560 ENSG00000183145 RNF144A-AS1 4.07 2.8 RNF144A antisense RNA 1 386597 NR_033997 Hs.559010 ENSG00000228203 RNF207 3.76 2.95 ring finger protein 207 388591 NM_173795 Hs.716549 ENSG00000158286 RNF222 3.81 3.32 ring finger protein 222 643904 NM_001146684 Hs.526550 ENSG00000189051 ROR1-AS1 4.17 3.15 ROR1 antisense RNA 1 101927034 NR_110665 Hs.680824 ENSG00000223949 RPL23AP53 3.22 2.57 ribosomal protein L23a pseudogene 53 644128 NR_003572 Hs.652159 RUNDC1 3.11 2.63 RUN domain containing 1 146923 NM_173079 Hs.632255 ENSG00000198863 S1PR2 3.38 2.86 sphingosine-1-phosphate receptor 2 9294 NM_004230 Hs.655405 ENSG00000267534 SAA2 4.24 3.13 serum amyloid A2 6289 NM_001127380 Hs.731376 ENSG00000134339 SCAI 2.63 2.39 suppressor of cancer cell invasion 286205 NM_001144877 Hs.59504 ENSG00000173611 SCD5 4.02 3.09 stearoyl-CoA desaturase 5 79966 NM_001037582 Hs.379191 ENSG00000145284 SCHLAP1 4.03 3.25 SWI/SNF complex antagonist 101669767 NR_104319 ENSG00000281131 associated with prostate cancer 1 (non-protein coding) SEC14L4 4.22 3.23 SEC14-like lipid binding 4 284904 NM_001161368 Hs.517541 ENSG00000133488 SEC24B-AS1 3.14 2.68 SEC24B antisense RNA 1 100533182 NR_039978 Hs.518927 ENSG00000247950 SEPSECS-AS1 2.6 4.21 SEPSECS antisense RNA 1 285540 NR_037934 Hs.732278 (head to head) SFTPB 3.95 3.17 surfactant protein B 6439 NM_000542 Hs.512690 ENSG00000168878 SGCB 2.27 1.97 sarcoglycan, beta (43 kDa dystrophin- 6443 NM_000232 Hs.438953 ENSG00000163069 associated glycoprotein) SGOL1 3.16 2.77 shugoshin-like 1 (S. pombe) 151648 NM_001012409 Hs.105153 ENSG00000129810 SGSM1 3.88 3.15 small G protein signaling modulator 1 129049 NM_001039948 Hs.474397 ENSG00000167037 SHANK2-AS3 4.12 3.3 SHANK2 antisense RNA 3 220070 NM_145308 Hs.326766 ENSG00000171671 SHISA9 5.02 3.8 shisa family member 9 729993 NM_001145204 Hs.130661 ENSG00000237515 SHOX 2.82 2.39 short stature homeobox 6473 NM_000451 Hs.105932 ENSG00000185960 SHROOM1 4.92 3.67 shroom family member 1 134549 NM_001172700 Hs.519574 ENSG00000164403 SIGLEC10 3.86 2.8 sialic acid binding Ig-like lectin 10 89790 NM_001171156 Hs.284813 ENSG00000142512 SIRPB2 3.31 2.78 signal-regulatory protein beta 2 284759 NM_001122962 Hs.721685 ENSG00000196209 SIX4 4.13 3.33 SIX homeobox 4 51804 NM_017420 Hs.97849 ENSG00000100625 SKA1 4.3 3.38 spindle and kinetochore 220134 NM_001039535 Hs.134726 ENSG00000154839 associated complex subunit 1 SKP2 2.69 2.14 S-phase kinase-associated protein 2, 6502 NM_001243120 Hs.23348 ENSG00000145604 E3 ubiquitin protein ligase SLC14A2 4.34 3.33 solute carrier family 14 (urea 8170 NM_001242692 Hs.710927 ENSG00000132874 transporter), member 2 SLC15A1 3.52 2.91 solute carrier family 15 (oligopeptide 6564 NM_005073 Hs.436893 ENSG00000088386 transporter), member 1 SLC16A4 3.6 2.98 solute carrier family 16, member 4 9122 NM_001201546 Hs.351306 ENSG00000168679 SLC25A15 3.84 3.09 solute carrier family 25 10166 NM_014252 Hs.646645 ENSG00000102743 (mitochondrial carrier; ornithine transporter) member 15 SLC28A2 4.35 3.53 solute carrier family 28 (concentrative 9153 NM_004212 Hs.367833 ENSG00000137860 nucleoside transporter), member 2 SLC31A1 4.06 3.11 solute carrier family 31 (copper 1317 NM_001859 Hs.532315 ENSG00000136868 transporter), member 1 SLC35E3 2.91 2.43 solute carrier family 35, member E3 55508 NM_018656 Hs.506011 ENSG00000175782 SLC36A2 4.11 3.19 solute carrier family 36 (proton/amino 153201 NM_181776 Hs.483877 ENSG00000186335 acid symporter), member 2 SLC37A2 4.9 3.85 solute carrier family 37 (glucose-6- 219855 NM_001145290 Hs.352661 ENSG00000134955 phosphate transporter), member 2 SLC44A4 5.05 3.52 solute carrier family 44, member 4 80736 NM_001178044 Hs.335355 ENSG00000204385 SLC4A1 3.33 2.73 solute carrier family 4 (anion 6521 NM_000342 Hs.210751 ENSG00000004939 exchanger), member 1 (Diego blood group) SLC4A8 3.56 2.94 solute carrier family 4, sodium 9498 NM_001039960 Hs.4749 ENSG00000050438 bicarbonate cotransporter, member 8 SLC50A1 2.28 1.92 solute carrier family 50 (sugar efflux 55974 NM_001122837 Hs.292154 ENSG00000169241 transporter), member 1 SLC5A5 3.63 3.05 solute carrier family 5 (sodium/iodide 6528 NM_000453 Hs.584804 ENSG00000105641 cotransporter), member 5 SLC6A4 3.93 3.47 solute carrier family 6 6532 NM_001045 Hs.29792 ENSG00000108576 (neurotransmitter transporter), member 4 SLC7A5P2 2.63 2.57 solute carrier family 7 387254 NR_002594 Hs.448808 (amino acid transporter light chain, L system), member 5 pseudogene 2 SLC9A4 5.08 3.5 solute carrier family 9, subfamily A 389015 NM_001011552 Hs.447686 ENSG00000180251 (NHE4, cation proton antiporter 4), member 4 SLFNL1-AS1 3.57 2.93 SLFNL1 antisense RNA 1 100507178 NR_037868 Hs.660056 ENSG00000281207 SMG1P7 3.5 3.15 SMG1 pseudogene 7 100506060 NR_033959 Hs.655258 ENSG00000261556 SMIM14 3.45 2.75 small integral membrane protein 14 201895 NM_174921 Hs.205952 ENSG00000163683 SMIM17 5.46 3.85 small integral membrane protein 17 147670 NM_001193628 Hs.336588 ENSG00000268182 SNHG20 3.48 3.1 small nucleolar RNA host gene 20 654434 NR_027058 Hs.720923 ENSG00000234912 SNHG4 4.17 3.63 small nucleolar RNA host gene 4 724102 NR_003141 Hs.268939 SNX22 2.51 2.18 sorting nexin 22 79856 NM_024798 Hs.744250 ENSG00000157734 SOX9-AS1 5.1 3.32 SOX9 antisense RNA 1 400618 NR_103737 Hs.657374 ENSG00000234899 SPATS2 2.59 2.32 spermatogenesis associated, 65244 NM_001293285 Hs.654826 ENSG00000123352 serine-rich 2 SPATS2L 2.78 2.29 spermatogenesis associated, 26010 NM_001100422 Hs.120323 ENSG00000196141 serine-rich 2-like SPC25 4.52 3.46 SPC25, NDC80 kinetochore 57405 NM_020675 Hs.421956 ENSG00000152253 complex component SPDYE8P 2.11 1.98 speedy/RINGO cell cycle regulator 728524 NM_001023562 Hs.571275 family member E8, pseudogene SPIB 3.67 2.75 Spi-B transcription factor 6689 NM_001243998 Hs.437905 ENSG00000269404 (Spi-1/PU.1 related) SPRED1 4.19 3.24 sprouty-related, EVH1 161742 NM_152594 Hs.525781 ENSG00000166068 domain containing 1 SRRM2-AS1 3.86 3.24 SRRM2 antisense RNA 1 100128788 NR_027274 Hs.311208 ENSG00000205913 SRSF12 3.63 3.27 serine/arginine-rich splicing factor 12 135295 NM_080743 Hs.254414 ENSG00000154548 STAC2 4.17 3.11 SH3 and cysteine rich domain 2 342667 NM_198993 Hs.145068 ENSG00000141750 STAP2 3.25 2.98 signal transducing adaptor 55620 NM_001013841 Hs.194385 ENSG00000178078 family member 2 STAR 3.6 2.66 steroidogenic acute regulatory protein 6770 NM_000349 Hs.521535 ENSG00000147465 STAU2-AS1 4.02 4.08 STAU2 antisense RNA 1 100128126 NR_038406 Hs.679921 ENSG00000253302 STRIP2 3.61 3.14 striatin interacting protein 2 57464 NM_001134336 Hs.489988 ENSG00000128578 SWSAP1 2.79 2.31 SWIM-type zinc finger 7 126074 NM_175871 Hs.631619 ENSG00000173928 associated protein 1 TAF8 2.86 2.4 TAF8 RNA polymerase II, TATA 129685 NM_138572 Hs.520122 ENSG00000137413 box binding protein (TBP)-associated factor, 43 kDa TANGO2 2.65 2.04 transport and golgi 128989 NM_001283106 Hs.474233 ENSG00000183597 organization 2 homolog TARS2 2.64 2.13 threonyl-tRNA synthetase 2, 80222 NM_001271895 Hs.288974 ENSG00000143374 mitochondrial (putative) TATDN3 3.33 2.85 TatD DNase domain containing 3 128387 NM_001042552 Hs.530538 ENSG00000203705 TBC1D24 2.97 2.82 TBC1 domain family, member 24 57465 NM_001199107 Hs.353087 ENSG00000162065 TBCCD1 2.64 2.29 TBCC domain containing 1 55171 NM_001134415 Hs.518469 ENSG00000113838 TBXA2R 3.83 3.16 thromboxane A2 receptor 6915 NM_001060 Hs.442530 ENSG00000006638 TEX101 3.65 3.17 testis expressed 101 83639 NM_001130011 Hs.97978 ENSG00000131126 TFDP2 2.02 1.98 transcription factor Dp-2 7029 NM_001178138 Hs.379018 ENSG00000114126 (E2F dimerization partner 2) THRIL 3.15 2.63 TNF and HNRNPL related 102659353 NR_110375 Hs.596464 ENSG00000280634 immunoregulatory long non- coding RNA TIGD1 2.33 2.38 rigger transposable element derived 1 200765 NM_145702 Hs.211823 ENSG00000221944 TINCR 2.55 2.42 tissue differentiation-inducing non- 257000 NM_153375 Hs.515575 ENSG00000223573 protein coding RNA TLCD2 4.68 3.6 TLC domain containing 2 727910 NM_001164407 Hs.531005 ENSG00000185561 TLR10 3.68 2.57 toll-like receptor 10 81793 NM_001017388 Hs.120551 ENSG00000174123 TLR8-AS1 5.69 3.95 TLR8 antisense RNA 1 349408 NR_030727 Hs.685035 ENSG00000233338 TMCC1-AS1 4.46 3.15 TMCC1 antisense RNA 1 100507032 NR_037893 Hs.529562 ENSG00000271270 (head to head) TMEM106A 3.32 2.82 transmembrane protein 106A 113277 NM_001291586 Hs.536474 ENSG00000184988 TMEM120B 2.62 2.28 transmembrane protein 120B 144404 NM_001080825 Hs.644504 ENSG00000188735 TMEM168 2.41 2.01 transmembrane protein 168 64418 NM_001287497 Hs.606345 ENSG00000146802 TMEM212 4.48 3.34 transmembrane protein 212 389177 NM_001164436 Hs.642307 ENSG00000186329 TMEM213 3.63 3.05 transmembrane protein 213 155006 NM_001085429 Hs.567729 ENSG00000214128 TMEM236 3.74 3.34 transmembrane protein 236 653567 NM_001013629 Hs.564139 ENSG00000148483 TMEM254-AS1 3.57 2.82 TMEM254 antisense RNA 1 219347 NR_027428 Hs.524453 TMEM38A 3.65 3.13 transmembrane protein 38A 79041 NM_024074 Hs.436068 ENSG00000072954 TMEM41B 2.92 2.24 transmembrane protein 41B 440026 NM_001165030 Hs.594563 ENSG00000166471 TMIGD2 2.08 1.98 transmembrane and immunoglobulin 126259 NM_001169126 Hs.263928 ENSG00000167664 domain containing 2 TNFAIP8L1 3.03 2.55 tumor necrosis factor, alpha- 126282 NM_001167942 Hs.465643 ENSG00000185361 induced protein 8-like 1 TNFAIP8L2- 6.07 4.08 TNFAIP8L2-SCNM1 readthrough 100534012 NM_001204848 Hs.732060 ENSG00000163156 SCNM1 TONSL 2.99 2.48 tonsoku-like, DNA repair protein 4796 NM_013432 Hs.675285 ENSG00000160949 TOR1AIP2 2.24 1.91 torsin A interacting protein 2 163590 NM_001199260 Hs.571797 ENSG00000169905 TOR4A 3.61 2.93 torsin family 4, member A 54863 NM_017723 Hs.495541 ENSG00000198113 TPMT 2.9 2.63 thiopurine S-methyltransferase 7172 NM_000367 Hs.444319 ENSG00000137364 TPTEP1 3.95 2.81 transmembrane phosphatase with 387590 NR_001591 Hs.474116 ENSG00000100181 tensin homology pseudogene 1 TRAF3IP2 3.47 2.98 TRAF3 interacting protein 2 10758 NM_001164281 Hs.561514 ENSG00000056972 TRAPPC2 2.11 2.01 trafficking protein particle complex 2 6399 NM_001011658 Hs.592238 ENSG00000196459 TRIM16 2.7 2.5 tripartite motif containing 16 10626 NM_006470 Hs.123534 ENSG00000221926 TRIM45 4.23 3.39 tripartite motif containing 45 80263 NM_001145635 Hs.301526 ENSG00000134253 TRPV1 3.44 3.24 transient receptor potential cation 7442 NM_018727 Hs.579217 ENSG00000196689 channel, subfamily V, member 1 TSG1 4.82 3.93 tumor suppressor TSG1 643432 NR_015362 Hs.509936 TSIX 4.23 3.42 TSIX transcript, XIST antisense RNA 9383 NR_003255 Hs.529901 ENSG00000270641 TSTD3 3.37 3.14 thiosulfate sulfurtransferase 100130890 NM_001195131 Hs.634506 ENSG00000228439 (rhodanese)-like domain containing 3 TUBA3FP 3.9 3.23 tubulin, alpha 3f, pseudogene 113691 NR_003608 Hs.585006 ENSG00000161149 TUFT1 3.19 2.99 tuftelin 1 7286 NM_001126337 Hs.489922 ENSG00000143367 TVP23C 2.66 2.56 trans-golgi network vesicle protein 23 201158 NM_001135036 Hs.164595 ENSG00000175106 homolog C (S. cerevisiae) UBE2Q2P1 3.73 3.08 ubiquitin-conjugating enzyme E2Q 388165 NM_207382 Hs.498348 ENSG00000189136 family member 2 pseudogene 1 UBL7-AS1 4.09 3.42 UBL7 antisense RNA 1 440288 NR_038448 Hs.611046 ENSG00000247240 (head to head) UBOX5 2.27 2.05 U-box domain containing 5 22888 NM_001267584 Hs.654646 ENSG00000185019 UCKL1-AS1 3.97 3.53 UCKL1 antisense RNA 1 100113386 NR_027287 Hs.551552 UGDH-AS1 4.44 3.36 UGDH antisense RNA 1 100885776 NR_047679 Hs.640769 ENSG00000249348 UGGT1 2.1 1.94 UDP-glucose glycoprotein 56886 NM_001025777 Hs.743306 ENSG00000136731 glucosyltransferase 1 UGT8 4.93 3.72 UDP glycosyltransferase 8 7368 NM_001128174 Hs.144197 ENSG00000174607 UPK1B 4.09 3.31 uroplakin 1B 7348 NM_006952 Hs.271580 ENSG00000114638 USP49 2.46 2.25 ubiquitin specific peptidase 49 25862 NM_001286554 Hs.593575 ENSG00000164663 USP54 2.37 2.16 ubiquitin specific peptidase 54 159195 NM_152586 Hs.657355 ENSG00000166348 UTP11L 3.22 2.35 UTP11-like, U3 small nucleolar 51118 NM_016037 Hs.472038 ENSG00000183520 ribonucleoprotein (yeast) UTS2B 4.79 3.78 urotensin 2B 257313 NM_198152 Hs.518492 ENSG00000188958 VSIG1 2.55 2.09 V-set and immunoglobulin 340547 NM_001170553 Hs.177164 ENSG00000101842 domain containing 1 VSTM4 4.19 3.25 V-set and transmembrane 196740 NM_001031746 Hs.522928 ENSG00000165633 domain containing 4 WDR11-AS1 4.3 3.3 WDR11 antisense RNA 1 283089 NR_033850 Hs.568750 ENSG00000227165 WDR45 2.27 1.9 WD repeat domain 45 11152 NM_001029896 Hs.632807 ENSG00000196998 WDR92 2.37 1.67 WD repeat domain 92 116143 NM_001256476 Hs.631877 ENSG00000243667 WFDC8 4.12 3.11 WAP four-disulfide core domain 8 90199 NM_130896 Hs.116128 ENSG00000158901 WNT7B 3.91 3.4 wingless-type MMTV integration site 7477 NM_058238 Hs.512714 ENSG00000188064 family, member 7B XIAP 2.32 1.93 X-linked inhibitor of apoptosis, E3 331 NM_001167 Hs.356076 ENSG00000101966 ubiquitin protein ligase XKR9 4.97 3.6 XK, Kell blood group complex 389668 NM_001011720 Hs.458938 ENSG00000221947 subunit-related family, member 9 XPNPEP3 2.73 2.35 X-prolyl aminopeptidase 3, 63929 NM_001204827 Hs.529163 ENSG00000196236 mitochondrial XRCC2 3.95 3.39 X-ray repair complementing defective 7516 NM_005431 Hs.647093 ENSG00000196584 repair in Chinese hamster cells 2 ZBTB8A 3.97 3.28 zinc finger and BTB domain 653121 NM_001040441 Hs.546479 ENSG00000160062 containing 8A ZC3H12D 2.26 2.3 zinc finger CCCH-type 340152 NM_207360 Hs.632618 ENSG00000178199 containing 12D ZFP14 2.62 1.96 ZFP14 zinc finger protein 57677 NM_001297619 Hs.35524 ENSG00000142065 ZFP30 2.66 2.28 ZFP30 zinc finger protein 22835 NM_014898 Hs.716719 ENSG00000120784 ZFP42 3.79 2.91 ZFP42 zinc finger protein 132625 NM_001304358 Hs.335787 ENSG00000179059 ZKSCAN3 3.87 2.77 zinc finger with KRAB and 80317 NM_001242894 Hs.380930 ENSG00000189298 SCAN domains 3 ZKSCAN7 2.64 2.17 zinc finger with KRAB and 55888 NM_001288590 Hs.529512 ENSG00000196345 SCAN domains 7 ZMYM5 2.23 1.95 zinc finger, MYM-type 5 9205 NM_001039649 Hs.530988 ENSG00000132950 ZNF154 2.49 2.26 zinc finger protein 154 7710 NM_001085384 Hs.646378 ENSG00000179909 ZNF2 3.33 2.35 zinc finger protein 2 7549 NM_001017396 Hs.590916 ENSG00000275111 ZNF264 2.16 1.84 zinc finger protein 264 9422 NM_003417 Hs.515634 ENSG00000083844 ZNF286B 3.02 2.56 zinc finger protein 286B 729288 NM_001145045 Hs.534279 ENSG00000249459 ZNF34 4 3.19 zinc finger protein 34 80778 NM_001286769 Hs.631854 ENSG00000196378 ZNF347 3.18 2.72 zinc finger protein 347 84671 NM_001172674 Hs.467239 ENSG00000197937 ZNF471 5.04 3.57 zinc finger protein 471 57573 NM_020813 Hs.710590 ENSG00000196263 ZNF483 3.18 2.91 zinc finger protein 483 158399 NM_001007169 Hs.584864 ENSG00000173258 ZNF490 2.8 2.42 zinc finger protein 490 57474 NM_020714 Hs.655860 ENSG00000188033 ZNF492 3.5 2.92 zinc finger protein 492 57615 NM_020855 Hs.232108 ENSG00000229676 ZNF526 3.18 2.4 zinc finger protein 526 116115 NM_133444 Hs.137282 ENSG00000167625 ZNF527 2.89 2.38 zinc finger protein 527 84503 NM_032453 Hs.590940 ENSG00000189164 ZNF543 2.48 2.13 zinc finger protein 543 125919 NM_213598 Hs.202544 ENSG00000178229 ZNF554 3.36 2.65 zinc finger protein 554 115196 NM_001102651 Hs.307043 ENSG00000172006 ZNF556 4.28 4.37 zinc finger protein 556 80032 NM_001300843 Hs.287433 ENSG00000172000 ZNF562 2.57 2.1 zinc finger protein 562 54811 NM_001130031 Hs.371107 ENSG00000171466 ZNF662 3.76 2.78 zinc finger protein 662 389114 NM_001134656 Hs.720173 ENSG00000182983 ZNF665 4.04 3.18 zinc finger protein 665 79788 NM_024733 Hs.745230 ENSG00000197497 ZNF677 3.48 2.9 zinc finger protein 677 342926 NM_182609 Hs.20506 ENSG00000197928 ZNF713 3.93 3.69 zinc finger protein 713 349075 NM_182633 Hs.660834 ENSG00000178665 ZNF716 3.7 3.18 zinc finger protein 716 441234 NM_001159279 Hs.533121 ENSG00000182111 ZNF761 3.08 2.59 zinc finger protein 761 388561 NM_001008401 Hs.433293 ENSG00000160336 ZNF785 2.85 2.5 zinc finger protein 785 146540 NM_152458 Hs.513509 ENSG00000197162 ZNF793 3.98 3.26 zinc finger protein 793 390927 NM_001013659 Hs.568010 ENSG00000188227 ZNF814 2.58 2.29 zinc finger protein 814 730051 NM_001144989 Hs.634143 ENSG00000204514 ZNF818P 3.18 2.52 zinc finger protein 818, pseudogene 390963 NM_001001675 Hs.444446 ZNF850 3.21 2.68 zinc finger protein 850 342892 NM_001193552 Hs.406307 ENSG00000267041 ZNRF3-AS1 4.24 3.54 ZNRF3 antisense RNA 1 100874123 NR_046851 Hs.674708 ENSG00000177993 ZSCAN22 3.74 2.67 zinc finger and SCAN 342945 NM_181846 Hs.388162 ENSG00000182318 domain containing 22 ZYG11A 4.09 3.51 zyg-11 family member A, 440590 NM_001004339 Hs.658458 ENSG00000203995 cell cycle regulator
TABLE-US-00008 TABLE 7A Monocyte Subtype Genes. Fold-change Entrez mono1 vs mono2 UniqueID Name ID Accession UGCluster Ensembl −2.1276596 NT5DC3 5′-nucleotidase domain 51559 NM_001031701 Hs.48428 ENSG00000111696 containing 3 2.0400000 PGLS 6-phosphogluconolactonase 25796 NM_012088 Hs.466165 ENSG00000130313 2.0200000 ABHD14A abhydrolase domain 25864 NM_015407 Hs.534400 ENSG00000248487 containing 14A 2.0600000 AAAS achalasia, adrenocortical 8086 NM_001173466 Hs.369144 ENSG00000094914 insufficiency, alacrimia 1.7100000 ACP2 acid phosphatase 2, lysosomal 53 NM_001131064 Hs.532492 ENSG00000134575 1.5600000 ACO2 aconitase 2, mitochondrial 50 NM_001098 Hs.643610 ENSG00000100412 1.6400000 APEH acylaminoacyl-peptide 327 NM_001640 Hs.517969 ENSG00000164062 hydrolase −2.7027027 ACBD7 acyl-CoA binding domain 414149 NM_001039844 Hs.644598 ENSG00000176244 containing 7 −2.1276596 ACADSB acyl-CoA dehydrogenase, 36 NM_001609 Hs.81934 ENSG00000196177 short/branched chain 1.6300000 AP1M1 adaptor-related protein 8907 NM_001130524 Hs.71040 ENSG00000072958 complex 1, mu 1 subunit −2.3809524 AP1S3 adaptor-related protein 130340 NM_001039569 Hs.632555 ENSG00000152056 complex 1, sigma 3 subunit 1.4800000 AP2B1 adaptor-related protein 163 NM_001030006 Hs.514819 ENSG00000006125 complex 2, beta 1 subunit −1.7857143 AP4S1 adaptor-related protein 11154 NM_001128126 Hs.293411 ENSG00000100478 complex 4, sigma 1 subunit −1.7543860 ADAT1 adenosine deaminase, tRNA- 23536 NM_012091 Hs.729312 ENSG00000065457 specific 1 1.5200000 ADSL adenylosuccinate lyase 158 NM_000026 Hs.75527 ENSG00000239900 1.5600000 ARL2BP ADP-ribosylation factor-like 23568 NM_012106 Hs.632873 ENSG00000102931 2 binding protein −2.4390244 ADRA1A adrenoceptor alpha 1A 148 NM_000680 Hs.709175 ENSG00000120907 −1.8181818 AARS2 alanyl-tRNA synthetase 2, 57505 NM_020745 Hs.158381 ENSG00000124608 mitochondrial 1.7400000 ALDH2 aldehyde dehydrogenase 2 217 NM_000690 Hs.604551 ENSG00000111275 family (mitochondrial) −2.0408163 ALDH6A1 aldehyde dehydrogenase 6 4329 NM_001278593 Hs.293970 ENSG00000119711 family, member A1 1.5700000 AKR1B1 aldo-keto reductase family 1, 231 NM_001628 Hs.521212 ENSG00000085662 member B1 (aldose reductase) 1.5800000 ALKBH5 AlkB family member 5, RNA 54890 NM_017758 Hs.744130 ENSG00000091542 demethylase −1.5384615 ALPK1 alpha-kinase 1 80216 NM_001102406 Hs.652825 ENSG00000073331 −2.0408163 AASS aminoadipate-semialdehyde 10157 NM_005763 Hs.156738 ENSG00000008311 synthase 2.0800000 AGTRAP angiotensin II receptor- 57085 NM_001040194 Hs.464438 ENSG00000177674 associated protein −1.8181818 ASB11 ankyrin repeat and SOCS box 140456 NM_001012428 Hs.352183 ENSG00000165192 containing 11, E3 ubiquitin protein ligase −2.4390244 ANKRD20A9P ankyrin repeat domain 20 284232 NR_027995 Hs.679496 family, member A9, pseudogene −1.6949153 ANKRD36B ankyrin repeat domain 36B 57730 NM_020970 Hs.532921 ENSG00000196912 1.3900000 ANXA11 annexin A11 311 NM_001157 Hs.530291 ENSG00000122359 −1.6393443 ANP32A-IT1 ANP32A intronic transcript 1 80035 NM_001040150 Hs.662150 −1.3698630 AAK1 AP2 associated kinase 1 22848 NM_014911 Hs.468878 ENSG00000115977 −3.1250000 APOBEC3B-AS1 APOBEC3B antisense RNA 1 100874530 NR_104187 Hs.626951 ENSG00000249310 1.7200000 APOA1BP apolipoprotein A-I binding 128240 NM_144772 Hs.528320 ENSG00000163382 protein −3.8461538 APOA2 apolipoprotein A-II 336 NM_001643 Hs.237658 ENSG00000158874 −1.8181818 APOL1 apolipoprotein L, 1 8542 NM_001136540 Hs.114309 ENSG00000100342 −2.4390244 APOL4 apolipoprotein L, 4 80832 NM_030643 Hs.115099 ENSG00000100336 −1.9607843 ARGFX arginine-fifty homeobox 503582 NM_001012659 Hs.224976 ENSG00000186103 −2.8571429 ARHGEF26-AS1 ARHGEF26 antisense RNA 1 100507524 NR_037901 Hs.370221 ENSG00000243069 −1.8518519 ARMC9 armadillo repeat containing 9 80210 NM_001271466 Hs.471610 ENSG00000135931 1.5400000 ASNA1 arsA arsenite transporter, 439 NM_004317 Hs.465985 ENSG00000198356 ATP-binding, homolog 1 (bacterial) −5.2631579 AS3MT arsenite methyltransferase 57412 NM_020682 Hs.720370 ENSG00000214435 −2.0833333 AIPL1 aryl hydrocarbon receptor 23746 NM_001033054 Hs.279887 ENSG00000129221 interacting protein-like 1 1.5600000 ASTE1 asteroid homolog 1 28990 NM_001288950 Hs.100878 ENSG00000034533 (Drosophila) −3.4482759 ASTN2 astrotactin 2 23245 NM_001184734 Hs.601562 ENSG00000148219 −1.4285714 ATXN7 ataxin 7 6314 NM_000333 Hs.476595 ENSG00000163635 1.5400000 ATP5B ATP synthase, H+ 506 NM_001686 Hs.406510 ENSG00000110955 transporting, mitochondrial F1 complex, beta polypeptide 2.5900000 ATP5D ATP synthase, H+ 513 NM_001001975 Hs.418668 ENSG00000099624 transporting, mitochondrial F1 complex, delta subunit 2.5100000 ATP5G2 ATP synthase, H+ 517 NM_001002031 Hs.524464 ENSG00000135390 transporting, mitochondrial Fo complex, subunit C2 (subunit 9) −2.2222222 ATAD3C ATPase family, AAA domain 219293 NM_001039211 Hs.724767 ENSG00000215915 containing 3C −2.1739130 ABCA9 ATP-binding cassette, sub- 10350 NM_080283 Hs.131686 ENSG00000154258 family A (ABC1), member 9 −2.8571429 ABCC9 ATP-binding cassette, sub- 10060 NM_005691 Hs.732701 ENSG00000069431 family C (CFTR/MRP), member 9 −1.7241379 ABCF1 ATP-binding cassette, sub- 23 NM_001025091 Hs.655285 ENSG00000204574 family F (GCN20), member 1 −2.5641026 BBS5 Bardet-Biedl syndrome 5 129880 NM_152384 Hs.233398 ENSG00000163093 −2.3255814 BNIPL BCL2/adenovirus E1B 19 kD 149428 NM_001159642 Hs.591473 ENSG00000163141 interacting protein like −2.0833333 BCL2L2- BCL2L2-PABPN1 100529063 NM_001199864 Hs.707712 ENSG00000258643 PABPN1 readthrough −2.3809524 BZRAP1 benzodiazepine receptor 9256 NM_001261835 Hs.112499 ENSG00000005379 (peripheral) associated protein 1 −2.2222222 BHMT2 betaine-homocysteine S- 23743 NM_001178005 Hs.114172 ENSG00000132840 methyltransferase 2 −1.7857143 BVES blood vessel epicardial 11149 NM_001199563 Hs.221660 ENSG00000112276 substance −2.0000000 BMS1P4 BMS1 pseudogene 4 729096 NR_026592 Hs.709171 ENSG00000271816 −2.0000000 BMS1P5 BMS1 pseudogene 5 399761 NM_001040053 Hs.571994 ENSG00000204177 −1.7857143 BMS1P6 BMS1 pseudogene 6 642826 NR_024495 Hs.463017 ENSG00000251079 1.9300000 BOLA3 bolA family member 3 388962 NM_001035505 Hs.61472 ENSG00000163170 −2.1276596 BMP7 bone morphogenetic protein 7 655 NM_001719 Hs.473163 ENSG00000101144 1.8200000 BCKDHA branched chain keto acid 593 NM_000709 Hs.433307 ENSG00000248098 dehydrogenase E1, alpha polypeptide −2.3809524 BRIP1 BRCA1 interacting protein C- 83990 NM_032043 Hs.128903 ENSG00000136492 terminal helicase 1 −2.6315789 BREA2 breast cancer estrogen- 286076 NM_001024610 Hs.178095 ENSG00000181097 induced apoptosis 2 −1.4492754 BAZ2A bromodomain adjacent to 11176 NM_001300905 Hs.314263 ENSG00000076108 zinc finger domain, 2A −1.7543860 BTN2A1 butyrophilin, subfamily 2. 11120 NM_001197233 Hs.159028 ENSG00000112763 member A1 2.5600000 C10orf32-ASMT C10orf32-ASMT readthrough 100528007 NR_037644 Hs.720370 (NMD candidate) −1.7241379 C1RL-AS1 C1RL antisense RNA 1 283314 NR_026947 Hs.744212 ENSG00000205885 −2.0408163 CDH23 cadherin-related 23 64072 NM_001171930 Hs.656032 ENSG00000107736 −2.1739130 LOC729603 calcineurin-like EF-hand 729603 NR_003288 Hs.674810 ENSG00000213073 protein 1 pseudogene −1.8867925 CAMK1D calcium/calmodulin- 57118 NM_020397 Hs.600547 ENSG00000183049 dependent protein kinase ID 1.3600000 CAD carbamoyl-phosphate 790 NM_004341 Hs.377010 ENSG00000084774 synthetase 2, aspartate transcarbamylase, and dihydroorotase −2.1739130 CHST6 carbohydrate (N- 4166 NM_021615 Hs.655622 ENSG00000183196 acetylglucosamine 6-O) sulfotransferase 6 −1.8867925 CA5B carbonic anhydrase VB, 11238 NM_007220 Hs.653287 ENSG00000169239 mitochondrial 1.3200000 CRTAP cartilage associated protein 10491 NM_006371 Hs.517888 ENSG00000170275 1.6700000 CASD1 CAS1 domain containing 1 64921 NM_022900 Hs.260041 ENSG00000127995 1.3600000 CSNK2A1 casein kinase 2, alpha 1 1457 NM_001895 Hs.644056 ENSG00000101266 polypeptide −1.5873016 CFLAR CASP8 and FADD-like 8837 NM_001127183 Hs.390736 ENSG00000003402 apoptosis regulator 1.8600000 CAT catalase 847 NM_001752 Hs.502302 ENSG00000121691 1.5900000 COMT catechol-O-methyltransferase 1312 NM_000754 Hs.370408 ENSG00000093010 −1.5873016 CTNNBL1 catenin, beta like 1 56259 NM_001281495 Hs.472667 ENSG00000132792 1.3200000 CD164 CD164 molecule, sialomucin 8763 NM_001142401 Hs.520313 ENSG00000135535 −2.3809524 CD24 CD24 molecule 100133941 NM_001291737 Hs.644105 ENSG00000272398 −2.5641026 CDKN2B-AS1 CDKN2B antisense RNA 1 100048912 NR_003529 Hs.493614 ENSG00000240498 2.2400000 CDIPT CDP-diacylglycerol--inositol 10423 NM_001286585 Hs.121549 ENSG00000103502 3-phosphatidyltransferase −2.5641026 LOC101409256 cell division cycle 42 101409256 NR_102424 pseudogene −1.4492754 CCAR1 cell division cycle and 55749 NM_001282959 Hs.49853 ENSG00000060339 apoptosis regulator 1 1.8200000 CREG1 cellular repressor of E1A- 8804 NM_003851 Hs.5710 ENSG00000143162 stimulated genes 1 −1.5625000 CENPC centromere protein C 1060 NM_001812 Hs.479867 ENSG00000145241 −2.0408163 CEP41 centrosomal protein 41 kDa 95681 NM_001257158 Hs.368315 ENSG00000106477 −1.2820513 CERS5 ceramide synthase 5 91012 NM_001281731 Hs.270525 ENSG00000139624 1.5700000 CCM2 cerebral cavernous 83605 NM_001029835 Hs.148272 ENSG00000136280 malformation 2 1.8600000 CLN6 ceroid-lipofuscinosis, 54982 NM_017882 Hs.584921 ENSG00000128973 neuronal 6, late infantile, variant −1.3888889 CHMP1B charged multivesicular body 57132 NM_020412 Hs.656244 ENSG00000255112 protein 1B 1.2600000 CHMP3 charged multivesicular body 51652 NM_001005753 Hs.591582 ENSG00000115561 protein 3 −2.3255814 CCR6 chemokine (C-C motif) 1235 NM_004367 Hs.46468 ENSG00000112486 receptor 6 −2.5641026 CHRM3 cholinergic receptor, 1131 NM_000740 Hs.7138 ENSG00000133019 muscarinic 3 −1.8181818 CHRNB1 cholinergic receptor, 1140 NM_000747 Hs.330386 ENSG00000170175 nicotinic, beta 1 (muscle) −2.2727273 LOC440300 chondroitin sulfate 440300 NR_033738 Hs.546565 ENSG00000259295 proteoglycan 4 pseudogene −1.4705882 CBX5 chromobox homolog 5 23468 NM_001127321 Hs.349283 ENSG00000094916 2.6700000 C1orf122 chromosome 1 open reading 127687 NM_001142726 Hs.532749 ENSG00000197982 frame 122 −1.8867925 C1orf174 chromosome 1 open reading 339448 NM_207356 Hs.103939 ENSG00000198912 frame 174 −2.9411765 C1orf229 chromosome 1 open reading 388759 NM_207401 Hs.456511 ENSG00000221953 frame 229 −1.4492754 C1orf27 chromosome 1 open reading 54953 NM_001164245 Hs.371210 ENSG00000157181 frame 27 −1.6129032 C10orf32 chromosome 10 open reading 119032 NM_001136200 Hs.34492 ENSG00000166275 frame 32 1.5400000 C12orf49 chromosome 12 open reading 79794 NM_024738 Hs.592011 ENSG00000111412 frame 49 −1.4492754 C12orf5 chromosome 12 open reading 57103 NM_020375 Hs.504545 ENSG00000078237 frame 5 1.6400000 C14orf142 chromosome 14 open reading 84520 NM_032490 Hs.20142 ENSG00000170270 frame 142 2.3400000 C16orf54 chromosome 16 open reading 283897 NM_175900 Hs.331095 ENSG00000185905 frame 54 1.5100000 C16orf62 chromosome 16 open reading 57020 NM_001300743 Hs.654964 ENSG00000103544 frame 62 −2.0000000 C17orf75 chromosome 17 open reading 64149 NM_022344 Hs.655257 ENSG00000108666 frame 75 −2.0000000 C17orf77 chromosome 17 open reading 146723 NM_001302809 Hs.350775 ENSG00000182352 frame 77 2.5600000 C19orf24 chromosome 19 open reading 55009 NM_017914 Hs.591383 ENSG00000228300 frame 24 −2.2727273 C19orf40 chromosome 19 open reading 91442 NM_001300978 Hs.579899 ENSG00000131944 frame 40 2.2300000 C19orf70 chromosome 19 open reading 125988 NM_205767 Hs.356626 ENSG00000174917 frame 70 −2.0000000 C2orf83 chromosome 2 open reading 56918 NM_001162483 Hs.283092 ENSG00000042304 frame 83 −3.1250000 C2orf91 chromosome 2 open reading 400950 NM_001242815 Hs.738713 ENSG00000205086 frame 91 −2.7777778 C20orf203 chromosome 20 open reading 284805 NM_182584 Hs.353262 frame 203 3.1100000 C20orf27 chromosome 20 open reading 54976 NM_001039140 Hs.274422 ENSG00000101220 frame 27 −2.3809524 C21orf62 chromosome 21 open reading 56245 NM_001162495 Hs.517235 ENSG00000262938 frame 62 −2.0000000 C3orf33 chromosome 3 open reading 285315 NM_173657 Hs.350846 ENSG00000174928 frame 33 −1.8518519 C4orf19 chromosome 4 open reading 55286 NM_001104629 Hs.107527 ENSG00000154274 frame 19 −2.2727273 C4orf26 chromosome 4 open reading 152816 NM_001206981 Hs.24510 ENSG00000174792 frame 26 −1.9607843 C5orf28 chromosome 5 open reading 64417 NM_022483 Hs.732093 ENSG00000151881 frame 28 −1.9230769 C5orf66 chromosome 5 open reading 100996485 NM_001277348 ENSG00000224186 frame 66 1.9400000 C6orf1 chromosome 6 open reading 221491 NM_001008703 Hs.381300 ENSG00000186577 frame 1 1.4400000 C6orf120 chromosome 6 open reading 387263 NM_001029863 Hs.591375 ENSG00000185127 frame 120 1.9100000 C7orf26 chromosome 7 open reading 79034 NM_001303039 Hs.487511 ENSG00000146576 frame 26 2.9900000 C9orf16 chromosome 9 open reading 79095 NM_024112 Hs.522412 ENSG00000171159 frame 16 −1.6129032 C9orf3 chromosome 9 open reading 84909 NM_001193329 Hs.434253 ENSG00000148120 frame 3 2.2200000 C9orf69 chromosome 9 open reading 90120 NM_001256526 Hs.287411 ENSG00000238227 frame 69 −2.2222222 CXorf36 chromosome X open reading 79742 NM_024689 Hs.98321 ENSG00000147113 frame 36 −2.1276596 CXorf56 chromosome X open reading 63932 NM_001170569 Hs.248572 ENSG00000018610 frame 56 −1.7543860 CROCCP3 ciliary rootlet coiled-coil, 114819 NR_023386 Hs.597881 ENSG00000080947 rootletin pseudogene 3 1.6000000 CMTM3 CKLF-like MARVEL 123920 NM_001048251 Hs.298198 ENSG00000140931 transmembrane domain containing 3 −2.0000000 CKMT2-AS1 CKMT2 antisense RNA 1 100131067 NR_034121 Hs.655855 ENSG00000247572 −1.8181818 CLSPN claspin 63967 NM_001190481 Hs.175613 ENSG00000092853 −1.4705882 CLINT1 clathrin interactor 1 9685 NM_001195555 Hs.644000 ENSG00000113282 1.7300000 CLDN15 claudin 15 24146 NM_001185080 Hs.38738 ENSG00000106404 −1.7543860 CLDN19 claudin 19 149461 NM_001123395 Hs.496270 ENSG00000164007 1.5300000 COPZ1 coatomer protein complex, 22818 NM_001271734 Hs.505652 ENSG00000111481 subunit zeta 1 1.4800000 CCDC115 coiled-coil domain containing 115 84317 NM_032357 Hs.104203 ENSG00000136710 −1.9230769 CCDC12 coiled-coil domain containing 12 151903 NM_001277074 Hs.631918 ENSG00000160799 −2.0408163 CCDC144B coiled-coil domain containing 144B 284047 NR_036647 Hs.448012 ENSG00000154874 (pseudogene) −2.0833333 CCDC148 coiled-coil domain containing 148 130940 NM_001171637 Hs.668597 ENSG00000153237 −2.0000000 CCBE1 collagen and calcium binding 147372 NM_133459 Hs.34333 ENSG00000183287 EGF domains 1 −1.7543860 COMMD2 COMM domain containing 2 51122 NM_016094 Hs.432729 ENSG00000114744 1.7000000 COMMD5 COMM domain containing 5 28991 NM_001081003 Hs.631856 ENSG00000170619 1.6700000 C1QBP complement component 1, q 708 NM_001212 Hs.555866 ENSG00000108561 subcomponent binding protein −2.7027027 CRX cone-rod homeobox 1406 NM_000554 Hs.617342 ENSG00000105392 1.7300000 CPNE1 copine I 8904 NM_001198863 Hs.246413 ENSG00000214078 2.1400000 CORO1A coronin, actin binding 11151 NM_001193333 Hs.415067 ENSG00000102879 protein, 1A −2.0000000 CXADR coxsackie virus and 1525 NM_001207063 Hs.627078 ENSG00000154639 adenovirus receptor −2.1739130 CRYM-AS1 CRYM antisense RNA 1 400508 NM_001101368 Hs.578949 −2.4390244 CRYBB2P1 crystallin, beta B2 1416 NR_033733 Hs.571835 ENSG00000100058 pseudogene 1 1.6400000 CHTF8 CTF8, chromosome 54921 NM_001002847 Hs.85962 ENSG00000168802 transmission fidelity factor 8 homolog (S. cerevisiae) −1.7857143 CLEC2D C-type lectin domain family 29121 NM_001004419 Hs.268326 ENSG00000069493 2, member D 1.7000000 CLEC4A C-type lectin domain family 50856 NM_016184 Hs.504657 ENSG00000111729 4, member A −1.8518519 CWC25 CWC25 spliceosome- 54883 NM_017748 Hs.406223 ENSG00000273559 associated protein homolog (S. cerevisiae) −1.3698630 DMTF1 cyclin D binding myb-like 9988 NM_001142326 Hs.196129 ENSG00000135164 transcription factor 1 −1.2987013 CCNT2 cyclin T2 905 NM_001241 Hs.744115 ENSG00000082258 −2.2727273 LOC727896 cysteine and histidine-rich 727896 NR_026659 Hs.673126 domain (CHORD) containing 1 pseudogene −1.9607843 CSAD cysteine sulfinic acid 51380 NM_001244705 Hs.279815 ENSG00000139631 decarboxylase 2.5200000 CDA cytidine deaminase 978 NM_001785 Hs.466910 ENSG00000158825 1.8900000 CYB561D2 cytochrome b561 family, 11068 NM_001291284 Hs.149443 ENSG00000114395 member D2 −2.0000000 COA7 cytochrome c oxidase 65260 NM_023077 Hs.349905 ENSG00000162377 assembly factor 7 (putative) −2.9411765 COX6B2 cytochrome c oxidase subunit 125965 NM_144613 Hs.550544 ENSG00000160471 VIb polypeptide 2 (testis) 2.3100000 COX8A cytochrome c oxidase subunit 1351 NM_004074 Hs.743989 ENSG00000176340 VIIIA (ubiquitous) −1.4925373 CYCS cytochrome c, somatic 54205 NM_018947 Hs.437060 ENSG00000172115 1.6800000 CYC1 cytochrome c-1 1537 NM_001916 Hs.289271 ENSG00000179091 −1.6393443 CYP20A1 cytochrome P450, family 20, 57404 NM_020674 Hs.446065 ENSG00000119004 subfamily A, polypeptide 1 −1.8867925 CYP4V2 cytochrome P450, family 4, 285440 NM_207352 Hs.587231 ENSG00000145476 subfamily V, polypeptide 2 −1.8181818 CYP51A1 cytochrome P450, family 51, 1595 NM_000786 Hs.417077 ENSG00000001630 subfamily A, polypeptide 1 −1.6129032 CYTIP cytohesin 1 interacting protein 9595 NM_004288 Hs.270 ENSG00000115165 −2.5000000 CRLF2 cytokine receptor-like factor 2 64109 NM_001012288 Hs.287729 ENSG00000205755 −1.7857143 CRTAM cytotoxic and regulatory T 56253 NM_001304782 Hs.159523 ENSG00000109943 cell molecule 2.1800000 DBP D site of albumin promoter 1628 NM_001352 Hs.414480 ENSG00000105516 (albumin D-box) binding protein 1.5100000 DDB1 damage-specific DNA 1642 NM_001923 Hs.290758 ENSG00000167986 binding protein 1, 127 kDa −1.6393443 DZIP3 DAZ interacting zinc finger 9666 NM_014648 Hs.409210 ENSG00000198919 protein 3 −2.3255814 DCUN1D2 DCN1, defective in cullin 55208 NM_001014283 Hs.682987 ENSG00000150401 neddylation 1, domain containing 2 −1.4084507 DCAF16 DDB1 and CUL4 associated 54876 NM_017741 Hs.614787 ENSG00000163257 factor 16 1.9500000 DDT D-dopachrome tautomerase 1652 NM_001084392 Hs.656723 ENSG00000099977 −1.8518519 DDX51 DEAD (Asp-Glu-Ala-Asp) 317781 NM_175066 Hs.445168 ENSG00000185163 box polypeptide 51 1.5500000 DEDD death effector domain 9191 NM_001039711 Hs.744092 ENSG00000158796 containing −1.6666667 DLEU1 deleted in lymphocytic 10301 NM_005887 Hs.591229 ENSG00000176124 leukemia 1 (non-protein coding) −2.2222222 DLK2 delta-like 2 homolog 65989 NM_001286655 Hs.337251 ENSG00000171462 (Drosophila) −1.4492754 DENND6A DENN/MADD domain 201627 NM_152678 Hs.91085 ENSG00000174839 containing 6A −2.2222222 DSG2 desmoglein 2 1829 NM_001943 Hs.412597 ENSG00000046604 −2.3255814 DSG3 desmoglein 3 1830 NM_001944 Hs.1925 ENSG00000134757 −1.2987013 DIABLO diablo, IAP-binding 56616 NM_001278302 Hs.169611 ENSG00000184047 mitochondrial protein 1.6600000 DBI diazepam binding inhibitor 1622 NM_001079862 Hs.78888 ENSG00000155368 (GABA receptor modulator, acyl-CoA binding protein) −2.0000000 DPH3P1 diphthamide biosynthesis 3 100132911 NM_080750 pseudogene 1 1.6700000 DPH7 diphthamide biosynthesis 7 92715 NM_138778 Hs.292570 ENSG00000148399 −1.4492754 DIS3 DIS3 exosome 22894 NM_001128226 Hs.744104 ENSG00000083520 endoribonuclease and 3′-5′ exoribonuclease −3.3333333 DLGAP1-AS2 DLGAP1 antisense RNA 2 84777 NM_032691 Hs.659053 −1.6666667 DFFA DNA fragmentation factor, 1676 NM_004401 Hs.484782 ENSG00000160049 45 kDa, alpha polypeptide −2.2727273 DMC1 DNA meiotic recombinase 1 11144 NM_001278208 Hs.339396 ENSG00000100206 −1.8518519 DNAH17-AS1 DNAH17 antisense RNA 1 100996295 NR_102401 Hs.615304 ENSG00000267432 −1.4285714 DNAJC21 DnaJ (Hsp40) homolog, 134218 NM_001012339 Hs.131887 ENSG00000168724 subfamily C, member 21 −2.5000000 DNAJC22 DnaJ (Hsp40) homolog, 79962 NM_001304944 Hs.659300 ENSG00000178401 subfamily C, member 22 1.9400000 DNAJC4 DnaJ (Hsp40) homolog, 3338 NM_005528 Hs.172847 ENSG00000110011 subfamily C, member 4 −2.0408163 DNAJC9-AS1 DNAJC9 antisense RNA 1 414245 NR_038373 Hs.661857 ENSG00000236756 2.3400000 DNLZ DNL-type zinc finger 728489 NM_001080849 Hs.528581 ENSG00000213221 −1.8518519 DNM1P46 DNM1 pseudogene 46 196968 NM_194295 Hs.567763 ENSG00000182397 −2.2222222 DUXA double homeobox A 503835 NM_001012729 Hs.585857 ENSG00000258873 −2.5641026 DYDC1 DPY30 domain containing 1 143241 NM_001269053 Hs.407751 ENSG00000170788 −1.6129032 DSTYK dual serine/threonine and 25778 NM_015375 Hs.6874 ENSG00000133059 tyrosine protein kinase 2.1000000 DUSP23 dual specificity phosphatase 23 54935 NM_017823 Hs.425801 ENSG00000158716 1.7200000 DUSP7 dual specificity phosphatase 7 1849 NM_001947 Hs.591664 ENSG00000164086 2.2900000 DYRK1B dual-specificity tyrosine-(Y)- 9149 NM_004714 Hs.130988 ENSG00000105204 phosphorylation regulated kinase 1B 1.6400000 DCTN2 dynactin 2 (p50) 10540 NM_001261412 Hs.289123 ENSG00000175203 −2.5641026 DYNAP dynactin associated protein 284254 NM_173629 Hs.376146 ENSG00000178690 1.5100000 DNAAF2 dynein, axonemal, assembly 55172 NM_001083908 Hs.231761 ENSG00000165506 factor 2 −1.9230769 DNAL1 dynein, axonemal, light chain 1 83544 NM_001201366 Hs.271270 ENSG00000119661 −1.9607843 DYX1C1 dyslexia susceptibility 1 161582 NM_001033559 Hs.126403 ENSG00000256061 candidate 1 −1.6393443 ENTPD4 ectonucleoside triphosphate 9583 NM_001128930 Hs.444389 ENSG00000197217 diphosphohydrolase 4 −1.9607843 EFCAB11 EF-hand calcium binding 90141 NM_001284266 Hs.123232 ENSG00000140025 domain 11 −2.0833333 EGFEM1P EGF-like and EMI domain 93556 NR_021485 Hs.478158 ENSG00000206120 containing 1, pseudogene −1.6666667 ERC1 ELKS/RAB6-interacting/ 23085 NM_001301248 Hs.601216 ENSG00000082805 CAST family member 1 −2.1276596 ELMOD1 ELMO/CED-12 domain 55531 NM_001130037 Hs.495779 ENSG00000110675 containing 1 −3.2258065 ESRG embryonic stem cell related 790952 NR_027122 Hs.720658 ENSG00000265992 (non-protein coding) −1.7543860 EBP emopamil binding protein 10682 NM_006579 Hs.30619 ENSG00000147155 (sterol isomerase) −2.2222222 EMX2OS EMX2 opposite 196047 NR_002791 Hs.312592 ENSG00000229847 strand/antisense RNA −1.7543860 ERVK13-1 endogenous retrovirus group 100507321 NM_001012731 Hs.406976 ENSG00000260565 K13, member 1 −2.3809524 ERVV-1 endogenous retrovirus group 147664 NM_152473 Hs.44329 ENSG00000269526 V, member 1 1.5000000 ERH enhancer of rudimentary 2079 NM_004450 Hs.509791 ENSG00000100632 homolog (Drosophila) 1.5800000 ECH1 enoyl CoA hydratase 1, 1891 NM_001398 Hs.196176 ENSG00000104823 peroxisomal −2.1276596 ENTPD1-AS1 ENTPD1 antisense RNA 1 728558 NR_038444 Hs.538374 ENSG00000226688 −2.5641026 EPHA10 EPH receptor A10 284656 NM_001004338 Hs.129435 ENSG00000183317 −2.6315789 EPPIN epididymal peptidase inhibitor 57119 NM_001302861 Hs.121084 ENSG00000101448 −1.8867925 ECT2 epithelial cell transforming 2 1894 NM_001258315 Hs.518299 ENSG00000114346 −2.0000000 EMP2 epithelial membrane protein 2 2013 NM_001424 Hs.531561 ENSG00000213853 1.3500000 EMC10 ER membrane protein 284361 NM_175063 Hs.448941 ENSG00000161671 complex subunit 10 4.5600000 EMC6 ER membrane protein 83460 NM_001014764 Hs.30011 ENSG00000127774 complex subunit 6 1.6200000 EMC8 ER membrane protein 10328 NM_001142288 Hs.173162 ENSG00000131148 complex subunit 8 1.9700000 ERI3 ERI1 exoribonuclease family 79033 NM_001301698 Hs.731413 ENSG00000117419 member 3 2.3100000 ETHE1 ethylmalonic encephalopathy 1 23474 NM_014297 Hs.7486 ENSG00000105755 −1.3698630 EEF1D eukaryotic translation 1936 NM_001130053 Hs.333388 ENSG00000104529 elongation factor 1 delta (guanine nucleotide exchange protein) 2.2300000 EIF4EBP3 eukaryotic translation 8637 NM_003732 Hs.594084 ENSG00000243056 initiation factor 4E binding protein 3 −1.5873016 EIF5 eukaryotic translation 1983 NM_001969 Hs.433702 ENSG00000100664 initiation factor 5 −1.3888889 EWSR1 EWS RNA-binding protein 1 2130 NM_001163285 Hs.374477 ENSG00000182944 −2.0408163 EXPH5 exophilin 5 23086 NM_001144763 Hs.28540 ENSG00000110723 1.3800000 ESYT1 extended synaptotagmin-like 23344 NM_001184796 Hs.632729 ENSG00000139641 protein 1 −1.9230769 FAM83H-AS1 FAM83H antisense RNA 1 100128338 NR_033849 Hs.493171 ENSG00000203499 (head to head) −1.8518519 FAM114A1 family with sequence 92689 NM_138389 Hs.476517 ENSG00000197712 similarity 114, member A1 −2.1739130 FAM122C family with sequence 159091 NM_001170779 Hs.269127 ENSG00000156500 similarity 122C −2.8571429 FAM133DP family with sequence 728066 NR_034169 Hs.470311 similarity 133, member A pseudogene −1.4084507 FAM177A1 family with sequence 283635 NM_001079519 Hs.446357 ENSG00000151327 similarity 177, member A1 −1.9230769 FAM71F2 family with sequence 346653 NM_001012454 Hs.445236 ENSG00000205085 similarity 71, member F2 1.7700000 FAM89B family with sequence 23625 NM_001098784 Hs.731854 ENSG00000176973 similarity 89, member B 1.6400000 FAM96A family with sequence 84191 NM_001014812 Hs.439548 ENSG00000166797 similarity 96, member A −2.2727273 FDPSP2 farnesyl diphosphate synthase 619190 NR_003262 Hs.609978 ENSG00000233980 pseudogene 2 1.5000000 FNTA farnesyltransferase, CAAX 2339 NM_001018676 Hs.370312 ENSG00000168522 box, alpha −2.3809524 FAIM Fas apoptotic inhibitory 55179 NM_001033030 Hs.173438 ENSG00000158234 molecule −1.8867925 FEZ1 fasciculation and elongation 9638 NM_005103 Hs.224008 ENSG00000149557 protein zeta 1 (zygin I) 1.9500000 FBXL14 F-box and leucine-rich repeat 144699 NM_152441 Hs.367956 ENSG00000171823 protein 14 −1.8181818 FBXL18 F-box and leucine-rich repeat 80028 NM_024963 Hs.623974 ENSG00000155034 protein 18 −1.4492754 FBXL20 F-box and leucine-rich repeat 84961 NM_001184906 Hs.462946 ENSG00000108306 protein 20 1.7200000 FBXW5 F-box and WD repeat domain 54461 NM_018998 Hs.522507 ENSG00000159069 containing 5 −2.0408163 FBXO17 F-box protein 17 115290 NM_024907 Hs.531770 ENSG00000269190 −2.2222222 FBXO27 F-box protein 27 126433 NM_178820 Hs.187461 ENSG00000161243 −1.6129032 FBXO44 F-box protein 44 93611 NM_001014765 Hs.556006 ENSG00000132879 1.3800000 FEM1A fem-1 homolog a (C. elegans) 55527 NM_018708 Hs.515082 ENSG00000141965 1.6800000 FDX1L ferredoxin 1-like 112812 NM_001031734 Hs.654865 ENSG00000267673 −2.2727273 FRRS1 ferric-chelate reductase 1 391059 NM_001013660 Hs.454779 ENSG00000156869 −1.8181818 FGFR1OP FGFR1 oncogene partner 11116 NM_001278690 Hs.487175 ENSG00000213066 −2.5641026 LOC100335030 FGFR1 oncogene partner 2 100335030 NR_033267 Hs.687044 ENSG00000257954 pseudogene −2.5000000 FGF5 fibroblast growth factor 5 2250 NM_001291812 Hs.37055 ENSG00000138675 −1.9607843 FGFR2 fibroblast growth factor 2263 NM_000141 Hs.533683 ENSG00000066468 receptor 2 −2.1739130 FBLN1 fibulin 1 2192 NM_001996 Hs.24601 ENSG00000077942 −3.4482759 FILIP1 filamin A interacting protein 1 27145 NM_001289987 Hs.696158 ENSG00000118407 −2.5641026 FBLIM1 filamin binding LIM protein 1 54751 NM_001024215 Hs.530101 ENSG00000162458 1.8300000 FIS1 fission 1 (mitochondrial outer 51024 NM_016068 Hs.423968 ENSG00000214253 membrane) homolog (S. cerevisiae) −2.2222222 FKBP14 FK506 binding protein 14, 22 kDa 55033 NM_017946 Hs.390838 ENSG00000106080 −1.7241379 FOXJ3 forkhead box J3 22887 NM_001198850 Hs.26023 ENSG00000198815 −1.5151515 FNBP4 formin binding protein 4 23360 NM_015308 Hs.6834 ENSG00000109920 1.4400000 FMNL3 formin-like 3 91010 NM_175736 Hs.179838 ENSG00000161791 −2.0000000 FOXL2NB FOXL2 neighbor 401089 NM_001040061 Hs.591303 ENSG00000206262 −2.1276596 FRY-AS1 FRY antisense RNA 1 100507099 NR_103839 Hs.536364 ENSG00000237637 −4.0000000 LOC642236 FSHD region gene 1 642236 NR_033907 Hs.529357 pseudogene −1.9230769 FUT1 fucosyltransferase 1 2523 NM_000148 Hs.69747 ENSG00000174951 (galactoside 2-alpha-L- fucosyltransferase, H blood group) −2.4390244 FUT2 fucosyltransferase 2 (secretor 2524 NM_000511 Hs.579928 ENSG00000176920 status included) −2.0833333 FUT6 fucosyltransferase 6 (alpha 2528 NM_000150 Hs.631846 ENSG00000156413 (1,3) fucosyltransferase) −2.0408163 FGD5P1 FYVE, RhoGEF and PH domain 100132526 NR_036481 Hs.637770 ENSG00000275340 containing 5 pseudogene 1 1.5600000 GPR108 G protein-coupled receptor 108 56927 NM_001080452 Hs.167641 ENSG00000125734 2.3400000 GPR141 G protein-coupled receptor 141 353345 NM_181791 Hs.688230 ENSG00000187037 −1.5384615 GPR18 G protein-coupled receptor 18 2841 NM_001098200 Hs.741589 ENSG00000125245 −2.3255814 GPR37L1 G protein-coupled receptor 37 9283 NM_004767 Hs.132049 ENSG00000170075 like 1 −2.1276596 GPR82 G protein-coupled receptor 82 27197 NM_080817 Hs.567457 ENSG00000171657 −1.8181818 GABPB1-AS1 GABPB1 antisense RNA 1 100129387 NR_024490 Hs.659360 2.4600000 GALK1 galactokinase 1 2584 NM_000154 Hs.407966 ENSG00000108479 −1.9607843 GAL3ST4 galactose-3-O- 79690 NM_024637 Hs.44856 ENSG00000197093 sulfotransferase 4 −2.5641026 GGT8P gamma-glutamyltransferase 8 645367 NR_003503 Hs.650223 pseudogene −2.5000000 GAS6-AS2 GAS6 antisense RNA 2 100506394 NR_044993 Hs.132168 ENSG00000272695 (head to head) −2.0833333 GSDMA gasdermin A 284110 NM_178171 Hs.448873 ENSG00000167914 1.7800000 GMPPA GDP-mannose 29926 NM_013335 Hs.27059 ENSG00000144591 pyrophosphorylase A 1.9300000 GSN gelsolin 2934 NM_000177 Hs.522373 ENSG00000148180 −2.3809524 GEMIN8 gem (nuclear organelle) 54960 NM_001042479 Hs.592237 ENSG00000046647 associated protein 8 1.7100000 GTF2H4 general transcription factor 2968 NM_001517 Hs.485070 ENSG00000213780 IIH, polypeptide 4, 52 kDa 1.5500000 GTF3C2 general transcription factor 2976 NM_001035521 Hs.75782 ENSG00000115207 IIIC, polypeptide 2, beta 110 kDa −2.7027027 GSG1 germ cell associated 1 83445 NM_001080554 Hs.240053 ENSG00000111305 1.9500000 GHDC GH3 domain containing 84514 NM_001142622 Hs.38039 ENSG00000167925 −3.2258065 GLIPR1L2 GLI pathogenesis-related 1 144321 NM_001270396 Hs.406728 ENSG00000180481 like 2 −1.5384615 GMEB1 glucocorticoid modulatory 10691 NM_006582 Hs.632373 ENSG00000162419 element binding protein 1 −2.2727273 GNE glucosamine (UDP-N-acetyl)- 10020 NM_001128227 Hs.5920 ENSG00000159921 2-epimerase/N- acetylmannosamine kinase 1.4600000 GLUD1 glutamate dehydrogenase 1 2746 NM_005271 Hs.500409 ENSG00000148672 1.6100000 QPCT glutaminyl-peptide 25797 NM_012413 Hs.79033 ENSG00000115828 cyclotransferase 2.1100000 GPX4 glutathione peroxidase 4 2879 NM_001039847 Hs.433951 ENSG00000167468 −2.4390244 GSTM3 glutathione S-transferase mu 2947 NM_000849 Hs.2006 ENSG00000134202 3 (brain) 1.9800000 GSTP1 glutathione S-transferase pi 1 2950 NM_000852 Hs.523836 ENSG00000084207 −1.7857143 GK5 glycerol kinase 5 (putative) 256356 NM_001039547 Hs.135904 ENSG00000175066 −2.2727273 GDPD1 glycerophosphodiester 284161 NM_001165993 Hs.631744 ENSG00000153982 phosphodiesterase domain containing 1 1.4800000 GYS1 glycogen synthase 1 (muscle) 2997 NM_001161587 Hs.386225 ENSG00000104812 −1.9230769 GPLD1 glycosylphosphatidylinositol 2822 NM_001503 Hs.533291 ENSG00000112293 specific phospholipase D1 −2.2727273 GOSR1 golgi SNAP receptor complex 9527 NM_001007024 Hs.462680 ENSG00000108587 member 1 −1.5384615 GOLGA2 golgin A2 2801 NM_004486 Hs.155827 ENSG00000167110 −2.8571429 GOLGA6L22 golgin A6 family-like 22 440243 NM_001271664 ENSG00000274404 1.5600000 GOLGA7 golgin A7 51125 NM_001002296 Hs.654773 ENSG00000147533 −3.0303030 GNRHR2 gonadotropin-releasing 114814 NM_057163 Hs.356873 ENSG00000211451 hormone (type 2) receptor 2, pseudogene −2.3809524 GPR1-AS GPR1 antisense RNA 101669764 NR_104359 Hs.574781 ENSG00000279220 −1.6129032 GAB2 GRB2-associated binding 9846 NM_012296 Hs.429434 ENSG00000033327 protein 2 −2.5641026 GRTP1 growth hormone regulated 79774 NM_001286732 Hs.745043 ENSG00000139835 TBC protein 1 −2.1276596 GREB1 growth regulation by estrogen 9687 NM_014668 Hs.467733 ENSG00000196208 in breast cancer 1 1.5400000 GTPBP6 GTP binding protein 6 (putative) 8225 NM_012227 Hs.437145 ENSG00000178605 −1.7543860 GTPBP10 GTP-binding protein 10 (putative) 85865 NM_001042717 Hs.593547 ENSG00000105793 1.7700000 GNB2 guanine nucleotide binding 2783 NM_005273 Hs.185172 ENSG00000172354 protein (G protein), beta polypeptide 2 −1.8867925 GNG4 guanine nucleotide binding 2786 NM_001098721 Hs.159711 ENSG00000168243 protein (G protein), gamma 4 −1.8181818 GNL1 guanine nucleotide binding 2794 NM_005275 Hs.83147 ENSG00000204590 protein-like 1 −1.9230769 H1FX-AS1 H1FX antisense RNA 1 339942 NM_001025468 Hs.450096 1.7800000 H2AFJ H2A histone family, member J 55766 NM_018267 Hs.524280 ENSG00000246705 2.0200000 H2AFX H2A histone family, member X 3014 NM_002105 Hs.477879 ENSG00000188486 1.3500000 HDHD3 haloacid dehalogenase-like 81932 NM_001304509 Hs.7739 ENSG00000119431 hydrolase domain containing 3 −1.8518519 HAUS3 HAUS augmin-like complex, 79441 NM_001303143 Hs.665869 ENSG00000214367 subunit 3 1.6700000 HS1BP3 HCLS1 binding protein 3 64342 NM_022460 Hs.531785 ENSG00000118960 −2.5641026 HSP90AB4P heat shock protein 90 kDa 664618 NR_002927 Hs.670224 alpha (cytosolic), class B member 4, pseudogene 1.6900000 HCST hematopoietic cell signal 10870 NM_001007469 Hs.117339 ENSG00000126264 transducer −1.7543860 HHLA2 HERV-H LTR-associating 2 11148 NM_001282556 Hs.252351 ENSG00000114455 −2.2222222 HHLA3 HERV-H LTR-associating 3 11147 NM_001031693 Hs.142245 ENSG00000197568 −2.3809524 HES2 hes family bHLH 54626 NM_019089 Hs.118727 ENSG00000069812 transcription factor 2 −1.8181818 HNRNPA1L2 heterogeneous nuclear 144983 NM_001011724 Hs.447506 ENSG00000139675 ribonucleoprotein A1-like 2 1.3800000 H6PD hexose-6-phosphate 9563 NM_001282587 Hs.463511 ENSG00000049239 dehydrogenase (glucose 1- dehydrogenase) −2.4390244 HMGB3P1 high mobility group box 3 128872 NR_002165 Hs.558624 pseudogene 1 1.9100000 HIST1H2AC histone cluster 1, H2ac 8334 NM_003512 Hs.484950 ENSG00000180573 2.5100000 HIST1H3H histone cluster 1, H3h 8357 NM_003536 Hs.591778 ENSG00000278828 −2.0833333 HCG26 HLA complex group 26 (non- 352961 NR_002812 Hs.132807 protein coding) −2.1739130 HNF1A-AS1 HNF1A antisense RNA 1 283460 NM_178513 Hs.612351 ENSG00000241388 1.7400000 HCFC1R1 host cell factor C1 regulator 1 54985 NM_001002017 Hs.423103 ENSG00000103145 (XPO1 dependent) −2.4390244 HTRA4 HtrA serine peptidase 4 203100 NM_153692 Hs.661014 ENSG00000169495 −2.0000000 HSD17B13 hydroxysteroid (17-beta) 345275 NM_001136230 Hs.284414 ENSG00000170509 dehydrogenase 13 −2.0833333 HILPDA hypoxia inducible lipid 29923 NM_001098786 Hs.706124 ENSG00000135245 droplet-associated −1.8181818 IBA57 IBA57, iron-sulfur cluster 200205 NM_001010867 Hs.237017 ENSG00000181873 assembly homolog (S. cerevisiae) −2.2727273 IKZF3 IKAROS family zinc finger 3 22806 NM_001257408 Hs.371680 ENSG00000161405 (Aiolos) −1.5151515 ILF3-AS1 ILF3 antisense RNA 1 147727 NR_024333 Hs.631616 ENSG00000267100 (head to head) −1.9230769 IRGQ immunity-related GTPase 126298 NM_001007561 Hs.6217 ENSG00000167378 family, Q −1.9230769 IPO5P1 importin 5 pseudogene 1 100132815 NR_103741 Hs.629249 ENSG00000269837 −2.3255814 INE1 inactivation escape 1 (non- 8552 NM_003669 Hs.657350 ENSG00000224975 protein coding) −2.4390244 IDO1 indoleamine 2,3-dioxygenase 1 3620 NM_002164 Hs.840 ENSG00000131203 −2.2727273 INMT indolethylamine N- 11185 NM_001199219 Hs.632629 ENSG00000241644 methyltransferase −1.9607843 INHBA-AS1 INHBA antisense RNA 1 285954 NR_027118 Hs.656869 ENSG00000224116 −1.5384615 ING5 inhibitor of growth family, 84289 NM_032329 Hs.529172 ENSG00000168395 member 5 −2.5641026 INGX inhibitor of growth family, X- 27160 NR_002226 Hs.721806 ENSG00000243468 linked, pseudogene 1.3800000 INPP5E inositol polyphosphate-5- 56623 NM_019892 Hs.120998 ENSG00000148384 phosphatase, 72 kDa 1.6500000 INTS9 integrator complex subunit 9 55756 NM_001145159 Hs.162397 ENSG00000104299 −1.8867925 ITIH5 inter-alpha-trypsin inhibitor 80760 NM_001001851 Hs.498586 ENSG00000123243 heavy chain family, member 5 1.7000000 IRF2BP1 interferon regulatory factor 2 26145 NM_015649 Hs.515477 ENSG00000170604 binding protein 1 −2.3809524 IFNLR1 interferon, lambda receptor 1 163702 NM_170743 Hs.221375 ENSG00000185436 −2.0000000 IL17RD interleukin 17 receptor D 54756 NM_017563 Hs.150725 ENSG00000144730 −1.5625000 ITSN2 intersectin 2 50618 NM_006277 Hs.432562 ENSG00000198399 −1.9607843 IFT22 intraflagellar transport 22 64792 NM_001130820 Hs.389104 ENSG00000128581 −2.2222222 IAPP islet amyloid polypeptide 3375 NM_000415 Hs.46835 ENSG00000121351 −2.0000000 ICA1L islet cell autoantigen 1, 130026 NM_001288622 Hs.516629 ENSG00000163596 69 kDa-like 2.3900000 JOSD2 Josephin domain containing 2 126119 NM_001270639 Hs.467151 ENSG00000161677 −2.2222222 JPX JPX transcript, XIST 554203 NR_024582 Hs.648316 ENSG00000225470 activator (non-protein coding) 1.6100000 JTB jumping translocation breakpoint 10899 NM_006694 Hs.6396 ENSG00000143543 −2.6315789 KCNQ1OT1 KCNQ1 opposite 10984 NR_002728 Hs.604823 ENSG00000269821 strand/antisense transcript 1 (non-protein coding) −2.2727273 KDELC2 KDEL (Lys-Asp-Glu-Leu) 143888 NM_153705 Hs.83286 ENSG00000178202 containing 2 1.9100000 KDELR1 KDEL (Lys-Asp-Glu-Leu) 10945 NM_006801 Hs.515515 ENSG00000105438 endoplasmic reticulum protein retention receptor 1 2.0800000 KDELR2 KDEL (Lys-Asp-Glu-Leu) 11014 NM_001100603 Hs.654552 ENSG00000136240 endoplasmic reticulum protein retention receptor 2 −2.5000000 KDM4A-AS1 KDM4A antisense RNA 1 100132774 NR_033827 Hs.655569 1.7100000 KLHDC3 kelch domain containing 3 116138 NM_001242872 Hs.412468 ENSG00000124702 −2.2222222 KBTBD12 kelch repeat and BTB (POZ) 166348 NM_207335 Hs.132087 ENSG00000187715 domain containing 12 −1.8181818 KRT8 keratin 8, type II 3856 NM_001256282 Hs.533782 ENSG00000170421 −3.4482759 KIAA0101 KIAA0101 9768 NM_001029989 Hs.81892 ENSG00000166803 −2.8571429 KIAA1161 KIAA1161 57462 NM_020702 Hs.522083 ENSG00000164976 −2.2222222 KIAA1456 KIAA1456 57604 NM_001099677 Hs.202521 ENSG00000250305 −2.1739130 KIAA1614 KIAA1614 57710 NM_020950 Hs.734816 ENSG00000135835 −2.0000000 KIAA1919 KIAA1919 91749 NM_153369 Hs.400572 ENSG00000173214 −2.3255814 KIR3DX1 killer cell immunoglobulin- 90011 NM_001047605 Hs.288520 ENSG00000104970 like receptor, three domains, X1 −3.2258065 KLRD1 killer cell lectin-like receptor 3824 NM_001114396 Hs.562457 ENSG00000134539 subfamily D, member 1 −1.5625000 KIN Kin17 DNA and RNA 22944 NM_012311 Hs.397918 ENSG00000151657 binding protein −2.2727273 KIF18B kinesin family member 18B 146909 NM_001080443 Hs.135094 ENSG00000186185 −1.3157895 KIF1B kinesin family member 1B 23095 NM_015074 Hs.97858 ENSG00000054523 −2.2222222 KIF3A kinesin family member 3A 11127 NM_001300791 Hs.43670 ENSG00000131437 −2.8571429 L2HGDH L-2-hydroxyglutarate 79944 NM_024884 Hs.256034 ENSG00000087299 dehydrogenase −2.0408163 LARS2-AS1 LARS2 antisense RNA 1 100885795 NR_048543 Hs.641094 ENSG00000232455 −2.2727273 LGMN legumain 5641 NM_001008530 Hs.18069 ENSG00000100600 −2.0000000 LRRC2 leucine rich repeat containing 2 79442 NM_024512 Hs.657345 ENSG00000163827 −1.9607843 LRRC27 leucine rich repeat containing 27 80313 NM_001143757 Hs.119897 ENSG00000148814 −1.3698630 LRRC37BP1 leucine rich repeat containing 37B 147172 NM_207323 Hs.568209 pseudogene 1 −2.1739130 LRTOMT leucine rich transmembrane 220074 NM_001145307 Hs.317243 ENSG00000184154 and O-methyltransferase domain containing 1.5400000 LILRA2 leukocyte immunoglobulin- 11027 NM_001130917 Hs.655593 ENSG00000239998 like receptor, subfamily A (with TM domain), member 2 −2.9411765 LIFR-AS1 LIFR antisense RNA 1 100506495 NR_103553 Hs.657602 ENSG00000244968 2.1200000 LIMD2 LIM domain containing 2 80774 NM_030576 Hs.591166 ENSG00000136490 −2.0408163 LMX1B LIM homeobox transcription 4010 NM_001174146 Hs.129133 ENSG00000136944 factor 1, beta −2.3255814 L1TD1 LINE-1 type transposase 54596 NM_001164835 Hs.685462 ENSG00000240563 domain containing 1 −1.9230769 LINC01010 long intergenic non-protein 154092 NR_038216 Hs.223718 ENSG00000236700 coding RNA 1010 −2.1739130 LINC01012 long intergenic non-protein 100507173 NR_038292 Hs.635987 coding RNA 1012 −2.0833333 LINC01016 long intergenic non-protein 100507584 NR_038989 Hs.547104 ENSG00000249346 coding RNA 1016 −2.7027027 LINC01057 long intergenic non-protein 101928079 NR_104131 Hs.596857 ENSG00000224081 coding RNA 1057 −2.2727273 LINC01087 long intergenic non-protein 101927994 NR_108087 Hs.635757 ENSG00000224559 coding RNA 1087 −2.3255814 LINC01205 long intergenic non-protein 401082 NM_001145553 Hs.477089 ENSG00000228980 coding RNA 1205 −2.2222222 LINC01207 long intergenic non-protein 100505989 NR_038834 Hs.328236 ENSG00000248771 coding RNA 1207 −2.3255814 LINC01209 long intergenic non-protein 101928684 NR_110819 Hs.639352 ENSG00000228308 coding RNA 1209 −2.2222222 LINC01226 long intergenic non-protein 284551 NR_027085 Hs.658659 ENSG00000223907 coding RNA 1226 −2.1739130 LINC01239 long intergenic non-protein 441389 NR_038977 ENSG00000234840 coding RNA 1239 −2.1276596 LINC01247 long intergenic non-protein 101929390 NR_110251 Hs.434407 ENSG00000227007 coding RNA 1247 −1.8867925 LINC01252 long intergenic non-protein 338817 NR_033890 Hs.733066 ENSG00000247157 coding RNA 1252 −1.9607843 LINC01299 long intergenic non-protein 286186 NR_033893 Hs.449427 ENSG00000254081 coding RNA 1299 −2.3809524 LINC01356 long intergenic non-protein 100996702 NR_103746 Hs.632431 ENSG00000215866 coding RNA 1356 −2.1739130 LINC00294 long intergenic non-protein 283267 NR_015451 Hs.533701 coding RNA 294 −1.8181818 LINC00330 long intergenic non-protein 144817 NR_038433 Hs.585616 ENSG00000235097 coding RNA 330 −1.8518519 LINC00342 long intergenic non-protein 150759 NR_103734 Hs.503463 coding RNA 342 −2.3255814 LINC00346 long intergenic non-protein 283487 NM_178514 Hs.245390 ENSG00000255874 coding RNA 346 −2.7027027 LINC00381 long intergenic non-protein 100874151 NR_047005 Hs.564552 ENSG00000226240 coding RNA 381 −2.1739130 LINC00410 long intergenic non-protein 144776 NR_027039 Hs.434120 ENSG00000231674 coding RNA 410 −3.0303030 LINC00458 long intergenic non-protein 100507428 NR_108062 Hs.351262 ENSG00000234787 coding RNA 458 −2.0000000 LINC00470 long intergenic non-protein 56651 NM_031416 Hs.541165 coding RNA 470 −2.5641026 LINC00485 long intergenic non-protein 283432 NR_033855 Hs.382110 ENSG00000258169 coding RNA 485 −3.5714286 LINC00506 long intergenic non-protein 100846978 NR_047469 Hs.570649 coding RNA 506 −3.2258065 LINC00507 long intergenic non-protein 100862680 NR_046392 Hs.385496 ENSG00000256193 coding RNA 507 −2.5000000 LINC00547 long intergenic non-protein 400121 NR_040244 Hs.558894 ENSG00000275226 coding RNA 547 −2.3809524 LINC00620 long intergenic non-protein 285375 NR_027103 Hs.319969 ENSG00000224514 coding RNA 620 −2.4390244 LINC00649 long intergenic non-protein 100506334 NR_038883 Hs.532855 ENSG00000237945 coding RNA 649 −2.5641026 LINC00652 long intergenic non-protein 29075 NM_014162 Hs.584899 ENSG00000179935 coding RNA 652 −2.7777778 LINC00670 long intergenic non-protein 284034 NR_034144 Hs.376614 ENSG00000179136 coding RNA 670 −2.3809524 LINC00672 long intergenic non-protein 100505576 NR_038847 Hs.634043 ENSG00000263874 coding RNA 672 −3.8461538 LINC00678 long intergenic non-protein 101410541 NR_102708 Hs.471439 ENSG00000254934 coding RNA 678 −2.0833333 LINC00889 long intergenic non-protein 158696 NR_026935 Hs.558664 coding RNA 889 −1.9607843 LINC00907 long intergenic non-protein 284260 NR_046174 Hs.652819 ENSG00000267586 coding RNA 907 −2.1739130 LINC00924 long intergenic non-protein 145820 NR_027132 Hs.652702 ENSG00000259134 coding RNA 924 −2.7027027 LINC00958 long intergenic non-protein 100506305 NR_038904 Hs.153408 ENSG00000251381 coding RNA 958 −2.8571429 LINC00965 long intergenic non-protein 349196 NM_001025473 Hs.559040 coding RNA 965 −2.7027027 LINC00970 long intergenic non-protein 101978719 NR_104091 Hs.517849 ENSG00000203601 coding RNA 970 −2.5641026 LOH12CR2 loss of heterozygosity, 12, 503693 NR_024061 Hs.67553 ENSG00000205791 chromosomal region 2 (non- protein coding) 1.9300000 LRP10 low density lipoprotein 26020 NM_014045 Hs.525232 ENSG00000197324 receptor-related protein 10 −2.0408163 LRRN4CL LRRN4 C-terminal like 221091 NM_203422 Hs.427449 ENSG00000177363 −1.6949153 LUC7L2 LUC7-like 2 (S. cerevisiae) 51631 NM_001244585 Hs.731488 ENSG00000146963 1.9500000 LYL1 lymphoblastic leukemia 4066 NM_005583 Hs.46446 ENSG00000104903 associated hematopoiesis regulator 1 −1.8518519 LYRM7 LYR motif containing 7 90624 NM_001293735 Hs.115467 ENSG00000186687 2.1100000 LYPLA2 lysophospholipase II 11313 NM_007260 Hs.533479 ENSG00000011009 −2.7777778 MAB21L3 mab-21-like 3 (C. elegans) 126868 NM_152367 Hs.376194 ENSG00000173212 −2.0000000 MRO maestro 83876 NM_001127174 Hs.30495 ENSG00000134042 2.1000000 MDP1 magnesium-dependent 145553 NM_001199821 Hs.220963 ENSG00000213920 phosphatase 1 1.8200000 MDH1 malate dehydrogenase 1, 4190 NM_001199111 Hs.526521 ENSG00000014641 NAD (soluble) 1.9200000 MDH2 malate dehydrogenase 2, 4191 NM_001282403 Hs.520967 ENSG00000146701 NAD (mitochondrial) −1.4492754 MCTS1 malignant T cell amplified 28985 NM_001137554 Hs.102696 ENSG00000232119 sequence 1 −2.1276596 MAN1B1-AS1 MAN1B1 antisense RNA 1 100289341 NR_027447 Hs.593896 ENSG00000268996 (head to head) −3.8461538 MANEAL mannosidase, endo-alpha-like 149175 NM_001031740 Hs.534562 ENSG00000185090 −1.8181818 MAP7D3 MAP7 domain containing 3 79649 NM_001173516 Hs.446275 ENSG00000129680 −2.1276596 MRGPRX3 MAS-related GPR, member X3 117195 NM_054031 Hs.380177 ENSG00000179826 −1.5151515 MDM4 MDM4, p53 regulator 4194 NM_001204171 Hs.497492 ENSG00000 198625 −2.1739130 MED15P9 mediator complex subunit 15 285103 NR_033903 Hs.570106 ENSG00000223760 pseudogene 9 −2.3255814 MED18 mediator complex subunit 18 54797 NM_001127350 Hs.479911 ENSG00000130772 −1.3888889 MED29 mediator complex subunit 29 55588 NM_017592 Hs.611541 ENSG00000063322 −2.0408163 MLANA melan-A 2315 NM_005511 Hs.154069 ENSG00000120215 −2.0833333 MAGEA10 melanoma antigen family A10 4109 NM_001011543 Hs.18048 ENSG00000124260 −1.9230769 MREG melanoregulin 55686 NM_018000 Hs.620391 ENSG00000118242 −2.0833333 MS4A10 membrane-spanning 4-domains, 341116 NM_206893 Hs.591956 ENSG00000172689 subfamily A, member 10 1.7600000 METTL17 methyltransferase like 17 64745 NM_001029991 Hs.512693 ENSG00000165792 −2.0408163 METTL20 methyltransferase like 20 254013 NM_001135863 Hs.740628 ENSG00000139160 −2.5000000 METTL21A methyltransferase like 21A 151194 NM_001127395 Hs.664764 ENSG00000144401 1.7000000 METTL23 methyltransferase like 23 124512 NM_001080510 Hs.74655 ENSG00000181038 −2.1739130 METTL2A methyltransferase like 2A 339175 NM_001005372 Hs.381204 ENSG00000087995 −1.9607843 METTL2B methyltransferase like 2B 55798 NM_018396 Hs.433213 ENSG00000165055 1.3000000 METTL4 methyltransferase like 4 64863 NM_022840 Hs.126888 ENSG00000101574 −2.0408163 METTL8 methyltransferase like 8 79828 NM_024770 Hs.135146 ENSG00000123600 1.7900000 MFNG MFNG O-fucosylpeptide 3- 4242 NM_001166343 Hs.517603 ENSG00000100060 beta-N- acetylglucosaminyltransferase 6.0100000 MIR3655 microRNA 3655 100500820 NR_037428 ENSG00000264052 −6.6666667 MIR5194 microRNA 5194 100847051 NR_049826 ENSG00000264653 3.3700000 MIR564 microRNA 564 693149 NR_030290 ENSG00000207783 2.8700000 MIR636 microRNA 636 693221 NR_030366 ENSG00000207556 −1.8867925 MIR6723 microRNA 6723 102465432 NR_106781 ENSG00000278791 9.2400000 MIR7845 microRNA 7845 102465835 NR_106999 ENSG00000277590 1.7900000 MGST1 microsomal glutathione S- 4257 NM_001260511 Hs.389700 ENSG00000008394 transferase 1 −1.7241379 MICAL3 microtubule associated 57553 NM_001122731 Hs.528024 ENSG00000243156 monooxygenase, calponin and LIM domain containing 3 −2.7027027 MAP1LC3C microtubule-associated 440738 NM_001004343 Hs.534971 ENSG00000197769 protein 1 light chain 3 gamma 1.7000000 MCMBP minichromosome 79892 NM_001256378 Hs.124246 ENSG00000197771 maintenance complex binding protein −1.7857143 MIR210HG MIR210 host gene 100506211 NR_038262 Hs.446388 ENSG00000247095 −1.8181818 MIRLET7BHG MIRLET7B host gene 400931 NM_207477 Hs.235838 ENSG00000197182 −2.4390244 MTFMT mitochondrial methionyl- 123263 NM_139242 Hs.531615 ENSG00000103707 tRNA formyltransferase 1.7600000 MRPL12 mitochondrial ribosomal 6182 NM_002949 Hs.109059 ENSG00000262814 protein L12 2.0900000 MRPL34 mitochondrial ribosomal 64981 NM_023937 Hs.515242 ENSG00000130312 protein L34 1.4900000 MRPL37 mitochondrial ribosomal 51253 NM_016491 Hs.584908 ENSG00000116221 protein L37 1.8000000 MRPL38 mitochondrial ribosomal 64978 NM_032478 Hs.442609 ENSG00000204316 protein L38 1.7300000 MRPL41 mitochondrial ribosomal 64975 NM_032477 Hs.44017 ENSG00000182154 protein L41 2.0000000 MRPS12 mitochondrial ribosomal 6183 NM_021107 Hs.411125 ENSG00000128626 protein S12 −1.8518519 MAPK13 mitogen-activated protein 5603 NM_002754 Hs.178695 ENSG00000156711 kinase 13 1.9300000 MAP2K2 mitogen-activated protein 5605 NM_030662 Hs.465627 ENSG00000126934 kinase kinase 2 1.5600000 MAP2K5 mitogen-activated protein 5607 NM_001206804 Hs.114198 ENSG00000137764 kinase kinase 5 −1.6949153 MAP3K9 mitogen-activated protein 4293 NM_001284230 Hs.445496 ENSG00000006432 kinase kinase kinase 9 1.8800000 MZT2A mitotic spindle organizing 653784 NM_001085365 Hs.655067 ENSG00000173272 protein 2A 1.4700000 MLX MLX, MAX dimerization 6945 NM_170607 Hs.383019 ENSG00000108788 protein −2.5000000 MOCS3 molybdenum cofactor 27304 NM_014484 Hs.159410 ENSG00000124217 synthesis 3 −2.1739130 MMD2 monocyte to macrophage 221938 NM_001100600 Hs.558694 ENSG00000136297 differentiation-associated 2 −1.9230769 MORN4 MORN repeat containing 4 118812 NM_001098831 Hs.217409 ENSG00000171160 −1.9607843 MPV17L MPV17 mitochondrial 255027 NM_001128423 Hs.720673 ENSG00000156968 membrane protein-like −2.2222222 MUC6 mucin 6, oligomeric 4588 NM_005961 Hs.528432 ENSG00000184956 mucus/gel-forming −2.3255814 MMRN2 multimerin 2 79812 NM_024756 Hs.524479 ENSG00000173269 −1.7857143 MCFD2 multiple coagulation factor 90411 NM_001171506 Hs.662152 ENSG00000180398 deficiency 2 1.4700000 MUS81 MUS81 structure-specific 80198 NM_025128 Hs.288798 ENSG00000172732 endonuclease subunit 2.0500000 MYPOP Myb-related transcription 339344 NM_001012643 Hs.515478 ENSG00000176182 factor, partner of profilin 1.3800000 MBP myelin basic protein 4155 NM_001025081 Hs.551713 ENSG00000197971 −1.7857143 MYEF2 myelin expression factor 2 50804 NM_001301210 Hs.6638 ENSG00000104177 −2.5000000 MOG myelin oligodendrocyte 4340 NM_001008228 Hs.141308 ENSG00000204655 glycoprotein −1.8181818 MPZL3 myelin protein zero-like 3 196264 NM_001286152 Hs.15396 ENSG00000160588 −1.8867925 MYLK3 myosin light chain kinase 3 91807 NM_182493 Hs.130465 ENSG00000140795 1.4000000 MYO7B myosin VIIB 4648 NM_001080527 Hs.154578 ENSG00000169994 −1.6666667 NAA16 N(alpha)-acetyltransferase 16, 79612 NM_001110798 Hs.512914 ENSG00000172766 NatA auxiliary subunit 1.6400000 NAGA N-acetylgalactosaminidase, 4668 NM_000262 Hs.75372 ENSG00000198951 alpha- −2.0833333 NWD1 NACHT and WD repeat 284434 NM_001007525 Hs.406014 ENSG00000188039 domain containing 1 −1.8867925 NQO1 NAD(P)H dehydrogenase, 1728 NM_000903 Hs.406515 ENSG00000181019 quinone 1 1.8100000 NDUFA7 NADH dehydrogenase 4701 NM_005001 Hs.333427 ENSG00000267855 (ubiquinone) 1 alpha subcomplex, 7, 14.5 kDa 1.9000000 NDUFB11 NADH dehydrogenase 54539 NM_001135998 Hs.521969 ENSG00000147123 (ubiquinone) 1 beta subcomplex, 11, 17.3 kDa 1.7300000 NDUFB6 NADH dehydrogenase 4712 NM_001199987 Hs.493668 ENSG00000165264 (ubiquinone) 1 beta subcomplex, 6, 17 kDa 1.5100000 NDUFB7 NADH dehydrogenase 4713 NM_004146 Hs.532853 ENSG00000099795 (ubiquinone) 1 beta subcomplex, 7, 18 kDa 1.3800000 NDUFB8 NADH dehydrogenase 4714 NM_001284367 Hs.523215 ENSG00000166136 (ubiquinone) 1 beta subcomplex, 8, 19 kDa 2.0600000 NDUFC1 NADH dehydrogenase 4717 NM_001184986 Hs.84549 ENSG00000109390 (ubiquinone) 1, subcomplex unknown, 1, 6 kDa −1.7857143 NDUFAF7 NADH dehydrogenase 55471 NM_001083946 Hs.433466 ENSG00000003509 (ubiquinone) complex I, assembly factor 7 1.8500000 NDUFS7 NADH dehydrogenase 374291 NM_024407 Hs.211914 ENSG00000115286 (ubiquinone) Fe—S protein 7, 20 kDa (NADH-coenzyme Q reductase) −1.4492754 NECAP1 NECAP endocytosis 25977 NM_015509 Hs.555927 ENSG00000089818 associated 1 −1.9607843 NPHS1 nephrosis 1, congenital, 4868 NM_004646 Hs.122186 ENSG00000161270 Finnish type (nephrin) −2.6315789 NBPF20 neuroblastoma breakpoint 100288142 NM_001278267 Hs.445080 ENSG00000162825 family, member 20 −2.6315789 NEXN-AS1 NEXN antisense RNA 1 374987 NM_001039463 Hs.632414 ENSG00000235927 1.5200000 NKIRAS2 NFKB inhibitor interacting 28511 NM_001001349 Hs.632252 ENSG00000168256 Ras-like 2 −1.9230769 NMNAT1 nicotinamide nucleotide 64802 NM_001297778 Hs.633762 ENSG00000173614 adenylyltransferase 1 −2.2222222 NEK2 NIMA-related kinase 2 4751 NM_001204182 Hs.153704 ENSG00000117650 1.7900000 NIPAL2 NIPA-like domain containing 2 79815 NM_024759 Hs.309489 ENSG00000104361 1.6200000 NIPSNAP3A nipsnap homolog 3A (C. elegans) 25934 NM_015469 Hs.530275 ENSG00000136783 −1.8518519 NMT2 N-myristoyltransferase 2 9397 NM_004808 Hs.60339 ENSG00000152465 −1.9607843 NCMAP noncompact myelin 400746 NM_001010980 Hs.200253 ENSG00000184454 associated protein −1.9230769 NFKBIZ nuclear factor of kappa light 64332 NM_001005474 Hs.319171 ENSG00000144802 polypeptide gene enhancer in B-cells inhibitor, zeta −1.8518519 NUGGC nuclear GTPase, germinal 389643 NM_001010906 Hs.370129 ENSG00000189233 center associated −1.8867925 NPAP1 nuclear pore associated 23742 NM_018958 Hs.649663 ENSG00000185823 protein 1 2.0700000 NPIPA2 nuclear pore complex 642799 NM_001277324 ENSG00000254852 interacting protein family, member A2 −2.0408163 NRIP3 nuclear receptor interacting 56675 NM_020645 Hs.523467 ENSG00000175352 protein 3 −1.4705882 NR6A1 nuclear receptor subfamily 6, 2649 NM_001278546 Hs.20131 ENSG00000148200 group A, member 1 −1.8518519 NFX1 nuclear transcription factor, 4799 NM_002504 Hs.413074 ENSG00000086102 X-box binding 1 1.2500000 NUP133 nucleoporin 133 kDa 55746 NM_018230 Hs.12457 ENSG00000069248 −2.6315789 NXN nucleoredoxin 64359 NM_001205319 Hs.527989 ENSG00000167693 −2.3255814 NXNL2 nucleoredoxin-like 2 158046 NM_001161625 Hs.734507 ENSG00000130045 1.8700000 NUDT22 nudix (nucleoside diphosphate 84304 NM_001128612 Hs.656074 ENSG00000149761 linked moiety X)-type motif 22 1.9300000 OCEL1 occludin/ELL domain containing 1 79629 NM_024578 Hs.422676 ENSG00000099330 −2.0408163 OLAH oleoyl-ACP hydrolase 55301 NM_001039702 Hs.24309 ENSG00000152463 −2.0833333 OR11A1 olfactory receptor, family 11, 26531 NM_013937 Hs.676010 ENSG00000204694 subfamily A, member 1 2.0400000 OLIG1 oligodendrocyte transcription 116448 NM_138983 Hs.56663 ENSG00000184221 factor 1 −2.5000000 OPHN1 oligophrenin 1 4983 NM_002547 Hs.128824 ENSG00000079482 −1.8518519 OSMR oncostatin M receptor 9180 NM_001168355 Hs.120658 ENSG00000145623 1.8100000 OPN3 opsin 3 23596 NM_001030011 Hs.409081 ENSG00000054277 −1.6949153 OPA3 optic atrophy 3 (autosomal 80207 NM_001017989 Hs.466945 ENSG00000125741 recessive, with chorea and spastic paraplegia) 1.8600000 ORAI3 ORAI calcium release- 93129 NM_152288 Hs.745104 ENSG00000175938 activated calcium modulator 3 −2.8571429 ORC4 origin recognition complex, 5000 NM_001190879 Hs.558364 ENSG00000115947 subunit 4 −1.9230769 OSGEPL1-AS1 OSGEPL1 antisense RNA 1 101409258 NR_102429 Hs.738558 ENSG00000253559 −1.8518519 OTUD3 OTU deubiquitinase 3 23252 NM_015207 Hs.374987 ENSG00000169914 −2.8571429 OTUD6A OTU deubiquitinase 6A 139562 NM_207320 Hs.447381 ENSG00000189401 −3.2258065 ODF2L outer dense fiber of sperm 57489 NM_001007022 Hs.149360 ENSG00000122417 tails 2-like −1.6666667 OSBPL2 oxysterol binding protein-like 2 9885 NM_001001691 Hs.473254 ENSG00000130703 1.5200000 OSBPL7 oxysterol binding protein-like 7 114881 NM_017731 Hs.463320 ENSG00000006025 −2.5000000 LOC646214 p21 protein (Cdc42/Rac)- 646214 NR_027053 Hs.510697 ENSG00000278673 activated kinase 2 pseudogene −2.1739130 P2RX5-TAX1BP3 P2RX5-TAX1BP3 readthrough 100533970 NR_037928 Hs.731607 (NMD candidate) −1.6393443 PAF1 Paf1, RNA polymerase II 54623 NM_001256826 Hs.466714 ENSG00000006712 associated factor, homolog (S. cerevisiae) −2.5000000 PTCSC3 papillary thyroid carcinoma 100886964 NR_049735 Hs.742592 ENSG00000259104 susceptibility candidate 3 (non-protein coding) −2.5000000 PARD6G par-6 family cell polarity 84552 NM_032510 Hs.654920 ENSG00000178184 regulator gamma −2.0833333 PNMA2 paraneoplastic Ma antigen 2 10687 NM_007257 Hs.591838 ENSG00000240694 −2.0408163 PARK2 parkin RBR E3 ubiquitin 5071 NM_004562 Hs.132954 ENSG00000185345 protein ligase −2.1276596 PDDC1 Parkinson disease 7 domain 347862 NM_182612 Hs.218362 ENSG00000177225 containing 1 1.3300000 PARK7 parkinson protein 7 11315 NM_001123377 Hs.419640 ENSG00000116288 −2.0408163 LOC100287846 patched 1 pseudogene 100287846 NR_037168 Hs.21550 −2.7027027 PTCHD4 patched domain containing 4 442213 NM_001013732 Hs.659409 ENSG00000244694 4.0900000 PDZK1IPl PDZK1 interacting protein 1 10158 NM_005764 Hs.431099 ENSG00000162366 1.6200000 PEPD peptidase D 5184 NM_000285 Hs.36473 ENSG00000124299 −2.1739130 PPIL6 peptidylprolyl isomerase 285755 NM_001111298 Hs.32234 ENSG00000185250 (cyclophilin)-like 6 −2.0833333 PPIEL peptidylprolyl isomerase E- 728448 NR_003929 Hs.472508 ENSG00000182109 like pseudogene −1.4925373 PER2 period circadian clock 2 8864 NM_003894 Hs.58756 ENSG00000132326 1.8600000 PRDX3 peroxiredoxin 3 10935 NM_001302272 Hs.523302 ENSG00000165672 1.8600000 PRDX4 peroxiredoxin 4 10549 NM_006406 Hs.83383 ENSG00000123131 −1.8867925 PXMP4 peroxisomal membrane 11264 NM_007238 Hs.654857 ENSG00000101417 protein 4, 24 kDa −1.3698630 PHF12 PHD finger protein 12 57649 NM_001033561 Hs.444173 ENSG00000109118 −1.7543860 PHACTR4 phosphatase and actin 65979 NM_001048183 Hs.225641 ENSG00000204138 regulator 4 1.3900000 PIGY phosphatidylinositol glycan 84992 NM_001042616 Hs.26136 ENSG00000255072 anchor biosynthesis, class Y −1.7857143 PLCXD1 phosphatidylinositol-specific 55344 NM_018390 Hs.522568 ENSG00000182378 phospholipase C, X domain containing 1 1.6000000 PISD phosphatidylserine 23761 NM_014338 Hs.420559 ENSG00000241878 decarboxylase −2.1276596 PDE4C phosphodiesterase 4C, 5143 NM_000923 Hs.132584 ENSG00000105650 cAMP-specific −2.3809524 PDE6A phosphodiesterase 6A, 5145 NM_000440 Hs.567314 ENSG00000132915 cGMP-specific, rod, alpha −3.4482759 PGM5P2 phosphoglucomutase 5 595135 NR_002836 Hs.571593 ENSG00000277778 pseudogene 2 −2.0833333 PLA2G4E phospholipase A2, group IVE 123745 NM_001080490 Hs.668060 ENSG00000188089 −1.7241379 PHAX phosphorylated adaptor for 51808 NM_032177 Hs.555731 ENSG00000164902 RNA export 1.3900000 PYURF PIGY upstream reading frame 100996939 NM_032906 Hs.26136 ENSG00000145337 −2.0408163 PNN pinin, desmosome associated 5411 NM_002687 Hs.409965 ENSG00000100941 protein −2.2222222 PLEKHA5 pleckstrin homology domain 54477 NM_001143821 Hs.188614 ENSG00000052126 containing, family A member 5 −1.9230769 PLEKHG2 pleckstrin homology domain 64857 NM_022835 Hs.631574 ENSG00000090924 containing, family G (with RhoGef domain) member 2 −2.5000000 PABPC1P2 poly(A) binding protein, 728773 NR_026904 Hs.334462 ENSG00000198526 cytoplasmic 1 pseudogene 2 −1.4492754 PCGF3 polycomb group ring finger 3 10336 NM_006315 Hs.144309 ENSG00000185619 −1.5625000 POLE3 polymerase (DNA directed), 54107 NM_001278255 Hs.108112 ENSG00000148229 epsilon 3, accessory subunit −1.7543860 POLH polymerase (DNA directed), eta 5429 NM_001291969 Hs.655467 ENSG00000170734 1.4800000 POLD4 polymerase (DNA-directed), 57804 NM_001256870 Hs.523829 ENSG00000175482 delta 4, accessory subunit 1.3500000 POLR2D polymerase (RNA) II (DNA 5433 NM_004805 Hs.715348 ENSG00000144231 directed) polypeptide D 1.4700000 PTBP1 polypyrimidine tract binding 5725 NM_002819 Hs.172550 ENSG00000011304 protein 1 −1.8518519 PBDC1 polysaccharide biosynthesis 51260 NM_001300888 Hs.370100 ENSG00000102390 domain containing 1 −1.5384615 KCMF1 potassium channel 56888 NM_020122 Hs.654968 ENSG00000176407 modulatory factor 1 −2.3809524 KCNJ5 potassium channel, inwardly 3762 NM_000890 Hs.444595 ENSG00000120457 rectifying subfamily J, member 5 −2.2222222 KCNA7 potassium channel, voltage 3743 NM_031886 Hs.306973 ENSG00000104848 gated shaker related subfamily A, member 7 −2.2727273 POU2AF1 POU class 2 associating 5450 NM_006235 Hs.654525 ENSG00000110777 factor 1 −2.5000000 POU5F1 POU class 5 homeobox 1 5460 NM_001173531 Hs.249184 ENSG00000204531 1.6600000 PQLC3 PQ loop repeat containing 3 130814 NM_001282710 Hs.274415 ENSG00000162976 −1.8518519 PRDM7 PR domain containing 7 11105 NM_001098173 Hs.406695 ENSG00000126856 −1.7857143 PRPF3 pre-mRNA processing factor 3 9129 NM_004698 Hs.11776 ENSG00000117360 −2.0408163 PRPF38B pre-mRNA processing factor 38B 55119 NM_018061 Hs.342307 ENSG00000134186 1.3100000 PRPF8 pre-mRNA processing factor 8 10594 NM_006445 Hs.181368 ENSG00000174231 −2.4390244 PRICKLE2-AS3 PRICKLE2 antisense RNA 3 100874243 NR_046702 Hs.670840 ENSG00000226017 −2.2222222 PRKAR2A-AS1 PRKAR2A antisense RNA 1 100506637 NR_109996 Hs.634259 ENSG00000224424 −2.0408163 PRKX-AS1 PRKX antisense RNA 1 100873944 NR_046643 ENSG00000236188 1.5600000 POP7 processing of precursor 7, 10248 NM_005837 Hs.416994 ENSG00000172336 ribonuclease P/MRP subunit (S. cerevisiae) −1.9230769 PFN1P2 profilin 1 pseudogene 2 767846 NR_003242 Hs.657186 ENSG00000270392 1.3700000 PDCD6IP programmed cell death 6 10015 NM_001162429 Hs.475896 ENSG00000170248 interacting protein 1.3600000 PHB2 prohibitin 2 11331 NM_001144831 Hs.504620 ENSG00000215021 −2.0000000 PRR11 proline rich 11 55771 NM_018304 Hs.631750 ENSG00000068489 −1.5384615 PRRC2C proline-rich coiled-coil 2C 23215 NM_015172 Hs.494614 ENSG00000117523 −2.8571429 PART1 prostate androgen-regulated 25859 NM_001039499 Hs.146312 ENSG00000152931 transcript 1 (non-protein coding) −2.3809524 PRNCR1 prostate cancer associated 101867536 NR_109833 Hs.652970 ENSG00000224722 non-coding RNA 1 −1.8181818 PCAT19 prostate cancer associated 100505495 NR_040109 Hs.648878 ENSG00000267107 transcript 19 (non-protein coding) 1.5700000 PSMD14 proteasome (prosome, 10213 NM_005805 Hs.740477 ENSG00000115233 macropain) 26S subunit, non- ATPase, 14 1.4300000 PSMD9 proteasome (prosome, 5715 NM_001261400 Hs.131151 ENSG00000110801 macropain) 26S subunit, non- ATPase, 9 1.7900000 PSMB5 proteasome (prosome, 5693 NM_001130725 Hs.422990 ENSG00000100804 macropain) subunit, beta type, 5 −2.1276596 PIN4P1 protein (peptidylprolyl 728758 NR_003571 Hs.658099 ENSG00000227973 cis/trans isomerase) NIMA- interacting, 4 pseudogene 1 −2.0000000 PRKXP1 protein kinase, X-linked, 441733 NR_073405 Hs.12250 ENSG00000270127 pseudogene 1 1.5900000 PPP1R37 protein phosphatase 1, 284352 NM_019121 Hs.285363 ENSG00000104866 regulatory subunit 37 1.8700000 PPP2CB protein phosphatase 2, 5516 NM_001009552 Hs.491440 ENSG00000104695 catalytic subunit, beta isozyme 1.2900000 PPP3CB protein phosphatase 3, 5532 NM_001142353 Hs.500067 ENSG00000107758 catalytic subunit, beta isozyme −1.7857143 PPM1K protein phosphatase, 152926 NM_152542 Hs.43744 ENSG00000163644 Mg2+/Mn2+ dependent, 1K −2.0408163 PTK6 protein tyrosine kinase 6 5753 NM_001256358 Hs.51133 ENSG00000101213 −1.7241379 PTPN14 protein tyrosine phosphatase, 5784 NM_005401 Hs.193557 ENSG00000152104 non-receptor type 14 1.4100000 PTPN9 protein tyrosine phosphatase, 5780 NM_002833 Hs.445775 ENSG00000169410 non-receptor type 9 −2.2727273 PCDH11X protocadherin 11 X-linked 27328 NM_001168360 Hs.655673 ENSG00000102290 −2.3809524 PCDH11Y protocadherin 11 Y-linked 83259 NM_001278619 Hs.661308 ENSG00000099715 −2.1739130 PCDHB9 protocadherin beta 9 56127 NM_019119 Hs.662726 ENSG00000177839 −1.8181818 PCBD2 pterin-4 alpha-carbinolamine 84105 NM_032151 Hs.710014 ENSG00000132570 dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 −1.8867925 PTGES2-AS1 PTGES2 antisense RNA 1 389791 NM_001013652 Hs.632678 ENSG00000232850 (head to head) −1.7241379 PPFIBP1 PTPRF interacting protein, 8496 NM_001198915 Hs.172445 ENSG00000110841 binding protein 1 (liprin beta 1) −1.9607843 PTPRG-AS1 PTPRG antisense RNA 1 100506994 NR_038281 Hs.656620 ENSG00000241472 −1.9607843 LOC100506127 putative uncharacterized 100506127 NM_001013634 Hs.503319 ENSG00000179240 protein FLJ37770-like 2.0800000 PYCARD PYD and CARD domain 29108 NM_013258 Hs.499094 ENSG00000103490 containing 2.1000000 PYGO2 pygopus family PHD finger 2 90780 NM_138300 Hs.533597 ENSG00000163348 −1.5873016 PDXDC2P pyridoxal-dependent 283970 NM_199134 Hs.513695 ENSG00000196696 decarboxylase domain containing 2, pseudogene −1.4925373 PGPEP1 pyroglutamyl-peptidase I 54858 NM_001300927 Hs.131776 ENSG00000130517 −2.0000000 PDP2 pyruvate dehyrogenase 57546 NM_020786 Hs.632214 ENSG00000172840 phosphatase catalytic subunit 2 1.5100000 QTRT1 queuine tRNA- 81890 NM_031209 Hs.631638 ENSG00000213339 ribosyltransferase 1 −1.2820513 QTRTD1 queuine tRNA- 79691 NM_001256835 Hs.477162 ENSG00000151576 ribosyltransferase domain containing 1 1.5700000 RABAC1 Rab acceptor 1 (prenylated) 10567 NM_006423 Hs.11417 ENSG00000105404 −1.4925373 RAB11FIP4 RAB11 family interacting 84440 NM_001303542 Hs.406788 ENSG00000131242 protein 4 (class II) −1.7857143 RAB12 RAB12, member RAS 201475 NM_001025300 Hs.270074 ENSG00000206418 oncogene family −2.1276596 RAB42 RAB42, member RAS 115273 NM_001193532 Hs.652321 ENSG00000188060 oncogene family 1.4000000 RAB5C RAB5C, member RAS 5878 NM_001252039 Hs.650382 ENSG00000108774 oncogene family −1.4705882 RAD1 RAD1 checkpoint DNA 5810 NM_001033673 Hs.38114 ENSG00000113456 exonuclease 1.5300000 RALY RALY heterogeneous nuclear 22913 NM_007367 Hs.136947 ENSG00000125970 ribonucleoprotein −2.7027027 RAMP2-AS1 RAMP2 antisense RNA 1 100190938 NR_024461 Hs.655265 ENSG00000197291 2.2400000 RHOG ras homolog family member G 391 NM_001665 Hs.501728 ENSG00000177105 −2.7777778 RASAL2-AS1 RASAL2 antisense RNA 1 100302401 NR_027982 Hs.736117 ENSG00000224687 1.8500000 RASL11A RAS-like, family 11, member A 387496 NM_206827 Hs.192131 ENSG00000122035 1.9700000 RAC2 ras-related C3 botulinum 5880 NM_002872 Hs.517601 ENSG00000128340 toxin substrate 2 (rho family, small GTP binding protein Rac2) 1.6400000 RITA1 RBPJ interacting and tubulin 84934 NM_001286215 Hs.524762 ENSG00000139405 associated 1 −1.3888889 RIPK1 receptor (TNFRSF)-interacting 8737 NM_003804 Hs.519842 ENSG00000137275 serine-threonine kinase 1 2.0100000 RGS14 regulator of G-protein 10636 NM_006480 Hs.9347 ENSG00000169220 signaling 14 1.4200000 RGS3 regulator of G-protein 5998 NM_001276260 Hs.494875 ENSG00000138835 signaling 3 1.6700000 RFX1 regulatory factor X, 1 5989 NM_002918 Hs.655215 ENSG00000132005 (influences HLA class II expression) 1.4800000 RTN3 reticulon 3 10313 NM_001265589 Hs.743229 ENSG00000133318 −1.8181818 RFPL1S RFPL1 antisense RNA 1 10740 NR_002727 Hs.167750 ENSG00000225465 −1.7241379 RHD Rh blood group, D antigen 6007 NM_001127691 Hs.449968 ENSG00000187010 −2.0000000 RHBG Rh family, B glycoprotein 57127 NM_001256395 Hs.131835 ENSG00000132677 (gene/pseudogene) −1.2987013 ARHGAP26 Rho GTPase activating 23092 NM_001135608 Hs.654668 ENSG00000145819 protein 26 −2.0833333 RHBDL2 rhomboid, veinlet-like 2 54933 NM_001304746 Hs.524626 ENSG00000158315 (Drosophila) 2.0000000 RAVER1 ribonucleoprotein, PTB- 125950 NM_133452 Hs.744952 ENSG00000161847 binding 1 1.6500000 RPL18A ribosomal protein L18a 6142 NM_000980 Hs.337766 ENSG00000105640 1.6300000 RPL28 ribosomal protein L28 6158 NM_000991 Hs.652114 ENSG00000108107 1.5400000 RPL41 ribosomal protein L41 6171 NM_001035267 Hs.112553 ENSG00000229117 1.5900000 RPS12 ribosomal protein S12 6206 NM_001016 Hs.546289 ENSG00000112306 −1.7241379 RPS15AP10 ribosomal protein S15a 728963 NR_026768 Hs.675157 ENSG00000225447 pseudogene 10 1.9500000 RPS6KA4 ribosomal protein S6 kinase, 8986 NM_001006944 Hs.105584 ENSG00000162302 90 kDa, polypeptide 4 1.8700000 RPLP1 ribosomal protein, large, P1 6176 NM_001003 Hs.356502 ENSG00000137818 −1.6129032 RRP15 ribosomal RNA processing 51018 NM_016052 Hs.660109 ENSG00000067533 15 homolog (S. cerevisiae) 1.9700000 RNF126 ring finger protein 126 55658 NM_017876 Hs.69554 ENSG00000070423 1.5400000 RNF167 ring finger protein 167 26001 NM_015528 Hs.7158 ENSG00000108523 −2.1276596 RNF207 ring finger protein 207 388591 NM_173795 Hs.716549 ENSG00000158286 −1.2195122 RNF216 ring finger protein 216 54476 NM_019011 Hs.487458 ENSG00000011275 −2.5641026 RNF222 ring finger protein 222 643904 NM_001146684 Hs.526550 ENSG00000189051 −1.9607843 RBM25 RNA binding motif protein 25 58517 NM_021239 Hs.531106 ENSG00000119707 −2.1276596 RBM34 RNA binding motif protein 34 23029 NM_001161533 Hs.535224 ENSG00000188739 1.4100000 RBM42 RNA binding motif protein 42 79171 NM_024321 Hs.5086 ENSG00000126254 −1.6666667 RBM43 RNA binding motif protein 43 375287 NM_198557 Hs.302442 ENSG00000184898 −1.8518519 RBM48 RNA binding motif protein 48 84060 NM_032120 Hs.21590 ENSG00000127993 −1.6129032 RBMS2 RNA binding motif, single 5939 NM_002898 Hs.505729 ENSG00000076067 stranded interacting protein 2 −2.3255814 RNF144A-AS1 RNF144A antisense RNA 1 386597 NR_033997 Hs.559010 ENSG00000228203 −3.0303030 ROR1-AS1 ROR1 antisense RNA 1 101927034 NR_110665 Hs.680824 ENSG00000223949 −1.4492754 SAP30BP SAP30 binding protein 29115 NM_001301839 Hs.655088 ENSG00000161526 −1.8867925 SFMBT2 Scm-like with four mbt 57713 NM_001018039 Hs.407983 ENSG00000198879 domains 2 −1.5151515 SDE2 SDE2 telomere maintenance 163859 NM_152608 Hs.520192 ENSG00000143751 homolog (S. pombe) 1.6000000 SEMA4A sema domain, 64218 NM_001193300 Hs.408846 ENSG00000196189 immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A 1.7900000 SEMA4B sema domain, 10509 NM_020210 Hs.474935 ENSG00000185033 immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B −1.6393443 SEPT7P2 septin 7 pseudogene 2 641977 NR_024271 Hs.723477 ENSG00000214765 1.5500000 SQSTM1 sequestosome 1 8878 NM_001142298 Hs.724025 ENSG00000161011 1.6700000 SHMT2 serine 6472 NM_001166356 Hs.741179 ENSG00000182199 hydroxymethyltransferase 2 (mitochondrial) 2.0700000 SPINT1 serine peptidase inhibitor, 6692 NM_001032367 Hs.233950 ENSG00000166145 Kunitz type 1 −1.4925373 SRSF10 serine/arginine-rich splicing 10772 NM_001191005 Hs.3530 ENSG00000188529 factor 10 −1.8181818 SRSF11 serine/arginine-rich splicing 9295 NM_001190987 Hs.479693 ENSG00000116754 factor 11 −1.8181818 SRSF4 serine/arginine-rich splicing 6429 NM_005626 Hs.469970 ENSG00000116350 factor 4 −2.2727273 SAA2 serum amyloid A2 6289 NM_001127380 Hs.731376 ENSG00000134339 −1.7241379 SMYD4 SET and MYND domain 114826 NM_052928 Hs.514602 ENSG00000186532 containing 4 −1.4492754 SETMAR SET domain and mariner 6419 NM_001243723 Hs.475300 ENSG00000170364 transposase fusion gene −1.8867925 SCML4 sex comb on midleg-like 4 256380 NM_001286408 Hs.486109 ENSG00000146285 (Drosophila) −2.1739130 STAC2 SH3 and cysteine rich domain 2 342667 NM_198993 Hs.145068 ENSG00000141750 −1.4925373 SH3BP5-AS1 SH3BP5 antisense RNA 1 100505696 NR_046084 Hs.745026 ENSG00000224660 −2.0408163 SHANK2-AS3 SHANK2 antisense RNA 3 220070 NM_145308 Hs.326766 ENSG00000171671 −2.0408163 LOC100420587 SHC SH2-domain binding 100420587 NR_110759 Hs.569956 ENSG00000267243 protein 1 pseudogene −3.0303030 SHISA9 shisa family member 9 729993 NM_001145204 Hs.130661 ENSG00000237515 −2.2222222 SGOL1 shugoshin-like 1 (S. pombe) 151648 NM_001012409 Hs.105153 ENSG00000129810 1.9100000 SIGLEC9 sialic acid binding Ig-like 27180 NM_001198558 Hs.245828 ENSG00000129450 lectin 9 1.6700000 SPCS1 signal peptidase complex 28972 NM_014041 Hs.11125 ENSG00000114902 subunit 1 homolog (S. cerevisiae) 1.5600000 SRP9 signal recognition particle 6726 NM_001130440 Hs.511425 ENSG00000143742 9 kDa 1.7700000 SSR2 signal sequence receptor, beta 6746 NM_003145 Hs.74564 ENSG00000163479 (translocon-associated protein beta) 1.4000000 STAT5B signal transducer and 6777 NM_012448 Hs.595276 ENSG00000173757 activator of transcription 5B 1.9900000 SMDT1 single-pass membrane protein 91689 NM_033318 Hs.306083 ENSG00000183172 with aspartate-rich tail 1 2.2700000 SIRT2 sirtuin 2 22933 NM_001193286 Hs.466693 ENSG00000068903 −1.5384615 SIRT3 sirtuin 3 23410 NM_001017524 Hs.716456 ENSG00000142082 −2.2222222 SIX4 SIX homeobox 4 51804 NM_017420 Hs.97849 ENSG00000100625 1.4600000 SSNA1 Sjogren syndrome nuclear 8636 NM_003731 Hs.530314 ENSG00000176101 autoantigen 1 −2.1739130 SLFNL1-AS1 SLFNL1 antisense RNA 1 100507178 NR_037868 Hs.660056 2.7900000 SLMO2-ATP5E SLMO2-ATP5E readthrough 100533975 NR_037929 Hs.656865 ENSG00000236105 2.9700000 SLX1A SLX1 structure-specific 548593 NM_001014999 Hs.729791 ENSG00000132207 endonuclease subunit homolog A (S. cerevisiae) 2.9700000 SLX1B SLX1 structure-specific 79008 NM_024044 Hs.728161 ENSG00000181625 endonuclease subunit homolog B (S. cerevisiae) −2.0000000 SNIP1 Smad nuclear interacting 79753 NM_024700 Hs.47232 ENSG00000163877 protein 1 3.2400000 SCARNA20 small Cajal body-specific 677681 NR_002999 ENSG00000252577 RNA 20 −2.1739130 SGSM1 small G protein signaling 129049 NM_001039948 Hs.474397 ENSG00000167037 modulator 1 −2.8571429 SNHG4 small nucleolar RNA host 724102 NR_003141 Hs.268939 ENSG00000015479 gene 4 3.4900000 SNORD16 small nucleolar RNA, C/D 595097 NR_002440 Hs.739034 ENSG00000174444 box 16 4.9900000 SNORD56 small nucleolar RNA, C/D 26793 NR_002739 ENSG00000229686 box 56 −2.3809524 SMG1P7 SMG1 pseudogene 7 100506060 NR_033959 Hs.655258 ENSG00000261556 −1.2987013 SMU1 smu-1 suppressor of mec-8 55234 NM_018225 Hs.655351 ENSG00000122692 and unc-52 homolog (C. elegans) 2.4700000 SNAI3 snail family zinc finger 3 333929 NM_178310 Hs.673548 ENSG00000185669 2.2800000 SCN1B sodium channel, voltage 6324 NM_001037 Hs.436646 ENSG00000105711 gated, type I beta subunit −2.2222222 SLC14A2 solute carrier family 14 (urea 8170 NM_001242692 Hs.710927 ENSG00000132874 transporter), member 2 −1.9607843 SLC15A1 solute carrier family 15 6564 NM_005073 Hs.436893 ENSG00000088386 (oligopeptide transporter), member 1 1.8100000 SLC16A5 solute carrier family 16 9121 NM_001271765 Hs.592095 ENSG00000170190 (monocarboxylate transporter), member 5 1.8800000 SLC19A1 solute carrier family 19 6573 NM_001205206 Hs.84190 ENSG00000173638 (folate transporter), member 1 1.3400000 SLC25A5 solute carrier family 25 292 NM_001152 Hs.632282 ENSG00000005022 (mitochondrial carrier; adenine nucleotide translocator), member 5 2.1000000 SLC25A1 solute carrier family 25 6576 NM_001256534 Hs.111024 ENSG00000100075 (mitochondrial carrier; citrate transporter), member 1 −2.3809524 SLC25A15 solute carrier family 25 10166 NM_014252 Hs.646645 ENSG00000102743 (mitochondrial carrier; ornithine transporter) member 15 1.8400000 SLC25A11 solute carrier family 25 8402 NM_001165417 Hs.184877 ENSG00000108528 (mitochondrial carrier; oxoglutarate carrier), member 11 1.6100000 SLC25A3 solute carrier family 25 5250 NM_002635 Hs.290404 ENSG00000075415 (mitochondrial carrier; phosphate carrier), member 3 −1.5873016 SLC25A32 solute carrier family 25 81034 NM_030780 Hs.532265 ENSG00000164933 (mitochondrial folate carrier), member 32 1.6500000 SLC25A38 solute carrier family 25, 54977 NM_017875 Hs.369615 ENSG00000144659 member 38 1.4800000 SLC27A1 solute carrier family 27 (fatty 376497 NM_198580 Hs.363138 ENSG00000130304 acid transporter), member 1 −2.8571429 SLC28A2 solute carrier family 28 9153 NM_004212 Hs.367833 ENSG00000137860 (concentrative nucleoside transporter), member 2 −1.7857143 SLC31A1 solute carrier family 31 1317 NM_001859 Hs.532315 ENSG00000136868 (copper transporter), member 1 1.6600000 SLC35A1 solute carrier family 35 10559 NM_001168398 Hs.423163 ENSG00000164414 (CMP-sialic acid transporter), member A1 1.6700000 SLC35A5 solute carrier family 35, 55032 NM_017945 Hs.237480 ENSG00000138459 member A5 −2.1739130 SLC36A2 solute carrier family 36 153201 NM_181776 Hs.483877 ENSG00000186335 (proton/amino acid symporter), member 2 −2.0000000 SLC38A1 solute carrier family 38, 81539 NM_001077484 Hs.533770 ENSG00000111371 member 1 1.5500000 SLC39A3 solute carrier family 39 (zinc 29985 NM_144564 Hs.515046 ENSG00000141873 transporter), member 3 −1.7857143 SLC4A8 solute carrier family 4, 9498 NM_001039960 Hs.4749 ENSG00000050438 sodium bicarbonate cotransporter, member 8 2.1500000 SLC40A1 solute carrier family 40 (iron- 30061 NM_014585 Hs.643005 ENSG00000138449 regulated transporter), member 1 −1.7857143 SLC41A2 solute carrier family 41 84102 NM_032148 Hs.577463 ENSG00000136052 (magnesium transporter), member 2 1.7100000 SLC41A3 solute carrier family 41, 54946 NM_001008485 Hs.573007 ENSG00000114544 member 3 −2.2727273 SLC44A4 solute carrier family 44, 80736 NM_001178044 Hs.335355 ENSG00000204385 member 4 −2.3809524 SLC5A5 solute carrier family 5 6528 NM_000453 Hs.584804 ENSG00000105641 (sodium/iodide cotransporter), member 5 −2.0408163 SLC7A5P2 solute carrier family 7 (amino 387254 NR_002594 Hs.448808 acid transporter light chain, L system), member 5 pseudogene 2 −2.1276596 LOC284379 solute carrier family 7 284379 NR_002938 Hs.631571 ENSG00000268864 (cationic amino acid transporter, y+ system), member 3 pseudogene −1.7241379 SLC7A14 solute carrier family 7, 57709 NM_020949 Hs.596660 ENSG00000013293 member 14 −2.6315789 SLC9A4 solute carrier family 9, 389015 NM_001011552 Hs.447686 ENSG00000180251 subfamily A (NHE4, cation proton antiporter 4), member 4 −1.4925373 SLC9A7 solute carrier family 9, 84679 NM_001257291 Hs.91389 ENSG00000065923 subfamily A (NHE7, cation proton antiporter 7), member 7 1.9100000 SORBS3 sorbin and SH3 domain 10174 NM_001018003 Hs.528572 ENSG00000120896 containing 3 1.4800000 SNX12 sorting nexin 12 29934 NM_001256185 Hs.260750 ENSG00000147164 1.6700000 SNX17 sorting nexin 17 9784 NM_001267059 Hs.278569 ENSG00000115234 −2.3255814 SOX9-AS1 SOX9 antisense RNA 1 400618 NR_103737 Hs.657374 ENSG00000234899 1.5900000 SPG21 spastic paraplegia 21 (autosomal 51324 NM_001127889 Hs.242458 ENSG00000090487 recessive, Mast syndrome) −1.3888889 SPAST spastin 6683 NM_014946 Hs.468091 ENSG00000021574 −3.2258065 SPC25 SPC25, NDC80 kinetochore 57405 NM_020675 Hs.421956 ENSG00000152253 complex component −1.6666667 SPDYE5 speedy/RINGO cell cycle 442590 NM_001099435 Hs.632298 ENSG00000170092 regulator family member E5 −1.9230769 SPATS2 spermatogenesis associated, 65244 NM_001293285 Hs.654826 ENSG00000123352 serine-rich 2 −2.3809524 SKA1 spindle and kinetochore 220134 NM_001039535 Hs.134726 ENSG00000154839 associated complex subunit 1 1.5200000 SF3A2 splicing factor 3a, subunit 2, 8175 NM_007165 Hs.115232 ENSG00000104897 66 kDa −2.0833333 SREK1 splicing regulatory 140890 NM_001077199 Hs.49367 ENSG00000153914 glutamine/lysine-rich protein 1 −1.8867925 SPRED1 sprouty-related, EVH1 161742 NM_152594 Hs.525781 ENSG00000166068 domain containing 1 −1.9607843 SRRM2-AS1 SRRM2 antisense RNA 1 100128788 NR_027274 Hs.311208 ENSG00000205913 −2.3255814 STAU2-AS1 STAU2 antisense RNA 1 100128126 NR_038406 Hs.679921 ENSG00000253302 −1.9230769 STEAP2 STEAP family member 2, 261729 NM_001040665 Hs.489051 ENSG00000157214 metalloreductase −3.1250000 SCD5 stearoyl-CoA desaturase 5 79966 NM_001037582 Hs.379191 ENSG00000145284 −1.8867925 STAR steroidogenic acute regulatory 6770 NM_000349 Hs.521535 ENSG00000147465 protein −2.0000000 STRIP2 striatin interacting protein 2 57464 NM_001134336 Hs.489988 ENSG00000128578 1.9000000 SDHAF1 succinate dehydrogenase 644096 NM_001042631 Hs.356460 ENSG00000205138 complex assembly factor 1 1.5200000 SDHB succinate dehydrogenase 6390 NM_003000 Hs.465924 ENSG00000117118 complex, subunit B, iron sulfur (Ip) −2.2727273 SUMO1P3 SUMO1 pseudogene 3 474338 NR_002190 Hs.621179 (functional) 1.5200000 SUV420H2 suppressor of variegation 4- 84787 NM_032701 Hs.590982 ENSG00000133247 20 homolog 2 (Drosophila) −1.9230769 SFTPB surfactant protein B 6439 NM_000542 Hs.512690 ENSG00000168878 −1.4285714 SUGP2 SURP and G patch domain 10147 NM_001017392 Hs.515271 ENSG00000064607 containing 2 −1.7857143 SWSAP1 SWIM-type zinc finger 7 126074 NM_175871 Hs.631619 ENSG00000173928 associated protein 1 1.7300000 SYTL1 synaptotagmin-like 1 84958 NM_001193308 Hs.469175 ENSG00000142765 −1.4492754 SS18 synovial sarcoma 6760 NM_001007559 Hs.129261 ENSG00000141380 translocation, chromosome 18 −2.0000000 TAF8 TAF8 RNA polymerase II, 129685 NM_138572 Hs.520122 ENSG00000137413 TATA box binding protein (TBP)-associated factor, 43 kDa −1.7543860 TBC1D24 TBC1 domain family, member 24 57465 NM_001199107 Hs.353087 ENSG00000162065 −2.0833333 TBCCD1 TBCC domain containing 1 55171 NM_001134415 Hs.518469 ENSG00000113838 1.8600000 TGDS TDP-glucose 4,6-dehydratase 23483 NM_001304430 Hs.12393 ENSG00000088451 −2.5641026 TEX101 testis expressed 101 83639 NM_001130011 Hs.97978 ENSG00000131126 −1.3698630 TTC21B tetratricopeptide repeat 79809 NM_024753 Hs.310672 ENSG00000123607 domain 21B 1.7100000 THAP11 THAP domain containing 11 57215 NM_020457 Hs.632200 ENSG00000168286 −1.8181818 THEM4 thioesterase superfamily 117145 NM_053055 Hs.164070 ENSG00000159445 member 4 1.6900000 TREX1 three prime repair 11277 NM_007248 Hs.707026 ENSG00000213689 exonuclease 1 1.3800000 TBXAS1 thromboxane A synthase 1 6916 NM_001061 Hs.520757 ENSG00000059377 (platelet) −2.1276596 TIGD1 tigger transposable element 200765 NM_145702 Hs.211823 ENSG00000221944 derived 1 −2.6315789 TLCD2 TLC domain containing 2 727910 NM_001164407 Hs.531005 ENSG00000185561 −2.1739130 TLR8-AS1 TLR8 antisense RNA 1 349408 NR_030727 Hs.685035 ENSG00000233338 −1.6949153 THRIL TNF and HNRNPL related 102659353 NR_110375 Hs.596464 immunoregulatory long non- coding RNA −1.6129032 TRAF3IP1 TNF receptor-associated 26146 NM_001139490 Hs.631898 ENSG00000204104 factor 3 interacting protein 1 −2.1739130 TNFAIP8L2- TNFAIP8L2-SCNM1 100534012 NM_001204848 Hs.732060 ENSG00000163156 SCNM1 readthrough 1.4400000 TOLLIP toll interacting protein 54472 NM_019009 Hs.368527 ENSG00000078902 −1.6949153 TLR10 toll-like receptor 10 81793 NM_001017388 Hs.120551 ENSG00000174123 1.3900000 TOR1A torsin family 1, member A 1861 NM_000113 Hs.534312 ENSG00000136827 (torsin A) 2.0000000 TOR2A torsin family 2, member A 27433 NM_001085347 Hs.444106 ENSG00000160404 −1.4925373 TLK2 tousled-like kinase 2 11011 NM_001112707 Hs.445078 ENSG00000146872 −2.3809524 TRAF3IP2 TRAF3 interacting protein 2 10758 NM_001164281 Hs.561514 ENSG00000056972 −1.8181818 TRAF3IP2-AS1 TRAF3IP2 antisense RNA 1 643749 NR_034108 Hs.486228 ENSG00000231889 1.6800000 TECR trans-2,3-enoyl-CoA 9524 NM_004868 Hs.515642 ENSG00000099797 reductase −1.4492754 TCERG1 transcription elongation 10915 NM_001040006 Hs.443465 ENSG00000113649 regulator 1 −1.8518519 TVP23A trans-golgi network vesicle 780776 NM_001079512 Hs.371576 ENSG00000166676 protein 23 homolog A (S. cerevisiae) −1.9230769 TVP23C trans-golgi network vesicle 201158 NM_001135036 Hs.164595 ENSG00000175106 protein 23 homolog C (S. cerevisiae) −1.8518519 TRPM6 transient receptor potential 140803 NM_001177310 Hs.272225 ENSG00000119121 cation channel, subfamily M, member 6 −2.3255814 TRPV1 transient receptor potential 7442 NM_018727 Hs.579217 ENSG00000196689 cation channel, subfamily V, member 1 −1.4084507 TIMM10B translocase of inner 26515 NM_012192 Hs.54943 ENSG00000132286 mitochondrial membrane 10 homolog B (yeast) 2.2500000 TSPO translocator protein (18 kDa) 706 NM_000714 Hs.202 ENSG00000100300 −2.1276596 TMIGD2 transmembrane and 126259 NM_001169126 Hs.263928 ENSG00000167664 immunoglobulin domain containing 2 1.3600000 TMBIM6 transmembrane BAX 7009 NM_001098576 Hs.743965 ENSG00000139644 inhibitor motif containing 6 −1.8181818 TPTE2P1 transmembrane 646405 NM_001126062 Hs.620592 phosphoinositide 3- phosphatase and tensin homolog 2 pseudogene 1 1.8200000 TMEM120A transmembrane protein 120A 83862 NM_031925 Hs.488835 ENSG00000189077 −1.9230769 TMEM120B transmembrane protein 120B 144404 NM_001080825 Hs.644504 ENSG00000188735 2.3900000 TMEM141 transmembrane protein 141 85014 NM_032928 Hs.356744 ENSG00000244187 1.9500000 TMEM14C transmembrane protein 14C 51522 NM_001165258 Hs.519557 ENSG00000111843 1.7600000 TMEM150A transmembrane protein 150A 129303 NM_001031738 Hs.591559 ENSG00000168890 2.3300000 TMEM160 transmembrane protein 160 54958 NM_017854 Hs.105606 ENSG00000130748 1.5400000 TMEM165 transmembrane protein 165 55858 NM_018475 Hs.479766 ENSG00000134851 1.6300000 TMEM179B transmembrane protein 179B 374395 NM_199337 Hs.381134 ENSG00000185475 −1.5625000 TMEM181 transmembrane protein 181 57583 NM_020823 Hs.99145 ENSG00000146433 −3.0303030 TMEM212 transmembrane protein 212 389177 NM_001164436 Hs.642307 ENSG00000186329 1.3600000 TMEM214 transmembrane protein 214 54867 NM_001083590 Hs.533934 ENSG00000119777 1.6000000 TMEM230 transmembrane protein 230 29058 NM_001009923 Hs.472024 ENSG00000089063 2.5700000 TMEM256 transmembrane protein 256 254863 NM_152766 Hs.730789 ENSG00000205544 −1.5625000 TMEM38A transmembrane protein 38A 79041 NM_024074 Hs.436068 ENSG00000072954 −1.9607843 TMEM41B transmembrane protein 41B 440026 NM_001165030 Hs.594563 ENSG00000166471 1.5000000 TMEM43 transmembrane protein 43 79188 NM_024334 Hs.517817 ENSG00000170876 −1.2987013 TRIM38 tripartite motif containing 38 10475 NM_006355 Hs.584851 ENSG00000112343 −2.3255814 TRIM45 tripartite motif containing 45 80263 NM_001145635 Hs.301526 ENSG00000134253 −1.9607843 TPM3P9 tropomyosin 3 pseudogene 9 147804 NM_001010856 Hs.433293 ENSG00000241015 −2.3255814 TSIX TSIX transcript, XIST 9383 NR_003255 Hs.529901 ENSG00000270641 antisense RNA −1.4084507 TSPYL1 TSPY-like 1 7259 NM_003309 Hs.458358 ENSG00000189241 1.7700000 TTLL12 tubulin tyrosine ligase-like 23170 NM_015140 Hs.517670 ENSG00000100304 family member 12 −2.4390244 TUBA3FP tubulin, alpha 3f, pseudogene 113691 NR_003608 Hs.585006 ENSG00000161149 1.5800000 TUBB tubulin, beta class I 203068 NM_001293212 Hs.636480 ENSG00000196230 −1.7241379 TUFT1 tuftelin 1 7286 NM_001126337 Hs.489922 ENSG00000143367 −2.3255814 TP53AIP1 tumor protein p53 regulated 63970 NM_001195194 Hs.160953 ENSG00000120471 apoptosis inducing protein 1 2.0000000 TPRG1L tumor protein p63 regulated 127262 NM_182752 Hs.20529 ENSG00000158109 1-like −2.0000000 TSG1 tumor suppressor TSG1 643432 NR_015362 Hs.509936 1.8000000 TWF2 twinfilin actin-binding protein 2 11344 NM_007284 Hs.436439 ENSG00000247596 −1.8518519 TAT tyrosine aminotransferase 6898 NM_000353 Hs.161640 ENSG00000198650 1.8200000 UQCR10 ubiquinol-cytochrome c 29796 NM_001003684 Hs.284292 ENSG00000184076 reductase, complex III subunit X 1.4300000 UBE3C ubiquitin protein ligase E3C 9690 NM_014671 Hs.118351 ENSG00000009335 1.4500000 USP21 ubiquitin specific peptidase 21 27005 NM_001014443 Hs.8015 ENSG00000143258 −1.4492754 USP42 ubiquitin specific peptidase 42 84132 NM_032172 Hs.31856 ENSG00000106346 −1.6393443 USP49 ubiquitin specific peptidase 49 25862 NM_001286554 Hs.593575 ENSG00000164663 1.7300000 UBE2D1 ubiquitin-conjugating enzyme E2D 1 7321 NM_001204880 Hs.129683 ENSG00000072401 −2.2222222 UBE2Q2P1 ubiquitin-conjugating enzyme E2Q 388165 NM_207382 Hs.498348 ENSG00000189136 family member 2 pseudogene 1 1.4900000 UBL5 ubiquitin-like 5 59286 NM_001048241 Hs.534477 ENSG00000198258 −2.1739130 UCKL1-AS1 UCKL1 antisense RNA 1 100113386 NR_027287 Hs.551552 1.6700000 B3GALT6 UDP-Gal:betaGal beta 1,3- 126792 NM_080605 Hs.284284 ENSG00000176022 galactosyltransferase polypeptide 6 −2.9411765 B3GNT6 UDP-GlcNAc:betaGal beta- 192134 NM_138706 Hs.352622 ENSG00000198488 1,3-N- acetylglucosaminyltransferase 6 −3.7037037 UGDH-AS1 UGDH antisense RNA 1 100885776 NR_047679 Hs.640769 ENSG00000249348 1.5300000 ULK3 unc-51 like kinase 3 25989 NM_001099436 Hs.513034 ENSG00000140474 −2.0833333 LOC100128233 uncharacterized LOC100128233 100128233 NR_103769 Hs.497323 ENSG00000255002 −2.6315789 LOC100128288 uncharacterized LOC100128288 100128288 NR_024447 Hs.549913 −2.0408163 LOC100128398 uncharacterized LOC100128398 100128398 NR_036508 Hs.655081 ENSG00000176593 −2.1276596 LOC100129940 uncharacterized LOC100129940 100129940 NM_001292023 Hs.685856 ENSG00000197301 −2.6315789 LOC100130451 uncharacterized LOC100130451 100130451 NM_001242575 −2.1739130 LOC100131564 uncharacterized LOC100131564 100131564 NR_034089 Hs.732666 ENSG00000223745 −3.0303030 LOC100131626 uncharacterized LOC100131626 100131626 NR_046369 Hs.721614 −2.4390244 LOC100132077 uncharacterized LOC100132077 100132077 NR_033937 Hs.679111 ENSG00000232063 −2.1276596 LOC100190986 uncharacterized LOC100190986 100190986 NR_024456 Hs.648439 −2.3809524 LOC100287225 uncharacterized LOC100287225 100287225 NR_040074 Hs.448920 ENSG00000227115 −2.0833333 LOC100379224 uncharacterized LOC100379224 100379224 NR_033341 Hs.585869 ENSG00000186019 2.2200000 LOC100505622 uncharacterized LOC100505622 100505622 NR_038332 Hs.661761 ENSG00000254887 −3.2258065 LOC100505817 uncharacterized LOC100505817 100505817 NR_038340 Hs.197042 ENSG00000261780 −2.0833333 LOC100506083 uncharacterized LOC100506083 100506083 NR_039997 Hs.635008 ENSG00000261777 −2.2222222 LOC100506085 uncharacterized LOC100506085 100506085 NR_037878 Hs.649173 ENSG00000248319 −2.0408163 LOC100506123 uncharacterized LOC100506123 100506123 NR_040097 Hs.720604 ENSG00000230606 −1.7857143 LOC100506472 uncharacterized LOC100506472 100506472 NR_040535 Hs.729080 −2.0408163 LOC100506688 uncharacterized LOC100506688 100506688 NM_001242737 Hs.532063 ENSG00000215246 −1.9230769 LOC100506746 uncharacterized LOC100506746 100506746 NR_038841 Hs.657766 ENSG00000163633 −2.3809524 LOC100996251 uncharacterized LOC100996251 100996251 NR_103777 Hs.382067 ENSG00000238198 −2.3809524 LOC100996351 uncharacterized LOC100996351 100996351 NR_110670 ENSG00000267551 −3.0303030 LOC101926889 uncharacterized LOC101926889 101926889 NR_109994 Hs.585997 −2.2727273 LOC101926928 uncharacterized LOC101926928 101926928 NR_110106 Hs.638788 ENSG00000258551 −1.7543860 LOC101926960 uncharacterized LOC101926960 101926960 NR_104635 Hs.365692 −2.0833333 LOC101927131 uncharacterized LOC101927131 101927131 NR_110907 Hs.569654 ENSG00000262999 −1.9230769 LOC101927181 uncharacterized LOC101927181 101927181 NR_108066 Hs.288853 ENSG00000175873 −2.0833333 LOC101927257 uncharacterized LOC101927257 101927257 NR_109965 Hs.662725 ENSG00000232564 −2.3255814 LOC101927274 uncharacterized LOC101927274 101927274 NR_110751 Hs.591168 ENSG00000249383 −3.4482759 LOC101927374 uncharacterized LOC101927374 101927374 NR_110133 Hs.570644 −2.3809524 LOC101927476 uncharacterized LOC101927476 101927476 NR_110386 Hs.522607 ENSG00000236393 −1.3888889 LOC101927550 uncharacterized LOC101927550 101927550 NR_110102 Hs.636663 ENSG00000242687 −3.2258065 LOC101927575 uncharacterized LOC101927575 101927575 NR_110995 Hs.459826 ENSG00000227463 −1.7241379 LOC101927666 uncharacterized LOC101927666 101927666 NR_110809 Hs.552237 ENSG00000266290 −2.2222222 LOC101927740 uncharacterized LOC101927740 101927740 NR_109890 Hs.738721 ENSG00000245812 −2.5641026 LOC101927797 uncharacterized LOC101927797 101927797 NR_109925 Hs.551743 ENSG00000224141 −2.3255814 LOC101927817 uncharacterized LOC101927817 101927817 NR_110931 Hs.667942 −2.7027027 LOC101927884 uncharacterized LOC101927884 101927884 NR_110281 Hs.671110 ENSG00000231172 −2.2727273 LOC101928103 uncharacterized LOC101928103 101928103 NR_110292 Hs.665619 ENSG00000229267 −3.2258065 LOC101928137 uncharacterized LOC101928137 101928137 NR_110130 Hs.694666 ENSG00000258123 −2.4390244 LOC101928254 uncharacterized LOC101928254 101928254 NR_110182 Hs.571236 ENSG00000219445 −2.4390244 LOC101928303 uncharacterized LOC101928303 101928303 NR_110698 Hs.375067 ENSG00000236155 −2.2727273 LOC101928567 uncharacterized LOC101928567 101928567 NR_110839 Hs.569757 ENSG00000237057 −2.0000000 LOC101928597 uncharacterized LOC101928597 101928597 NR_110091 Hs.638942 ENSG00000246394 −2.3809524 LOC101928674 uncharacterized LOC101928674 101928674 NR_110845 Hs.637297 ENSG00000266970 −2.9411765 LOC101928844 uncharacterized LOC101928844 101928844 NR_110740 Hs.434577 ENSG00000267709 −3.0303030 LOC101928936 uncharacterized LOC101928936 101928936 NR_110867 Hs.533080 −1.8518519 LOC101929144 uncharacterized LOC101929144 101929144 NR_110745 Hs.531631 ENSG00000261615 −2.5641026 LOC101929224 uncharacterized LOC101929224 101929224 NR_110787 Hs.639369 ENSG00000260088 −2.3809524 LOC101929259 uncharacterized LOC101929259 101929259 NR_120424 Hs.638490 −2.5000000 LOC101929486 uncharacterized LOC101929486 101929486 NR_109868 Hs.548761 ENSG00000233048 −2.7027027 LOC101929567 uncharacterized LOC101929567 101929567 NR_110257 Hs.634706 ENSG00000236008 −2.3255814 LOC101929586 uncharacterized LOC101929586 101929586 NR_120363 Hs.569426 ENSG00000259175 −3.0303030 LOC101929698 uncharacterized LOC101929698 101929698 NR_110619 Hs.638392 ENSG00000277301 −1.9607843 LOC101929767 uncharacterized LOC101929767 101929767 NR_110868 Hs.640892 ENSG00000267002 −3.0303030 LOC102467081 uncharacterized LOC102467081 102467081 NR_104662 ENSG00000240535 −2.7027027 LOC102723769 uncharacterized LOC102723769 102723769 NR_110761 Hs.652926 −2.3255814 LOC102724927 uncharacterized LOC102724927 102724927 NR_120311 Hs.364739 ENSG00000262185 −2.0000000 LOC151475 uncharacterized LOC151475 151475 NR_040038 Hs.528154 ENSG00000226125 −2.1276596 MGC32805 uncharacterized LOC153163 153163 NR_051996 Hs.679757 ENSG00000250328 −2.1739130 LOC284023 uncharacterized LOC284023 284023 NR_024349 Hs.744470 ENSG00000179859 −2.1276596 LOC284581 uncharacterized LOC284581 284581 NR_046097 −2.2222222 LOC284865 uncharacterized LOC284865 284865 NR_038460 Hs.638498 ENSG00000249923 −2.2222222 LOC284950 uncharacterized LOC284950 284950 NR_038888 Hs.570227 ENSG00000229498 −2.7777778 LOC286437 uncharacterized LOC286437 286437 NR_039980 Hs.656786 −2.1276596 LOC339166 uncharacterized LOC339166 339166 NR_040000 Hs.736088 ENSG00000179314 −2.0000000 LOC339803 uncharacterized LOC339803 339803 NR_036496 Hs.252433 ENSG00000212978 −2.0408163 LOC389641 uncharacterized LOC389641 389641 NR_033928 Hs.591835 ENSG00000246582 −2.3809524 FLJ42102 uncharacterized LOC399923 399923 NM_001001680 Hs.128191 ENSG00000172900 −2.2222222 LOC400958 uncharacterized LOC400958 400958 NR_036586 Hs.591565 ENSG00000237638 −2.3809524 LOC401052 uncharacterized LOC401052 401052 NM_001008737 Hs.662766 −1.4705882 LOC401320 uncharacterized LOC401320 401320 NR_038889 Hs.561708 −2.4390244 FLJ31662 uncharacterized LOC440594 440594 NR_033966 Hs.514123 ENSG00000233907 −2.3809524 FLJ31104 uncharacterized LOC441072 441072 NR_102755 Hs.482141 ENSG00000227908 −2.9411765 LOC643406 uncharacterized LOC643406 643406 NM_175877 Hs.431161 ENSG00000230563 −3.0303030 LOC644919 uncharacterized LOC644919 644919 NR_109757 Hs.434414 −4.3478261 LOC728752 uncharacterized LOC728752 728752 NR_036504 Hs.729762 ENSG00000267309 −2.0408163 LOC729732 uncharacterized LOC729732 729732 NR_047662 Hs.322761 −2.1276596 LOC731424 uncharacterized LOC731424 731424 NR_037867 Hs.427740 −1.4084507 DKFZP586I1420 uncharacterized protein 222161 NR_002186 Hs.112423 ENSG00000235859 DKFZp586I1420 −2.4390244 FLJ31356 uncharacterized protein 403150 NR_103831 Hs.562970 ENSG00000229951 FLJ31356 −1.8518519 UPK3B uroplakin 3B 80761 NM_030570 Hs.488861 ENSG00000243566 −2.2727273 UTS2B urotensin 2B 257313 NM_198152 Hs.518492 ENSG00000188958 1.6700000 VPS28 vacuolar protein sorting 28 51160 NM_016208 Hs.418175 ENSG00000160948 homolog (S. cerevisiae) 1.8000000 VPS51 vacuolar protein sorting 51 738 NM_013265 Hs.277517 ENSG00000149823 homolog (S. cerevisiae) 1.7100000 VIPR1 vasoactive intestinal peptide 7433 NM_001251882 Hs.348500 ENSG00000114812 receptor 1 −1.4705882 CRK v-crk avian sarcoma virus 1398 NM_005206 Hs.461896 ENSG00000167193 CT 10 oncogene homolog 1.4500000 CRKL v-crk avian sarcoma virus 1399 NM_005207 Hs.5613 ENSG00000099942 CT 10 oncogene homolog-like 1.8000000 MYCL v-myc avian myclocytomatosis 4610 NM_001033081 Hs.437922 ENSG00000116990 viral oncogene lung carcinoma derived homolog −2.5641026 VN1R2 vomeronasal 1 receptor 2 317701 NM_173856 Hs.553684 ENSG00000196131 1.7500000 VBP1 von Hippel-Lindau binding 7411 NM_001303543 Hs.436803 ENSG00000155959 protein 1 −2.7777778 VSIG1 V-set and immunoglobulin 340547 NM_001170553 Hs.177164 ENSG00000101842 domain containing 1 −2.5000000 WFDC8 WAP four-disulfide core 90199 NM_130896 Hs.116128 ENSG00000158901 domain 8 −1.5151515 WHAMM WAS protein homolog 123720 NM_001080435 Hs.377360 ENSG00000156232 associated with actin, golgi membranes and microtubules 1.8600000 WDTC1 WD and tetratricopeptide 23038 NM_001276252 Hs.469154 ENSG00000142784 repeats 1 −1.7241379 WDR55 WD repeat domain 55 54853 NM_017706 Hs.286261 ENSG00000120314 2.3100000 WDR83OS WD repeat domain 83 51398 NM_016145 Hs.108969 ENSG00000105583 opposite strand −1.6949153 WDR92 WD repeat domain 92 116143 NM_001256476 Hs.631877 ENSG00000243667 1.9000000 WBP1 WW domain binding protein 1 23559 NM_012477 Hs.516114 ENSG00000239779 −3.4482759 XKR9 XK, Kell blood group 389668 NM_001011720 Hs.458938 ENSG00000221947 complex subunit-related family, member 9 −1.7241379 XIAP X-linked inhibitor of 331 NM_001167 Hs.356076 ENSG00000101966 apoptosis, E3 ubiquitin protein ligase −1.8518519 XRCC2 X-ray repair complementing 7516 NM_005431 Hs.647093 ENSG00000196584 defective repair in Chinese hamster cells 2 −1.9230769 YES1 YES proto-oncogene 1, Src 7525 NM_005433 Hs.194148 ENSG00000176105 family tyrosine kinase 1.3300000 YIPF1 Yip1 domain family, member 1 54432 NM_018982 Hs.11923 ENSG00000058799 1.7800000 YIPF4 Yip1 domain family, member 4 84272 NM_032312 Hs.468099 ENSG00000119820 −1.4492754 YAF2 YY1 associated factor 2 10138 NM_001012424 Hs.649195 ENSG00000015153 1.3900000 YY1 YY1 transcription factor 7528 NM_003403 Hs.388927 ENSG00000100811 −1.7241379 ZFP14 ZFP14 zinc finger protein 57677 NM_001297619 Hs.35524 ENSG00000142065 −2.0000000 ZFP30 ZFP30 zinc finger protein 22835 NM_014898 Hs.716719 ENSG00000120784 −2.4390244 ZFP91-CNTF ZFP91-CNTF readthrough 386607 NM_170768 Hs.524920 ENSG00000255073 (NMD candidate) 1.8900000 ZBTB45 zinc finger and BTB domain 84878 NM_032792 Hs.515662 ENSG00000119574 containing 45 −1.8181818 ZSCAN12 zinc finger and SCAN 9753 NM_001039643 Hs.134816 ENSG00000158691 domain containing 12 −1.6949153 ZSCAN2 zinc finger and SCAN 54993 NM_001007072 Hs.594023 ENSG00000176371 domain containing 2 −2.3255814 ZSCAN22 zinc finger and SCAN 342945 NM_181846 Hs.388162 ENSG00000182318 domain containing 22 −2.1739130 ZC3H12D zinc finger CCCH-type 340152 NM_207360 Hs.632618 ENSG00000178199 containing 12D −1.5151515 ZNF117 zinc finger protein 117 51351 NM_015852 Hs.250693 ENSG00000152926 −1.7857143 ZNF264 zinc finger protein 264 9422 NM_003417 Hs.515634 ENSG00000083844 −1.7543860 ZNF286A zinc finger protein 286A 57335 NM_001130842 Hs.585799 ENSG00000187607 −1.8181818 ZNF286B zinc finger protein 286B 729288 NM_001145045 Hs.534279 ENSG00000249459 −1.8518519 ZNF326 zinc finger protein 326 284695 NM_181781 Hs.306221 ENSG00000162664 −2.0833333 ZNF329 zinc finger protein 329 79673 NM_024620 Hs.458377 ENSG00000181894 −1.5384615 ZNF417 zinc finger protein 417 147687 NM_001297734 Hs.567710 ENSG00000173480 1.8500000 ZNF428 zinc finger protein 428 126299 NM_182498 Hs.99093 ENSG00000131116 −1.4084507 ZNF44 zinc finger protein 44 51710 NM_001164276 Hs.296731 ENSG00000197857 −2.8571429 ZNF471 zinc finger protein 471 57573 NM_020813 Hs.710590 ENSG00000196263 −2.5641026 ZNF483 zinc finger protein 483 158399 NM_001007169 Hs.660784 ENSG00000173258 −2.0000000 ZNF490 zinc finger protein 490 57474 NM_020714 Hs.655860 ENSG00000188033 −1.9607843 ZNF527 zinc finger protein 527 84503 NM_032453 Hs.590940 ENSG00000189164 −2.0833333 ZNF528 zinc finger protein 528 84436 NM_032423 Hs.662043 ENSG00000167555 −1.8867925 ZNF548 zinc finger protein 548 147694 NM_001172773 Hs.126905 ENSG00000188785 −2.0000000 ZNF554 zinc finger protein 554 115196 NM_001102651 Hs.307043 ENSG00000172006 −1.7857143 ZNF562 zinc finger protein 562 54811 NM_001130031 Hs.371107 ENSG00000171466 −2.1276596 ZNF585B zinc finger protein 585B 92285 NM_152279 Hs.390568 ENSG00000245680 −1.4084507 ZNF587 zinc finger protein 587 84914 NM_001204817 Hs.642598 ENSG00000198466 −1.5151515 ZNF621 zinc finger protein 621 285268 NM_001098414 Hs.19977 ENSG00000172888 −1.2820513 ZNF655 zinc finger protein 655 79027 NM_001009956 Hs.599798 ENSG00000197343 −2.7777778 LOC100131257 zinc finger protein 655 100131257 NR_034022 Hs.551110 pseudogene −1.8867925 ZNF662 zinc finger protein 662 389114 NM_001134656 Hs.720173 ENSG00000182983 −2.2222222 ZNF665 zinc finger protein 665 79788 NM_024733 Hs.745230 ENSG00000197497 −2.0833333 ZNF677 zinc finger protein 677 342926 NM_182609 Hs.20506 ENSG00000197928 −2.0000000 ZNF713 zinc finger protein 713 349075 NM_182633 Hs.660834 ENSG00000178665 −1.5384615 ZNF714 zinc finger protein 714 148206 NM_182515 Hs.729186 ENSG00000160352 −1.7857143 ZNF737 zinc finger protein 737 100129842 NM_001159293 Hs.515696 ENSG00000237440 −2.4390244 ZNF761 zinc finger protein 761 388561 NM_001008401 Hs.433293 ENSG00000160336 −2.2222222 ZNF793 zinc finger protein 793 390927 NM_001013659 Hs.568010 ENSG00000188227 −2.0000000 ZNF814 zinc finger protein 814 730051 NM_001144989 Hs.634143 ENSG00000204514 −1.9607843 ZNF818P zinc finger protein 818, 390963 NM_001001675 Hs.444446 ENSG00000269001 pseudogene −2.0408163 ZNF850 zinc finger protein 850 342892 NM_001193552 Hs.406307 ENSG00000267041 −2.7777778 ZKSCAN3 zinc finger with KRAB and 80317 NM_001242894 Hs.380930 ENSG00000189298 SCAN domains 3 −1.8518519 ZCCHC4 zinc finger, CCHC domain 29063 NM_024936 Hs.278945 ENSG00000168228 containing 4 1.5800000 ZFYVE21 zinc finger, FYVE domain 79038 NM_001198953 Hs.592322 ENSG00000100711 containing 21 1.8100000 ZNHIT1 zinc finger, HIT-type 10467 NM_006349 Hs.211079 ENSG00000106400 containing 1 −1.5625000 ZMAT1 zinc finger, matrin-type 1 84460 NM_001011657 Hs.496512 ENSG00000166432 −1.4705882 ZSWIM7 zinc finger, SWIM-type 125150 NM_001042697 Hs.593985 ENSG00000214941 containing 7 2.1700000 ZMYM6NB ZMYM6 neighbor 100506144 NM_001195156 Hs.533986 ENSG00000243749 −2.3255814 ZNRF3-AS1 ZNRF3 antisense RNA 1 100874123 NR_046851 Hs.674708 ENSG00000177993 −1.9230769 ZYG11A zyg-11 family member A, cell 440590 NM_001004339 Hs.658458 ENSG00000203995 cycle regulator −3.2258065 LOC101928243 Non-annotated gene 101928243 −3.1250000 OLMALINC Oligodendrocyte Maturation- 90271 NR_026762 ENSG00000235823 Associated Long Intergenic Non-Coding RNA −2.9411765 LOC100506385 long intergenic non-protein NR_038885/ ENSG00000234380 coding RNA 1426 NR_038886 −2.6315789 LOC400644 long intergenic non-protein NR_104164 ENSG00000266554 coding RNA 1443 −2.4390244 HECTD2-AS1 HECTD2 antisense RNA 1 100188947 NR_024467 −2.3809524 LINC01530 long intergenic non-protein 729975 NR_034159 coding RNA 1530 −2.3255814 TCAF2 TRPM8 Channel Associated 285966 ENSG00000170379 Factor 2 −2.3255814 LOC100130954 long intergenic non-protein NR_034016/ coding RNA 1502 NR_034017/ NR_109814 −2.3255814 RRP7B Ribosomal RNA Processing 7 91695 NR_002184 ENSG00000182841 Homolog B, Pseudogene −2.2222222 P3H4 Prolyl 3-Hydroxylase Family 10609 NM_006455 ENSG00000141696 Member 4 −2.1276596 L3MBTL4-AS1 L3MBTL4 antisense RNA 1 10192715 ENSG00000264707 −2.0408163 SIRPG-AS1 SIRPG antisense RNA 1 10192901 NR_110090 ENSG00000237914 −1.9607843 RUNDC3A-AS1 RUNDC3A antisense RNA 1 101926996 NR_110802 ENSG00000267750 −1.8518519 SLC25A25-AS1 SLC25A25 antisense RNA 1 NR_033374 −1.7543860 LINC01521 long intergenic non-protein 54944 NR_120386 ENSG00000213888 coding RNA 1521 −1.6949153 LOC100506747 alpha-1,3-mannosyl- 100506747 NR_036557 ENSG00000234761 glycoprotein 4-beta-N- acetylglucosaminyltransferase- like protein LOC641515 −1.3698630 RBSN Rabenosyn, RAB Effector 64145 ENSG00000131381 2.1700000 CPTP ceramide-1-phosphate 80772 NM_001029885 ENSG00000224051 transfer protein
TABLE-US-00009 TABLE 7B Molecular Mechanisms and Pathways Associated with Monocyte Subtype Genes UniqueID Associated Pathways/Mechanism ABCA9 ABC transporters ABCC9 ABC transporters RIPK1 Acetylation and Deacetylation of RelA in The Nucleus, Ceramide Signaling Pathway, HIV- I Nef: negative effector of Fas and TNF, Induction of apoptosis through DR3 and DR4/5 Death Receptors, Keratinocyte Differentiation, MAPKinase Signaling Pathway, NF-kB Signaling Pathway, p38 MAPK Signaling Pathway, SODD/TNFR1 Signaling Pathway, TNF/Stress Related Signaling, TNFR1 Signaling Pathway, TNFR2 Signaling Pathway, Apoptosis, Cytosolic DNA-sensing pathway, Hepatitis C, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway RAC2 Adherens junction, Axon guidance, B cell receptor signaling pathway, Chemokine signaling pathway, Colorectal cancer, Fc epsilon RI signaling pathway, Fc gamma R- mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Pancreatic cancer, Pathways in cancer, Regulation of actin cytoskeleton, VEGF signaling pathway, Viral myocarditis, Wnt signaling pathway YES1 Adherens junction, Tight junction GPLD1 ADP-Ribosylation Factor, Glycosylphosphatidylinositol(GPI)-anchor biosynthesis APOL1 African trypanosomiasis IDO1 African trypanosomiasis, Metabolic pathways, Tryptophan metabolism GLUD1 Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, D- Glutamine and D-glutamate metabolism, Metabolic pathways, Nitrogen metabolism, Proximal tubule bicarbonate reclamation ADSL Alanine, aspartate and glutamate metabolism, Metabolic pathways, Purine metabolism CAD Alanine, aspartate and glutamate metabolism, Metabolic pathways, Pyrimidine metabolism BMP7 ALK in cardiac myocytes, Cytokine-cytokine receptor interaction, Hedgehog signaling pathway, TGF-beta signaling pathway PLA2G4E alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fat digestion and absorption, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Pancreatic secretion, Toxoplasmosis, Vascular smooth muscle contraction, VEGF signaling pathway CYCS Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Huntington's disease, p53 signaling pathway, Parkinson's disease, Pathways in cancer, Small cell lung cancer, Toxoplasmosis, Viral myocarditis COX6B2 Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease COX8A Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease CYC1 Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease UQCR10 Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease ATP5B Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease ATP5D Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease ATP5G2 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFA7 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFB6 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFB7 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFB8 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFC1 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFS7 Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease NDUFB11 Alzheimer's disease, Huntington's disease, Oxidative phosphorylation, Parkinson's disease GMPPA Amino sugar and nucleotide sugar metabolism, Fructose and mannose metabolism, Metabolic pathways GNE Amino sugar and nucleotide sugar metabolism, Metabolic pathways AARS2 Aminoacyl-tRNA biosynthesis MTFMT Aminoacyl-tRNA biosynthesis, One carbon pool by folate RAB5C Amoebiasis, Endocytosis, Phagosome, Vasopressin-regulated water reabsorption MAP2K2 Angiotensin II mediated activation of JNK Pathway via Pyk2 dependent signaling, Anthrax Toxin Mechanism of Action, Bioactive Peptide Induced Signaling Pathway, Erk1/Erk2 Mapk Signaling pathway, fMLP induced chemokine gene expression in HMC-1 cells, Human Cytomegalovirus and Map Kinase Pathways, Integrin Signaling Pathway, Links between Pyk2 and Map Kinases, MAPKinase Signaling Pathway, Phosphorylation of MEK1 by cdk5/p35 down regulates the MAP kinase pathway, Role of b-arrestins in the activation and targeting of MAP kinases, Role of MAL in Rho-Mediated Activation of SRF, Roles of b-arrestin-dependent Recruitment of Src Kinases in GPCR Signaling, Signaling of Hepatocyte Growth Factor Receptor, Acute myeloid leukemia, B cell receptor signaling pathway, Bladder cancer, Chronic myeloid leukemia, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, . . . LGMN Antigen processing and presentation, Lysosome PSMB5 Antigen Processing and Presentation, Proteasome DFFA Apoptotic DNA fragmentation and tissue homeostasis, Caspase Cascade in Apoptosis, FAS signaling pathway (CD95), Granzyme A mediated Apoptosis Pathway, HIV-I Nef: negative effector of Fas and TNF, Induction of apoptosis through DR3 and DR4/5 Death Receptors, Role of Mitochondria in Apoptotic Signaling, TNFR1 Signaling Pathway, Apoptosis ALDH2 Arginine and proline metabolism, Ascorbate and aldarate metabolism, beta-Alanine metabolism, Fatty acid degradation, Glycerolipid metabolism, Glycolysis/ Gluconeogenesis, Histidine metabolism, Lysine degradation, Metabolic pathways, Pentose and glucuronate interconversions, Propanoate metabolism, Pyruvate metabolism, Tryptophan metabolism, Valine, leucine and isoleucine degradation DSG2 Arrhythmogenic right ventricular cardiomyopathy (ARVC) TBXAS1 Aspirin Blocks Signaling Pathway Involved in Platelet Activation, Eicosanoid Metabolism, Arachidonic acid metabolism, Metabolic pathways RGS3 Axon guidance SEMA4A Axon guidance SEMA4B Axon guidance XIAP B Cell Survival Pathway, Caspase Cascade in Apoptosis, HIV-I Nef: negative effector of Fas and TNF, Induction of apoptosis through DR3 and DR4/5 Death Receptors, Role of Mitochondria in Apoptotic Signaling, Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Toxoplasmosis, Ubiquitin mediated proteolysis RHOG Bacterial invasion of epithelial cells, Shigellosis GTF2H4 Basal transcription factors, Nucleotide excision repair POLD4 Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism POLE3 Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism PPP3CB BCR Signaling Pathway, Control of skeletal myogenesis by HDAC & calcium/calmodulin- dependent kinase (CaMK), Effects of calcineurin in Keratinocyte Differentiation, Endocytotic role of NDK, Phosphins and Dynamin, Fc Epsilon Receptor I Signaling in Mast Cells, fMLP induced chemokine gene expression in HMC-1 cells, Neuropeptides VIP and PACAP inhibit the apoptosis of activated T cells, NFAT and Hypertrophy of the heart (Transcription in the broken heart), Nitric Oxide Signaling Pathway, Regulation of PGC-1a, Role of MEF2D in T-cell Apoptosis, Signaling Pathway from G-Protein Families, T Cell Receptor Signaling Pathway, Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Axon guidance, B cell receptor signaling pathway, Calcium signaling pathway, Long-term potentiation, MAPK signaling pathway, Natural killer cell mediated cytotoxicity, Oocyte meiosis, Osteoclast differentiation, T cell receptor signaling pathway, VEGF signaling pathway, Wnt signaling pathway TECR Biosynthesis of unsaturated fatty acids SCD5 Biosynthesis of unsaturated fatty acids, PPAR signaling pathway L2HGDH Butanoate metabolism MYLK3 Calcium signaling pathway, Focal adhesion, Gastric acid secretion, Regulation of actin cytoskeleton, Vascular smooth muscle contraction CHRM3 Calcium signaling pathway, Gastric acid secretion, Neuroactive ligand-receptor interaction, Pancreatic secretion, Regulation of actin cytoskeleton, Salivary secretion SLC25A5 Calcium signaling pathway, Huntington's disease, Parkinson's disease ADRA1A Calcium signaling pathway, Neuroactive ligand-receptor interaction, Salivary secretion, Vascular smooth muscle contraction PHB2 CARM1 and Regulation of the Estrogen Receptor ORC4 CDK Regulation of DNA Replication, Cell cycle CLDN15 Cell adhesion molecules (CAMs), Hepatitis C, Leukocyte transendothelial migration, Tight junction CLDN19 Cell adhesion molecules (CAMs), Hepatitis C, Leukocyte transendothelial migration, Tight junction PPP2CB Chagas disease (American trypanosomiasis), Hepatitis C, Long-term depression, mRNA surveillance pathway, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway GNB2 Chemokine signaling pathway GNG4 Chemokine signaling pathway CCR6 Chemokine signaling pathway, Cytokine-cytokine receptor interaction GAB2 Chronic myeloid leukemia, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Osteoclast differentiation PER2 Circadian rhythm ACO2 Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways MDH2 Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Pyruvate metabolism CRK CXCR4 Signaling Pathway, Signaling of Hepatocyte Growth Factor Receptor, Bacterial invasion of epithelial cells, Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Shigellosis SHMT2 Cyanoamino acid metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, One carbon pool by folate TAT Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine metabolism, Phenylalanine, tyrosine and tryptophan biosynthesis, Tyrosine metabolism, Ubiquinone and other terpenoid-quinone biosynthesis CRLF2 Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway IFNLR1 Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway OSMR Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway PYCARD Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway GREB1 Downregulated of MTA-3 in ER-negative Breast Tumors GSTM3 Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 MGST1 Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450 CDA Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism CSNK2A1 EGF Signaling Pathway, EPO Signaling Pathway, IGF-1 Signaling Pathway, IL 2 signaling pathway, IL 6 signaling pathway, Insulin Signaling Pathway, Lissencephaly gene (LIS1) in neuronal migration and development, Nerve growth factor pathway (NGF), PDGF Signaling Pathway, TPO Signaling Pathway, WNT Signaling Pathway, Adherens junction, Ribosome biogenesis in eukaryotes, Tight junction, Wnt signaling pathway SDHB Electron Transport Reaction in Mitochondria, Alzheimer's disease, Citrate cycle (TCA cycle), Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease CHMP1B Endocytosis CHMP3 Endocytosis PDCD6IP Endocytosis RAB11FIP4 Endocytosis VPS28 Endocytosis AP2B1 Endocytosis, Huntington's disease FGFR2 Endocytosis, MAPK signaling pathway, Pathways in cancer, Prostate cancer, Regulation of actin cytoskeleton PARD6G Endocytosis, Tight junction STAT5B EPO Signaling Pathway, Growth Hormone Signaling Pathway, IL 2 signaling pathway, IL 3 signaling pathway, IL-2 Receptor Beta Chain in T cell Activation, IL22 Soluble Receptor Signaling Pathway, IL-7 Signal Transduction, Inhibition of Cellular Proliferation by Gleevec, Mechanism of Gene Regulation by Peroxisome Proliferators via PPARa(alpha), TPO Signaling Pathway, Acute myeloid leukemia, Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Jak-STAT signaling pathway, Pathways in cancer GSN Erk and PI-3 Kinase Are Necessary for Collagen Binding in Corneal Epithelia, HIV-I Nef: negative effector of Fas and TNF, Rho cell motility signaling pathway, Fc gamma R- mediated phagocytosis, Regulation of actin cytoskeleton EIF5 Eukaryotic protein translation, Regulation of eIF2, RNA transport CFLAR FAS signaling pathway (CD95), HIV-I Nef: negative effector of Fas and TNF, IL-2 Receptor Beta Chain in T cell Activation, Induction of apoptosis through DR3 and DR4/5 Death Receptors, Apoptosis, Chagas disease (American trypanosomiasis) OLAH Fatty acid biosynthesis, Metabolic pathways ACADSB Fatty acid degradation, Metabolic pathways, Valine, leucine and isoleucine degradation AKR1B1 Fructose and mannose metabolism, Galactose metabolism, Glycerolipid metabolism, Metabolic pathways, Pentose and glucuronate interconversions, Pyruvate metabolism TUBB Gap junction, Pathogenic Escherichia coli infection, Phagosome SLC9A4 Gastric acid secretion GPX4 Glutathione metabolism LYPLA2 Glycerophospholipid metabolism CDIPT Glycerophospholipid metabolism, Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system PISD Glycerophospholipid metabolism, Metabolic pathways B3GALT6 Glycosaminoglycan biosynthesis - chondroitin sulfate/dermatan sulfate, Glycosaminoglycan biosynthesis - heparan sulfate/heparin, Metabolic pathways CHST6 Glycosaminoglycan biosynthesis - keratan sulfate FUT1 Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways FUT2 Glycosphingolipid biosynthesis - globo series, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways NAGA Glycosphingolipid biosynthesis - globo series, Lysosome PIGY Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways CD24 Hematopoietic cell lineage METTL2B Histidine metabolism, Tyrosine metabolism MUS81 Homologous recombination XRCC2 Homologous recombination DNAL1 Huntington's disease POLR2D Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase DCTN2 Huntington's disease, Vasopressin-regulated water reabsorption NQO1 Hypoxia and p53 in the Cardiovascular system IKZF3 IL-2 Receptor Beta Chain in T cell Activation CRKL IL-2 Receptor Beta Chain in T cell Activation, Inhibition of Cellular Proliferation by Gleevec, Integrin Signaling Pathway, Links between Pyk2 and Map Kinases, Signaling of Hepatocyte Growth Factor Receptor, Bacterial invasion of epithelial cells, Chemokine signaling pathway, Chronic myeloid leukemia, ErbB signaling pathway, Fc gamma R- mediated phagocytosis, Focal adhesion, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, Shigellosis INPP5E Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system ALDH6A1 Inositol phosphate metabolism, Metabolic pathways, Propanoate metabolism, Valine, leucine and isoleucine degradation GYS1 Insulin signaling pathway, Starch and sucrose metabolism SPRED1 Jak-STAT signaling pathway MAPK13 Keratinocyte Differentiation, MAPKinase Signaling Pathway, Stathmin and breast cancer resistance to antimicrotubule agents, Amyotrophic lateral sclerosis (ALS), Chagas disease (American trypanosomiasis), Epithelial cell signaling in Helicobacter pylori infection, Fc epsilon RI signaling pathway, GnRH signaling pathway, Hepatitis C, Leishmaniasis, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Osteoclast differentiation, Progesterone- mediated oocyte maturation, RIG-I-like receptor signaling pathway, Shigellosis, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Toxoplasmosis, VEGF signaling pathway GALK1 Leloir pathway of galactose metabolism, Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways AASS Lysine biosynthesis, Lysine degradation, Metabolic pathways SETMAR Lysine degradation SUV420H2 Lysine degradation AP1M1 Lysosome AP1S3 Lysosome AP4S1 Lysosome CD164 Lysosome ENTPD4 Lysosome, Purine metabolism, Pyrimidine metabolism ACP2 Lysosome, Riboflavin metabolism SLC25A11 Malate-aspartate shuttle, Shuttle for transfer of acetyl groups from mitochondria to the cytosol MDH1 Malate-aspartate shuttle, Shuttle for transfer of acetyl groups from mitochondria to the cytosol, Citrate cycle (TCA cycle), Glyoxylate and dicarboxylate metabolism, Metabolic pathways, Proximal tubule bicarbonate reclamation, Pyruvate metabolism DUSP7 MAPK signaling pathway FGF5 MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton MAP2K5 MAPKinase Signaling Pathway, Gap junction, MAPK signaling pathway, Neurotrophin signaling pathway RPS6KA4 MAPKinase Signaling Pathway, MAPK signaling pathway, Neurotrophin signaling pathway MAP3K9 MAPKinase Signaling Pathway, p38 MAPK Signaling Pathway IAPP Maturity onset diabetes of the young APOA2 Mechanism of Gene Regulation by Peroxisome Proliferators via PPARa(alpha), PPAR signaling pathway TGDS Metabolic pathways B3GNT6 Metabolic pathways, Mucin type O-Glycan biosynthesis NMNAT1 Metabolic pathways, Nicotinate and nicotinamide metabolism PGLS Metabolic pathways, Pentose phosphate pathway H6PD Metabolic pathways, Pentose phosphate pathway CYP51A1 Metabolic pathways, Steroid biosynthesis EBP Metabolic pathways, Steroid biosynthesis COMT Metabolic pathways, Steroid hormone biosynthesis, Tyrosine metabolism CSAD Metabolic pathways, Taurine and hypotaurine metabolism BCKDHA Metabolic pathways, Valine, leucine and isoleucine degradation PNN mRNA surveillance pathway, RNA transport ULK3 mTOR signaling pathway, Regulation of autophagy GSTP1 Multi-Drug Resistance Factors, Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450, Pathways in cancer, Prostate cancer HCST Natural killer cell mediated cytotoxicity TRPV1 Neuroactive ligand-receptor interaction TSPO Neuroactive ligand-receptor interaction VIPR1 Neuroactive ligand-receptor interaction UBE2D1 Neuroregulin receptor degradation protein-1 Controls ErbB3 receptor recycling, Protein processing in endoplasmic reticulum, Ubiquitin mediated proteolysis CA5B Nitrogen metabolism MFNG Notch signaling pathway, Other types of O-glycan biosynthesis DDB1 Nucleotide excision repair, Ubiquitin mediated proteolysis OR11A1 Olfactory transduction SGOL1 Oocyte meiosis LILRA2 Osteoclast differentiation SQSTM1 Osteoclast differentiation MDM4 p53 signaling pathway TP53AIP1 p53 signaling pathway PARK7 Parkinson's disease PARK2 Parkinson's disease, Protein processing in endoplasmic reticulum, Ubiquitin mediated proteolysis ECH1 Peroxisome MPV17L Peroxisome PXMP4 Peroxisome CORO1A Phagosome DBI PPAR signaling pathway SLC27A1 PPAR signaling pathway PSMD14 Proteasome SLC15A1 Protein digestion and absorption SPCS1 Protein export SRP9 Protein export SSR2 Protein processing in endoplasmic reticulum PDE4C Purine metabolism KLRD1 Ras-Independent pathway in NK cell-mediated cytotoxicity, Antigen processing and presentation, Graft-versus-host disease, Natural killer cell mediated cytotoxicity OPHN1 Rho cell motility signaling pathway RPL18A Ribosome RPL28 Ribosome RPL41 Ribosome RPS12 Ribosome RPLP1 Ribosome POP7 Ribosome biogenesis in eukaryotes, RNA transport DIS3 RNA degradation AAAS RNA transport GEMIN8 RNA transport NUP133 RNA transport PHAX RNA transport RAD1 Role of BRCA1, BRCA2 and ATR in Cancer Susceptibility TREX1 Role of BRCA1, BRCA2 and ATR in Cancer Susceptibility, Cytosolic DNA-sensing pathway DIABLO Role of Mitochondria in Apoptotic Signaling CHRNB1 Role of nicotinic acetylcholine receptors in the regulation of apoptosis, Neuroactive ligand- receptor interaction INMT Selenocompound metabolism, Tryptophan metabolism SLC25A1 Shuttle for transfer of acetyl groups from mitochondria to the cytosol GOSR1 SNARE interactions in vesicular transport DYRK1B Sonic Hedgehog (Shh) Pathway CTNNBL1 Spliceosome CCDC12 Spliceosome HNRNPA1L2 Spliceosome PRPF3 Spliceosome PRPF38B Spliceosome PRPF8 Spliceosome RBM25 Spliceosome SRSF10 Spliceosome SRSF4 Spliceosome SF3A2 Spliceosome TCERG1 Spliceosome FUT6 Steps in the Glycosylation of Mammalian N-linked Oligosaccarides, Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways MOCS3 Sulfur relay system H2AFJ Systemic lupus erythematosus H2AFX Systemic lupus erythematosus HIST1H2AC Systemic lupus erythematosus HIST1H3H Systemic lupus erythematosus CAT The IGF-1 Receptor and Longevity, Amyotrophic lateral sclerosis (ALS), Metabolic pathways, Peroxisome, Tryptophan metabolism YY1 The PRC2 Complex Sets Long-term Gene Silencing Through Modification of Histone Tails TOLLIP Toll-like receptor signaling pathway UBE3C Ubiquitin mediated proteolysis KDELR1 Vibrio cholerae infection KDELR2 Vibrio cholerae infection CXADR Viral myocarditis PDE6A Visual Signal Transduction, Phototransduction, Purine metabolism SLC19A1 Vitamin digestion and absorption
TABLE-US-00010 TABLE 8 Anti-TL1A and Anti-DR3 Antibodiy Sequences SEQ ID NO Identifier Amino Acid Sequence 209 HCDR1 GFTFSTYG 210 HCDR2 ISGTGRTT 211 HCDR3 TKERGDYYYG VFDY 212 LCDR1 QTISSW 213 LCDR2 AAS 214 LCDR3 QQYHRSWT 215 HC EVQLLESGGG LVQPGKSLRL SCAVSGFTFS TYGMNWVRQA Variable PGKGLEWVSS ISGTGRTTYH ADSVQGRFTV SRDNSKNILY LQMNSLRADD TAVYFCTKER GDYYYGVFDY WGQGTLVTVS S 216 LC DIQMTQSPST LSASVGDRVT ITCRASQTIS SWLAWYQQTP Variable EKAPKLLIYA ASNLQSGVPS RFSGSGSGTE FTLTISSLQP DDFATYYCQQ YHRSWTFGQG TKVEIT 217 HCDR1 GFTFSSYW 218 HCDR2 IKEDGSEK 219 HCDR3 AREDYDSYYK YGMDV 220 LCDR1 QSILYSSNNK NY 221 LCDR2 WAS 222 LCDR3 QQYYSTPFT 223 HC EVQLVESGGG LVQPGGSLRL SCAVSGFTFS SYWMSWVRQA Variable PGKGLEWVAN IKEDGSEKNY VDSVKGRFTL SSDNAKNSLY LQMNSLRAED TAVYYCARED YDSYYKYGMD VWGQGTAVIV SS 224 LC DIVMTQSPDS LAVSLGERAT INCKSSQSIL YSSNNKNYLA Variable WYQQKPGQPP KLLIYWASTR ESGVPDRFSG SGSGTDFTLT ISSLQAEDVS VYYCQQYYST PFTFGPGTKV DIK 225 HCDR1 GGSFTGFY 226 HCDR2 INHRGNT 227 HCDR3 ASPFYDFWSG SDY 228 LCDR1 QSLVHSDGNT Y 229 LCDR2 KIS 230 LCDR3 MQATQFPLT 231 HC QVQLQQWGAG LLKPSETLSL TCAVYGGSFT GFYWSWIRQP Variable PGKGLEWIGE INHRGNTNYN PSLKSRVTMS VDTSKNQFSL NMISVTAADT AMYFCASPFY DFWSGSDYWG QGTLVTVSS 232 LC DIMLTQTPLT SPVTLGQPAS ISCKSSQSLV HSDGNTYLSW Variable LQQRPGQPPR LLFYKISNRF SGVPDRFSGS GAGTDFTLKI SRVEAEDVGV YYCMQATQFP LTFGGGTKVE IK 233 HCDR1 GY(X1)F(X2)(X3)YGIS; X1 = P, S, D, Q, N; X2 = T, R; X3 = N, T, Y, H 234 HCDR2 WIS(X1)YNG(X2)(X3)(X4)YA(X5)(X6)(X7)QG; X1 = T, P, S, A; X2 = N, G, V, K, A; X3 = T, K; X4 = H, N; X5 = Q, R; X6 = K, M; X7 = L, H 235 HCDR3 ENYYGSG(X1)(X2)R GGMD(X3); X1 = S, A; X2 = Y, P; X3 = V, A, G 236 HCDR1 GYDFTYYGIS 237 HCDR2 WISTYNGNTH YARMLQG 238 HCDR3 ENYYGSGAYR GGMDV 239 LCDR1 RASQSVSSYL A 240 LCDR2 DASNRAT 241 LCDR3 QQRSNWPWT 242 HC QVQLVQSGAE VKKPGASVKV SCKASGYDFT YYGISWVRQA Variable PGQGLEWMGW ISTYNGNTHY ARMLQGRVTM TTDTSTRTAY MELRSLRSDD TAVYYCAREN YYGSGAYRGG MDVWGQGTTV TVSS 243 LC EIVLTQSPAT LSLSPGERAT LSCRASQSVS SYLAWYQQKP Variable GQAPRLLIYD ASNRATGIPA RFSGSGSGTD FTLTISSLEP EDFAVYYCQQ RSNWPWTFGQ GTKVEIK 244 HC QVQLVQSGAE VKKPGASVKV SCKASGYDFT YYGISWVRQA PGQGLEWMGW ISTYNGNTHY ARMLQGRVTM TTDTSTRTAY MELRSLRSDD TAVYYCAREN YYGSGAYRGG MDVWGQGTTV TVSSASTKGP SVFPLAPSSK STSGGTAALG CLVKDYFPEP VTVSWNSGAL TSGVHTFPAV LQSSGLYSLS SVVTVPSSSL GTQTYICNVN HKPSNTKVDK KVEPKSCDKT HTCPPCPAPE AAGAPSVFLF PPKPKDTLMI SRTPEVTCVV VDVSHEDPEV KFNWYVDGVE VHNAKTKPRE EQYNSTYRVV SVLTVLHQDW LNGKEYKCKV SNKALPAPIE KTISKAKGQP REPQVYTLPP SREEMTKNQV SLTCLVKGFY PSDIAVEWES NGQPENNYKT TPPVLDSDGS FFLYSKLTVD KSRWQQGNVF SCSVMHEALH NHYTQKSLSL SPG 245 LC EIVLTQSPAT LSLSPGERAT LSCRASQSVS SYLAWYQQKP GQAPRLLIYD ASNRATGIPA RFSGSGSGTD FTLTISSLEP EDFAVYYCQQ RSNWPWTFGQ GTKVEIKRTV AAPSVFIFPP SDEQLKSGTA SVVCLLNNFY PREAKVQWKV DNALQSGNSQ ESVTEQDSKD STYSLSSTLT LSKADYEKHK VYACEVTHQG LSSPVTKSFN RGEC 246 HCDR1 SRSYYWG 247 HCDR2 SIYYNGRTYY NPSLKS 248 HCDR3 EDYGDYGAFD I 249 LCDR1 RASQGISSAL A 250 LCDR2 DASSLES 251 LCDR3 QQFNSYPLT 252 HC QLQLQESGPG LVKPSETLSL TCTVSGGSIS SRSYYWGWIR Variable QPPGKGLEWI GSIYYNGRTY YNPSLKSRVT ISVDTSKNQF SLKLSSVTAA DTAVYYCARE DYGDYGAFDI WGQGTMVTVS S 253 LC AIQLTQSPSS LSASVGDRVT ITCRASQGIS SALAWYQQKP Variable GKAPKLLIYD ASSLESGVPS RFSGSGSGTD FTLTISSLQP EDFATYYCQQ FNSYPLTFGG GTKVEIK 254 HCDR1 TSNMGVV 255 HCDR2 HILWDDREY SNPALKS 256 HCDR3 MSRNYYGSSYVMDY 257 LCDR1 SASSSVNYMH 258 LCDR2 STSNLAS 259 LCDR3 HQWNNYGT 260 HC QVTLKESGPALVKPTQTLTLTCTFSGFSLSTSNMGVVWIRQPPGKALEW Variable LAHILWDD REYSNPALKSRLTISKDTSKNQVVLTMTNMDPVDTATYYCARMSRNY YGSSYVMD YWGQGTLVTVSS 261 LC DIQLTQSPSFLSASVGDRVTITCSASSSVNYMHWYQQKPGKAPKLLIYS Variable TSNLASGVP SRFSGSGSGTEFTLTISSLQPEDFATYYCHQWNNYGTFGQGTKVEIKR 262 HCDR1 LYGMN 263 HCDR1 NYGMN 264 HCDR2 WINTYTGEPTYADDFKG 265 HCDR3 DTAMDYAMAY 266 HCDR3 DYGKYGDYYAMDY 267 LCDR1 KSSQNIVHSDGNTYLE 268 LCDR1 RSSQSIVHSNGNTYLD 269 LCDR2 KVSNRFS 270 LCDR3 FQGSHVPLT 271 HC QVQLVQSGSELKKPGASVKVSCKASGYTFTLYGMNWVRQAPGQGLE Variable WMG WINTYTGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR DTAMDYAMAYWGQGTLVTVSS 272 HC QVQLVQSGSELKKPGASVKVSCKASGYTFTLYGMNWVKQAPGKGLK Variable WMG WINTYTGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYFCAR DTAMDYAMAYWGQGTLVTVSS 273 HC QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGQGLE Variable WMG WINTYTGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCAR DYGKYGDYYAMDYWGQGTLVTVSS 274 HC QVQLVQSGSELKKPGASVKVSCKASGYTFTNYGMNWVRQAPGKGLK Variable WMG WINTYTGEPTYADDFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYFCAR DYGKYGDYYAMDYWGQGTLVTVSS 275 LC DVVMTQSPLSLPVTLGQPASISCKSSQNIVHSDGNTYLEWFQQRPGQSP Variable RRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSH VPLTFGGGTKVEIKR 276 LC DVVMTQSPLSLPVTLGQPASISCKSSQNIVHSDGNTYLEWFQQRPGQSP Variable RRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSH VPLTFGQGTKVEIKR 277 LC DVVMTQTPLSLPVTPGEPASISCKSSQNIVHSDGNTYLEWYLQKPGQSP Variable QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSH VPLTFGGGTKVEIKR 278 LC DVVMTQTPLSLPVSLGDQASISCKSSQNIVHSDGNTYLEWYLQKPGQSP Variable KVLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSH VPLTFGGGTKVEIKR 279 LC DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLDWFQQRPGQSP Variable RRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSH VPLTFGGGTKVEIKR 280 LC DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLDWFQQRPGQSP Variable RRLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSH VPLTFGQGTKVEIKR 281 LC DVVMTQTPLSLPVTPGEPASISCRSSQSIVHSNGNTYLDWYLQKPGQSP Variable QLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSH VPLTFGGGTKVEIKR 282 LC DVVMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLDWYLQKPGQSP Variable KVLIYKVSNRFSGVPDRFSGSGSGTDFTLKINRVEAEDLGVYFCFQGSH VPLTFGGGTKLEIKR 283 HCDR1 GYTFTSSWMH 284 HCDR2 IHPNSGGT 285 HCDR3 ARGDYYGYVS WFAY 286 LCDR1 QNINVL 287 LCDR2 KAS 288 LCDR3 QQGQSYPYT 289 HC QVQLQQPGSV LVRPGASVKV SCKASGYTFT SSWMHWAKQR Variable PGQGLEWIGE IHPNSGGTNY NEKFKGKATV DTSSSTAYVD LSSLTSEDSA VYYCARGDYY GYVSWFAYWG QGTLVTVSS 290 HC QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSWMHWARQA Variable PGQGLEWIGE IHPNSGGTNY AQKFQGRATL TVDTSSSTAY MELSRLRSDD TAVYYCARGD YYGYVSWFAY WGQGTLVTVS S 291 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SSWMHWARQA Variable PGQGLEWIGE IHPNSGGTNY AQKFQGRATM TVDTSISTAY MELSRLRSDD TAVYYCARGD YYGYVSWFAY WGQGTLVTVS S 292 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SSWMHWARQA Variable PGQGLEWIGE IHPNSGGTNY AQKFQGRVTM TVDTSISTAY MELSRLRSDD TAVYYCARGD YYGYVSWFAY WGQGTLVTVS S 293 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SSWMHWARQA Variable PGQGLEWMGE IHPNSGGTNY AQKFQGRVTM TVDTSISTAY MELSRLRSDD TAVYYCARGD YYGYVSWFAY WGQGTLVTVS S 294 LC DIQMNQSPSS LSASLGDTIT ITCHASQNIN VLLSWYQQKP Variable GNIPKLLIYK ASNLHTGVPS RFSGSGSGTG FTFTISSLQP EDIATYYCQQ GQSYPYTFGG GTKLEIK 295 LC DIQMTQSPSS LSASVGDRVT ITCQASQDIS NYLNWYQQKP Variable GKAPKLLIYD ASNLETGVPS RFSGSGSGTD FTFTISSLQP EDIATYYCQQ YDNLPYTFGQ GTKLEIK 296 LC DIQMTQSPSS LSASVGDRVT ITCQASQNIN VLLNWYQQKP Variable GKAPKLLIYK ASNLHTGVPS RFSGSGSGTD FTFTISSLQP EDIATYYCQQ GQSYPYTFGQ GTKLEIK 297 LC DIQMNQSPSS LSASVGDRVT ITCQASQNIN VLLSWYQQKP Variable GKAPKLLIYK ASNLHTGVPS RFSGSGSGTD FTFTISSLQP EDIATYYCQQ GQSYPYTFGQ GTKLEIK 298 HCDR1 GYTFTSYDIN 299 HCDR2 WLNPNSGXTG; X = N, Y 300 HCDR3 EVPETAAFEY 301 LCDR1 TSSSSDIGA(X1)(X2)GV(X3); X1 = G, A; X2 = L, S, Q; X3 = H, L 302 LCDR2 GYYNRPS 303 LCDR3 QSXDGTLSAL; X = Y, W, F 304 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGNTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 305 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AXXGVXWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSXDGTLSAL FGGGTKLTVL G 306 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGNTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 307 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGLGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 308 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGYTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 309 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGLGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSYDGTLSAL FGGGTKLTVL G 310 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGNTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 311 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AALGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 312 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGNTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 313 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGSGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 314 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGNTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 315 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGQGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 316 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGNTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 317 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGLGVLWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 318 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGYTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 319 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGLGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 320 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGYTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 321 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGSGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 322 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGYTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 323 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGQGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 324 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGYTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 325 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGLGVLWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSWDGTLSAL FGGGTKLTVL G 326 HC QVQLVQSGAE VKKPGASVKV SCKASGYTFT SYDINWVRQA Variable PGQGLEWMGW LNPNSGYTGY AQKFQGRVTM TADRSTSTAY MELSSLRSED TAVYYCAREV PETAAFEYWG QGTLVTVSS 327 LC QSVLTQPPSV SGAPGQRVTI SCTSSSSDIG AGLGVHWYQQ Variable LPGTAPKLLI EGYYNRPSGV PDRFSGSKSG TSASLTITGL LPEDEGDYYC QSFDGTLSAL FGGGTKLTVL G 328 HCDR1 SYFWS 329 HCDR2 YIYYSGNTKYNPSLKS 330 HCDR3 ETGSYYGFDY 331 LCDR1 RASQSINNYLN 332 LCDR2 AASSLQS 333 LCDR3 QQSYSTPRT 334 HC QVQLQESGPGLVKPSETLSLTCTVSGGSISSYFWSWIRQPPGKGLEWIGY Variable IYYSGNTKYNPSLKSRVTISIDTSKNQFSLKLSSVTAADTAVYYCARETG SYYGFDYWGQGTLVTVSS 335 LC DIQMTQSPSSLSASVGDRVTITCRASQSINNYLNWYQQRPGKAPKLLIY Variable AASSLQSGVPSRFSGSGSGTDFTLTISSLQPGDFATYYCQQSYSTPRTFG QGTKLEIK 336 HCDR1 GYYWN 337 HCDR2 EINHAGNTNYNPSLKS 338 HCDR3 GYCRSTTCYFDY 339 LCDR1 RASQSVRSSYLA 340 LCDR2 GASSRAT 341 LCDR3 QQYGSSPT 342 HC QVQLQQWGAGLLKPSETLSLTCAVHGGSFSGYYWNWIRQPPGKGLEW Variable IGEINHAGNTNYNPSLKSRVTISLDTSKNQFSLTLTSVTAADTAVYYCAR GYCRSTTCYFDYWGQGTLVTVSS 343 LC EIVLTQSPGTLSLSPGERATLSCRASQSVRSSYLAWYQQKPGQAPRLLIY Variable GASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPTFGQ GTRLEIK 344 HC EVQLQQSGAELVKPGASVKLSCTASGFDIQDTYMHWVKQRPEQGLEWI Variable GRIDPASGHTKYDPKFQVKATITTDTSSNTAYLQLSSLTSEDTAVYYCS RSGGLPDVWGAGTTVTVSS 345 LC QIVLSQSPAILSASPGEKVTMTCRASSSVSYMYWYQQKPGSSPKPWIYA Variable TSNLASGVPDRFSGSGSGTSYSLTISRVEAEDAATYYCQQWSGNPRTFG GGTKLEIK 346 HCDR1 GFDIQDTYMH 347 HCDR2 RIDPASGHTKYDPKFQV 348 HCDR3 SGGLPDV 349 LCDR1 RASSSVSYMY 350 LCDR2 ATSNLAS 351 LCDR3 QQWSGNPRT 352 HC QVQLVQSGAEVKKPGASVKLSCKASGFDIQDTYMHWVRQAPGQGLE Variable WMGRIDPASGHTKYDPKFQVRVTMTTDTSTSTVYMELSSLRSEDTAVY YCSRSGGLPDVWGQGTTVTVSS 353 LC EIVLTQSPGTLSLSPGERVTMSCRASSSVSYMYWYQQKPGQAPRPWIYA Variable TSNLASGVPDRFSGSGSGTDYTLTISRLEPEDFAVYYCQQWSGNPRTFG GGTKLEIK 354 (CDR- QVQLVQSGAEVKKPGASVKLSCKASGFDIQDTYMHWVRQAPGQGLE grafted WMGRIDPASGHTKYDPKFQVRVTMTRDTSTSTVYMELSSLRSEDTAVY LC) HC YCSRSGGLPDVWGQGTTVTVSS variable region 355 (CDR- EIVLTQSPGTLSLSPGERATLSCRASSSVSYMYWYQQKPGQAPRLLIYA grafted TSNLASGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQWSGNPRTFGG LC) HC GTKLEIK variable region 356 (CDR- QVQLVQSGAEVKKPGASVKVSCKASGFDIQDTYMHWVRQAPGQGLE grafted WMGRIDPASGHTKYDPKFQVRVTMTRDTSTSTVYMELSSLRSEDTAVY HC) HC YCARSGGLPDVWGQGTTVTVSS variable region 357 (CDR- EIVLTQSPGTLSLSPGERATLSCRASSSVSYMYWYQQKPGQAPRLLIYA grafted TSNLASGVPDRFSGSGSGTDYTLTISRLEPEDFAVYYCQQWSGNPRTFG HC) LC GGTKLEIK variable region 358 HC EVMLVESGGGLVKPGGSLKLSCAASGFTFTNYAMSWVRQTPEKRLEW variable VATITSGGSYIYYLDSVKGRFTISRDNAKSTLYLQMSSLRSEDTAIYNCA RRKDGNYYYAMDYWGQGTSVTVSS 359 HC EVMLVESGGGLVKPGGSLKLSCAASGFTFTNYAMSWVRQTPEKRLEW variable VATITSGGSYIYYLDSVKGRFTISRDNAKSTLYLQMSSLRSEDTAIYYCA RRKDGNYYYAMDYWGQGTSVTVSS 360 HC EVQLVESGGGLVKPGGSLRLSCAASGFTFTNYAMSWVRQAPGQRLEW variable VSTITSGGSYIYYLDSVKGRFTISRDNAKSTLYLQMNSLRAEDTAVYNC ARRKDGNYYYAMDYWGQGTTVTVSS 361 HC EVQLVESGGGLVKPGGSLRLSCAASGFTFTNYAMSWVRQAPGQRLEW variable VSTITSGGSYIYYLDSVKGRFTISRDNAKSTLYLQMNSLRAEDTAVYYC ARRKDGNYYYAMDYWGQGTTVTVSS 362 HC EVQLLESGGGLVQPGRSLRLSCAASGFTFTNYAMSWVRQAPGQRLEW variable LATITSGGSYIYYLDSVKGRFTISRDNSKSTLYLQMGSLRAEDMAVYNC ARRKDGNYYYAMDYWGQGTTVTVSS 363 HC EVQLLESGGGLVQPGRSLRLSCAASGFTFTNYAMSWVRQAPGQRLEW variable LATITSGGSYIYYLDSVKGRFTISRDNSKSTLYLQMGSLRAEDMAVYYC ARRKDGNYYYAMDYWGQGTTVTVSS 364 HC QVQLVESGGGLIQPGGSLRLSCAASGFTFTNYAMSWVRQARGQRLEW variable VSTITSGGSYIYYLDSVKGRFTISRDNSKSTLYMELSSLRSEDTAVYNCA RRKDGNYYYAMDYWGQGTTVTVSS 365 HC QVQLVESGGGLIQPGGSLRLSCAASGFTFTNYAMSWVRQARGQRLEW variable VSTITSGGSYIYYLDSVKGRFTISRDNSKSTLYMELSSLRSEDTAVYYCA RRKDGNYYYAMDYWGQGTTVTVSS 366 HC QVQLVQSGSELKKPGASVKVSCKASGFTFTNYAMSWVRQAPGKRLEW variable VSTITSGGSYIYYLDSVKGRFTISRENAKSTLYLQMNSLRTEDTALYNCA RRKDGNYYYAMDYWGQGTTVTVSS 367 HC QVQLVQSGSELKKPGASVKVSCKASGFTFTNYAMSWVRQAPGKRLEW variable VATITSGGSYIYYLDSVKGRFTISRENAKSTLYLQMNSLRTEDTALYYC ARRKDGNYYYAMDYWGQGTTVTVSS 368 HC EVQLLQSGAEVKKPGASVKVSCKASGFTFTNYAMSWVRQAPGQRLEW variable VATITSGGSYIYYLDSVKGRFTISRDNAKSTLHLQMNSLRAEDTAVYNC ARRKDGNYYYAMDYWGQGTTVTVSS 369 HC EVQLLQSGAEVKKPGASVKVSCKASGFTFTNYAMSWVRQAPGQRLEW variable VATITSGGSYIYYLDSVKGRFTISRDNAKSTLHLQMNSLRAEDTAIYYC ARRKDGNYYYAMDYWGQGTTVTVSS 370 HC EVMLLQSGAEVKKPGASVKVSCKASGFTFTNYAMSWVRQAPGQRLE variable WVATITSGGSYIYYLDSVKGRFTISRDNAKSTLHLQMNSLRAEDTAVY YCARRKDGNYYYAMDYWGQGTTVTVSS 371 LC DIVLTQSPASLAVSLGQRATISCRASESVDSYGNSFIHWYQQKAGQPPK variable LLIYRASNLESGIPARFSGSGSRTDFTLTINPVEADDVATYYCQQSYEDP WTFGGGTKLEIK 372 LC DIVLTQSPATLSLSPGERATLSCRASESVDSYGNSFIHWYQQKPGQPPKL variable LIYRASNLESGIPARFSGSGSRTDFTLTISSLEPEDFAVYYCQQSYEDPWT FGGGTKXEIK 373 LC DIVLTQSPSSLSASVGDRVTITCRASESVDSYGNSFIHWYQQKPGQPPKL variable LIYRASNLESGIPARFSGSGSRTDFTLTISSLQPEDFATYYCQQSYEDPWT FGGGTKXEIK 374 LC DIVLTQSPDFQSVTPKEKVTITCRASESVDSYGNSFIHWYQQKPGQPPKL variable LIYRASNLESGIPARFSGSGSRTDFTLTISSLEAEDAATYYCQQSYEDPW TFGGGTKXEIK 375 LC DIVLTQTPLSLSVTPGQPASISCRASESVDSYGNSFIHWYQQKPGQPPKL variable LIYRASNLESGIPARFSGSGSRTDFTLKISRVEAEDVGVYYCQQSYEDPW TFGGGTKXEIK 376 HCDR1 TYGMS 377 HCDR2 WMNTYSGVTTYADDFKG 378 HCDR3 EGYVFDDYYATDY 379 LCDR1 RSSQNIVHSDGNTYLE 380 LCDR2 KVSNRFS 381 LCDR3 FQGSHVPLT 382 HC QIQLVQSGPELKKPGETVKISCKASGYTFTTYGMSWVKQAPGKGLKW Variable MGWMNTYSGVTTYADDFKGRFAFSLETSASTAYMQIDNLKNEDTATY FCAREGYVFDDYYATDYWGQGTSVTVSS 383 LC DVLMTQTPLSLPVSLGDQASISCRSSQNIVHSDGNTYLEWYLQKPGQSP Variable KLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHV PLTFGAGTKLELK 384 HCDR1 KYDIN 385 HCDR2 WIFPGDGRTDYNEKFKG 386 HCDR3 YGPAMDY 387 LCDR1 RSSQTIVHSNGDTYLD 388 LCDR2 KVSNRFS 389 LCDR3 FQGSHVPYT 390 HC MGWSWVFLFLLSVTAGVHSQVHLQQSGPELVKPGASVKLSCKASGYT Variable FTKYDINWVRQRPEQGLEWIGWIFPGDGRTDYNEKFKGKATLTTDKSS STAYMEVSRLTSEDSAVYFCARYGPAMDYWGQGTSVTVA S 391 LC MKLPVRLLVLMFWIPASSSDVLMTQTPLSLPVSLGDQASISCRSSQTIVH Variable SNGDTYLDWFLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKIS RVEAEDLGVYYCFQGSHVPYTFGGGTKLEIK