TICK CHEMOKINE BINDING PROTEINS FOR USE IN THERAPY AND DIAGNOSIS
20240034757 ยท 2024-02-01
Assignee
Inventors
Cpc classification
G01N33/6863
PHYSICS
International classification
Abstract
The described invention relates to tick chemokine binding polypeptides (tick CKBPs, typically tick Evasins) including hybrid CKBPs based on sequences from two or more tick CKBPs, and the uses of such polypeptides in inhibition of chemokines or detection of chemokine expression and inflammation.
Claims
1-43. (canceled)
44. A composition of matter which comprises: (i) a hybrid polypeptide comprising an amino acid sequence of a first tick CKBP polypeptide or a variant thereof and an amino acid sequence of a second tick CKBP polypeptide or a variant thereof, wherein said hybrid polypeptide has an altered chemokine binding profile compared to the first or second tick CKBP polypeptide; (ii) a polypeptide comprising (a) all or part of an amino acid sequence shown in any one of SEQ ID NOs 45-72 or (b) all or part of an amino acid sequence having at least 70% homology or identity to a sequence of (a) over its entire length, wherein said polypeptide binds at least one CXC chemokine; (iii) a polypeptide comprising (a) all or part of an amino acid sequence selected from SEQ ID NO: 88, 89 and 103 to 109 or (b) all or part of an amino acid sequence having at least 70% homology or identity to a sequence of (a) over its entire length, wherein said polypeptide binds at least one chemokine selected from CCL8, CCL7 and CCL18, preferably wherein said polypeptide binds all said chemokines, preferably wherein said polypeptide comprises all or part of an amino acid sequence shown in SEQ ID NO: 106; (iv) a combination of two or more polypeptides according to (i), (ii) or (iii); (v) a polynucleotide which encodes a polypeptide according to (i), (ii) or (iii) or a combination according to (iv); (vi) a combination of two or more polynucleotides each of which encodes a polypeptide according to (i), (ii) or (iii); (vii) a vector which comprises a polynucleotide according to (v) or a combination according to (vi); (viii) a host cell which comprises a polynucleotide according to (v), a combination of two or more polynucleotides according to (vi) or a vector according to (vii); (ix) a pharmaceutical composition comprising (a) a polypeptide according to (i), (ii) or (iii), a combination according to (iv) or (vi), a polynucleotide according to (v), a vector according to (vii) or a host cell according to (viii) and (b) a pharmaceutically acceptable carrier or diluent; or (x) an antibody or a fragment thereof which specifically binds a polypeptide according to (i), (ii) or (iii).
45. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), where said first and second tick CKBP polypeptides comprise a CC chemokine-binding tick CKBP and a CXC chemokine binding tick CKBP.
46. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein said hybrid polypeptide binds: (a) at least one CC chemokine and at least one CXC chemokine; (b) a reduced number of chemokines compared to said first and second tick CKBP polypeptides in combination; or (c) all of the chemokines bound by the first and second tick CKBP polypeptides in combination.
47. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein said hybrid polypeptide comprises: (a) a fusion of said amino acid sequence of a first tick CKBP polypeptide or variant thereof and said amino acid sequence of a second tick CKBP polypeptide or a variant thereof; or (b) a substitution of a chemokine-binding sequence of said second tick CKBP polypeptide or variant thereof into the amino acid sequence of said first tick CKBP polypeptide or variant thereof.
48. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein said hybrid polypeptide comprises an amino acid sequence of at least one additional tick CKBP polypeptide or a variant thereof.
49. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein: (a) a said variant amino acid sequence comprises a part of the amino acid sequence of said tick CKBP polypeptide or an amino acid sequence having at least 70% homology or identity over its entire length to the whole or part of the amino acid sequence of said tick CKBP polypeptide; and/or (b) said tick CKBP polypeptides are tick Evasin polypeptides.
50. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein said hybrid polypeptide comprises: (a) all or part of a first amino acid sequence selected from any one of SEQ ID NOs: 1 to 72 or all or part of an amino acid sequence having at least 70% homology or identity to said first amino acid sequence over its entire length; and (b) all or part of a second amino acid sequence shown in any one of SEQ ID NOs: 1 to 72 and not selected in (a), or all or part of an amino acid sequence having at least 70% homology or identity to said second sequence over its entire length.
51. A composition of matter according to claim 50, wherein said polypeptide comprises: (a) a first amino acid sequence selected from any one of SEQ ID NOs 1-3, 6-9, 20-23, 29, 32 and 34-44, and a second amino acid sequence is selected from any one of SEQ ID NOs 5, 18, 19, 33 and 45-72; or (b) a first or second amino acid sequence selected from SEQ ID NO: 88, 89 and 103 to 109 or a variant thereof.
52. A composition of matter according to claim 44(i), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein said hybrid polypeptide comprises an amino acid sequence selected from any one of SEQ ID NOs 73, 74, 76-87, 92-93 and 95 or a variant thereof, optionally having at least 70% homology or identity to said amino acid sequence over its entire length.
53. A composition of matter according to claim 44(ii), (iv), (v), (vi), (vii), (viii), (ix) or (x), wherein a said polypeptide is in accordance with (ii) and said amino acid sequence of (a) is an amino acid sequence shown in any one of SEQ ID NOs 45-60 and 64-65, and wherein said polypeptide binds one or more human chemokines selected from CXCL7, CXCL9, CXCL10, CXCL11 and CXCL12, preferably wherein said sequence of (a) is an amino acid sequence shown in any one of SEQ ID NOs 45-48, 51-53, 56, 59, 60, and 65 and wherein said polypeptide binds one or more human chemokines selected from CXCL7, CXCL9, and CXCL11.
54. A composition of matter according to claim 44(iii), (iv), (v), (vi), (vii), (viii), or (ix), wherein a said polypeptide is in accordance with (iii) and wherein said polypeptide is in a cyclic or stapled form and/or is fused to a carrier, such as albumin.
55. A composition of matter according to claim 44(v), (vi), (vii), (viii), or (ix), wherein a said polynucleotide is in accordance with (vi) and wherein said polynucleotide is a ribonucleic acid modified to reduce immunogenicity and increase stability for instance by substitution of uridine and cytidine with 1-methylpseudouridine and 5-methylcytidine, and/or placing an Anti-Reverse Cap Analog (ARCA) cap at the 5 end.
56. A method which is: (a) a method of producing a polypeptide according to claim 44(i), (ii) or (iii) or a combination according to claim 44(iv) comprising culturing a host cell according to claim 44(viii) under conditions which produce the polypeptide or the combination; or (b) a method of inhibiting the signalling of one or more chemokines in an in vitro culture, the method comprising contacting the culture with a polypeptide according to claim 44(i), (ii) or (iii), a combination according to claim 44(iv) or (vi), a polynucleotide according to claim 44(v), a vector according to claim 44(vii) or a host cell according to claim 44(viii).
57. A method of inhibiting the signalling of one or more chemokines in a subject, the method comprising administering to the subject a polypeptide according to claim 44(i), (ii) or (iii), a combination according to claim 44(iv) or (vi), a polynucleotide according to claim 44(v), a vector according to claim 44(vii) or a host cell according to claim 44(viii).
58. A method according to claim 57, wherein: (a) the polypeptide is as defined in claim 44(iii), 51(b) or 54, and said method is for inhibiting the signalling of one or more of CCL8, CCL7 and CCL18 in a subject, preferably all said chemokines; or (b) the method comprises administering a polypeptide comprising the amino acid sequence of SEQ ID NO: 92 or 93 or a variant thereof as defined in claim 52, or a polynucleotide encoding said polypeptide as defined in claim 44(v) or 55, and said method is for inhibiting the signalling of three or more of CCL2, CCL5, CCL8, CXCL8, CXCL10 and CXCL1 in a subject.
59. A method of treating or preventing in a subject one or more diseases associated with one or more chemokines, the method comprising administering to the subject a polypeptide according to claim 44(i), (ii) or (iii), a combination according to claim 44(iv) or (vi), a polynucleotide according to claim 44(v), a vector according to claim 44(vii) or a host cell according to claim 44(viii).
60. A method according to claim 59, wherein: (a) the polypeptide, the combination, the polynucleotide, the vector or the host cell is administered in combination with another therapy; (b) the disease comprises expression of CC and CXC chemokines and the polypeptide is a hybrid polypeptide according to claim 45 or 51(a); (c) the one or more chemokines are selected from CXCL1, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11 and CXCL2, and the polypeptide is a polypeptide according to claims 44(ii) or 53; (d) the method comprises treating or preventing an inflammatory disease, or any disease selected from any one of myocarditis, myocardial infarction, atherosclerosis, vasculitis, stroke, multiple sclerosis, Alzheimer's disease, autoimmune hepatitis, primary biliary cirrhosis, primary schlerosing cholangitis, liver fibrosis, non alcoholic steatohepatitis, paracetamol liver injury, alcohol liver injury, idiopathic pulmonary fibrosis, acute lung injury, cardiac allograft vasculopathy, sarcoidosis, influenza, inflammatory bowel disease, pancreatitis, rheumatoid arthritis, psoriasis, skin fibrosis, breast cancer and colorectal cancer; (e) the polypeptide is as defined in claim 44(iii), 51(b) or 54, and said method is for treating or preventing a disease selected from any one of alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, non-alcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury; or (f) the method comprises administering a polypeptide comprising the amino acid sequence of SEQ ID NO: 92 or 93 or a variant thereof as defined in claim 52, or a polynucleotide encoding said polypeptide as defined in claim 44(v) or 55, and said method is for treating or preventing a disease selected from any one of myocardial infarction, myocarditis, myocardial ischemia, and acute lung injury.
61. A method of detecting one or more chemokines in a tissue, comprising contacting the tissue with a detectably-labelled polypeptide according to claim 44 (i), (ii) or (iii) or a detectably-labelled combination according to claim 44(iv) and detecting the binding of the polypeptide or the combination to one or more chemokines.
62. A method according to claim 61, wherein: (a) the one or more chemokines are selected from any chemokines shown in Tables 2-4 and 6; or (b) the method is for diagnosing or prognosing one or more diseases associated with one or more chemokines.
Description
DESCRIPTION OF THE FIGURES
[0032]
[0033] Literature references are as follows: Myocarditis, including giant cell, viral, Chagas and lymphocytic myocarditis: [42-50]; myocardial infarction: [51,52], atherosclerosis: [53-67], vasculitis, including Takayasu disease, ANCA vasculitis, and giant cell arteritis: [68-73], stroke: [4], multiple sclerosis [74-76], Alzheimer's disease [77], primary biliary cirrhosis [78-84], primary sclerosing cholangitis [81,85], liver fibrosis [86,87], nonalcoholic steatohepatitis [88,89], paracetamol liver injury [90], alcoholic liver injury [91], idiopathic pulmonary fibrosis [92-102], acute lung injury [103,104], sarcoidosis [105-111], influenza [112-122], kidney fibrosis [86], inflammatory bowel disease [123-134], pancreatitis [135,136], rheumatoid arthritis [9], psoriasis [137-141], skin fibrosis [86], atopic dermatitis [137,142-147], breast cancer [148-154], colorectal cancer [155-159].
[0034]
[0035] Alignment was performed using the MUSCLE algorithm in DNASTAR. The mature peptide sequences of Evasin-1 (EVA1_RHISA) and 4 (EVA4_RHISA) are published [20,21]. Other tick CKBP sequences were disclosed previously in PCT/GB2017/050563 and published in Singh et al[17]. Peptide sequence prefix indicates the identity, and suffix indicate the tick species as follows: RHISA and RHIPURhipicephalus sanguineus and pulchellus respectively, and AMBPA, AMBCA, AMBMA, AMBTRAmblyomma parvum, cajennense, maculatum, triste) respectively. Amino acid residues shaded as black are identical to EVA1_RHISA. Disulfide bonds (DSB) in Evasin-1 are indicated, and were taken from the analysis of the Evasin-1:CCL3 structure 3FPU provided in PDBSum[22]. The positions of the 8 conserved cysteines are indicated by arrows, and are conserved in all CC-chemokine binding tick CKBPs, which we term 8-Cys tick chemokine binding proteins. The arrangement of Cys residues is C-x(14,17)-C-x(3)-C-x(11,16)-C-x(17,20)-C-x(4)-C-x(4)-C-x(8)-C, with numbers in parentheses indicating spacing between Cys residues. CKBPs in
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051] The following peptides were used in this experiment:
TABLE-US-00001 P672_PEP(C-terminallyamidated)= EDEDYEDFFKPVTAYF(SEQIDNO88,peptideBK1.1), P672_PEP-FITC(C-terminallyamidated)=FITC-NH- EDEDYEDFFKPVTAYF(SEQIDNO90) and P672_PEP_SCRAM(C-terminallyamidated)= EFTEVYEFDFKYDAPD(SEQIDNO91).
[0052]
[0053]
[0054] The following peptide was used in this experiment:
TABLE-US-00002 P672_PEP(C-terminallyamidated)= EDEDYEDFFKPVTAYF(SEQIDNO88,peptideBK1.1), P672_PEP_SCRAM(C-terminallyamidated)= EFTEVYEFDFKYDAPD
[0055]
[0056]
[0057]
[0058]
[0059] A. Surface representation (top) and ribbon diagram (bottom) of a homology model of P672 (darker grey) and CCL8 (lighter grey) complex. P672 and CCL8 in 1:1 ratio was pre-incubated for 1 h, then diluted in D.sub.2O containing buffer and quenched at different time intervals (5 s, 30 s, 5 min, 60 min).
[0060] B. Surface representation in light grey (top) and ribbon diagram (bottom) of P672 and CCL8 complex at the time points indicated. Residues with statistically significant increased HDX rates, (exposed residues) are shown in darkest grey. Regions with statistically significant decreased HDX rates (protected residues) are shown in mid-greys for P672 and CCL8. All analyses were performed in triplicate.
[0061] C. Surface representations in light grey (top) and ribbon diagrams (bottom) of P672 (90 rotated view along the y-axis of B). Residues protected at 5 s and 30 s time points (E22-F32) are indicated in mid-grey in the top panel. Exposed residues (G87-C94) are indicated in darkest grey in the bottom panel. The surface of the protected residues (E22-F32) is also shown in the bottom panel.
[0062] D. Surface representation in light grey (top) and ribbon diagram (bottom) of CCL8, with residues protected at all time points (R18-S27) indicated in mid-grey. Disulfide bonds are indicated in lightest grey in the bottom panel. The surface of the N-loop (residues C12-R24) is also shown in the bottom panel to show the overlap with protected residues.
[0063] E. Spectra of two representative peptides from the Y21-F32 region in P672 (mid-grey and black bars) that are protected from deuterium uptake upon complex formation. H/D exchange mass spectra was measured at t=5 s. These peptides display reduced relative deuterium uptake upon complex formation. Other peptides from this region are indicated as gray bars. Mass spectra is shown for control non-deuterated peptides (c-i, iv), unbound P672 deuterated peptides (c-ii, v), and P672 deuterated peptides when in complex with CCL8 (c-iii, vi).
[0064]
[0065] A. Alignment of EVA1 (SEQ ID NO: 32), P672 (SEQ ID NO: 3) and EVA1/P672 (EVA1 containing P672E22-E32; SEQ ID NO: 95) hybrid protein using MUSCLE algorithm. Amino acids are color-coded according to physicochemical properties: aromatic (F, W, and Y); acidic (D and E); basic (R, H, and K); nonpolar aliphatic (A, G, I, L, M, P, and V); polar neutral (C, N, Q, and T). Amino acids that were protected from deuterium uptake in P672 are indicated with the right black box. The N-terminal acidic region is enclosed in the left black box.
[0066] B. Biolayer interferometry sensorgram obtained when either P672, EVA1/P672 or EVA1 is loaded onto the BLI sensor and exposed to 600 nM CCL8. Plots display wavelength shift (Y-axis, nm) versus time (X axis, seconds).
[0067] C. Biolayer interferometry sensorgram for EVA1(P672.sub.E22-E32) hybrid binding to CCL8. Dotted lines indicate collected data, solid lines indicate modelled data. Plots display wavelength shift (Y-axis, nm) versus time (X axis, seconds).
[0068]
[0069] A. Design of a P672 peptide tiling array to identify CCL8-binding peptides. Positions of each residue within P672 are indicated, and the gray box indicates the CCL8 binding region identified by HDX-MS. P672 residues are shaded according to CCL8 binding affinity from the Ala-scanning mutagenesis (see text and Table 9). Y21A, E22A, F25A, P27A, V28A, and Y31A mutants lead to either complete or highly significant loss of activity (P<0.0001), D18A and F32A mutants lead to moderately significant loss of activity (P<0.05). Peptides synthesized (BK1.1-BK8) are indicated as gray bars.
[0070] B. Fluorescent peptides BK1.1-BK6 (50 nM) were incubated with CCL8 (1 M) and the resulting anisotropy determined. A scrambled peptide (S, SCR.sub.FITC) was used as a negative control. The anisotropy of each peptide after being incubated with CCL8 was compared to scrambled peptide using one-way ANOVA with Sidak's correction for multiple comparisons. **** indicates P0.0001.
[0071] C. Fluorescent polarization assay to determine binding of BK1.1.sub.FITC to CCL8. The Y axis shows anisotropy, and X axis the dose of CCL8. Individual data points are indicated and the curve was generated as a non-linear fit with 3 parameters to estimate K.sub.D.
[0072] D. Fluorescent polarization assay to assess effect of alanine-scanning mutagenesis of BK1.1.sub.FITC on CCL8 binding. K.sub.D values for each BK1.1.sub.FITC Ala mutant are shown as means.e.m of three biological replicates, which are individually indicated as points. Data for each mutant was compared to wild-type (WT) BK1.1, using a one-way ANOVA with Sidak's correction for multiple comparisons. ****=P0.0001, *=P0.05. The mutant P27A showed no detectable binding.
[0073] E. Mass spectrometry (MS) to assess effect of BK1.1 on CCL8 Top panel: Native MS of CCL8 homodimer. Mid panel: In-solution dissociation of CCL8 dimer and further binding of CCL8 to one and two BK-1. Confirmation of CCL8/BK-1 complex by HCD gas-phase dissociation of isolated precursor ions: Bottom panel, left: 2217 m/z corresponding to CCL8/BK-1 (1:1) and Bottom panel, left: 2555 m/z corresponding to CCL8/BK-1 (1:2). Buffers contained up to 0.5% DMSO. All analyses were performed in triplicate.
[0074] F. Fluorescent polarization assay to assess the binding of BK1.1.sub.FITC against a CC-chemokine panel. Data are presented as means.e.m of three biological replicates, which are individually indicated as points. Each biological replicate was performed as technical duplicate. CXCL1 was used as a negative control. CC-chemokine binding compared to the negative control using a one-way ANOVA with Sidak's correction for multiple comparisons. ****=P0.0001, * P<0.05.
[0075] G-I. Fluorescence polarization competition assay for BK1.1.sub.FITC and CC-chemokine interactions. BK1.1.sub.FITC (50 nM) was incubated with the indicated chemokine (1 M) with or without unlabeled BK1.1 or SCR (BK1.1 scrambled) peptides (50 M) for 30 min and the resulting anisotropy was measured. Data are presented as means.e.m of three biological replicates, which are individually indicated as points. Each biological replicate was performed as technical duplicate. Statistical significance of differences (SCR versus BK1.1) were calculated using a one-way ANOVA. ****=P0.0001, ***=P0.001.
[0076]
[0077] A. Sequences of peptides studied, with disulfide bond (BK1.3) or thioether cyclization (BK1.2, BK1.4) indicated by lines. SCR is a scrambled peptide based on the sequence of BK1.1 (SEQ ID NO: 88). Y21F32, C30A (SEQ ID NO: 103); Y21F32 (SEQ ID NO: 104); BK1.2 (SEQ ID NO: 105); BK1.3 (SEQ ID NO: 106); BK1.4 (SEQ ID NO: 107); SCR (SEQ ID NO: 91).
[0078] B-D. Effect of indicated peptides at a concentration of 100 M on a His-tagged P672-biotinylated CCL8, CCL2 or CCL3 interaction respectively using an AlphaScreen assay. In each panel. Y axis shows intensity counts, and X axis the peptide. Data are presented as means.e.m. of three independent experiments, shown as individual data points. Statistically significant differences (compared to chemokine+P672), using a one-way ANOVA with Sidak's multiple comparisons test are indicated by asterisks. ****=P0.0001, ***=P0.001, **=P0.01.
[0079] E-G. Representative dose-response AlphaScreen assay curves showing disruption of His-tagged P672 interactions with biotinylated human CCL8, CCL2 and CCL3 respectively by each member of the BK1.1 derived series. Y axis shows intensity counts, and X axis the peptide concentration (Log.sub.10 Molar). Data are shown as mean of two technical replicates. Curves were fitted with 4 parameters to estimate IC.sub.50.
[0080] H-J. Summary IC.sub.50 values for inhibition of His-tagged P672 binding to human CCL8, CCL2 and CCL3 respectively by each member of the BK1.1 derived series, where these could be calculated. Y axis shows IC.sub.50 (M). Data are presented as means.e.m. of three independent experiments, each shown as individual data points. Each independent experiment was conducted as two technical replicates. Statistically significant differences (compared to BK1.1), using a one-way ANOVA with Sidak's multiple comparisons test, are indicated by black asterisks. Statistically significant differences (pairwise comparisons of BK1.2, BK1.3, BK1.4 and BK1.5) using one-way ANOVA with Tukey's multiple comparisons test are indicated with blue asterisks (comparisons to BK1.2), or green asterisks (comparisons to BK1.3). ***=P0.001, **=P0.01, *=P0.05.
[0081]
[0082] A-D. Inhibition of human chemokine induced THP-1 cell migration by BK1.1, BK1.2, BK1.3, SCR (BK1.1 scrambled, negative control) peptides, each at 10 M, and by P672 protein (positive control, 300 nM). Y axis in each panel shows % migration of THP-1 cells normalized to chemokine alone which was set at 100%. All experiments were performed at EC.sub.80 doses of CCL8 (5.8 nM), CCL7 (7.2 nM), CCL3 (3.5 nM), and CCL2 (1.2 nM), respectively. Data are shown as means.e.m. of three independent biological replicates, shown as individual data points. Each biological experiment was performed as three technical replicates. Statistically significant differences (compared to SCR), using a one-way ANOVA with Sidak's correction for multiple comparisons, are indicated by asterisks: ****=P0.0001, ***=P0.001, **=P0.01, *=P0.05.
[0083] E. Representative dose-response curves showing inhibition of human CCL8 induced THP-1 cell migration by BK1.1 (black), BK1.2 (darker grey), BK1.3 (lighter grey) peptides and by P672 protein (positive control, magenta). Y axis shows % migration of THP-1 cells normalized to CCL8 alone which was set at 100%. Data are shown as means.e.m. of three technical replicates. X-axis shows inhibitor concentration (Log.sub.10 Molar). Curves were fitted with 4 parameters to estimate IC.sub.50.
[0084] F. Summary IC.sub.50 values for inhibition of human CCL8 induced THP-1 cell migration by BK1.1, BK1.2, BK1.3, and P672 protein. Y axis shows IC.sub.50 (M). Data are shown as mean s.e.m. of three biological replicates. Statistically significant differences (compared to BK1.1) using a one-way ANOVA with Sidak's correction for multiple comparisons, are indicated by asterisks: ****=P0.0001, ***=P0.001, **=P0.01, *=P0.05.
[0085] G. I. Representative dose-response curves showing inhibition of human CCL8-647 (g) and human CCL2-647 (i) induced THP-1 cell fluorescence by BK1.1 (black), BK1.2 (darker grey), BK1.3 (lighter grey), SCR (scrambled, negative control, light-grey without line) peptides and by P672 protein (positive control, mid grey). Y axis shows fluorescence (arbitrary units). Data are shown as mean of two technical replicates. X axis shows inhibitor concentration (Log.sub.10 Molar). Curves were fitted with 4 parameters to estimate IC.sub.50.
[0086] H. J. Summary IC.sub.50 values for inhibition of human CCL8-647 (h) or CCL2-647 (i) induced THIP-1 cell fluorescence by BK1.1, BK1.2, BK1.3, and P672 protein. Y axis shows IC.sub.50 (M). Data are shown as means.e.m. of three biological replicates, shown as individual data points. Each biological experiment was conducted as two technical replicates. Statistically significant differences (compared to BK1.1) using a one-way ANOVA with Sidak's correction for multiple comparisons, are indicated by asterisks: ****=P0.0001, ***=P0.001, **=P0.01, *=P0.05.
[0087]
[0088] A. Experimental design to characterize the zymosan air-pouch model. A dorsal air-pouch (a.p.) was created by subcutaneous (s.c.) injection of air on day 0 and day 3. Zymosan or PBS (control) was injected into the air-pouch (a.p.) on day 6. Air-pouch exudate was collected and analysed at 4 and at 24 hours by a membrane assay.
[0089] B. Top: Images of membranes used to analyse air-pouch fluid chemokines at different time points and conditions. See example 19 for details. Bottom: arrangement of chemokines, positive (PC) and negative (NC) controls.
[0090] C. Chemokine expression relative to the positive control which was set at 100, at different time points and conditions (mean of two spots. Indicated in shades of grey) and fold change (FC) in chemokine expression at 4 and 24 hours compared to PBS control (indicated in shades of grey).
[0091]
[0092] A. Experimental design to assess efficacy of locally administered peptide. A dorsal air-pouch (a.p.) was created by subcutaneous (s.c.) injection of air on day 0 and day 3. Zymosan or PBS (control) was injected into the air-pouch (a.p.) on day 6. Peptide or protein (blue) was injected into the air-pouch on day 6 at the time of zymosan injection and repeated 9 hours later. Air-pouch exudate was collected and analysed on day 7 by flow cytometry (FC). Nine mice were studied in each of 5 study arms: PBS alone (PBS), zymosan (zymo), zymosan+scrambled peptide (SCR), zymosan+P672 (P672), and zymosan+BK1.3 (BK1.3).
[0093] B-F. Summary data for flow cytometry analysis for locally administered peptide. Y axis shows cell counts of total leucocytes (B), neutrophils (C), eosinophils (D), monocytes (E) and T-cells (F). Data are presented for each arm as means.e.m. and with individual data points. Statistically significant differences (compared to zymosan) using a one-way ANOVA with Dunnett's correction for multiple comparisons, are indicated by asterisks: ****=P0.0001, ***=P0.001, **=P0.01, *=P0.05.
[0094] G. Experimental design to assess efficacy of intraperitoneally administered peptide. This is identical to that used for locally administered peptide (above) except that peptide or protein was administered intraperitoneally (i.p.). Nine mice were studied in each of 3 study arms: zymosan+SCR, zymosan+P672 (P672), and zymosan+BK1.3 (BK1.3).
[0095] H-L. Summary data for flow cytometry analysis for intraperitoneally administered peptide. Y axis shows cell counts of total leucocytes (H), neutrophils (I), eosinophils (J), monocytes (K) and T-cells (L). Data are presented for each arm as means.e.m. and with individual data points. Statistically significant differences (compared to SCR) using a one-way ANOVA with Dunnett's correction for multiple comparisons, are indicated by asterisks: ****=P0.0001, ***=P0.001, **=P0.01, *=P0.05.
[0096]
[0097] A. CCL8 protein (1-97)(SEQ ID NO: 110) aligned against the 44 peptides generated by peptic digestion of CCL8, yielding 96.9% coverage, and 8.0 redundancy (calculated as the average number of peptides in which each residue is found.
[0098] B. P672 protein (1-130)(SEQ ID NO: 111) aligned against the 38 peptides generated by peptic digestion of P672, yielding 100% sequence coverage, and 4.95 redundancy.
[0099] These peptides passed the identification criteria outlined example 19, and were used for further H/D exchange measurements. Adequate overlap is observed, except for CCL8 P2-N14 and A40-C52 regions for which only one peptide was identified.
[0100]
[0101] Percentage of H/D exchange measured at four incubation time points (5 s, 30 s, 5 min, 60 min). Regions with increased HDX rates (exposed residues) are shown in green and regions with decreased HDX rates (protected residues) are shown as darker shades. Regions with no significant exchange are indicated as lighter grey. Protein tags are highlighted in grey box on sequence. All analyses were performed in triplicate. CCL8 (SEQ ID NO: 112); P672 (SEQ ID NO: 111).
[0102]
[0103] A. Mass spectrum of 20 M BK1.3 after incubation for 4 h in RPMI media at 37 C. mimicking cell assay. Note that RPMI contains a mix of amino acids including Cys-SH (200 M). The mass M-SS-Cys is that of the peptide bonded to a cysteine.
[0104] B. Mass spectrum of 20 M BK1.3 after incubation for 1 h in AlphaScreen buffer (50 mM HEPES, 150 mM NaCl, 0.1% BSA, 0.01% Tween20, pH7.5) at room temperature mimicking AlphaScreen assay.
[0105]
[0106] Representative flow cytometry data of zymosan air-pouch exudate from different arms of peptide in vivo efficacy experiments. Panel series from the top to bottom show scrambled (SCR) peptide, isotype control, SCR, P672 protein, BK1.3 peptide (see
DESCRIPTION OF THE SEQUENCE LISTING
[0107] SEQ ID NOs: 1 to 72 are shown in Tables 1, 4 and 5 below and in the electronic sequence listing.
[0108] SEQ ID NOs: 73 to 109 are shown above and in the Detailed Description and electronic sequence listing.
DETAILED DESCRIPTION OF THE INVENTION
[0109] It is to be understood that different applications of the disclosed products and methods may be tailored to the specific needs in the art. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments of the invention only, and is not intended to be limiting.
[0110] In addition as used in this specification and the appended claims, the singular forms a, an, and the include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to a polypeptide includes two or more such polypeptides, or reference to a polynucleotide includes two or more such polynucleotides and the like.
[0111] All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety. The disclosure of PCT/GB2017/050563 in relation to SEQ ID NOs 1-31 is specifically incorporated by reference, including each of Tables 1-5 and
Information on Tick CKBPs (Tables 1-8)
[0112] Table 1. Tick CKBPs described in PCT/GB2017/050563 and [17]. Tick peptide sequences isolated in yeast surface display fluorescent-activated cell sorting (FACS) screens using a labelled chemokine. Identity with Evasin-1, 4 or 3 was calculated using BLAST. Abbreviations: IXORIIxodes ricinus, RHISARhipicephalus sanguineus, AMBMAAmblyomma maculatum, AMBPAAmblyomma parvum, AMBTRAmblyomma triste, AMBAMAmblyomma americanum, AMBCAAmblyomma cajennense, RHIPURhipicephalus pulchellus.
[0113] Table 2A-C. Binding characteristics of tick CKBPs previously disclosed (PCT/GB2017/050563 and [17]).
[0114] All members of the human chemokine family[164] are listed in column 1. Binding to human chemokines was determined for 14 tick CKBPs using biolayer interferometry (BLI) [17,165] with calculated K.sub.d shown as Molar (Moles/Litre). Binding data for 17 other novel tick CKBPs was assayed using yeast surface display[17,166], with positive binding results shown as YES. For biolayer interferometry, His-tagged purified tick CKBP was bound to a Ni-NINTA sensor on an OctetRed 384 system, and then binding to each chemokine listed (with the exception of CCL25, CCL26, CXCL16, CXCL17, CXCL4L1, XCL2) was assayed in a cross-binding screen at a chemokine concentration of 300 nM as described[17]. For those chemokines showing binding to a tick CKBP in the cross-binding screen, binding assays were repeated using different doses of chemokine. Association, equilibrium and dissociation data were analysed using Octet software to create corresponding fitted curves, and used to calculate K.sub.d. For yeast surface display, (YSD) background fluorescence was controlled for by using either an empty vector or by omitting the chemokine (i.e. using streptavidin-Alexa647 alone). An arbitrary threshold of >3 fold over background mean fluorescence intensity was chosen to describe confirmed re-tests. Where binding was detected data are indicated as YES. For biolayer interferometry (BLI) data, empty cells in
[0115] Table 3: Neutralisation of human chemokines by tick CKBPs previously disclosed (PCT/GB2017/050563 and [17]). Neutralising activity was determined using a quantitative THP1 cell migration assay in a 96-well Boyden chamber with chemokine in the bottom chamber as described[17]. Cells migrating through to the bottom chamber at 4 hours were counted using flow cytometry in a 96 well plate format. IC.sub.50 for neutralisation was determined at the chemokine EC.sub.80 dose as determined using a range of tick CKBP concentrations. Data was analysed using GraphPad Prism to determine IC.sub.50, which is shown as Molar (Moles/Litre). Empty cells represent experiments not done.
[0116] Table 4Other previously described tick CKBPs [18,20-22]. Tick CKBPs that were also described in PCT/GB2017/050563 and Singh et al. [17] are indicated in Notes.
[0117] Table 5.Novel tick CKBPs of the invention.
[0118] Table 6. Binding characteristics of new CXC chemokine binding tick CKBPs shown in Table 3. Column 1 shows sequence ID, column 2 the name of the tick peptide. The peptide sequence prefix indicates the identity, and suffix indicate the tick species as follows: AMBCA, Amblyomma cajennense and IXORI, Ixodes ricinus. Column 3 shows the identity of the chemokine that was used in the yeast surface display screen to isolate the yeast clone displaying the peptide from a yeast library. Certain tick peptides e.g. P1074_IXORI were recovered from screens performed with more than one chemokine. Individual yeast clones recovered from the library were re-tested using a FACS (fluorescence activated cell sorting), experiment. The binding of the peptide to the chemokine was assayed by measuring the percent (%), of yeast cells expressing the given peptide that exceeded a background threshold set by measuring the fluorescence of the yeast library pool treated with streptavidin-Alexa467 alone.
[0119] When more than one independent yeast clone was isolated for a given peptide-chemokine combination, the mean percent shift was calculated and reported in column 3. Note that as binding of other chemokines to the indicated tick peptide have not yet been determined, the data in column 3 is necessarily incomplete. Column 4 shows the percent identity of each tick peptide to prior art tick CKBPs (EVA1, EVA4 or EVA3). This was calculated using the BLAST algorithm using default parameters, and is reported together with the alignment length in residues. A blank cell indicates that no homology was identified by BLAST.
[0120] Table 7. Potential disease applications of tick CKBPs in Table 1. Table based on binding and inhibition data shown above and on published chemokine expression in disease states as shown in
[0121] Table 8. Potential disease applications of tick CKBPs in Table 5. Table based on binding and inhibition data shown above and on published chemokine expression in disease states as shown in
Hybrid Polypeptides of the Invention
[0122] The invention provides a hybrid polypeptide representing amino acid sequences derived from two or more different tick CKBPs. The hybrid polypeptide typically has different chemokine binding properties compared to any single tick CKBPs from which it is derived. The hybrid polypeptide may have different chemokine binding properties compared to any single tick CKBP.
[0123] The invention typically provides a hybrid polypeptide comprising an amino acid sequence of a first tick CKBP or a variant thereof and an amino acid sequence of a second tick CKBP or a variant thereof, wherein said hybrid polypeptide has an altered chemokine binding profile compared to the first or second tick CKBP. The first and second tick CKBP polypeptides are not identical.
[0124] The hybrid polypeptide comprises at least an amino acid sequence of a first tick CKBP polypeptide or variant thereof, and an amino acid sequence of a second tick CKBP polypeptide or variant thereof, but may also comprise amino acid sequences from one or more other tick CKBP polypeptides or variants thereof. Thus, the hybrid polypeptide may be derived from three, four, five or more different tick CKBP polypeptides. The discussion herein of selection of second tick CKBP polypeptides by comparison with first tick CKBP polypeptides for provision of sequences for a hybrid polypeptide is also applicable to selection of any additional tick CKBP polypeptide to be represented in the hybrid polypeptide. Thus, an additional sequence to be provided from a further (for example, third) tick CKBP polypeptide may be selected to provide an additional chemokine-binding activity for the hybrid polypeptide compared to those provided by sequences derived from the other (for example, first and second) tick CKBP polypeptides.
[0125] Chemokine Binding
[0126] The altered chemokine binding profile for the hybrid polypeptide comprises the ability to bind a different selection of chemokines as compared to those bound by the first or second tick CKBP polypeptide individually. The hybrid polypeptide may thus be able to bind one or more chemokines not bound by the first or second tick CKBP polypeptide individually. The hybrid polypeptide may not exhibit binding to one or more chemokines that are bound by the first or second tick CKBP polypeptide. It should be understood that the altered chemokine binding profile for the hybrid polypeptide is by comparison to that of any single tick CKBP polypeptide from which it is derived, taken individually. Thus, the hybrid polypeptide displays an altered chemokine binding profile compared to any single tick CKBP polypeptide whose sequence it represents. In some aspects, the chemokine binding profile of the hybrid polypeptide may in contrast be substantially identical or identical to the cumulative (combined) chemokine binding profile of each of the individual tick CKBP polypeptides whose sequences it represents.
[0127] The hybrid polypeptide may bind at least one additional chemokine compared to a first tick CKBP polypeptide from which it is derived. The additional chemokine binding for the hybrid polypeptide is provided by the presence of at least one chemokine binding sequence derived from a different (second) tick CKBP polypeptide to the first tick CKBP polypeptide. The second tick CKBP polypeptide thus binds one or more different chemokines compared to the first tick CKBP polypeptide. The hybrid polypeptide may bind at least two, at least three, at least four, at least five, at least six, or at least eight additional chemokines as compared to the first tick CKBP polypeptide.
[0128] The hybrid polypeptide may bind in total at least two, at least three, at least four, at least five, at least six, at least eight, at least ten, at least twelve, at least fourteen or more different chemokines, The hybrid polypeptide may bind up to five, up to ten, up to twelve, up to fifteen or up to twenty different chemokines. The hybrid polypeptide may bind two to five, two to eight, two to ten, two to twelve, two to fifteen, or two to twenty different chemokines. The hybrid polypeptide may bind five to ten, five to fifteen, or five to twenty different chemokines.
[0129] The hybrid polypeptide may bind all chemokines bound by the two or more different tick CKBP polypeptides from which it is derived.
[0130] The hybrid polypeptide may alternatively bind a reduced number of chemokines compared to the total number of chemokines that are bound by the two or more different tick CKBP polypeptides from which it is derived. The reduced chemokine binding for the hybrid polypeptide may be provided by the loss of one or more chemokine binding sequences present in the two or more different tick CKBP polypeptides from which it is derived. In this aspect, the hybrid polypeptide may not bind at least one, at least two, at least three, at least four, at least five, at least six or at least eight of the chemokines that are bound (jn combination) by the two or more different tick CKBP polypeptides from which it is derived. In some aspects, the hybrid polypeptide may have reduced chemokine binding (bind to a reduced number of different chemokines) compared to any individual tick CKBP from which it is derived. Thus, it may only bind one chemokine, two chemokines, three chemokines, four chemokines, or five different chemokines. It may bind up to two, up to three, up to four or up to five different chemokines.
[0131] The chemokines may be selected from any known chemokines or chemokines newly identified in the future which are bound by tick CKBP polypeptides. The chemokines are preferably human chemokines. However chemokines may also be selected from other animals of veterinary importance (e.g. dog, cat, pig, sheep, cow, horse) and scientific importance (e.g. mouse, rat, monkey).
[0132] It is preferred that a hybrid polypeptide bind at least one CC chemokine and at least one CXC chemokine, i.e. at least one chemokine of the CC class and at least one chemokine of the CXC class. The known human CC and CXC chemokines are indicated in Table 2 and the hybrid polypeptide may bind any of the CC and/or CXC chemokines shown in Table 2. Certain CC and CXC chemokines are not known to be bound by tick CKBPs described to date (including ones detailed here). These include: CCL28, CXCL13, CXCL14, CXCL16, CXCL17, CXCL4, CXCL4L1.
[0133] Binding of at least one CC and at least one CXC chemokine is of particular utility in matching to chemokine expression in disease where both CC and CXC chemokines are expressed. A CC chemokine may be selected from any of the disease expressed CC chemokines shown in
[0134] Ideally a hybrid polypeptide should bind CC and CXC chemokines expressed and relevant to a particular disease. The hybrid polypeptide may be designed to bind CX3C and CC chemokines or CX3C and CXC chemokines, or CX3C, CC and CXC chemokines if the CX3C chemokine is expressed in the disease, and thought to be relevant to the disease.
[0135] Tick CKBPs
[0136] The tick CKBP polypeptides from which the hybrid polypeptide is derived may be selected from any tick CKBP polypeptides, including currently described tick CKBPs and tick CKBPs identified in the future. A tick CKBP polypeptide may be derived from any tick species, preferably a tick species that infects humans. The tick species may be selected from any of Amblyomma, Anomalohimalaya, Bothriocroton, Cosmiomma, Cornupalpatum, Compluriscutula, Dermacentor, Haemaphysalis, Hyalomma, Ixodes, Margaropus, Nosomma, Rhipicentor, Rhipicephalus, Nuttalliella, Antricola, Argas, Nothoaspis, Ornithodoros, and Otobius genera. A tick CKBP polypeptide binds one or more chemokines, preferably one or more human chemokines. A tick CKBP polypeptide typically binds multiple chemokines, such as at least two different chemokines.
[0137] The tick CKBP family is characterised by low sequence identity between members (although more closely related tick CKBPs may display greater sequence identity). Conserved structural features though exist allowing for ready classification of chemokine-binding proteins as tick CKBPs. A tick CKBP is typically a tick Evasin polypeptide. A tick CKBP may be a previously described tick Evasin or tick Evasin variant or a tick Evasin or tick Evasin variant identified in the future. An example of a previously described tick Evasin variant is provided by the sequence having the accession number EZ406190.1, which may be used in place of native Evasin-1 (SEQ ID NO: 32) in any sequence combination based on SEQ ID NO: 32 described herein.
[0138] A tick CKBP polypeptide may thus display a conserved set of eight cysteine residues (typically forming four disulphide bonds), which can be aligned with corresponding cysteine residues in known tick CKBP having a set of eight cysteines. Tick CKBPs of this type are typically CC binding tick CKBPs. Examples include Evasin-1 and Evasin-4 (SEQ ID NOs 32 and 34) and SEQ ID NOs 1-3, 6-9, 20-23, 29, and 35-44.
[0139] An illustration of a sequence alignment of tick CKBPs of this type against Evasin-1, showing the conserved eight cysteine positions, is provided in
[0140] Alternatively, a tick CKBP polypeptide may display a conserved set of six cysteine residues which can be aligned against sequences of known tick CKBPs also having a corresponding set of six cysteines. Tick CKBPs of this type are typically CXC binding CKBPs. Examples of CXC-binding tick CKBPs include Evasin-3 (SEQ ID NO: 33) and SEQ ID NOs 5, 18, 19, and 45-72. An illustration of a sequence alignment of tick CKBPs of this type against Evasin-3, showing the conserved six cysteine positions, is provided in
[0141] Tick CKBP polypeptides may also be selected from any of polypeptides comprising the amino acid sequence of any one of SEQ ID NOs 1-72 or naturally occurring homologues thereof, including homologues present in any tick species discussed above. Such naturally occurring homologues may comprise an amino acid sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95% or at least 99% homology or identity to the amino acid sequence of any one of SEQ ID NOs 1-72. Preferably, the above homology or identity is measured over the full length of the homologue.
[0142] As discussed above, a first tick CKBP polypeptide represented in the hybrid polypeptide is selected to differ from the second tick CKBP polypeptide represented in the hybrid polypeptide (and any additional tick CKBP polypeptides represented in the hybrid polypeptide are also selected to differ from other tick CKBPs represented). However, the first and second (and additional) tick CKBP polypeptides may otherwise be selected from any tick CKBP polypeptides discussed above. Each tick CKBP polypeptide selected as a basis for provision of the hybrid polypeptide typically has at least one differing chemokine-binding activity. Thus, for example a first tick CKBP polypeptide may be a CC-binding tick CKBP and the second tick CKBP polypeptide a CXC-binding tick CKBP. Alternatively, the first and second tick CKBP polypeptides may both be CC-binding tick CKBPs, but with at least one differing CC-binding activity between them. Thus, for example the first tick CKBP may bind CCL8 and the second tick CKBP CCL5, or the first tick CKBP may bind CCL8 and the second tick CKBP CCL5 and CCL8. In another aspect, the first and second tick CKBP polypeptides may both be CXC-binding tick CKBPs, but with at least one differing CXC-binding activity between them. Thus, for example the first tick CKBP may bind CXCL8 and the second tick CKBP CXCL12, or the first tick CKBP may bind CXCL1 and CXCL8 and the second tick CKBP CXCL1, CXCL3 and CXCL8.
[0143] Examples of differing chemokine-binding activities for individual tick CKBP polypeptides are provided in Tables 2-4 and 6. Combinations of two or more tick CKBPs may accordingly be selected together to provide a desired combination of chemokine-binding activities in a hybrid polypeptide, starting from consideration of the individual binding activities displayed by each tick CKBP. The combination of chemokine-binding activities may be selected to reflect chemokine expression in particular disease, such as any chemokine disease expression pattern shown in
[0144] Particular CC-binding tick CKBPs are provided by SEQ ID NOs 1-3, 6-9, 20-23, 29. 32, and 34-44. Particular CXC-binding tick CKBPs are provided by SEQ ID NOs 5, 18, 19, 33 and 45-72. Thus a hybrid polypeptide may comprise (i) an amino acid sequence of a first tick CKBP polypeptide selected from any one of SEQ ID NOs 1-3, 6-9, 20-23, 32, and 34-44, or a variant of any thereof, and (ii) an amino acid sequence of a second tick CKBP polypeptide selected from any one of SEQ ID NOs 5, 18, 19, 33 and 45-72 or a variant of any thereof. A preferred variant of SEQ ID NO: 3 is the peptide of SEQ ID NO: 89 (EDEDYEDFFKPVTCYF) or a variant thereof, such as SEQ ID NO: 88 (EDEDYEDFFKPVTAYF). A variant of SEQ ID NO: 89 typically binds CCL8, CCL7 and CCL18. SEQ ID NO: 89 or a variant thereof as above may be used in place of SEQ ID NO: 3 in any hybrid polypeptide described herein including an amino acid sequence of a tick CKBP polypeptide selected from SEQ ID NO: 3 or a variant thereof.
[0145] A hybrid polypeptide may alternatively comprise first and second tick CKBP amino acid sequences or variants thereof each selected from group (i) above, or first and second tick CKBP amino acid sequences each selected from group (ii) above.
[0146] Specific examples of hybrid polypeptides based on the above tick CKBP sequences are provided by the hybrid polypeptides comprising amino acid sequences as shown in SEQ ID NOs: 7-74 and 80-81 shown below.
TABLE-US-00003 SEQIDNO:73(linkerregionboldandunderlined): ENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCN VTRCTAPDTYPCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELC FKAPNLEEGGGGSADDDNELFTVQYCGMNCTKDEGGTWTGCTGKKEGCKC YHESGKNYGLCLSTEYTDFSQYGNPSDSEIEAAKPKRSDTLSH SEQIDNO:74(linkerregionboldandunderlined): RNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKLLGCHYFCNGTLCTA PDGYPCYNLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTPGG GGSADDDNELFTVQYCGMNCTKDEGGTWTGCTGKKEGCKCYHESGKNYGL CLSTEYTDFSQYGNPSDSEIEAAKPKRSDTLSH SEQIDNO:80(linkerregionboldandunderlined): ADDDNELFTVQYCGMNCTKDEGGTWTGCTGKKEGCKCYHESGKNYGLCLS TEYTDFSQYGNPSDSEIEAAKPKRSDTLSHGGGGSENGEGTTQPDYDNST DYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCNVTRCTAPDTYPCYNL TEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELCFKAPNLEE SEQIDNO:81(linkerregionboldandunderlined): ADDDNELFTVQYCGMNCTKDEGGTWTGCTGKKEGCKCYHESGKNYGLCLS TEYTDFSQYGNPSDSEIEAAKPKRSDTLSHGGGGSRNHTEDNSTEYYDYE EARCACPARHLNNTNGTVLKLLGCHYFCNGTLCTAPDGYPCYNLTAQQVR TLTTYPNTSCAVGVCMKGTCVKNGTMEQCFKTP
[0147] SEQ ID NO: 73 comprises a first (CC-binding) tick CKBP amino acid sequence shown in SEQ ID NO: 9 and a second (CXC-binding) tick CKBP amino acid sequence shown in SEQ ID NO: 19. SEQ ID NO: 80 comprises these two tick CKBP amino acid sequences in the alternative order. More generally, a hybrid polypeptide may comprise the amino acid sequence of SEQ ID NO: 9 or a variant thereof and the amino acid sequence of SEQ ID NO: 19 or a variant thereof.
[0148] SEQ ID NO: 74 comprises a first (CC-binding amino acid sequence shown in SEQ ID NO: 29 and a second (CXC-binding) tick CKBP amino acid sequence shown in SEQ ID NO: 19. SEQ ID NO: 81 comprises these two tick CKBP amino acid sequences in the alternative order. A hybrid polypeptide may more generally comprise the amino acid sequence of SEQ ID NO: 29 or a variant thereof and the amino acid sequence of SEQ ID NO: 19 or a variant thereof.
[0149] Hybrid polypeptides comprising first, second and third (or more) chemokine binding sequences are also provided herein, including the 3-warhead evasins described below. SEQ ID NO: 92 comprises a first chemokine-binding sequence shown in SEQ ID 65, a second chemokine-binding sequence shown in SEQ ID 19, and a third chemokine-binding sequence shown in SEQ ID NO: 1, with intervening GGGGS linkers. A related hybrid polypeptide may more generally comprise the amino acid sequence of SEQ ID NO: 65 or a variant thereof, the amino acid sequence of SEQ ID NO: 19 or a variant thereof, and the amino acid sequence of SEQ ID NO: 1 or a variant thereof. The three amino acid sequences may be present in any order and may be fused contiguously or separated by any suitable linkers.
[0150] SEQ ID NO: 93 comprises a first chemokine-binding sequence shown in SEQ ID 65, a second chemokine-binding sequence shown in SEQ ID 19, and a third chemokine-binding sequence shown in SEQ ID NO: 9, with intervening GGGGS linkers. A related hybrid polypeptide may more generally comprise the amino acid sequence of SEQ ID NO: 65 or a variant thereof, the amino acid sequence of SEQ ID NO: 19 or a variant thereof, and the amino acid sequence of SEQ ID NO: 9 or a variant thereof. The three amino acid sequences may be present in any order and may be fused contiguously or separated by any suitable linkers.
[0151] Specific diseases that could be suitable for targeting with a hybrid polypeptide, and additional tick CKBP sequence combinations are described in the section therapeutic methods of the invention below.
[0152] Engineering of Hybrid Polypeptides
[0153] A hybrid polypeptide may be engineered from first and second tick CKBP polypeptides in any manner. A hybrid polypeptide may comprise a fusion of an amino acid sequence of a first tick CKBP polypeptide or a variant thereof and an amino acid sequence of a second tick CKBP polypeptide or a variant thereof. The amino acid sequences or variants thereof may be fused directly or separated by a suitable linker. Suitable linkers include, but are not limited to, chemical crosslinkers and peptide linkers. Peptide linkers are preferred if the polypeptide of the invention and second peptide or polypeptide are genetically fused. Preferred linkers are amino acid sequences (i.e. peptide linkers). A peptide linker may be of any amino acid sequence composition or length. A linker may be at least three, at least four, or at least five amino acids in length. The length, flexibility and hydrophilicity of the peptide linker are typically designed such that it does not to disturb the functions of the polypeptide of the invention. A linker is preferably selected to be conformationally flexible and may comprise one or more glycine residues, and optionally one or more serine residues. A linker may comprise in sequence at least two, at least three or least four glycine residues. A linker may consist essentially of or consist of glycine residues. Preferred flexible peptide linkers are stretches of 2 to 20, such as 4, 6, 8, 10 or 16, serine and/or glycine amino acids. Other preferred flexible linkers include (SG)1, (SG)2, (SG)3, (SG)4, (SG)5 and (SG)8 wherein S is serine and G is glycine. A particularly preferred linker sequence is GGGGS (SEQ ID NO: 75).
[0154] A hybrid polypeptide may comprise a fusion of a first tick CKBP amino acid sequence of SEQ ID NOs 1-72 or variant thereof and a second, different amino acid sequence selected from any one of SEQ ID NOs 1-72 or a variant thereof. A hybrid polypeptide may comprise a fusion of (i) an amino acid sequence selected from any one of SEQ ID NOs 1-3, 6-9, 20-23, 29, 32, and 34-44 or a variant thereof and (ii) an amino acid sequence selected from any one of SEQ ID NOs 5, 18, 19, 33 and 45-72. The amino acid sequence or variant of (i) and the amino acid sequence or variant of (ii) may be in either orientation; thus the amino acid sequence or variant of (i) may be N-terminal or C-terminal to the amino acid sequence or variant of (ii). Examples of hybrid polypeptides which are fusions of first and second tick CKBP amino acid sequences are provided by SEQ ID NOs 73, 74 and 80-81 described above.
[0155] Alternatively, a hybrid polypeptide may comprise the amino acid sequence of a second tick CKBP polypeptide or a variant thereof substituted into the amino acid sequence of a first tick CKBP polypeptide or variant thereof. Such a hybrid polypeptide comprises a substituted derivative of the amino acid sequence of the first tick CKBP polypeptide or variant thereof.
[0156] The substitution may introduce a chemokine-binding sequence provided by the amino acid sequence of the second tick CKBP polypeptide or variant thereof into the amino acid sequence of the first tick CKBP polypeptide or variant thereof. Alternatively or additionally, the substitution may remove a chemokine-binding sequence present in the amino acid sequence of the first tick CKBP polypeptide or variant thereof. The introduced chemokine-binding sequence may bind one or more chemokines. The chemokine binding sequence may bind at least one CC chemokine and/or at least one CXC chemokine.
[0157] The substitution may introduce a CXC chemokine-binding sequence from a first tick CKBP polypeptide or variant thereof into an amino acid sequence of a second tick CKBP polypeptide or variant thereof. The second tick CKBP polypeptide may not previously have any CXC-chemokine binding activity. Alternatively, the substitution may introduce an additional CXC-chemokine binding activity. The CXC chemokine-binding sequence may bind one or more of CXCL1-14, 16.
[0158] Alternatively, the substitution may introduce a CC chemokine-binding sequence from a first tick CKBP polypeptide or variant thereof into an amino acid sequence of a second tick CKBP polypeptide or variant thereof. The second tick CKBP polypeptide may not previously have any CC-chemokine binding activity. Alternatively, the substitution may introduce an additional CC-chemokine binding activity. The CC chemokine-binding sequence may bind one or more of CCL1-24, 28.
[0159] The substitution may result in a hybrid polypeptide only having chemokine-binding activity from the introduced chemokine-binding sequence. The substitution may introduce a single chemokine-binding activity. The substitution may introduce a single chemokine-binding activity and reduce or remove the original chemokine-binding activity of the tick CKBP amino acid sequence or variant thereof into which the substitution is made. The substitution may result in a hybrid polypeptide binding a reduced number of chemokines compared to the second tick CKBP polypeptide or variant thereof.
[0160] The substitution may comprise exchange of any sequence region in the amino acid sequence of the second tick CKBP polypeptide or variant thereof for any sequence region in the amino acid sequence of the first tick CKBP polypeptide or variant thereof. The substitution may be of a chemokine-binding sequence in the amino acid sequence of the first tick CKBP polypeptide or variant thereof for a chemokine-binding sequence in the amino acid sequence of the second tick CKBP polypeptide or variant thereof. Alternatively, the substitution may introduce an additional chemokine-binding sequence provided by the first tick CKBP polypeptide or variant thereof into a region of the amino acid sequence of the second tick CKBP polypeptide or variant thereof not comprising a chemokine-binding sequence.
[0161] A hybrid polypeptide may comprise a substitution of a first tick CKBP amino acid sequence of SEQ ID NOs 1-72 or variant thereof into a second, different amino acid sequence selected from any one of SEQ ID NOs 1-72 or a variant thereof. A hybrid polypeptide may comprise a substitution of (i) an amino acid sequence selected from any one of SEQ ID NOs 1-3, 6-9, 20-23, 29, 32, and 34-44 or a variant thereof into (ii) an amino acid sequence selected from any one of SEQ ID NOs 5, 18, 19, 33 and 45-72, or vice-versa. Such a hybrid polypeptide may comprise a substitution of a chemokine-binding sequence from an amino acid sequence of (i) into an amino acid sequence of (ii) or a variant thereof. Alternatively, a chemokine-binding sequence from an amino acid sequence of (ii) may be substituted into an amino acid sequence of (i) or a variant thereof.
[0162] A specific example of a hybrid polypeptide comprising a substitution of an amino acid sequence of a second tick CKBP polypeptide into the amino acid sequence of a first tick CKBP polypeptide is provided by a polypeptide comprising the amino acid sequence of SEQ ID NO: 76, shown below.
TABLE-US-00004 SEQIDNO:76(first(introduced)tickCKBP sequenceboldandunderlined;residualrecipient secondtickCKBPsequenceinitalics): VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPNCKQD CNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKET YEVCYRRNWRDEKN.
[0163] The introduced chemokine binding sequence comprised in SEQ ID NO: 76 is derived from SEQ ID NO: 3 and shown below as SEQ ID NO: 77. SEQ ID NO:77 provides a chemokine-binding sequence binding CCL8. The full-length recipient tick CKBP sequence substituted to create SEQ ID NO: 76 is a variant sequence of Evasin-1 of SEQ ID NO: 32 shown in EZ406190.1 (as discussed above), with the residual recipient sequence remaining after the substitution shown below as SEQ ID NO: 78. The sequence removed from SEQ ID NO: 32 by the substitution is shown below as SEQ ID NO: 79. A chemokine-binding sequence comprising SEQ ID NO: 79 may be used to provide one or more chemokine-binding functions of Evasin-1.
TABLE-US-00005 SEQIDNO:77: VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPN SEQIDNO:78: CKQDCNGTTETAPNGTRCFSIGDEGLRRMTANLPYDCPLGQCSNGDCI PKETYEVCYRRNWRDEKN SEQIDNO:79: EDDEDYGDLGGCPFLVAENKTGYPTIVA
[0164] The hybrid polypeptide of SEQ ID NO: 76 binds CCL8 by virtue of the introduced chemokine-binding sequence from the tick CKBP of SEQ ID NO: 3, whereas Evasin-1 natively does not have CCL8-binding activity. Accordingly, the inventors have shown the ability to isolate an independent binding function from a first tick CKBP and transport this into a second tick CKBP, resulting in a hybrid tick CKBP polypeptide with an altered chemokine binding profile.
[0165] Also provided is a hybrid polypeptide comprising the amino acid sequence of SEQ ID NO: 76 or a variant thereof substituted into the amino acid sequence of any tick CKBP polypeptide. A variant of SEQ ID NO: 76 is selected to have CCL8-binding activity. The tick CKBP polypeptide may be selected from any tick CKBP described above. The tick CKBP amino acid sequence into which the amino acid sequence of SEQ ID NO: 76 or a variant thereof is substituted may be selected from any of SEQ ID Nos 1-72 or variants thereof. The tick CKBP amino acid sequence is typically one which does not have CCL8-binding activity, such as SEQ ID NO: 32, 39, 41. The tick CKBP amino acid sequence may be selected from one having a conserved set of eight cysteines as described above, for example any one of SEQ ID NOs 1-3, 6-9, 20-23, 29, 32 and 34-44.
[0166] Also provided is a hybrid polypeptide comprising the amino acid sequence of P672_RHIPU E22-F32 (SEQ ID NO: 108) or of any one of SEQ ID NOs 88, 89 and 103-107, or a variant of any thereof substituted into the amino acid sequence of any tick CKBP polypeptide described herein. The tick CKBP polypeptide may be SEQ ID NO: 32. In one aspect, the hybrid polypeptide comprises the amino acid sequence of SEQ ID NO: 95 or a variant thereof.
[0167] Further provided is a hybrid polypeptide comprising a chemokine binding sequence of a first tick CKBP amino acid sequence or a variant thereof fused (directly or by a linker as described above) to SEQ ID NO: 78 or a variant thereof. A variant of SEQ ID NO: 78 (or of any other recipient sequence fragment derived from Evasin-1 described herein) includes the corresponding sequence fragment from Evasin-1 of SEQ ID NO: 32 (without the K92E substitution discussed herein). SEQ ID NO: 78 represents an amino acid sequence derived from Evasin-1 able to functionally accommodate a chemokine-binding sequence from another tick CKBP. The chemokine-binding sequence to be provided upstream of SEQ ID NO: 78 or a variant thereof typically binds one or more chemokines that are not bound by SEQ ID NO: 32. The chemokine-binding sequence may be derived from a first tick CKBP amino acid sequence selected from any one of SEQ ID NOs 1-3, 6-9, 20-23, 29, 32 and 34-44.
[0168] The inventors have also shown that a greater extent of sequence may be introduced from the tick CKBP of SEQ ID NO: 3 into Evasin-1, and a lesser extent of recipient sequence retained, while providing a hybrid polypeptide binding CCL8. This demonstrates flexibility in substitution of chemokine-binding sequences from one tick CKBP into another tick CKBP. Thus, the additional substituted hybrid polypeptides of SEQ ID NOs 82 and 83 are provided, as shown below. The first (introduced) tick CKBP sequence is bold and underlined; and the residual recipient second tick CKBP sequence in italics): The introduced and recipient tick CKBP sequences are shown below as SEQ ID NOs 84-85 (derived from SEQ ID NO: 82) and SEQ ID NOs: 86-87 (derived from SEQ ID NO: 83).
TABLE-US-00006 SEQIDNO:82: VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPNCTVV CTNNTAWWNDTKSDGGHCYSEYRPEKRTHSREIYNCTIGVCGNGDCIP KETYEVCYRRNWRDEKN SEQIDNO:83: VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPNCTVV CTNNTAWWNDTKSDGGHCFSIGDEGLRRMTANLPYDCPLGQCSNGDCI PKETYEVCYRRNWRDEKN SEQIDNO:84: VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPNCTVV CTNNTAWWNDTKSDGGHCYSEYRPEKRTHSREIYNCTIGVCGNG SEQIDNO:85: DCIPKETYEVCYRRNWRDEKN SEQIDNO:86: VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPNCTVV CTNNTAWWNDTKSDGGHC SEQIDNO:87: FSIGDEGLRRMTANLPYDCPLGQCSNGDCIPKETYEVCYRRNWRDEKN
[0169] Also provided herein is a hybrid polypeptide comprising the amino acid sequence of SEQ ID NO: 84 or 86 or a variant of either thereof substituted into the amino acid sequence of any tick CKBP polypeptide. A variant of SEQ ID NO: 84 or 86 is selected to have CCL8-binding activity. Additionally described herein is a hybrid polypeptide comprising a chemokine binding sequence of a first tick CKBP amino acid sequence or a variant thereof fused (directly or by a linker as described above) to SEQ ID NO: 85 or 87 or a variant of either thereof.
[0170] Thus, a range of hybrid polypeptides may be provided based on substitution of a chemokine-binding sequence of a first tick CKBP polypeptide into the amino acid sequence of a second tick CKBP polypeptide. Hybrid polypeptides may also be provided which comprise one or more substituted tick CKBP amino acid sequences as described above (comprising a chemokine-binding sequence derived from a first tick CKBP amino acid sequence) fused directly or via a linker region with one or more additional tick CKBP amino acid sequences or variant thereof. Thus, a hybrid polypeptide may comprise a chemokine-binding sequence derived from a first tick CKBP polypeptide and additional tick CKBP amino acid sequences, for example one or two additional tick CKBP amino acid sequences or variants thereof. Such additional tick CKBP amino acid sequences may be selected from any one of SEQ ID NOs 1-72. The combination of one or more chemokine-binding sequences (which may be specific for a single chemokine) and one or more additional tick CKBP amino acid sequences may assist provision of a specific chemokine-binding profile of interest.
[0171] Chemokine-Binding Sequences
[0172] Identification of a suitable chemokine-binding sequence and selection of a region for substitution may be performed by various means. The inventors have identified that discrete contiguous sequence regions of tick CKBP polypeptides encode chemokine-binding activity. Thus, a tick CKBP polypeptide may be truncated N- or C-terminally and a series of truncated polypeptides then screened for binding activity for one or more chemokines bound by the full-length tick CKBP. Where the tick CKBP polypeptide has a conserved set of eight cysteine residues as discussed above, the inventors' analysis in relation to polypeptides of this group (SEQ ID Nos 3 and 32) indicates that one or more chemokine binding activities are typically present in an N-terminal region. Thus, C-terminal truncations of SEQ ID NOs 1-3, 6-9, 20-23, 29, 32 and 34-44 may be preferable when providing a chemokine-binding sequence based on any of the above tick CKBP polypeptides.
[0173] The chemokine-binding sequence may be identified by hydrogen-deuterium exchange mass spectrometry (HDX-MS). The amino acid residues involved in the interface between a chemokine and a tick CKBP polypeptides can be identified and a chemokine-binding sequence inferred. Thus, a tick CKBP polypeptide may result from N- and/or C-terminal truncations of a tick CKBP polypeptide. A tick chemokine binding polypeptide may be truncated N- and/or C-terminally and/or be chemically modified. A series of truncated and/or modified polypeptides may be screened for binding activity for one or more chemokines bound by the full-length tick CKBP. A tick chemokine binding polypeptide may be extended N- and/or C-terminally and/or chemically modified.
[0174] The chemokine binding sequence may be at least 10, at least 11, at least 12, at least 15, at least 16, at least 17, at least 20, at least 30, at least 40, at least 50, at least 80 or at least 90 amino acids in length, depending on the particular tick CKBP. The chemokine binding sequence may be of 20-100, 20-90, 20-70, 20-60, 20-50, 10-100, 11-100, 12-100, 16-100, 11-70, 11-60, 11-50, 11-17 amino acids in length. Corresponding N- or C-terminal truncations may be made to any tick CKBP polypeptide described herein to provide a chemokine-binding sequence, and also a recipient sequence able to accommodate a chemokine-binding sequence derived from another tick CKBP.
[0175] A chemokine-binding sequence may thus be identified by performing a chemokine binding assay on truncation variants of a tick CKBP polypeptide, such as the biointerferometry assay described in Table 2A, and also in [17]. Other suitable binding assays include HDX-MS, mass spectrometry (MS) dimerization, Alphascreen, surface plasmon resonance, microscale thermophoresis, fluorescent polarization, and FRET based assays. The tick CKBP polypeptide may be truncated to provide a minimal chemokine-binding sequence (for one or more chemokines of interest), and not include other sequence of the tick CKBP polypeptide not essential for the relevant chemokine-binding activity. Truncation variants of a first tick CKBP amino acid sequence that comprise chemokine-binding sequences may also be screened for their ability to inhibit or neutralize chemokine activity, for example by performing a chemokine-induced cell migration assay, for example the assay as described in Table 3, or as described in
[0176] A variant of SEQ ID NOs: 88, 89 or 105 to 107 preferably retains one or more, two or more, three or more, preferably four N-terminal acidic amino acid residues. A variant of SEQ ID NOs: 88, 89 or 103 to 107 preferably does not substitute Pro27 for another amino acid (numbering according to the P672_RHIPU parental evasin, SEQ ID NO: 3). A variant of SEQ ID NOs: 89 or 104 to 107 preferably does not substitute Cys30 for alanine (numbering according to the P672_RHIPU parental evasin, SEQ ID NO: 3). A variant of SEQ ID NOs: 88, 89 or 103 to 107 may comprise a substitution of one or more other amino acid residues to alanine or a similar amino acid residue. Such changes do not significantly affect the ability of the peptide to specifically bind CCL8 (see
[0177] A truncated tick CKBP polypeptide such as SEQ ID NO: 89 may also be extended N- and/or C-terminally and variants screened for their ability to inhibit or neutralize chemokine activity, for example by performing suitable binding assays such as those described above. For example, the fluorescent polarization, MS dimerization, Alphascreen and cell migration assays described in
[0178] Examples of functional substituted variants are provided by peptide BK1.1 (SEQ ID NO: 88). Peptide BK1.1 retained the ability of the parental (BK1.5, SEQ ID NO: 89) peptide to bind chemokines CCL7, CCL8 and CCL18, which is retained with or without an N-terminal FITC molecule (
[0179] Also provided is a method of treating or preventing in a subject one or more diseases associated with CCL2, CCL3, CCL7, CCL8 and/or CCL18, the method comprising administering to the subject a polypeptide selected from any of SEQ ID NOs: 88, 89, 103 to 109, or a variant thereof. The disease is preferably a disease associated with CCL8. The polypeptide is preferably SEQ ID NO: 106.
[0180] A tick CKBP polypeptide may also be modified. Examples of modification include addition of an N-terminal tyrosine residue or presence of an intra- or inter-polypeptide disulfide bond (see for example BK1.3 peptide,
[0181] A consensus sequence for a functional variant peptide based on SEQ ID NO: 88, 89 or 103 to 107 is also provided herein. A variant of SEQ ID NO: 88, 89 or 105 to 107 may retain one or more N-terminal acidic amino acid residues, such as EDED. A variant of SEQ ID NO: 88, 89 or 103 to 107 may retain Pro27 and/or Cys30 (numbering according to the parental P672_RHIPU evasin, SEQ ID NO: 3). Other amino acid residues may be removed, added and/or substituted, such as for alanine or a similar amino acid residue. Said variant preferably specifically binds CCL8.
[0182] SEQ ID NOs: 103-107, and more preferably SEQ ID NO: 106 may be used alone as a chemokine-binding agent or as a chemokine-binding sequence in any hybrid polypeptide described herein.
[0183] The hybrid polypeptide having a chemokine-binding sequence introduced from the first tick CKBP polypeptide can be confirmed as having the transferred chemokine-binding activity by performing similar binding, inhibition and/or neutralization assays for the relevant chemokine(s).
[0184] Additionally, chemokine-binding sequences may be identified based on sequence alignment and structural modelling of tick CKBPs.
[0185] Structural modelling may also be used to assist determination of chemokine-binding sequences. A published structure is available for Evasin-1 (3FPU, SEQ ID NO: 32)[22]), in complex with CCL3. As described in
[0186] Structural analysis may also identify residues that make inter-chain hydrogen or salt bridges and suitable points of transfer that do not disrupt structural folds or motifs, assisting selection of a discrete chemokine-binding sequence and a position for introduction of a chemokine-binding sequence in a recipient tick CKBP amino acid sequence. The models shown in
Novel Tick CKBPs of the Invention
[0187] The invention further provides a polypeptide comprising (a) all or part of an amino acid sequence shown in any one of SEQ ID NOs 45-72 or (b) all or part of an amino acid sequence having at least 70% homology or identity to a sequence of (a) over its entire length, wherein said polypeptide binds at least one CXC-class chemokine. SEQ ID NOs 45-72 represent tick CKBP amino acid sequences newly identified and functionally characterised as binding CXC chemokines by the inventors.
[0188] The sequence of (a) may be an amino acid sequence shown in any one of SEQ ID NOs 45-60 and 64-65. In such an embodiment, the polypeptide binds one or more human chemokines selected from CXCL7, CXCL9, CXCL10, CXCL11 and CXCL12.
[0189] The sequence of (a) may be an amino acid sequence shown in any one of SEQ ID NOs 45-48, 51-53, 56, 59, 60, and 65. In this embodiment, the polypeptide binds one or more human chemokines selected from CXCL7, CXCL9, and CXCL11.
[0190] The polypeptide can be any length. The polypeptide is preferably at least 40 amino acids in length, such as at least 50, at least 60, at least 70 or at least 80 amino acids in length. The polypeptide is preferably 250 amino acids or fewer in length, such as 200 amino acids or fewer, 150 amino acids or fewer or 100 amino acids or fewer in length. The length of the polypeptide typically depends on the length of any one of SEQ ID NOs 45-72. Deletions and/or extension are allowable in accordance with the invention as discussed in detail below. The polypeptide is typically from 40 to 250 amino acids in length, such as from 45 to 200 amino acids in length or from 50 to 160 amino acids in length.
[0191] The polypeptide is typically formed from naturally-occurring amino acids. The polypeptide may contain non-naturally-occurring amino acids. The polypeptide typically comprises L-amino acids. The polypeptide may comprise D-amino acids.
[0192] The selection of variants of SEQ ID NOs: 45 to 72 as discussed below is also applicable to selection of variants of any of SEQ ID NOs 1-44, 73-74 and 76-94. A variant of any one of SEQ ID NOs: 45 to 72 is a polypeptide that has an amino acid sequence which varies from that of any one of SEQ ID NOs: 45 to 72 and has the ability to bind to one or more chemokines. A variant of any one of SEQ ID NOs: 45 to 72 may be a polypeptide that has an amino acid sequence which varies from that of any one of SEQ ID NOs: 45 to 72 and has the ability to bind to and inhibit one or more chemokines.
[0193] The variant preferably binds and preferably inhibits one or more or all of the same chemokines as the sequence on which the variant is based. For instance, a variant of SEQ ID NO: 45 is a polypeptide that has an amino acid sequence which varies from that of SEQ ID NO: 45 and has the ability to bind to the chemokine shown in SEQ ID NO: 45's row in Table 6 (CXCL9). The same is true for any of SEQ ID NOs: 46 to 72. Thus, variants of the tick CKBPs as described above preferably bind to and preferably inhibit the same chemokines as the sequence on which the variant is based.
[0194] The ability of a variant to bind to and preferably inhibit a chemokine can be assayed using any method known in the art. Suitable methods are described in the Examples and Figures, and include yeast surface display and biolayer interferometry (for binding) and chemotaxis assays (for inhibition).
[0195] The variant may be a naturally occurring variant which is expressed naturally, for instance in ticks. Alternatively, the variant may be expressed in vitro or recombinantly as discussed below. Variants also include non-naturally occurring variants produced by recombinant technology.
[0196] Over the entire length of the amino acid sequence of any one of SEQ ID NOs: 45 to 72 (or SEQ ID NOs 1-44, 73-74 and 76-94), a variant will preferably be at least 70% homologous or identical to that sequence. More preferably, the variant may have at least 75%, at least 80%, at least 85%, at least 90% and more preferably at least 95%, 97% or 99% homology or amino acid identity to the amino acid sequence of any one of SEQ ID NOs: 35 to 62 over the entire sequence. There may be at least 80%, for example at least 85%, 90% or 95%, homology or amino acid identity over a stretch of 20 or more, for example 30, 40, 50, 60, 70, or more, contiguous amino acids (hard homology or hard identity).
[0197] Standard methods in the art may be used to determine homology. For example the UWGCG Package provides the BESTFIT program, which can be used to calculate homology, for example used on its default settings (Devereux et al (1984) Nucleic Acids Research 12, p387-395). The PILEUP and BLAST algorithms can be used to calculate homology or line up sequences (such as identifying equivalent residues or corresponding sequences (typically on their default settings)), for example as described in Altschul S. F. (1993) J Mol Evol 36:290-300; Altschul, S. F et al (1990) J Mol Biol 215:403-10. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (ncbi.nlm.nih.gov).
[0198] Amino acid substitutions may be made to the amino acid sequences of SEQ ID NOs: 45 to 72 (or SEQ ID NOs 1-44, 73-74 and 76-107), for example up to 1, 2, 3, 4, 5, 10, 20, 30 or 50 substitutions. Conservative substitutions replace amino acids with other amino acids of similar chemical structure, similar chemical properties or similar side-chain volume. The amino acids introduced may have similar polarity, hydrophilicity, hydrophobicity, basicity, acidity, neutrality or charge to the amino acids they replace. Alternatively, the conservative substitution may introduce another amino acid that is aromatic or aliphatic in the place of a pre-existing aromatic or aliphatic amino acid. Conservative amino acid changes are well-known in the art and may be selected in accordance with the properties of the 20 main amino acids as defined in Table 9 below. Where amino acids have similar polarity, this can also be determined by reference to the hydropathy scale for amino acid side chains in Table 10.
TABLE-US-00007 TABLE 9 Chemical properties of amino acids Ala aliphatic, hydrophobic, neutral Met hydrophobic, neutral Cys polar, hydrophobic, neutral Asn polar, hydrophilic, neutral Asp polar, hydrophilic, charged () Pro hydrophobic, neutral Glu polar, hydrophilic, charged () Gln polar, hydrophilic, neutral Phe aromatic, hydrophobic, neutral Arg polar, hydrophilic, charged (+) Gly aliphatic, neutral Ser polar, hydrophilic, neutral His aromatic, polar, hydrophilic, Thr polar, hydrophilic, neutral charged (+) Ile aliphatic, hydrophobic, neutral Val aliphatic, hydrophobic, neutral Lys polar, hydrophilic, charged(+) Trp aromatic, hydrophobic, neutral Leu aliphatic, hydrophobic, neutral Tyr aromatic, polar, hydrophobic
TABLE-US-00008 TABLE 10 Hydropathy scale Side Chain Hydropathy Ile 4.5 Val 4.2 Leu 3.8 Phe 2.8 Cys 2.5 Met 1.9 Ala 1.8 Gly 0.4 Thr 0.7 Ser 0.8 Trp 0.9 Tyr 1.3 Pro 1.6 His 3.2 Glu 3.5 Gln 3.5 Asp 3.5 Asn 3.5 Lys 3.9 Arg 4.5
[0199] One or more amino acids of the amino acid sequence of any one of SEQ ID NOs: 45 to 72 may additionally be deleted from the polypeptides described above. Up to 1, 2, 3, 4, 5, 10, 20 or 30 amino acids may be deleted, or more.
[0200] Variants may include fragments of any one of SEQ ID NOs: 45 to 72. Such fragments typically retain a chemokine-binding sequence (for one or more chemokines) of any one of SEQ ID NOs: 45 to 72. Fragments may be at least 40, at least 50, at least 60, at least 70, at least 80, at least 90 or at least 100 amino acids in length.
[0201] One or more amino acids may be alternatively or additionally added to the polypeptides described above. Put another way, the polypeptide may comprise a sequence consisting of any one of SEQ ID NOs: 45 to 72 or a variant thereof having an N-terminal and/or C-terminal extension of a number of amino acids. The N-terminal and/or C-terminal extension may comprise 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acids or more, such as 15, 20, 30, 40, 50 or 100 amino acids.
Variants of Other Tick CKBP Amino Acid Sequences
[0202] Variants of other tick CKBP amino acid sequences described herein (such as SEQ ID NOs 1-44) are typically selected according to the same principles described above for variants of SEQ ID NOs 45-72. Thus, a variant of a first tick CKBP amino acid sequence selected for inclusion in a hybrid polypeptide, and a variant of a second tick CKBP polypeptide also selected for inclusion in the hybrid polypeptide (as described above) may comprise (a) part of the relevant tick CKBP amino acid sequence or (b) all or part of an amino acid sequence having at least 70% homology or identity to the relevant tick CKBP amino acid sequence over its entire length. The variant may comprise any extent of length of the tick CKBP amino acid sequence as described above. The variant may comprise any degree of homology or identity to the relevant tick CKBP amino acid sequence as described above, such as at least 75%, at least 80%, at least 85%, at least 90% and more preferably at least 95%, 97% or 99% homology or amino acid identity to the amino acid sequence of the relevant tick CKBP amino acid sequence over the entire sequence. The variant may comprise substitutions or represent a fragment or extension of the tick CKBP amino acid sequence as described above. Typically the variant binds to and preferably inhibits one or more of the same chemokines as the tick CKBP amino acid sequence on which it is based. Chemokine binding for SEQ ID NOs 1-72 is shown in Tables 2, 4 and 6 above. Thus, a variant of a given tick CKBP amino acid sequence selected from SEQ ID NOs 1-72 may bind to (and preferably inhibit) one or more of, or all of the chemokines shown to be bound by the relevant tick CKBP polypeptide in Tables 2, 4 and 6.
[0203] The invention additionally provides variants of the hybrid polypeptides of SEQ ID NOs 73, 74, 76, 80-82 and 92-95, or of the chemokine-binding and recipient sequences of SEQ ID NOs 76-78, 84-89 and 103-107 selected accorded to similar principles to those described above. Such variants may be selected to have the same chemokine binding as the above hybrid polypeptides or chemokine-binding sequences as described herein, or the same ability to act as recipient for a chemokine binding sequence, and for example to comprise a degree of identity or homology to SEQ ID NOs 73, 74, 76-78, 80-89, 92-94 and 103-107 as described above.
Polypeptides
[0204] Any references to polypeptides herein encompass the hybrid polypeptides discussed above, and the novel tick CKBP polypeptides described above, unless indicated otherwise.
[0205] The invention encompasses any pharmaceutically acceptable salt of a polypeptide described herein. Said pharmaceutically acceptable salts include, for example, mineral acid salts such as chlorides, hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like; and salts of monocationic metal ions such as sodium and potassium and the like; and salts of bases such as ammonia. A hydrochloride salt or an acetate salt is preferred.
[0206] The polypeptide may be labelled with a detectable label. The detectable label may be any suitable label which allows the polypeptide to be detected. Suitable labels include, but are not limited to, fluorescent molecules, radioisotopes, e.g. .sup.125I, .sup.35S, enzymes, antibodies, antigens, polynucleotides and ligands such as biotin. The label is preferably a tracer that is suitable for positron emission tomography (PET), such as fluorine (.sup.18F). The label is preferably a tracer suitable for magnetic resonance imaging (MRI), such as fluorine (.sup.19F). The label may be a Fluorescein isothiocyanate (FITC) moiety.
[0207] The polypeptides of the invention may be made in any way. They may be made in accordance with the invention as discussed in more detail below.
[0208] The polypeptides described herein can be prepared by any suitable technique.
[0209] Alternatively, the polypeptide may be made by solid-phase peptide synthesis (SPPS) is a preferred technique. This involves formation of the peptide on small solid beads. Using SPPS, the polypeptide remains covalently attached to a bead during synthesis. The polypeptide is synthesised using repeated cycles of coupling-washing-deprotection-washing. In particular, the free N-terminal amine of a solid-phase attached polypeptide is coupled to a single N-protected amino acid unit. This unit is then deprotected, revealing a new N-terminal amine to which a further protected amino acid is attached. These steps are repeated until the polypeptide is complete. The polypeptide is then cleaved from the beads using a suitable reagent.
[0210] Suitable protecting groups, reagents, solvents and reaction conditions for SPPS are well known to those skilled in the art and as such conditions can be determined by one skilled in the art by routine optimization procedures.
[0211] Pharmaceutically acceptable salts of polypeptides can be prepared by any suitable technique. Typically, salification involves reaction of the polypeptide or a salt thereof with a suitable reagent, typically acid, to obtain the pharmaceutically acceptable salt selected.
[0212] For example, a hydrochloride salt of a polypeptide can be prepared by initially cleaving the polypeptide from the solid phase using trifluoroacetic acid. The polypeptide will thus initially be a trifluoroacetate salt. The trifluoroacetate salt can then be converted into a hydrochloride salt by any known technique, such as ion exchange on a suitable column using hydrochloric acid as an eluent.
[0213] The polypeptide or polypeptide salt products can be purified, where required, by any suitable technique. High pressure liquid chromatography (HPLC) can be used, for example.
[0214] The term polypeptide includes not only molecules in which amino acid residues are joined by peptide (CONH) linkages but also molecules in which the peptide bond is reversed. Such retro-inverso peptidomimetics may be made using methods known in the art, for example such as those described in Meziere et al (1997) J. Immunol. 159, 3230-3237. This approach involves making pseudopolypeptides containing changes involving the backbone, and not the orientation of side chains.
[0215] Similarly, the peptide bond may be dispensed with altogether provided that an appropriate linker moiety which retains the spacing between the carbon atoms of the amino acid residues is used; it is particularly preferred if the linker moiety has substantially the same charge distribution and substantially the same planarity as a peptide bond. It will also be appreciated that the peptide may conveniently be blocked at its N-or C-terminus so as to help reduce susceptibility to exoproteolytic digestion. For example, the N-terminal amino group of the polypeptides may be protected by reacting with a carboxylic acid and the C-terminal carboxyl group of the peptide may be protected by reacting with an amine. Other examples of modifications include glycosylation and phosphorylation. Another potential modification is that hydrogens on the side chain amines of R or K may be replaced with methylene groups (NH.sub.2.fwdarw.
[0216] NH(Me) or N(Me).sub.2). Other potential modifications include thioether cyclization and intra- and/or inter-peptide disulphide bonds.
[0217] Polypeptides according to the invention may also include peptide variants that increase or decrease the polypeptide's half-life in vivo. Examples of analogues capable of increasing the half-life of polypeptides used according to the invention include peptoid analogues of the peptides, D-amino acid derivatives of the peptides, and peptide-peptoid hybrids. A further embodiment of the variant polypeptides used according to the invention comprises D-amino acid forms of the polypeptide. The preparation of polypeptides using D-amino acids rather than L-amino acids greatly decreases any unwanted breakdown of such an agent by normal metabolic processes, decreasing the amounts of agent which needs to be administered, along with the frequency of its administration.
[0218] The polypeptides may also be derived from amino acid mutants, glycosylation variants and other covalent derivatives of the parent polypeptides. Exemplary derivatives include molecules wherein the polypeptides of the invention are covalently modified by substitution, chemical, enzymatic, or other appropriate means with a moiety other than a naturally occurring amino acid. Further included are naturally occurring variant amino acid sequences of the parent polypeptides. Such a variant amino acid sequence may be encoded by an allelic variant or represent an alternative splicing variant.
[0219] Modifications as described above may be prepared during synthesis of the peptide or by post-production modification, or when the polypeptide is in recombinant form using the known techniques of site-directed mutagenesis, random mutagenesis, or enzymatic cleavage and/or ligation of nucleic acids.
[0220] The polypeptides described herein may also be modified to improve physicochemical characteristics. Thus, for example, original amino acid sequences may be altered to improve their solubility, and accordingly a polypeptide of the invention having a variant sequence will preferably be more soluble than a polypeptide having the corresponding original amino acid sequence under equivalent conditions. Methods for evaluating the solubility of polypeptides are well known in the art.
[0221] The present invention also provides a fusion polypeptide comprising fusion polypeptide comprising a polypeptide of the invention linked to a second peptide or polypeptide. The polypeptide of the invention may be any of those discussed above. The polypeptide of the invention is typically covalently linked to the second peptide or polypeptide. The polypeptide of the invention is typically genetically fused to the second peptide or polypeptide. The polypeptide of the invention is genetically fused to the second peptide or polypeptide if the whole construct is expressed from a single polynucleotide sequence. The coding sequences of the polypeptide of the invention and the second peptide or polypeptide may be combined in any way to form a single polynucleotide sequence encoding the construct. They may be genetically fused in any configuration. They are typically fused via their terminal amino acids. For instance, the amino terminus of the polypeptide of the invention may be fused to the carboxy terminus of the second peptide or polypeptide and vice versa.
[0222] The polypeptide of the invention may be attached directly to the second peptide or polypeptide. The polypeptide of the invention is preferably attached to the second peptide or polypeptide using one or more linkers. The one or more linkers may be designed to constrain the mobility of the polypeptides. Suitable linkers include, but are not limited to, chemical crosslinkers and peptide linkers. Peptide linker are preferred if the polypeptide of the invention and second peptide or polypeptide are genetically fused. Preferred linkers are amino acid sequences (i.e. peptide linkers). The length, flexibility and hydrophilicity of the peptide linker are typically designed such that it does not to disturb the functions of the polypeptide of the invention. Preferred flexible peptide linkers are stretches of 2 to 20, such as 4, 6, 8, 10 or 16, serine and/or glycine amino acids. More preferred flexible linkers include (SG)1, (SG)2, (SG)3, (SG)4, (SG)5 and (SG)8 wherein S is serine and G is glycine. Preferred rigid linkers are stretches of 2 to 30, such as 4, 6, 8, 16 or 24, proline amino acids. More preferred rigid linkers include (P)12 wherein P is proline. The polypeptide of the invention may be attached to the second peptide or polypeptide via the side chains of the amino acid residues. Such attachments include thioether and disulphide bonds.
[0223] The polypeptide of the invention may be transiently attached to the second peptide or polypeptide by a hex-his tag or Ni-NTA. They may also be modified such that they transiently attach to each other. The polypeptide of the invention may also be attached to the second peptide or polypeptide via cysteine linkage. This can be mediated by a bi-functional chemical linker or by a polypeptide linker with a terminal presented cysteine residue.
[0224] The second peptide or polypeptide may be any peptide or protein. The second protein is preferably a fragment crystallizable region (Fc region). The Fc region may be from any of the types of subject discussed below. Fc region is preferably human. The Fc region may derived from any isotype of antibody, such as IgA, IgD, IgG, IgE or IgM.
[0225] The second peptide or polypeptide may be an epitope tag or purification tag or cell-surface display tag or a tag that enables or facilitates systemic peptide delivery or delivery and targeting to a specific organ or to a tumour, or facilitates transfer across a barrier such as skin or gut or blood brain barrier. Suitable tags are known in the art. Suitable tags include, but are not limited to, AviTag, calmodulin-tag, polyglutamate tag, E-tag, FLAG-tag, HA-tag, His-tag, Myc-tag, S-tag, SBP-tag, Softag 1, Softag 3, Strep-tag, TC tag, V5 tag, VSV-tag, Xpress tag, Isopeptag, SpyTag, SnoopTag, BCCP (Biotin Carboxyl Carrier Protein), Glutathione-S-transferase-tag, Green fluorescent protein-tag, Halo-tag, Maltose binding protein-tag, Nus-tag, Thioredoxin-tag, Strep-tag, Skin permeating and cell entering (SPACE)-tag, TD1-tag, magainin tag, TAT-tag, penetratin-tag, cell penetrating peptide (CPP)-tag, Fc tag. The second peptide or polypeptide may be a signal peptide, such as an IgK peptide.
[0226] The fusion polypeptide may be labelled with a detectable label. The detectable label may be any of those discussed above.
Polypeptide Combinations of the Invention
[0227] The invention also provides a combination of two or more polypeptides of the invention, i.e. two or more different polypeptides of the invention. The combination may comprise two or more polypeptides of the invention, two or more fusion polypeptides of the invention or a two or more of both types of polypeptide.
[0228] The combination may comprise any number of different polypeptides of the invention. For instance, the combination may comprise 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or 31 different polypeptides of the invention. The combination may comprise 10 or more, 20 or more, 30 or more, 40 or more or 50 or more polypeptides of the invention.
[0229] One or more of, such as all of, the polypeptides in the combination may be labelled with a detectable label. The label may be any of those discussed above. Different polypeptides in the combination may be labelled with the same detectable label or different detectable labels.
Polynucleotides of the Invention
[0230] The invention also provides a polynucleotide which encodes a polypeptide of the invention. The polypeptide may be any of those discussed above.
[0231] The invention also provides a polynucleotide which encodes a fusion polypeptide of the invention. The fusion polypeptide is preferably genetically fused as discussed above.
[0232] The invention also provides a polynucleotide which encodes a combination of the invention. The coding sequences for the two or more polypeptides in the combination may be present in a single polynucleotide of the invention. This is typically the case when the combination is encoded by a single vector of the invention.
[0233] A polynucleotide, such as a nucleic acid, is a polymer comprising two or more nucleotides. The nucleotides can be naturally occurring or artificial. A nucleotide typically contains a nucleobase, a sugar and at least one linking group, such as a phosphate, 2O-methyl, 2 methoxy-ethyl, phosphoramidate, methylphosphonate or phosphorothioate group. The nucleobase is typically heterocyclic. Nucleobases include, but are not limited to, purines and pyrimidines and more specifically adenine (A), guanine (G), thymine (T), uracil (U) and cytosine (C). The sugar is typically a pentose sugar. Nucleotide sugars include, but are not limited to, ribose and deoxyribose. The nucleotide is typically a ribonucleotide or deoxyribonucleotide. The nucleotide typically contains a monophosphate, diphosphate or triphosphate. Phosphates may be attached on the 5 or 3 side of a nucleotide.
[0234] Nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), 5-methylcytidine monophosphate, 5-methylcytidine diphosphate, 5-methylcytidine triphosphate, 5-hydroxymethylcytidine monophosphate, 5-hydroxymethylcytidine diphosphate, 5-hydroxymethylcytidine triphosphate, cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (dADP), deoxyadenosine triphosphate (dATP), deoxyguanosine monophosphate (dGMP), deoxyguanosine diphosphate (dGDP), deoxyguanosine triphosphate (dGTP), deoxythymidine monophosphate (dTMP), deoxythymidine diphosphate (dTDP), deoxythymidine triphosphate (dTTP), deoxyuridine monophosphate (dUMP), deoxyuridine diphosphate (dUDP), deoxyuridine triphosphate (dUTP), deoxycytidine monophosphate (dCMP), deoxycytidine diphosphate (dCDP) and deoxycytidine triphosphate (dCTP), 5-methyl-2-deoxycytidine monophosphate, 5-methyl-2-deoxycytidine diphosphate, 5-methyl-2-deoxycytidine triphosphate, 5-hydroxymethyl-2-deoxycytidine monophosphate, 5-hydroxymethyl-2-deoxycytidine diphosphate and 5-hydroxymethyl-2-deoxycytidine triphosphate. The nucleotides are preferably selected from AMP, TMP, GMP, UMP, dAMP, dTMP, dGMP or dCMP.
[0235] The nucleotides may contain additional modifications. In particular, suitable modified nucleotides include, but are not limited to, 2amino pyrimidines (such as 2-amino cytidine and 2-amino uridine), 2-hyrdroxyl purines (such as, 2-fluoro pyrimidines (such as 2-fluorocytidine and 2fluoro uridine), hydroxyl pyrimidines (such as 5--P-borano uridine), 2-O-methyl nucleotides (such as 2-O-methyl adenosine, 2-O-methyl guanosine, 2-O-methyl cytidine and 2-O-methyl uridine), 4-thio pyrimidines (such as 4-thio uridine and 4-thio cytidine) and nucleotides have modifications of the nucleobase (such as 5-pentynyl-2-deoxy uridine, 5-(3-aminopropyl)-uridine and 1,6-diaminohexyl-N-5-carbamoylmethyl uridine).
[0236] One or more nucleotides in the polynucleotide can be oxidized or methylated. One or more nucleotides in the polynucleotide may be damaged. For instance, the polynucleotide may comprise a pyrimidine dimer. Such dimers are typically associated with damage by ultraviolet light.
[0237] The nucleotides in the polynucleotide may be attached to each other in any manner. The nucleotides may be linked by phosphate, 2O-methyl, 2 methoxy-ethyl, phosphoramidate, methylphosphonate or phosphorothioate linkages. The nucleotides are typically attached by their sugar and phosphate groups as in nucleic acids. The nucleotides may be connected via their nucleobases as in pyrimidine dimers.
[0238] The polynucleotide can be a nucleic acid, such as deoxyribonucleic acid (DNA) or a ribonucleic acid (RNA). The polynucleotide may be any synthetic nucleic acid known in the art, such as peptide nucleic acid (PNA), glycerol nucleic acid (GNA), threose nucleic acid (TNA), locked nucleic acid (LNA), morpholino nucleic acid or other synthetic polymers with nucleotide side chains. The polynucleotide may be single stranded or double stranded.
[0239] The polynucleotide sequence encodes the relevant polypeptide(s) on the basis of the genetic code, including its degeneracy.
[0240] The polynucleotide may be a ribonucleic acid modified to reduce immunogenicity and increase stability for instance by substitution of uridine and cytidine with 1-methylpseudouridine and 5-methylcytidine, and/or placing an Anti-Reverse Cap Analog (ARCA) cap at the 5 end. Such modified ribonucleic acids can be delivered using nanoparticles and other transfection reagents ([38-41]).
[0241] Polynucleotide sequences may be derived and replicated using standard methods in the art, for example using PCR involving specific primers. It is straightforward to generate polynucleotide sequences using such standard techniques. These are discussed in more detail below.
Polynucleotide Combinations of the Invention
[0242] The invention also provides a combination of two or more polynucleotides each of which encodes a polypeptide of the invention, i.e. each of which encodes a different polypeptide of the invention. The combination may encode two or more polypeptides of the invention, two or more fusion polypeptides of the invention or a two or more of both types of polypeptide.
[0243] The combination may comprise any number of different polynucleotides. For instance, the combination may comprise 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or 31 different polynucleotide of the invention. The combination may comprise 10 or more, 20 or more, 30 or more, 40 or more or 50 or more polynucleotides of the invention.
Vectors of the Invention
[0244] The invention also provides a vector comprising a polynucleotide of the invention or a combination of two or more polynucleotides of the invention.
[0245] The vector may be a cloning vector. The amplified sequences may be incorporated into a recombinant replicable vector such as a cloning vector. The vector may be used to replicate the polynucleotide in a compatible host cell. Thus polynucleotide sequences may be made by introducing the polynucleotide into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
[0246] The vector may be recovered from the host cell. Suitable host cells for cloning of polynucleotides are known in the art and described in more detail below. The vector may be an expression vector. The polynucleotide sequence may be cloned into any suitable expression vector. In an expression vector, the polynucleotide of the invention or the combination of the invention is typically operably linked to a control sequence which is capable of providing for the expression of the polynucleotide or the combination by the host cell. Such expression vectors can be used to express one or more polypeptides of the invention.
[0247] The term operably linked refers to a juxtaposition wherein the components described are in a relationship permitting them to function in their intended manner. A control sequence operably linked to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under conditions compatible with the control sequences. Multiple copies of the same or different polynucleotide may be introduced into the vector.
[0248] The term control sequence is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g. transcription termination signals, such as polyadenylation signals and poly-U sequences). Such control sequences are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif (1990). Control sequences include those that direct constitutive expression of a nucleotide sequence in many types of brain cell and those that direct expression of the nucleotide sequence only in certain brain cells. A non-limiting example of a suitable neuron-specific promoters include the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477.
[0249] Control sequences may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g. 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g. 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g. 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Examples of pol III promoters include, but are not limited to, U6 and H1 promoters. Examples of pol II promoters include, but are not limited to, the retroviral Rous sarcoma virus (RSV) LTR promoter (optionally with the RSV enhancer), the cytomegalovirus (CMV) promoter (optionally with the CMV enhancer) [see, e.g., Boshart et al, Cell, 41:521-530 (1985)], the SV40 promoter, the dihydrofolate reductase promoter, the -actin promoter, the phosphoglycerol kinase (PGK) promoter, and the EFla promoter. Also encompassed by the term control sequence are enhancer elements, such as WPRE; CMV enhancers; the R-U5 segment in LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1), p. 466-472, 1988); SV40 enhancer; and the intron sequence between exons 2 and 3 of rabbit -globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), p. 1527-31, 1981). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc. With regards to control sequences, mention is made of U.S. patent application Ser. No. 10/491,026. With regards to promoters, mention is made of PCT publication WO 2011/028929 and U.S. application Ser. No. 12/511,940.
[0250] The expression vector may then be introduced into a suitable host cell. Thus, polypeptide of the invention can be produced by inserting a polynucleotide or a combination into an expression vector, introducing the vector into a compatible bacterial host cell, and growing the host cell under conditions which bring about expression of the polynucleotide or combination. The vectors may be for example, plasmid, virus or phage vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide or combination and optionally a regulator of the promoter. The vectors may contain one or more selectable marker genes, for example an ampicillin resistance gene. Promoters and other expression regulation signals may be selected to be compatible with the host cell for which the expression vector is designed. A T7, trc, lac, ara or .sub.L promoter is typically used.
[0251] The vector may be used to administer a polynucleotide of the invention or a combination of two or more polynuclelotides to a subject as discussed in more detail below. Conventional viral and non-viral based gene transfer methods can be used to introduce the polynucleotide or combination into cells. Non-viral vector delivery systems include DNA plasmids, RNA, naked nucleic acid, and nucleic acid complexed with a delivery vehicle, such as a liposome. Methods of non-viral delivery of nucleic acids include lipofection, microinjection, biolistics, virosomes, liposomes, immunoliposomes, polycation or lipid:nucleic acid conjugates, naked DNA, artificial virions, and agent-enhanced uptake of DNA. Lipofection is described in e.g., U.S. Pat. Nos. 5,049,386, 4,946,787; and 4,897,355) and lipofection reagents are sold commercially (e.g., Transfectam and Lipofectin). Cationic and neutral lipids that are suitable for efficient receptor-recognition lipofection of polynucleotides include those of Felgner, WO 91/17424; WO 91/16024. The preparation of lipid:nucleic acid complexes, including targeted liposomes such as immunolipid complexes, is well known to one of skill in the art (see, e.g., Crystal, Science 270:404-410 (1995); Blaese et al., Cancer Gene Ther. 2:291-297 (1995); Behr et al., Bioconjugate Chem. 5:382-389 (1994); Remy et al., Bioconjugate Chem. 5:647-654 (1994); Gao et al., Gene Therapy 2:710-722 (1995); Ahmad et al., Cancer Res. 52:4817-4820 (1992); U.S. Pat. Nos. 4,186,183, 4,217,344, 4,235,871, 4,261,975, 4,485,054, 4,501,728, 4,774,085, 4,837,028, and 4,946,787).
[0252] Conventional viral based expression systems could include retroviral, lentivirus, adenoviral, adeno-associated (AAV) and herpes simplex virus (HSV) vectors for gene transfer. Methods for producing and purifying such vectors are know in the art.
[0253] Exemplary vector systems for using the invention are a virus, such as rAAV, that comprises or consists essentially of an exogenous polynucleotide encoding the polypeptide, fusion polypeptide or polypeptide combination of the invention, e.g., a cassette comprising or consisting essentially of a promoter, a polynucleotide encoding the polypeptide, fusion polypeptide or polypeptide combination of the invention and a terminator.
[0254] Since AAV is a DNA virus, the polynucleotides used in AAV or rAAV are advantageously DNA.
[0255] The vector may be delivered using nanoparticle delivery systems. Such delivery systems include, but are not limited to, lipid-based systems, liposomes, micelles, microvesicles, exosomes, and gene gun. With regard to nanoparticles that can deliver RNA, see, e.g., Alabi et al., Proc Natl Acad Sci USA. 2013 Aug. 6; 110(32):12881-6; Zhang et al., Adv Mater. 2013 Sep. 6; 25(33):4641-5; Jiang et al., Nano Lett. 2013 Mar. 13; 13(3):1059-64; Karagiannis et al., ACS Nano. 2012 Oct. 23; 6(10):8484-7; Whitehead et al., ACS Nano. 2012 Aug. 28; 6(8):6922-9 and Lee et al., Nat Nanotechnol. 2012 Jun. 3; 7(6):389-93. Lipid Nanoparticles, Spherical Nucleic Acid (SNA) constructs, nanoplexes and other nanoparticles (particularly gold nanoparticles) are also contemplated as a means for delivery of a polynucleotide or a polynucleotide of the invention. The invention provides any of these deliver systems comprising a vector of the invention, a polynucleotide of the invention or a polynucleotide combination of the invention.
[0256] In some embodiments, the vector may form a component of an inducible system. The inducible nature of the system would allow for spatiotemporal control of expression of a polypeptide of the invention or a combination of such polypeptides using a form of energy. The form of energy may include but is not limited to electromagnetic radiation, sound energy, chemical energy and thermal energy. Examples of inducible system include tetracycline inducible promoters (Tet-On or Tet-Off), small molecule two-hybrid transcription activations systems (FKBP, ABA, etc), or light inducible systems (Phytochrome, LOV domains, or cryptochrome).
[0257] As will be clear from below, the polynucleoide of the invention or a polynucleotide combination of the invention or any expression vector containing these components may be present in a population of cells. The cells may be administered to the subject. Suitable ways of modifying and administering cells are known in the art.
Host Cells of the Invention
[0258] The invention also provides a host cell which comprises a polynucleotide of the invention, a polynucleotide combination of the invention or a vector of the invention. The host cell may be used to replicate the polynucleotide, combination or vector. The host cell may be used to express a polypeptide of the invention or a combination of polypeptides of the invention in vitro. The host cell may be used to deliver the polynucleotide, combination or vector to a subject in need thereof as discussed below.
[0259] Host cells will be chosen to be compatible with the cloning or expression vector used to transform the cell. Suitable conditions are known in the art (see, for instance, Sambrook, J. and Russell, D. supra).
[0260] Suitable cells for use in the invention include prokaryotic cells and eukaryotic cells. The prokaryotic cell is preferably a bacterial cell. Suitable bacterial cells include, but are not limited to, Escherichia coli, Corynebacterium and Pseudomonas fluorescens. Any E. coli cell with a DE3 lysogen, for example C41 (DE3), BL21 (DE3), JM109 (DE3), B834 (DE3), TUNER, Origami and Origami B, can express a vector comprising the T7 promoter.
[0261] Suitable eukaryotic cells include, but are not limited to, Saccharomyces cerevisiae, Pichia pastoris, filamentous fungi, such as Aspergillus, Trichoderma and Myceliophthora thermophila C1, baculovirus-infected insect cells, such as Sf9, Sf21 and High Five strains, non-lytic insect cells, Leishmania cells, plant cells, such as tobacco plant cells, and mammalian cells, such as Bos primigenius cells (Bovine), Mus musculus cells (Mouse), Chinese Hamster Ovary (CHO) cells, Human Embryonic Kidney (HEK) cells, Baby Hamster Kidney (BHK) cells and HeLa cells. Other preferred mammalian cells include, but are not limited to, PC12, HEK293, HEK293A, HEK293T, CHO, BHK-21, HeLa, ARPE-19, RAW264.7 and COS cells.
[0262] The host cell is preferably HEK293T.
[0263] If the cell is being administered to a subject, the cell is preferably derived from the subject or a subject of the same species. For instance, a human cell is typically administered to a human subject. The host cell is preferably autologous. In other words, the cell is preferably derived from the subject into which the cell will be administered. Alternatively, the host cell is preferably allogeneic. In other words, the cell is preferably derived from a patient that is immunologically compatible with the patient into which the cell will be administered.
[0264] The cell may be isolated, substantially isolated, purified or substantially purified. The cell is isolated or purified if it is completely free of any other components, such as culture medium or other cell types. The cell is substantially isolated if it is mixed with carriers or diluents, such as culture medium and others discussed above and below, which will not interfere with its intended use. Alternatively, the host cell of the invention may be present in a growth matrix or immobilized on a surface as discussed below.
Pharmaceutical Compositions of the Invention
[0265] The invention also provides a pharmaceutical composition comprising (a) a polypeptide of the invention, a polypeptide combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention and (b) a pharmaceutically acceptable carrier or diluent. The carrier or diluent may be any of those discussed above with reference to the vectors of the invention.
[0266] The carrier(s) or diluent(s) present in the pharmaceutical composition must be acceptable in the sense of being compatible with the other ingredients of the composition and not deleterious to the recipient thereof. Typically, carriers for injection, and the final formulation, are sterile and pyrogen free. Preferably, the carrier or diluent is water. A pharmaceutically acceptable carrier or diluent may comprise as one of its components thioglycerol or thioanisole.
[0267] Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances and the like, may be present in the excipient or vehicle. These excipients, vehicles and auxiliary substances are generally pharmaceutical agents that do not induce an immune response in the individual receiving the composition, and which may be administered without undue toxicity. Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, polyethyleneglycol, hyaluronic acid, glycerol, thioglycerol and ethanol. Pharmaceutically acceptable salts can also be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharmaceutically acceptable excipients, vehicles and auxiliary substances is available in Remington's Pharmaceutical Sciences (Mack Pub. Co., N.J. 1991).
[0268] The active agents are typically present at 0.1% to 50% by weight in the pharmaceutical composition, more preferably at 0.1% to 5% by weight. They may be present at less than 0.1% by weight in the pharmaceutical composition.
[0269] The pharmaceutically acceptable carrier or diluent is typically present at 50% to 99.9% by weight in the pharmaceutical composition, more preferably at 95% to 99.9% by weight. The pharmaceutically acceptable carrier or diluents may be present at more than 99.9% by weight in the pharmaceutical composition.
[0270] Pharmaceutical compositions include, but are not limited to pharmaceutically acceptable solutions, lyophilisates, suspensions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable compositions. Such pharmaceutical compositions may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. A lyophilisate may comprise one or more of trehalose, thioglycerol and thioanisole. In one embodiment of a pharmaceutical composition for parenteral administration, the active ingredient is provided in dry form (e.g., a lyophilisate, powder or granules) for reconstitution with a suitable vehicle (e.g., sterile pyrogen-free water) prior to parenteral administration of the reconstituted pharmaceutical composition.
[0271] The pharmaceutical composition may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution. This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein. Such sterile injectable compositions may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butane diol, for example. Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono-or di-glycerides.
[0272] Other parenterally-administrable pharmaceutical compositions which are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer systems. Pharmaceutical compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.
[0273] For example, solid oral forms may contain, together with the active substance, diluents, e.g. lactose, dextrose, saccharose, cellulose, corn starch or potato starch; lubricants, e.g. silica, talc, stearic acid, magnesium or calcium stearate, and/or polyethylene glycols; binding agents; e.g. starches, gum arabic, gelatin, methylcellulose, carboxymethylcellulose or polyvinyl pyrrolidone; disaggregating agents, e.g. starch, alginic acid, alginates or sodium starch glycolate; effervescing mixtures; dyestuffs; sweeteners; wetting agents, such as lecithin, polysorbates, laurylsulphates; and, in general, non-toxic and pharmacologically inactive substances used in pharmaceutical compositions. Such pharmaceutical preparations may be manufactured in known manner, for example, by means of mixing, granulating, tabletting, sugar-coating, or film-coating processes.
[0274] Liquid dispersions for oral administration may be syrups, emulsions or suspensions. The syrups may contain as carriers, for example, saccharose or saccharose with glycerine and/or mannitol and/or sorbitol.
[0275] Suspensions and emulsions may contain as carrier, for example a natural gum, agar, sodium alginate, pectin, methylcellulose, carboxymethylcellulose, or polyvinyl alcohol. The suspensions or solutions for intramuscular injections may contain, together with the active substance, a pharmaceutically acceptable carrier, e.g. sterile water, olive oil, ethyl oleate, glycols, e.g. propylene glycol, and if desired, a suitable amount of lidocaine hydrochloride.
[0276] Solutions for intravenous administration or infusion may contain as carrier, for example, sterile water or preferably they may be in the form of sterile, aqueous, isotonic saline solutions.
[0277] For suppositories, traditional binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1% to 2%.
[0278] Oral compositions include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release compositions or powders and contain 10% to 95% of active ingredient, preferably 25% to 70%. Where the pharmaceutical composition is lyophilised, the lyophilised material may be reconstituted prior to administration, e.g. a suspension. Reconstitution is preferably effected in buffer.
[0279] Capsules, tablets and pills for oral administration to an individual may be provided
[0280] with an enteric coating comprising, for example, Eudragit S, Eudragit L, cellulose acetate, cellulose acetate phthalate or hydroxypropylmethyl cellulose.
[0281] Polynucleotides may be present in combination with cationic lipids, polymers or targeting systems.
[0282] Uptake of polynucleotide or oligonucleotide constructs may be enhanced by several known transfection techniques, for example those including the use of transfection agents. Examples of these agents include cationic agents, for example, calcium phosphate and DEAE-Dextran and lipofectants, for example, lipofectamine and transfectam. The dosage of the polynucleotide or oligonucleotide to be administered can be altered.
[0283] Alternatively, the active agent may be encapsulated, adsorbed to, or associated with, particulate carriers. Suitable particulate carriers include those derived from polymethyl methacrylate polymers, as well as PLG microparticles derived from poly(lactides) and poly(lactide-co-glycolides). See, e.g., Jeffery et al. (1993) Pharm. Res. 10:362-368. Other particulate systems and polymers can also be used, for example, polymers such as polylysine, polyarginine, polyornithine, spermine, spermidine, as well as conjugates of these molecules.
[0284] The composition will depend upon factors such as the nature of the active agent and the method of delivery. The pharmaceutical composition may be administered in a variety of dosage forms. It may be administered orally (e.g. as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules), topically, parenterally, subcutaneously, by inhalation, intravenously, intramuscularly, intralymphatically (such as to lymph nodes in the groin), intrasternally, transdermally, intradermally, epidermally, sublingually, intranasally, buccally or by infusion techniques. The administration may be intratonsillar. The administration may be as suppositories. The administration may be made by iontophoresis. Preferably, the administration is intradermal, epidermal or transdermal. The administration may be made by a patch, such as a microtine patch. Administration is discussed in more detail below.
[0285] A physician will be able to determine the required route and means of administration for each particular individual.
[0286] The pharmaceutical compositions of the invention are preferably provided sealed in a container. The pharmaceutical compositions are typically provided in unit dose form, for example single dose form. They may alternatively be provided in multi-dose form. Where the pharmaceutical composition is a pharmaceutically acceptable solution, the solution may be provided in an ampoule, sealed vial, syringe, cartridge, flexible bag or glass bottle. Where the pharmaceutical composition is a lyophilisate, it is preferably provided in a sealed vial.
[0287] The pharmaceutical compositions of the invention will comprise a suitable concentration of each agent to be effective without causing adverse reaction. Where the pharmaceutical composition is for example a lyophilisate, the relevant concentration will be that of each polypeptide following reconstitution. Typically, the concentration of each agent in the pharmaceutical composition when in solution will be in the range of 0.03 to 200 nmol/ml. The concentration of each agent may be more preferably in the range of 0.3 to 200 nmol/ml, 3 to 180 nmol/ml, 5 to 160 nmol/ml, 10 to 150 nmol/ml, 50 to 200 nmol/ml or 30 to 120 nmol/ml, for example about 100 nmol/ml. The pharmaceutical composition should have a purity of greater than 95% or 98% or a purity of at least 99%.
[0288] In an embodiment where the invention involves combines therapy, the other therapeutic agents or adjuvants may be administered separately, simultaneously or sequentially. They may be administered in the same or different pharmaceutical compositions. A pharmaceutical composition may therefore be prepared which comprises an agent of the invention and also one or more other therapeutic agents or adjuvants. A pharmaceutical composition of the invention may alternatively be used simultaneously, sequentially or separately with one or more other therapeutic compositions as part of a combined treatment.
In Vitro Methods of the Invention
[0289] The invention also provides a method of inhibiting the signalling of one or more chemokines in an in vitro culture, the method comprising contacting the culture with a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention.
[0290] The method may comprise inhibiting any number of chemokines, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 chemokines. The chemokines may be selected from any of those in Tables 2, 4, and 6. When inhibiting the one or more chemokines in a particular row in the above Tables, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the tick CKBP in the same row is preferably used in the method of the invention. For instance, when inhibiting CCL8 employing a chemokine-binding sequence from a CCL8-binding tick CKBP, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the sequence shown in SEQ ID NO: 8 may be used. A hybrid polypeptide comprising the amino acid sequence of SEQ ID NO: 76, 82, 83 or 95 may also be used.
[0291] Similarly, when inhibiting CCL2 or CCL1/CCL2/CCL3/CCL5 employing applicable chemokine-binding sequences from tick CKBPs described herein, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the sequence shown in SEQ ID NO: 1 is preferably used. When inhibiting one or more of CCL2, CC13 and/or CCL20 employing applicable chemokine binding sequences from tick CKBPs described herein, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the sequence shown in any one of SEQ ID NOs 1-3, 6-9, 20-23 and 29 is preferably used. When inhibiting one or more of CXCL3, CXCL10 and/or CXCL12 employing applicable chemokine binding sequences from tick CKBPs described herein, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the sequence shown in SEQ ID NO 5 or 19 is preferably used.
[0292] When inhibiting one or more of CXCL1, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11 or CXCL12, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the sequence shown in any one of SEQ ID NOs: 45-72 and indicated in Table 6 as binding the relevant chemokine(s) may be used. For example, products of the invention as above based on SEQ ID NO: 45 may be used to inhibit CXCL9. Products of the invention as above based on one of SEQ ID NOs 45-48, 51-53, 56, 59-60 and 65 may be used to inhibit one or more of CXCL7, CXCL9 and CXCL11, as indicated in Table 6.
[0293] The in vitro culture is preferable a culture of cells capable of undergoing chemotaxis. The in vitro culture is preferably a chemotactic assay. The culture may be present in a culture flask or the wells of a flat plate, such as a standard 96 or 384 well plate. Such plates are commercially available Fisher scientific, VWR suppliers, Nunc, Starstedt or Falcon. Conditions for culturing cells are known in the art.
[0294] The polypeptide, combination, polynucleotide, vector or host cell of the invention may be administered in any of the forms discussed above.
Therapeutic Methods of the Invention
[0295] The invention also provides a method of inhibiting the signalling of one or more chemokines in a subject, the method comprising administering to the subject a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention. The invention also provides a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention for use in a method of inhibiting the signalling of one or more chemokines in a subject. The invention also provides use of a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention in the manufacture of a medicament for use in inhibiting the signalling of one or more chemokines in a subject.
[0296] The method may comprise inhibiting any number of chemokines, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 chemokines. The chemokines may be selected from any of those in Tables 2, 4 and 6. When inhibiting the one or more chemokines in a particular row in the above Tables, a polypeptide, combination, polynucleotide, vector or host cell of the invention based on the tick CKBP in the same row is preferably used in the method of the invention. The examples of selection of particular tick CKBP amino acid sequences for in vitro inhibition of particular chemokines provided above are also applicable to selection of tick CKBP amino acid sequences for in vivo inhibition of the same chemokines.
[0297] The skilled person can design combinations of tick CKBPs to inhibit specific combinations of chemokines.
[0298] The invention also provides a method of treating or preventing in a subject one or more diseases associated with one or more chemokines, the method comprising administering to the subject a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention. The invention also provides a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention for use in a method of treating or preventing in a subject one or more diseases associated with one or more chemokines. The invention also provides use of a polypeptide of the invention, a combination of the invention, a polynucleotide of the invention, a vector of the invention or a host cell of the invention in the manufacture of a medicament for treating or preventing in a subject one or more diseases associated with one or more chemokines.
[0299] A disease is associated with one or more chemokines if the disease has a chemokine component. In other words, one or more symptoms of the disease may be treated or prevented by inhibiting one or more chemokines. Any number of chemokines may be involved as discussed above. The chemokines are preferably selected from those shown in any of Tables 2, 4 and 6 and also from those shown in
[0300] The method may comprise treating or preventing any number of diseases associated with one or more chemokines, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or 13 diseases. The chemokines may be selected from any of those in Tables 2, 4 and 6. The one or more diseases may be as identified in Table 7 or 8 or
[0301] As seen from
[0302] Diseases that may be treated or prevented by polypeptides representing amino acid sequences derived from SEQ ID NOs 5 or 19 (and related polynucleotides/combinations/host cells) include diseases where CXCL3 is known to be expressed, including, idiopathic pulmonary fibrosis and breast cancer, where CXCL10 is known to be expressed, including atherosclerosis, inflammatory bowel disease, rheumatoid arthritis, liver fibrosis, idiopathic pulmonary fibrosis, multiple sclerosis, psoriasis, Alzheimer disease, myocarditis, primary biliary cirrhosis, autoimmune hepatitis, vasculitis, non-alcoholic steatohepatitis, myocardial infarction, and alcohol liver injury, or where CXCL12 is expressed, as in atherosclerosis, inflammatory bowel disease, rheumatoid arthritis, idiopathic pulmonary fibrosis, multiple sclerosis, colorectal cancer, myocarditis, primary biliary cirrhosis, primary sclerosing cholangitis, and autoimmune hepatitis.
[0303] A hybrid polypeptide of the invention may be used to treat or prevent a disease comprising expression of multiple chemokines, such as five or more, eight or more or ten or more chemokines. The multiple chemokines may preferably comprise both CC and CXC chemokines. A hybrid polypeptide binding both a CC chemokine and a CXC chemokine may be used to inhibit chemokine signalling in, and to treat or prevent, any of myocarditis, myocardial infarction, atherosclerosis, vasculitis, stroke, multiple sclerosis, Alzheimer's disease, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, liver fibrosis, non-alcoholic steatohepatitis, paracetamol liver injury, alcohol liver injury, idiopathic pulmonary fibrosis, acute lung injury, cardiac allograft vasculopathy, sarcoidosis, influenza, inflammatory bowel disease, pancreatitis, rheumatoid arthritis, psoriasis, skin fibrosis, breast cancer and colorectal cancer, which all comprise expression of both CC and CXC chemokines, as shown in
[0304] Exemplary therapeutic indications suitable for the hybrid polypeptide of SEQ ID 74, as seen in
[0305] First and second tick CKBP amino acid sequences selected in combination for provision of a hybrid polypeptide for binding chemokines expressed in a particular disease may be selected to individually bind multiple chemokines expressed in that disease. For instance, when treating rheumatoid arthritis, a hybrid polypeptide, combination, polynucleotide, vector or host cell of the invention representing a tick CKBP amino acid sequence shown in SEQ ID NO: 3 may be used. Similarly, when treating or preventing one or more of atherosclerosis, rheumatoid arthritis, inflammatory bowel disease, liver fibrosis, lung fibrosis, kidney fibrosis, skin fibrosis, multiple sclerosis, breast cancer, or Alzheimer's disease, a hybrid polypeptide, combination, polynucleotide, vector or host cell of the invention representing a tick CKBP amino acid sequence shown in SEQ ID NO: 1 may be used.
[0306] Where the disease to be treated or prevented is myocarditis, giant cell myocarditis, myocardial infarction, stroke or idiopathic pulmonary fibrosis, a hybrid polypeptide, combination, polynucleotide, vector or host cell of the invention representing a tick CKBP amino acid sequence shown in SEQ ID NO: 29 and/or a tick CKBP amino acid sequence shown in SEQ ID NO: 9 may be used. A hybrid polypeptide, combination, polynucleotide, vector or host cell of the invention representing a tick CKBP amino acid sequence shown in SEQ ID NO: 1 may also be used for treatment or prevention of the above diseases.
[0307] Where the disease comprises expression of one or more of CXCL1, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11 and CXCL2, a polypeptide, combination, polynucleotide, vector or host cell of the invention representing a tick CKBP amino acid sequence shown in any one of SEQ ID NOs 45-72 or a variant thereof may be used for treatment or prevention of the disease. The polypeptide may be a hybrid polypeptide comprising a binding sequence for one or more of the above CXC chemokines derived from any one of SEQ ID NOs 45-72 or a variant thereof. Alternatively, the polypeptide may comprise the full-length sequence of any one of SEQ ID NOs 45-72 or a variant thereof. Where the disease comprises expression of one or more of CXCL7, CXCL9, CXCL10, CXCL11 and CXCL12, a chemokine-binding sequence comprised in the hybrid polypeptide may be derived from, or the polypeptide may comprise, the amino acid sequence of any one of SEQ ID NOs 45-60 and 64-65 or a variant thereof. Where the disease comprises expression of one or more of CXCL7, CXCL9 and CXCL11 a chemokine-binding sequence comprised in the hybrid polypeptide may be derived from, or the polypeptide may comprise, the amino acid sequence of any one of SEQ ID NOs 45-48, 51-53, 56, 59, 60 and 65 or a variant thereof. The disease to be treated or prevented by one or more of the above CXC-binding chemokines may be one in which multiple CXC chemokines are expressed, such as rheumatoid arthritis, atherosclerosis or pancreatitis.
[0308] The skilled person can provide hybrid tick CKBPs having appropriate combinations of chemokine-binding activities from first and second tick CKBP amino acid sequences or variants thereof, or select novel tick CKBP polypeptides described herein to treat or prevent specific diseases or combinations of diseases. The skilled person can further provide hybrid tick CKBPs having chemokine-binding activities from three different tick CKBP amino acid sequences or variants thereof, as illustrated by the 3-warhead tick CKBPs described herein.
[0309] The 3-warhead tick CKBPs of SEQ ID NOs 92 and 93 or variants thereof as described herein are particularly suitable for treatment of diseases in which one or more, preferably three or more of CCL2, CCL5, CCL8, CXCL8, CXCL10 and CXCL1 are expressed, including any such disease described above. For example, acute lung injury (also referred to as acute respiratory distress syndrome) occurs in the context of smoke inhalation, toxins, aspiration, severe burns, pneumonia, sepsis, pancreatitis, trauma, transplant donor ischemia, and cardiopulmonary bypass. CC and CXC chemokines (e.g. CCL2, CCL5, CCL7, CXCL1, CXCL3, CXCL5, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11) are expressed in the lung following acute injury.[103,104,170-177]. The three-warhead evasins described above would be predicted to be of therapeutic benefit in acute lung injury.
[0310] A major complication of heart transplantation is cardiac allograft vasculopathy (CAV) which reduces graft and recipient survival. Chemokines that drive CAV include CXC chemokines (CXCL1, CXCL2, CXCL5, CXCL8, CXCL9) and CC-chemokines (CCL1, CCL2, CCL3, CCL4, CCL5), which drive the influx of neutrophils, NK cells and monocyte/macrophages [178,179]. The three-warhead evasins described above would also be predicted to be of therapeutic benefit in CAV.
[0311] The skilled person can also provide truncated forms of evasins retaining chemokine-binding activity for use in treatment of diseases, such as the truncated peptide of SEQ ID NO: 89 or a variant thereof. The truncated peptide or variant may be modified for example by cyclisation, or an inter-peptide disulphide bond or be in a stapled form, and/or may be bound or fused to a carrier, such as albumin. Such a truncated peptide or variant thereof may also be used to provide CCL8, CCL7 and CCL18 binding activity in a hybrid evasin polypeptide of the invention. SEQ ID NO: 89 and variants thereof are useful for treatment of diseases comprising expression of one or more of CCL8, CCL7 and CCL18, including any such disease described above. A peptidomimetic of SEQ ID NO: 89 or a variant thereof may also be provided and used in the above treatments. Suitable variants include SEQ ID NOs: 88, 103-109, comprising truncations and/or other modifications as described above. In preferred embodiments, the peptide variant is BK1.2 or BK1.3 (SEQ ID NOs: 105 or 106), preferably BK1.3. The truncated variant peptide may be modified for example by cyclisation, inter-peptide disulphide bond or be in a stapled form, and/or may be bound or fused to a carrier, such as albumin. The variant peptide may comprise SEQ ID NO: 106 fused to a second variant peptide via a disulphide bond at Cys 30 of each peptide. Particular diseases in which the above chemokines are expressed are also as follows: CCL18atherosclerosis, rheumatoid arthritis, myocarditis, sarcoidosis, idiopathic pulmonary fibrosis, vasculitis, atopic dermatitis, breast cancer, influenza; CCL7acute lung injury, stroke, idiopathic pulmonary fibrosis, Psoriasis, colorectal cancer, skin fibrosis, rheumatoid arthritis, inflammatory bowel disease; CCL8rheumatoid arthritis, inflammatory bowel disease, idiopathic pulmonary fibrosis.
[0312] Any subject may be treated in accordance with the invention. The subject is typically human. However, the subject can be another animal or mammal, such as a research animal, such as a rat, a mouse, a rabbit or a guinea pig, a commercially farmed animal, such as a horse, a cow, a sheep or a pig, or a pet, such as a cat, a dog or a hamster.
[0313] The subject may be asymptomatic. A prophylactically effective amount of the polypeptide, combination, polynucleotide, vector or host cell is administered to such a subject. A prophylactically effective amount is an amount which prevents the onset of one or more, preferably all of, symptoms of the one or more diseases.
[0314] Alternatively, the subject may be in need thereof. That is, the subject may exhibit one or more symptoms of the one or more diseases. A therapeutically effective amount of the polypeptide, combination, polynucleotide, vector or host cell is administered to such a subject. A therapeutically effective amount is an amount which is effective to ameliorate one or more of, preferably all of, the symptoms of the one or more diseases.
[0315] The polypeptide, combination, polynucleotide, vector or host cell may be administered to the subject in any appropriate way. In the invention, the polypeptide, combination, polynucleotide, vector or host cell may be administered in a variety of dosage forms. Thus, it can be administered orally, for example as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules. It may also be administered by enteral or parenteral routes such as via buccal, anal, pulmonary, intravenous, intra-arterial, intramuscular, intraperitoneal, intraarticular, topical or other appropriate administration routes. A physician will be able to determine the required route of administration for each particular subject.
[0316] The polypeptide, combination, polynucleotide, vector or host cell may be in any of the forms discussed above with reference to the pharmaceutical composition of the invention.
[0317] Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859 and 5,589,466. The nucleic acid molecule or a modified nucleic acid molecule can be introduced directly into the recipient subject, such as by standard intramuscular or intradermal or intravenous or intra coronary artery or intramyocardial injection; transdermal particle delivery; inhalation; topically, or by oral, intranasal or mucosal modes of administration. The molecule alternatively can be introduced ex vivo into cells that have been removed from a subject. For example, a polynucleotide, expression cassette or vector of the invention may be introduced into APCs of an individual ex vivo. Cells containing the nucleic acid molecule of interest are re-introduced into the subject such that an immune response can be mounted against the peptide encoded by the nucleic acid molecule. The nucleic acid molecules used in such immunization are generally referred to herein as nucleic acid vaccines.
[0318] The dose may be determined according to various parameters, especially according to the substance used; the age, weight and condition of the subject to be treated; the route of administration; and the required regimen. Again, a physician will be able to determine the required route of administration and dosage for any particular subject. A typical daily dose is from about 0.1 to 50 mg per kg of body weight, such as 5 mg per kg of body weight, according to the activity of the specific inhibitor, the age, weight and conditions of the subject to be treated and the frequency and route of administration. The dose may be provided as a single dose or may be provided as multiple doses, for example taken at regular intervals, for example 2, 3 or 4 doses administered hourly. Preferably, dosage levels of inhibitors are from 5 mg to 2 g.
[0319] Typically polynucleotide or oligonucleotide inhibitors are administered in the range of 1 pg to 1 mg, preferably to 1 pg to 10 g nucleic acid for particle mediated delivery and 10 g to 1 mg for other routes.
[0320] The polypeptide, the combination, the polynucleotide, the vector or the host cell is preferably administered in combination with another therapy
[0321] The inhibitor may be used in combination with one or more other therapies intended to treat the same subject. By a combination is meant that the therapies may be administered simultaneously, in a combined or separate form, to the subject. The therapies may be administered separately or sequentially to a subject as part of the same therapeutic regimen. For example, the polypeptide, the combination, the polynucleotide, the vector or the host cell be used in combination with another therapy intended to treat the one or more disease. The other therapy may be a general therapy aimed at treating or improving the condition of the subject. For example, treatment with methotrexate, glucocorticoids, salicylates, nonsteroidal anti-inflammatory drugs (NSAIDs), analgesics, other DMARDs, aminosalicylates, corticosteroids, and/or immunomodulatory agents (e.g., 6-mercaptopurine and azathioprine) may be combined with the inhibitor. The other therapy may be a specific treatment directed at the one or more diseases. Such treatments are known in the art. For instance in the treatment of rheumatoid arthritis this may include anti-TNF [180] or other biologics targeting other cytokines (e.g. IL7, IL17, IL17) or their receptors (e.g. IL1-R, IL-6R), that are in clinical use or development [181]. In the treatment of inflammatory bowel disease we may use biologics such as vedolizumab [182]. For atherosclerosis simvastatin or other statins may be used.
Antibodies of the Invention
[0322] The invention also provides an antibody or a fragment thereof which specifically binds a polypeptide comprising (a) an amino acid sequence shown in any one of SEQ ID NOs: 45 to 72 or (b) an amino acid sequence having at least 70% homology or amino identity to a sequence of (a) over its entire length. The antibody or fragment thereof preferably specifically binds a polypeptide comprising an amino acid sequence shown in any one of SEQ ID NOs: 45 to 72.
[0323] An antibody specifically binds to a polypeptide when it binds with preferential or high affinity to that polypeptide but does not substantially bind, does not bind or binds with only low affinity to other polypeptides. For instance, an antibody specifically binds to SEQ ID NO: 45 or a variant thereof when it binds with preferential or high affinity to SEQ ID NO: 45 or a variant thereof but does not substantially bind, does not bind or binds with only low affinity to other polypeptides. The same applies to any one of SEQ ID NOs: 46 to 72.
[0324] An antibody binds with preferential or high affinity if it binds with a Kd of 110-7 M or less, more preferably 510-8 M or less, more preferably 110-8 M or less or more preferably 510-9 M or less. An antibody binds with low affinity if it binds with a Kd of 110-6 M or more, more preferably 110-5 M or more, more preferably 110-4 M or more, more preferably 110-3 M or more, even more preferably 110-2 M or more. A variety of protocols for competitive binding or immunoradiometric assays to determine the specific binding capability of compounds, such as antibodies or antibody constructs and oligonucleotides are well known in the art (see for example Maddox et al, J. Exp. Med. 158, 1211-1226, 1993).
[0325] The antibody may be, for example, a monoclonal antibody, a polyclonal antibody, a single chain antibody, a chimeric antibody, a CDR-grafted antibody or a humanized antibody. The antibody may be an intact immunoglobulin molecule or a fragment thereof such as a Fab, F(ab).sub.2 or Fv fragment. Furthermore, the antibodies and fragment thereof may be chimeric antibodies, CDR-grafted antibodies or humanised antibodies.
[0326] Antibodies of the invention can be produced by any suitable method. Means for preparing and characterising antibodies are well known in the art, see for example Harlow and Lane (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY. For example, an antibody may be produced by raising an antibody in a host animal against the whole polypeptide or a fragment thereof, for example an antigenic epitope thereof, hereinafter the immunogen. The fragment may be any of the fragments mentioned herein (typically at least 10 or at least 15 amino acids long).
[0327] A method for producing a polyclonal antibody comprises immunising a suitable host animal, for example an experimental animal, with the immunogen and isolating immunoglobulins from the animal's serum. The animal may therefore be inoculated with the immunogen, blood subsequently removed from the animal and the IgG fraction purified. A method for producing a monoclonal antibody comprises immortalising cells which produce the desired antibody. Hybridoma cells may be produced by fusing spleen cells from an inoculated experimental animal with tumour cells (Kohler and Milstein (1975) Nature 256, 495-497).
[0328] An immortalized cell producing the desired antibody may be selected by a conventional procedure. The hybridomas may be grown in culture or injected intraperitoneally for formation of ascites fluid or into the blood stream of an allogenic host or immunocompromised host. Human antibody may be prepared by in vitro immunisation of human lymphocytes, followed by transformation of the lymphocytes with Epstein-Barr virus.
[0329] For the production of both monoclonal and polyclonal antibodies, the experimental animal is suitably a goat, rabbit, rat, mouse, guinea pig, chicken, sheep or horse. If desired, the immunogen may be administered as a conjugate in which the immunogen is coupled, for example via a side chain of one of the amino acid residues, to a suitable carrier. The carrier molecule is typically a physiologically acceptable carrier. The antibody obtained may be isolated and, if desired, purified.
Diagnostic Methods of the Invention
[0330] The invention also provides a method of detecting one or more chemokines in a tissue, comprising contacting the tissue with a detectably-labelled polypeptide of the invention or a detectably-labelled polypeptide combination of the invention and detecting the binding of the polypeptide or the combination to one or more chemokines in the tissue. The polypeptide may be a fusion polypeptide of the invention. The tissue may be in vitro or in vivo. The invention also provides a detectably-labelled polypeptide of the invention or a detectably-labelled combination of the invention for use in a method of detecting one or more chemokines in a tissue. The invention also provides use of a detectably-labelled polypeptide of the invention or a detectably-labelled combination in the manufacture of medicament for detecting one or more chemokines in a tissue.
[0331] Any method of detecting binding may be used. The method may be positron emission tomography (PET) or magnetic resonance imaging (MRI).
[0332] The tissue may be any tissue. The tissue is preferably in a subject. The subject may be any those discussed above. The polypeptide or combination may be administered to the subject in any of the forms discussed above.
[0333] Any of the polypeptides of the invention or combinations of the invention discussed above may be used. Suitable detectable labels are also discussed above. The label is preferably a tracer that is suitable for positron emission tomography (PET), such as fluorodeoxyglucose (.sup.18F). The label is preferably a tracer suitable for magnetic resonance imaging (MRI), such as fluorine (.sup.19F).
[0334] The method may comprise detecting any number of chemokines, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 chemokines. The chemokines may be selected from any of those in Table 2, 4 and 6. When detecting one or more of CXCL1, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11 and CXCL2, a hybrid polypeptide comprising a binding sequence for one or more of the above CXC chemokines derived from any one of SEQ ID NOs 45-72 or a variant thereof may be used. Alternatively, a polypeptide comprising the full length sequence of any one of SEQ ID NOs 45-72 or a variant thereof may be used. When detecting both one or more CC and one or more CXC chemokines, a hybrid polypeptide of the invention binding a CC and a CXC chemokine may be used.
[0335] The method is preferably for diagnosing or prognosing one or more diseases associated with one or more chemokines. The method may comprise diagnosing or prognosing any number of diseases associated with one or more chemokines, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or 13 diseases. The one or more diseases may as be identified in Table 7 and 8 or
[0336] Particular selections of tick CKBP amino acid sequences for diagnosis or prognosis of particular diseases may be made according to the same criteria discussed above in relation to medical uses. Thus, a hybrid polypeptide binding both a CC chemokine and a CXC chemokine may be used to diagnose or prognose any of myocarditis, myocardial infarction, atherosclerosis, vasculitis, stroke, multiple sclerosis, Alzheimer's disease, autoimmune hepatitis, primary biliary cirrhosis, primary schlerosing cholangitis, liver fibrosis, non-alcoholic steatohepatitis, paracetamol liver injury, alcohol liver injury, idiopathic pulmonary fibrosis, acute lung injury, sarcoidosis, influenza, inflammatory bowel disease, pancreatitis, rheumatoid arthritis, psoriasis, skin fibrosis, breast cancer and colorectal cancer, which all comprise expression of both CC and CXC chemokines, as shown in
[0337] The skilled person can provide hybrid tick CKBP polypeptides having appropriate combinations of chemokine-binding activities from first and second tick CKBP amino acid sequences or variants thereof, or select novel tick CKBP polypeptides described herein or combinations of the above to diagnose or prognose specific diseases or combinations of diseases.
Examples
[0338] 1. Identification of Chemokine-Binding Tick CKBPs.
[0339] To identify protein-protein interactions between extracellular proteins we adapted yeast surface display technology, originally developed for the identification of single chain antibodies[17,183]. Here candidate proteins are expressed in yeast and displayed on the cell wall. Fluorescent-activated cell sorting (FACS) is used to select a desired yeast cell that bind a fluorescent-labelled target. To identify tick CKBPs we created yeast surface display libraries that express mature peptides identified in tick salivary transcriptomes, we systematically screened the above libraries using the chemokines CCL1, CCL2, CCL3, CCL4, CCL5, CCL8, CCL11, CCL15, CCL17, CCL18, CCL19, CCL20, CCL22, CCL25, CX3CL1, CXCL8, CXCL10, CXCL11, CXCL12, CXCL13. We obtained interacting clones that were retested and bound to one or more chemokines confirmed using FACS (SEQ ID NOs: 1 to 31) Table 1). This method can be used also to alter affinities and binding characteristics of a tick CKBP e.g. through mutagenesis and FACS selection.
[0340] 2. Characterisation of Tick CKBP Binding to Chemokines.
[0341] Characterisation of binding of certain tick CKBPs identified in Example 1 against all known human chemokines (with exception of CCL25, CCL26, CXCL16, CXCL17, CXCL4L1, XCL2) was carried out using biolayer interferometry. The data for their binding properties are shown in Table 2, alongside published K.sub.d data in relation to binding of human chemokines for previously described tick CKBPs (Evasins 1, 3 and 4). Other binding data for the tick CKBPs obtained using yeast surface display is also summarised. From this data three classes of novel tick CKBPs were identified, as shown in Table 2. Class I tick CKBPs bind CC-class chemokines CCL2, CCL13 or CCL20 in addition to other CC chemokines as indicated. Class III tick CKBPs bind CXC-class chemokines CXC-chemokines CXCL3, CXCL10 or CXCL12 in addition to other CXC chemokines as indicated. Class III tick CKBPs have other chemokine-binding characteristics.
[0342] 3. Characterisation of Inhibition of Chemokine Function by a Tick CKBP.
[0343] Evaluation of the neutralisation activity of certain tick CKBPs identified in Example 1 against particular human chemokines was carried out using a THP1 transwell cell migration assay, with results (IC.sub.50 data) shown in Table 3. The results illustrate neutralisation of function of multiple chemokines by certain tick CKBPs.
[0344] 4. Isolation and Characterisation of Novel Tick CKBP Polypeptides
[0345] 28 novel CXC-binding tick CKBP polypeptides (SEQ IDS 45-72) were isolated in an additional yeast surface display screening carried out in accordance with Example 1, with results shown in Tables 5 and 6.
[0346] 5. Hybrid Tick CKBP Comprising a Substituted Chemokine-Binding Sequence.
[0347] Alignment of P672_RHIPU to EVA1_RHISA (
[0348] We exchanged the N-terminal 29 residues of Evasin-1, with the N-terminal 44 residues of P672_RHIPU to generate a hybrid tick CKBP having the amino acid sequence shown in SEQ ID NO: 76. The nucleotide sequence used here is EZ406190.1, which encodes the Evasin-1 peptide variant K92E. Evasin-1 (EVA1_RHISA) binds CCL3, CCL3L1, CCL4, CCL4L1, CCL14 and CCL18 but not CCL8[20,21]. We have confirmed using biolayer interferometry that the Evasin-1 peptide encoded by EZ406190.1 also does not bind CCL8 at a concentration of 300 nM CCL8. P672_RHIPU binds CCL8 with K.sub.d=3.7 nM. The hybrid tick CKBP (P672:EVA1) binds CCL8 with K.sub.d=223 nM (
[0349] 6. Two-Warhead Tick CKBPs
[0350] We genetically engineered P991_AMBCA and P1243_AMBAM (CC binding tick CKBPs) to link each via a flexible GGGGS linker to P1156_IXORI (CXC binding tick CKBP) to create 2-warhead tick CKBPs, shown respectively in SEQ ID NO: 73, and 74, We show that the 2-warhead tick CKBPs retain some of the properties of each of the parental tick CKBPs by binding and neutralizing both CC and CXC chemokines as shown in the results in
[0351] The results obtained for a 2-warhead tick CKBP indicate, that two (or more) tick CKBPs can be physically linked e.g. via a flexible linker or linkers, of variable length or design, to create a non-natural peptide that that retains the properties of the two parent tick CKBPs. Novel artificial chemokine binding peptides with desired properties that match CC and CXC chemokine expression patterns in disease, can thus be created by mixing and matching a number of CC or CXC binding natural tick CKBPs.
[0352] 2-warhead evasins (SEQ ID NOs 74 and 81) were further investigated for their ability to functionally inhibit CC and CXC chemokines as compared to individual (parental) evasins represented in the 2-warhead molecules. Results are shown in
[0353] 2-warhead evasins (SEQ ID NOs 73 and 80) were also further analysed for their binding to human chemokines compared to parental evasins, with summary data shown in
[0354] The ability of 2-warhead evasins to engage in polyvalent binding of CC and CXC chemokines was further determined. Results are shown in
[0355] 7. CXC Chemokine Binding Evasins
[0356] The various CXC chemokine binding evasins described in the application were analysed in more detail for their chemokine binding activity using biolayer interferometry. This permitted identification of two functional classes of CXC chemokine binding evasins. Results are shown in
[0357] The functional inhibition of CXC chemokines by P1142_AMBCA was also further investigated. Results from chemokine-induced cell migration assays are shown in
[0358] 8. Analysis of a Truncated Evasin Peptide with Chemokine-Binding Activity
[0359] A truncated peptide P672 PEP (SEQ ID NO: 88, peptide BK1.1) was generated consisting of residues E17 to E32 of P672_RHIPU, within the CCL8-binding region of this evasin. Residue C30 was mutated to A to avoid an unpaired cysteine residue. The peptide was N-terminally labelled with FITC (P672_PEP-FITC) to allow for characterisation of chemokine binding by fluorescence polarisation. Results are shown in
[0360] The binding specificity of the truncated peptide was further investigated in displacement assays, with results shown in
[0361] Additionally, functional inhibition by the truncated evasin peptide in cell migration assays was investigated, with results shown in
[0362] 9. 3-Warhead Evasins
[0363] The ability to design 3-warhead evasins representing sequences from three different individual parental evasins was investigated.
[0364] Three warhead evasin P1820 was created by genetically fusing P1142_AMBCA (SEQ ID 65), P1156_IXORI (SEQ ID 19), and P467_RHIPU (SEQ ID 1) with intervening GGGGS linkers (bold and underlined in sequence below) to create P1142:G4S:P1156:G4S:P467 (SEQ ID NO: 92, P1820).
[0365] Three warhead evasin P1821 was created by genetically fusing P1142_AMBCA (SEQ ID 65), P1156_IXORI (SEQ ID 19), and P991_AMBCA (SEQ ID 9) with intervening GGGGS linkers (bold and underlined in sequence below) to create P1142:G4S:P1156:G4S:P991 (SEQ ID NO: 93, P1821).
[0366] The sequences of the three warhead evasins are shown below:
TABLE-US-00009 P1820: KPQILQRTDHSTDSDWDPQMCPETCNPSKNISCSSECLCVTLGGGDET GTCFNMSGVDWLGHAQASDGHNDGGGGGSADDDNELFTVQYCGMNCTK DEGGTWTGCTGKKEGCKCYHESGKNYGLCLSTEYTDFSQYGNPSDSEI EAAKPKRSDTLSHGGGGSAEKSLDSDSSGEDYELWTQGCPFLVAENRT GFGTTVSCQHNCNGAIEKVPEGEPCYTIGEDGLGRMKLNLPYNCSLGE CSGGVCVPNGRSDVCFKRTWEENNKAMA P1821: KPQILQRTDHSTDSDWDPQMCPETCNPSKNISCSSECLCVTLGGGDET GTCFNMSGVDWLGHAQASDGHNDGGGGGSADDDNELFTVQYCGMNCTK DEGGTWTGCTGKKEGCKCYHESGKNYGLCLSTEYTDFSQYGNPSDSEI EAAKPKRSDTLSHGGGGSENGEGTTQPDYDNSTDYYNYEDFKCTCPAP HLNNTNGTVMKPIGCYYTCNVTRCTAPDTYPCYNLTEHQAKNLTTSPT TLCAVGNCDHGICVPNGTKELCFKAPNLEE
[0367] The binding affinities (K.sub.d, M) of immobilized purified 3 warhead evasins P1820 (P1142:G4S:P1156:G4S:P467) and P1821 (P1142:G4S:P1156:G4S:P991) to exemplar human CC and CXC-chemokines were then determined using biolayer interferometry, with results shown below.
TABLE-US-00010 CCL2 CCL5 CCL8 CXCL1 CXCL8 CXCL10 P1820 2.86E09 4.10E10 1.82E08 1.12E09 1.11E09 1.01E09 P1821 1.18E08 1.00E12 1.41E08 1.86E09 1.55E09 1.44E09
[0368] The 3-warhead evasins thus were found to bind CCL2, CCL5 and CCL8 (bound by each of the parental evasins P467_RHIPU and P991_AMBCA), CXCL8 (bound by the parental evasin P1156_IXORI), CXCL10 (bound by the parental evasin P1142_AMBCA) and CXCL1, bound by both P1156_IXORI and P1142_AMBCA. Based on the ability to combine each of the individual binding activities of the parental evasins in a single 3-warhead evasin, the potential therapeutic indications for each 3-warhead evasin represent a combination of the individual indications for the parental evasins. The use of a 3-warhead evasin thus extends the therapeutic application of the parental evasins. Additionally, increasing the molecular weight (e.g. in 2, 3 or multi-warheads) in comparison to each parental evasin and may be expected to have advantageous pharmacokinetic effects such as reduced renal clearance resulting in prolonged half-life [184,185]. This would be expected to result in reduction of dose required to be therapeutically effective and resulting also in a prolongation of intervals between doses which would enhance patient acceptability.
[0369] 10. Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS) of the P672:CCL8 Complex Interface
[0370] Peptide-resolution HDX-MS was performed to characterise the interaction between P672_RHIPU (referred to hereinafter as P672) and CCL8. Deuterium uptake of free P672, free CCL8 and of each protein upon complex formation was measured. Sequence mapping and coverage of each protein (100% for P672, 96.9% for CCL8,
[0371] Spectra of two representative P672 peptides showing a reduction in deuterium incorporation for this protected region upon complex formation are shown in
[0372] In this study we used HDX-MS and identified a 11-residue region (E22-F32) of P672 that was protected from deuterium uptake upon complexing with CCL8. The HDX-MS result also indicated that CCL8 residues R18-S27, which overlap the N-terminal loop (C12-R24), interact with P672. A key function of the N-terminal loop of CC chemokines is receptor binding, and it is targeted by several pathogenic chemokine-binding proteins. For example, the viral chemokine binding protein VV-35 kDa targets K19 and R24 of CCL2 and the viral chemokine binding protein vCCI targets R18 and R24 of CCL2. This common mechanism suggests the convergent evolution of these proteins to target the residues found in this region. The binding of P672 to this region would competitively prevent CCL8 binding to its receptor, explaining how CCL8 function is neutralised. The N-terminal loop of CCL8 and other CC chemokines is also part of the homodimerization interface, and binding to this loop explains the prevention of CCL8 dimerization by P672 reported previously.
[0373] 11. Residues E22-F32 in P672 Contain a Transferable CCL8 Binding Activity
[0374] The P672 (E22-F32) region was swapped with the corresponding segment of EVA1_RHISA, which is a related CC-chemokine binding evasin that does not bind CCL8 (Eaton, J. R. O. et al., JBC [2018]) (
[0375] Taken together with the HDX-MS analysis, these experiments indicate that P672(E22-F32) is involved in forming protein-protein interactions with CCL8, and that this function can be transferred to another evasin.
[0376] Swapping the P672.sub.22-32 region into EVA1, an evasin that does not bind CCL8, transferred CCL8 binding activity to the hybrid protein. These results indicate that this 11-residue region binds CCL8.
[0377] 12. Development of BK1.1, a CCL8 Binding Peptide
[0378] A number of tiled peptide fragments spanning the E17-F32 region in P672 were tested for CCL8 binding (
[0379] 13. BK1.1 Disrupts CCL8 Homodimerization
[0380] As shown by native mass spectrometry CCL8 exists as a homodimer (
[0381] 14. BK1.1 Promiscuously Binds Three CC Class Chemokines
[0382] BK1.1.sub.FITC was screened for binding against the 13 CC-chemokines known to bind to P672 (Eaton, J. R. O. et al., JBC [2018])(
[0383] 15. Engineering of Peptides with Improved Potency and Promiscuous CC-Chemokine Binding
[0384] The role of the four acidic residues N-terminal to Y21, and the impact of C30A mutation introduced into BK1.1, were explored. Two shorter peptides, Y21-F32 with or without the C30A mutation (
[0385] The addition of four acidic N-terminal residues and Tyr21 was necessary to be able to detect binding under these conditions, suggesting these acidic residues may be needed for increased affinity, or that the shorter peptides were sterically hindered from binding by the FITC moiety. Alanine scanning mutagenesis of the 16-residue peptide BK1.1 indicated that binding to CCL8 was mediated by Tyr and Phe residues, and also by the acidic residues at the N-terminus. Notably, Tyr and Phe are both found in protein interaction hot-spots, and complementarity in surface charge mediated by acidic residues can modulate protein interactions. A notable finding was that the Pro residue is critical for binding. Pro residues are found in turns, and can undergo cis-trans isomerisation, making it likely that the Pro residue is of structural importance for BK1.1. BK1.1 was observed to prevent CCL8 homodimerization, suggesting that it likely employs a similar mechanism as P672 in binding CCL8, i.e. to the N-loop region. The fluorescent polarisation studies reported indicate that BK1.1 also binds the chemokines CCL7, and CCL18, but not several others.
[0386] Given the role of Pro in protein conformation, cyclisation was employed as a strategy for restricting conformational flexibility. A surprising finding was that the addition of an N-terminal Tyr residue, introduced for the purpose of thioether cyclisation, enhanced affinity. The role of the added N-terminal Tyr is supported by the increased affinity of the peptides (BK1.2, BK1.3) that carry it compared to the ones that do not (BK1.1, BK1.4, BK1.5). The role of the re-introduced Cys30 is supported by BK1.5, which differs by a single residue in comparison to BK1.1, and has marked improvement in affinity. The substantial enhancement of activity of BK1.3 thus likely arises from addition of Tyr and re-introduction of Cys30. In addition, it is likely that the unexpected formation of a Cys linked dimer in BK1.3 enhances the functional affinity or avidity of the molecule. Cyclisation in these experiments did not appear to enhance affinity, as evidenced by the lack of improvement of BK1.4 in comparison to BK1.5 or BK1.2 in comparison to BK1.3. This may be, in part, due to non-optimised cyclisation points and/or forced constraint.
[0387] 16. Engineered Peptides Promiscuously Neutralize Chemokine Function
[0388] The effect of BK1.1, 1.2 and 1.3 on CCL8, CCL7, CCL3 and CCL2 induced cell migration was explored. P672 has previously been shown to neutralise these chemokines in analogous experiments (Eaton, J. R. O. et al., JBC [2018]). THP-1 cells express CCR1, CCR2 and CCR5 (Parker, L. C. et al., Journal of immunology [2004])(Achour, L. et al., Blood [2009]), which are activated by CCL8, CCL7 and CCL2, while CCL3 activates CCR1 and CCR5 (Harding, S. D. et al., Nucleic Acids Res [2018]). The experiments were performed with a single concentration of peptide (10 M,
[0389] 17. Engineered Peptides Prevent Cellular Chemokine Binding
[0390] To explore the effect of BK1.1 and derivatives on chemokine ligand-cell interactions, a fluorescent-chemokine cell binding assay was developed. Fluorescent chemokine (conjugated to AlexaFluor-647) binding to THP-1 cells results in an increase in the cellular fluorescence intensity, which is quantitatively measured using flow cytometry. In dose-response assays, increasing doses of peptide suppressed CCL8-647 and CCL2-647 induced cellular fluorescence (
[0391] The improvement in binding to CCL8 observed in the BK1.1-BK1.3 peptide series, as well as their ability to inhibit P672:CC-chemokine interactions (CCL8, CCL2, CCL3), correlated with increased chemokine neutralization potency and promiscuity. In cell-based chemotaxis assays, it was found that the improvement in binding affinity for CCL8 translated into increased potency for inhibiting CCL8-induced cell migration, as evidenced by the reduced IC.sub.50. In addition to neutralizing CCL8 and CCL7, which was predicted by the BK1.1 fluorescent polarisation binding study, the peptides BK1.2 and BK1.3 were also able to neutralize CCL2 and CCL3 induced chemotaxis. The inhibition of chemokine binding to cells indicate that the mechanism of neutralization is the prevention of chemokine binding to the cells, likely by preventing chemokine-receptor interactions.
[0392] 18. Engineered Peptide BK1.3 has In Vivo Anti-Inflammatory Activity
[0393] The results suggested that the chemokine-neutralizing properties of the engineered peptides may translate into anti-inflammatory activity in vivo. To study this, the lead peptide BK1.3 was tested in a mouse short-term inflammation model. In this model, zymosan, a yeast cell wall derived PAMP, activates cytokine and chemokine production, and leucocyte infiltration, when injected into an artificially created subcutaneous air-pouch (Coates, N. J. et al., Journal of immunology [2001])(El-Achkar, G. A. et al., PLoS One [2019]). Characterization of this model showed that Ccl9 is expressed at a high basal level but is not induced by zymosan. Ccl2, 5, 11, 12, 20, 22, 24, and Cxcl1, 2, 4, 5, 11, 13, 16 are expressed (>3 fold) at 4 hours following zymosan, and Ccl2, 5, 12, and Cxcl2, 4, 13, 16 are expressed (>3 fold) at 24 hours (
[0394] Systemic administration of BK1.3 peptide would have anti-inflammatory activity. BK1.3, control SCR peptides, and the positive control P672 were injected intraperitoneally at 0 and 9 h following zymosan injection, and the air-pouch exudate characterized at 24 hours after zymosan injection. Both BK1.3 and P672 showed a substantial and significant reduction in the number of neutrophils, eosinophils, monocytes and T-cells recruited to the air-pouch (
[0395] A critical step in the clinical translation of novel anti-inflammatory therapeutics is the demonstration of efficacy in vivo, using a model where many components of the immune-inflammatory network are activated. A short-term inflammation model using the well characterized PAMP, zymosan, which activates TLR2 signalling, was used, and resulted in the production of cytokines, chemokines, and complement. The results indicate that zymosan-induced inflammation is significantly inhibited by both local as well as systemic administration of BK1.3. It is likely that the in vivo mechanism of action of BK1.3 includes the inhibition of CC-class chemokines which not only are chemoattractants for leucocyte recruitment, but also heterodimerize and synergise with certain CXC-class chemokines. Our work indicates that peptides with promiscuous chemokine-binding and anti-inflammatory activity can be developed from tick evasins. Such peptides could provide a route to the development of new anti-inflammatory therapeutics.
[0396] 19. Materials and Methods for Examples 10 to 18
[0397] Reagents
[0398] All chemokines, unless otherwise stated, were purchased from Peprotech (UK). Fluorescent chemokines were purchased from Almac (UK). THP-1 cells (ECACC 88081201) were maintained in RPMI-1640 media supplemented with 10% fetal calf serum and 4 mM L-glutamine. Cultures were maintained between 310.sup.5 and 110.sup.6 cells/ml in a 37 C. incubator with 5% CO.sub.2. HEK 293F cells (Thermo Fisher) were maintained between 310.sup.5 and 110.sup.6 cells/ml in a 37 C. incubator with 8% CO.sub.2 and 130 RPM agitation in FreeStyle 293 Expression Medium.
[0399] Plasmids
[0400] Evasins were cloned in the expression vector pHLSec. P672 (N-terminal 8His-StrepII tag) expression vector and EVA1 (C-terminal Strep-8HisII tag) have been described previously (Eaton, J. R. O. et al., JBC [2018]). The expression vector EVA1(P672.sub.21-32) was constructed using PCR and infusion cloning as described.sup.15, and has a N-terminal 8His-StrepII tag. Plasmid sequences were confirmed by Sanger sequencing (Source Bioscience, UK). The CCL8 expression plasmid in vector pNIC-BIO3 has been described previously (Eaton, J. R. O. et al., JBC [2018]). Plasmids and sequences are available on request.
[0401] Protein Expression
[0402] Evasin proteins were expressed as described previously using a mammalian expression system (Eaton, J. R. O. et al., JBC [2018]). Briefly, HEK293F cells were transiently transfected with expression vectors using polyethylenimine and incubated for five days. The supernatant was collected and the recombinant proteins isolated using nickel affinity chromatography followed by size exclusion chromatography. Fractions showing absorbance at 280 nm were analyzed on SDS-PAGE and protein containing fractions were combined for future use. Recombinant CCL8 was expressed as described previously as a SUMO fusion protein from Escherichia coli RosettaGami 2 (DE3) cells (Novagen)(Eaton, J. R. O. et al., JBC [2018]). To produce biotinylated CCL8 the same protocol was followed except the cells were also transformed with a plasmid encoding for BirA and 500 M biotin was also added at the same time as IPTG.sup.51. Following IPTG induction, the over-expressed protein was isolated from the soluble fraction using nickel-charged IMAC Sepharose 6 Fast Flow resin (GE Healthcare). SUMO protease was added to partially purified protein and left overnight at 30 C. The SUMO tag was separated from CCL8 using cation exchange chromatography and the chemokine purified further using size exclusion chromatography. Fractions showing absorbance at 280 nm were analyzed on SDS-PAGE and protein containing fractions were combined for future use.
[0403] Hydrogen Deuterium Exchange Analysis
[0404] Working solutions of CCL8 and P672 were prepared at a concentration of 35 M in 50 mM ammonium bicarbonate buffer pH=6.5. For estimation of HDX in the heterodimer state, solutions of CCL8 and P672 were mixed in a (1:1) ratio to reach a final concentration of 17.5 M and incubated at 4 C. for 1 h (Eaton, J. R. O. et al., JBC [2018]). For estimation of HDX in the unbound state, working solution were diluted to 17.5 M with 50 mM ammonium bicarbonate pH=6.5. Aliquots of 4.3 L of heterodimer or unbound proteins were mixed with 48.2 L of D.sub.2O containing 50 mM ammonium bicarbonate buffer adjusted to pH=6.5 with DCl (final content of D.sub.2O of 91.8%) and incubated for 5 s, 30 s, 5 min and 60 min at RT. HDX was quenched by adding 22.5 L of 10% formic acid to reach a final volume of 75 L and pH=2.5, corresponding to a final concentration of 1 M. Samples were then rapidly flash frozen in liquid nitrogen and stored at 80 C. for up to 5 days before analysis.
[0405] An Acquity M class ultra-high performance liquid chromatographer with a nanoAcquity HDX manager coupled to a Synapt G2-Si time-of-flight mass spectrometer (Waters) was used and controlled using the MassLynx 4.1 software. Samples were loaded at 200 L/min into an Enzymate pepsin column (2.1 mm30 mm, 5 m particle size) where the proteins were quickly digested at 20 C. Peptides were then captured for 2 min into a BEH C18 trap column (300 m30 mm, 1.7 m particle size) at 0 C. and then separated in a BEH C18 analytical column (2.1 mm50 mm, 1.7 m particle size) at 40 L/min and 0 C. under a 12 minutes linear gradient from 4 to 85% of acetonitrile with 0.1% formic acid. The MS.sup.E approach was used for peptide mapping of non-deuterated proteins with trap collision energies of 15 to 35 V. Deuterated samples were analysed in scan mode only. Source parameters included: cone voltage 30V, capillary voltage 2.8 KV, source temperature 80 C., desolvation temperature 150 C., gas cone flow rate 80 L/h and desolvation gas 250 L/h.
[0406] The ProteinLynx Global Server 3.0.2 software was used for peptide mapping. Spectra were searched against a custom database containing the protein sequence of interest, requiring a non-specific digestion enzyme and allowing for variable modifications (i.e. N-terminus pyroglutamic acid from glutamine and deamidation or HexNAc (N-acetylhexosamine) of asparagine present in a N-X-S/T motif). Peptide identification required at least 3 fragment ion matches, the peptide presence in 4 out of 5 replicates, a retention time relative standard deviation of 5%, a precursor ion mass tolerance of 10 ppm and peptide maximum length of 30 residues. Relative deuterium uptakes % at the peptide-level were estimated using Dynamix 3.0 as the difference between the uptake (Da) observed for the complex species and the free species divided by the maximum possible uptake of the peptide. Manual check of peptide retention time, charge state and possible peak overlap were also performed. Statistical analysis included a t-Student test and HDX rate differences 5% with a p-value 0.05 were considered significant. Residues with statistically significant increased or decreased HDX rates were mapped on to a previously described homology model of the P672:CCL8 complex (Eaton, J. R. O. et al., JBC [2018])(generated using the EVA1:CCL3 complex 3FPU (Gault, J. et al., Nature methods [2016]) as template) in which the CCL8 homology structure was replaced by the CCL8 x-ray crystal structure (1ESR)(Kawamura, A. et al., Nat Comms. [2017]). Note that in the case of overlapping peptides, Dynamix 3.0 displays the % Relative Uptake for any given residue as the % Relative Uptake of the shortest peptide. Additionally, in the particular case of overlapping peptides of equal length, the % Relative Uptake refers to that of the peptide in which the residue is closest to the peptide C-terminus. Structural models were created using PyMol2.3.
[0407] Biolayer Interferometry
[0408] This was carried out as described previously using an OctetRed system (Singh, K. et al., Sci Rep [2017]). Briefly, affinity determination was evaluated with chemokine concentrations typically ranging from 300 to 0.4 nM, using a non-interacting reference protein to allow for nonspecific binding to the sensor. We used ForteBio Data Analysis 9 software to process the data and calculate association (k.sub.on), dissociation (k.sub.off), and affinity (K.sub.d) constants. Data with poor curve fits (R.sup.2<0.9) were excluded. All biolayer interferometry experiments were performed at least three times.
[0409] Fluorescent Peptides
[0410] All fluorescent peptides and scrambled (SCR) peptide were purchased from GL Biochem (Shanghai) and were synthesized using standard Fmoc solid phase synthesis to give peptides with a C-terminal amide. The scrambled peptide sequence EFTEVYEFDFKYDAPD is based on BK1.1. All were deemed to be >90% pure by HPLC analysis and verified by LC-MS. Peptides were dissolved in DMSO and the concentration determined using NMR with TSP as an internal standard (Larive, C. K., et al., Applied Spectroscopy [1997]). All peptides were analysed using a Bruker Microflex LRF MALDI-TOF mass spectrometer.
[0411] Peptide Synthesis In-House
[0412] Amino acids were purchased from CEM. Peptides were purified by HPLC using a Waters SFO system with a Kinetex 5 mm EVO C18 100 (15021.2 mm) column. All peptides were synthesized with a C-terminal amide on a 50 mmol scale using standard Fmoc protection chemistry on a CEM Liberty Blue automated peptide synthesiser. We used NovaPEG Rink Amide resin (Merck) with N,N-diisopropylcarbodiimide as a coupling reagent. Following the final Fmoc deprotection step, the resin was washed with N,N-dimethylformamide (5 ml, twice) and dichloromethane (5 ml, twice). The peptides were deprotected and cleaved from the resin by incubation of the beads with a mixture of trifluoroacetic acid/1,3 dimethoxybenzene/triisopropylsilane/water (92.5:2.5:2.5:2.5) at room temperature for 3 h. The cleaved peptides were then precipitated through the addition of 50 mL ice cold diethyl ether, the solution centrifuged for 10 min at 750 g and the resulting pellet resuspended in acetonitrile/water. The peptides were purified by reverse-phase preparative HPLC (5 to 50% B, A: solution of ammonium bicarbonate 0.1 M at pH 8 with 5% acetonitrile in water; B: solution of ammonium bicarbonate 0.1 M at pH 8 with 5% water in acetonitrile). Fractions were analysed using a MALDI-TOF mass spectrometer and peptide containing fractions were combined, dried under vacuum using a Genevac EZ-2 Elite system, and characterised using High Resolution mass spectroscopy. For cyclic peptides, the linear precursor was prepared as described above except following the final Fmoc deprotection step, on-bead chloroacetylation of the N-terminus was achieved through incubating the beads with a 2 mL of a solution of 0.3 M chloroacetic anhydride in N,N-dimethylformamide for 3 h at room temperature. After washing, cleaving and precipitating as described above the N-terminally chloroacetylated linear peptides were dissolved in no more than 2 mL of an adequate mixture of 1 M triethylammonium acetate pH 9.6 buffer and acetonitrile, where the pH was maintained at >9 through the addition of KOH. The cyclic peptide precursors were incubated at 42 C. for 1 h and the cyclisation reaction was monitored using MALDI-TOF mass spectrometry. Once the reaction appeared to have gone to completion the cyclic peptides were purified as above. Peptides were dissolved in DMSO-d6 to form 100 mM stocks. Accurate concentrations were measured by 1H-qNMR in D2O accounting for aromatic protons with TSP as standard and using a Bruker AVII 500 instrument.
[0413] Fluorescence Polarization Assays
[0414] Fluorescence polarization assays were performed using a Clariostar (BMG Tech) plate reader with the supplied FITC excitation and emission filters using 96 half area well plates (Corning). The buffer used (FP assay buffer) was 50 mM HEPES, 150 mM NaCl, 0.1% BSA, 0.002% TWEEN-20, 0.2% DMSO, pH 7.4 and the final volume in each well was 30 L. Polarization was converted to anisotropy using the equation A=(2*P)/(3P) where P is polarization and A is anisotropy. For each peptide tested the gain was set to 35mP and adjusted to a well containing fluorescent peptide only. The polarization of the emitted light in the FITC emission channel was then determined. Experiments were performed as two technical and three biological replicates. Screening of P672 peptide fragments was achieved through incubation of each peptide (50 nM) with 1 M CCL8 (Peprotech) for 30 minutes in FP assay buffer and the resulting anisotropy of the emitted light determined as above. The chemokine cross binding screen was performed by incubating 1 M chemokine (Peprotech) with 50 nM BK1.1.sub.FITC for half an hour in FP assay buffer and the resulting anisotropy of the emitted light determined as above. To monitor BK1.1.sub.FITC Ala mutants of binding to CCL8, 50 nM labelled peptide was incubated with varying concentrations of recombinant CCL8 (0-25 M, final) in 30 L FP assay buffer for 30 minutes and the resulting anisotropy of the emitted light determined as above. The anisotropy was plotted as a function of CCL8 concentration and fitted to the equation: Y=Bmax*X/(K.sub.D+X)+NS*X+Background, where Y is the measured anisotropy, X is the concentration of CCL8 added, Bmax is the maximum binding, K.sub.D is the equilibrium dissociation constant, NS is the slope of the nonlinear regression and Background is the anisotropy when no CCL8 is present, in Graph Pad Prism. Displacement assays were carried out with CCL7, CCL8, and CCL18 (Peprotech, 1 M). The chemokines were incubated with BK1.1 (50 M) or SCR (50 M) and BK1.1.sub.FITC (50 nM) for 30 minutes in FA buffer and the resulting anisotropy of the emitted light determined as above. For all FP assays, the experiments were carried out as two technical and three biological replicates.
[0415] Native Mass Spectrometry Analyses
[0416] Samples were analysed using a modified Q-Exactive mass spectrometer (Thermo Fisher Scientific) for high-mass range measurements (Gault, J. et al., Nature methods [2016]). CCL8 was buffered exchanged into 200 mM ammonium acetate solution (pH=6.5). BK1.1 obtained in dimethyl sulfoxide (DMSO) was then added to the CCL8 homodimer solution in a 1:1 (CCL8 monomer:BK1.1) ratio. In all cases no more than 0.5% DMSO was present in the final mixture, and a control sample of CCL8 homodimer containing 0.5% DMSO was also analysed. Instrumental parameters were set to: capillary voltage of 1.2 KV, source temperature of 50 C. and 60 V of source induced dissociation (SID). Gas phase dissociation was carried out by applying 35 and 55 V of higher-energy collisional dissociation (HCD) to the most intense charge state after isolation (25 m/z window). Spectra was acquired using a mass resolution of 60,000 for both precursor and dissociated product ions. All measurements were done in triplicates.
[0417] AlphaScreen Assay
[0418] AlphaScreen Histidine detection kit was purchased from PerkinElmer (6760619M lot: 2457886) and the assay was set up in white bottom Proxiplate 384 Plus microplates (PerkinElmer) following the manufacturer's instructions. The assay buffer used was 50 mM HEPES, 150 mM NaCl, 0.1% BSA, 0.01% Tween20, 1% DMSO, pH 7.5 and the final volume in each well was 20 L. Briefly, biotinylated chemokine (recombinant, final concentration 1.25 nM (CCL8), 5 nM (CCL2) and 2.5 nM (CCL3)) was pre-incubated at room temperature for 15 min with different concentrations of each peptide. His-tagged P672 (final concentration 2.5 nM (CCL8), 5 nM (CCL2) and 1.25 nM (CCL3)) was then added to each well and the plate was incubated at room temperature for 30 min. Finally, acceptor and donor beads were added as a 1:1 suspension in buffer to each well and the plate was further incubated at RT for 1 h. Data was obtained by reading the plate using a Pherastar FSX plate reader (excitation 680 nm, emission 570 nm) and was analysed using GraphPad Prism.
[0419] Fluorescent Chemokine Receptor Blocking Assay
[0420] CCL8-647 (2.5 nM, final) or CCL2-657 (1.2 nM, final) was incubated for 30 minutes with varying doses of peptide (0-100 M, final concentration) in 50 L assay buffer (RPMI-1640+L-glutamine (4 mM)+10% heat treated fetal bovine serum+0.2% DMSO) at 37 C. This mixture was then added to 50,000 THP-1 cells in a 96-well v-bottomed plated to give a final volume of 100 L, and everything incubated together for a further 30 minutes at 37 C. Following this time, the plate was centrifuged, the supernatant flicked off, and the cells resuspended in 150 L ice cold PBSA. This was repeated twice more and the cells were finally resuspended in 150 L ice cold PBSA. The median fluorescence intensity of 10,000 cells on the RL-1 channel was determined using an ATTUNE flow cytometer and plotted as function of peptide concentration and the data fitted to an inhibitor response curve with 4 parameters using Graph Pad prism 6. Experiments were performed as two technical and three biological replicates.
[0421] THP-1 Cell Migration Assays
[0422] THP-1 monocyte cell migration assays were carried out as described (Deruaz, M. et al., J Exp Med [2008]). Briefly, effective chemokine concentration (EC) EC.sub.80 was determined using a 96-transwell migration plate (5 M pore size, Corning), with THP-1 cells (300,000) in the top chamber and varying chemokine doses (0-100 nM) in the bottom chamber. The migration buffer used was RPMI 1640+0.5% FCS and 4 mM L-glutamine. This was incubated for four hours and the number of migrating cells in the bottom chamber counted using an ATTUNE flow cytometer. Data were analysed by fitting an agonist response curve with 4 parameters in GraphPad Prism. Neutralization assays were performed using the above system, using an EC.sub.80 chemokine dose, and varying evasin or peptide doses in the bottom chamber for 30 min at 37 C. before beginning the assay. In experiments involving peptides, 0.2% DMSO was maintained in the migration buffer to ensure peptide solubility. IC50 was calculated by fitting an inhibitor response curve with 4 parameters in GraphPad Prism. Experiments were performed as 3 technical and 3 biological replicates.
[0423] Subcutaneous Dorsal Air Pouch Model
[0424] C57BL/6J male mice (25-30 g, 8-10-week-old) were obtained from Charles River (UK). They were group housed in temperature and humidity-controlled rooms, kept on a 12-hr light-dark cycle, and provided with food and water ad libitum. Air pouches were established at the dorsal side of the mice as described (Duarte, D. B. et al., Curr Protoc Pharmacol [2016]). Briefly, mice were anesthetized using isoflurane inhalation and air pouches were produced on day 0 by subcutaneously injecting 4 ml of sterile air into the back of the mice. On day 3, pouches were re inflated with 3 ml of sterile air. On day 6, 0.5 ml of sterile saline solution or 0.5 ml of 25 g of zymosan (Cat #Z4250, Sigma Aldrich) in saline (w/v) was injected into the air pouch. Five minutes prior to the injection of zymosan, mice were either injected into the air pouch (local) or intra peritoneally (systemic) with 100 L of 5 mg/kg body weight of either P672 protein or the indicated peptide which was repeated 9 hours later. Mice were sacrificed 24 hours following zymosan injection by isoflurane inhalation followed by cervical dislocation and the air-pouch exudates were collected in 2 ml of saline containing 2 mM EDTA to prevent cell aggregation. Total numbers of leucocytes, neutrophils, monocytes, T-cells and eosinophils were counted using an Attune NT flow cytometer following staining with cell specific antibodies. Supernatants were kept at 80 C. for chemokine profiling. All animal procedures were approved and carried out in accordance with the UK Home Office Animals (Scientific Procedures) Act 1986, under project licence PPL P973A60F5.
[0425] Flow Cytometry Analysis
[0426] To characterize the inflammatory subsets in the pouch, multi-colour fluorescence cell staining was conducted using the combination of the following antibodies for various immune cells. Leucocytes (CD45-PE, Cat #130-110-797, Miltenyi Biotec), T-Cells (CD3-FITC, Cat #130-119-798, Miltenyi Biotec), neutrophils (Ly6G-PE.Vio 770, Cat #130-121-438, Miltenyi Biotec), monocytes (Ly-6C-APC, Cat #130-111-779, Miltenyi Biotec) and eosinophils (SigF-APC.Cy7, Cat #565527, BD-Pharmingen). Isotype control antibodies were run parallel (REA-PE, Cat #130-113-450, REA-PE.Vio770, Cat #130-113-452, REA-APC, Cat #130-113-446, REA-FITC, Cat #130-113-449, Miltenyi Biotec, Iso-APC.Cy7, Cat #5527770, BD-Pharmingen). One sample from each group was chosen randomly and labelled for all isotype control antibodies. Briefly, 200 L cell suspension was pelleted down and before staining with cell surface markers, cells were incubated with an Fc receptor block (2.5 g/10.sup.6 cells; BD Pharmingen, cat #553142) to reduce non-specific binding. Then, cells were suspended in 100 L FACS buffer (0.5% BSA/PBS/2 mM EDTA) containing fluorophore conjugated antibodies (1:50 dilution, Miltenyi Biotec antibodies and 1:100 for BD-Pharmingen antibodies) and stained for 15 minutes on ice in the dark. After washing with FACS buffer, samples were run and analysis was performed on Attune NT flow cytometer (Life Technologies, USA). Samples were run on an Attune NT flow cytometer. Data were analysed using FlowJo by an observer blinded to the treatment received. Neutrophils were defined as CD45.sup.+Ly-6G.sup.+, monocytes/macrophages were defined as CD45+Ly-6C.sup.+, T cells were defined as CD45.sup.+CD3.sup.+ and eosinophils were defined as CD45.sup.+Ly-6G.sup. SigF.sup.+ (
[0427] Chemokine Expression in Air Pouch Fluid
[0428] Air pouch exudate supernatants were screened for mouse chemokine profile using a mouse chemokine antibody array (RayBiotech C1 array), according to the manufacturer's instructions. The array consists of 25 different mouse chemokine antibodies spotted in duplicate, three positive controls, two negative controls and two blanks. Membranes were incubated overnight with air pouch exudate, washed and incubated with streptavidin-horseradish peroxidase and chemiluminescent reagent mix and then imaged on a BioRad ChemiDoc MP system following the manufacturer's instructions. The intensity of each chemokine spot was determined by Image Lab software (Version 5.0). Background intensity (from blanks) were subtracted from each measurement. Relative intensity to the positive control (set at 100) was calculated (see
[0429] Statistical Analysis
[0430] All statistical analyses were performed using GraphPad Prism8. The statistical significance was evaluated by one-way analysis of variance (ANOVA) and P value (probability of a type I error) was adjusted for multiple comparisons with threshold (alpha) for a type I error was P0.05. Unless otherwise indicated all data are represented as the means.e.m. of three independent experiments.
TABLE-US-00011 TABLE1 SEQ Identitywith ID Peptide Evasin1,4or3 NO: Name PeptideSequence usingBLAST 1 P467_RHIPU AEKSLDSDSSGEDYELWTQGCPFLVAENRTGFGTTVSCQHNCNGAIE EVA1(53.09%); KVPEGEPCYTIGEDGLGRMKLNLPYNCSLGECSGGVCVPNGRSDVCF EVA4(35.14%); KRTWEENNKAMA EVA3(35.48%) 2 P546_AMBCA ENTQQEEEDYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLT EVA1(41.30%); DGTACYVVERKVWDRMTPMLWYSCPLGECKNGVCEDLRKKEECRK EVA4(36.36%) GNGEEK 3 P672_RHIPU VCEVSEQEGVGEDNATEDEDYEDFFKPVTCYFANSTVGPLRPPNCTV EVA4(36.19%); VCTNNTAWWNDTKSDGGHCYSEYRPEKRTHSREIYNCTIGVCGNGT EVA1(29.21%) CIANHTYADCW 4 P698_RHISA NEDDSSDYYDASPMNCSSMSVNSTMGWLSMNCTMSCNGTTFPLSNS EVA1(30.68%); THCFHSYTNLTVQSRMETMTYNCSVGTCSNGTCVENGTTTTCW EVA4(35.48%) 5 P943_IXORI RSKQPTASQSSKNSIKAEFCDTNCTQGTNGAWSGCSEGCFCVHVGNN EVA3(50.00%) TKGRCMKLSSDYDYTTQ 6 P974_AMBCA ENTQQEEQDYDYGTDTCPFPVLANKTNKAKFVGCHQKCNGGDQKLT EVA1(41.30%); DGTACYVVERKVWDRMTPMLWYECPLGECKNGVCEDLRKKEDCRK EVA4(36.36%) GNGEEK 7 P983_AMBCA EDTGTEDDFDYGNTGCPFPVLGNYKSNMTKPVGCKNKCGSGYEVLN EVA1(39.77%); DTTPCYVIDQKVFNNMVPLRQYSKCPLGFCENGECKPNDQAEDCYKG EVA4(25.00%) REEQK 8 P985_AMBPA DEESEELGASTDVDYEELDANCTCPAPALTSTRNNKHYPLGCIYNCSS EVA1(28.57%); YNCTIPDGTPCYVLTLGEVKEHLQIGSTVPNCTCGLCRNGTCVSNGTV EVA4(29.91%) EECFAVEEIEET 9 P991_AMBCA ENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYY EVA1(30.00%); TCNVTRCTAPDTYPCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPN EVA4(25.53%) GTKELCFKAPNLEE 10 P993_AMBPA HRHYDPNEPCLIAGLKTPRDALPAGCRYDCMIKKNQKLRDGLLCLDV EVA1(33.85%); PEKVVKRMVNYLNYSCPLGTCRKGICKRKHRNVRCQKYPVFYMSPP EVA4(36.36%) K 11 P1005_AMBMA EKDTPKNIPGCGDTGTTAAPPADNPKHFAVYTDKHGCTIKVIGTWMT EVA4(26.60%); KEDHSRLPVSLRRVRASSGRVMLPASCQKICNDTVKNFPEGTPCRLVT EVA1(27.12%); GDPIKGKNHIKDGCIRGYCSSGVCVSDKRNISCYVPPN EVA3(39.13%) 12 P1006_AMBCA DTIGGIPGCGDPATTSAPEDQPKHYAVRTDKNGCKVMVIGTWMTKED EVA1(38.33%); HNLLPPYISKERAPSGKVQLPASCKKNCHGKLKNLPNGTPCREVFGDL EVA4(20.22%) RRRRKHIKDGCKVGKCQNGLCVSEERIISCYLPPNITDPRPTHGPLAE 13 P1011_AMBTR EKDTPKNIPGCEDAGTTAAPPADNPKHYAVYTDKNGCTFKVIGTWMT EVA4(26.51%); KEDHRRLPVSLRRVRASSGRVKLPASCQKICKHSVKKFPEGTPCRLVT EVA1(23.73%); RDPIKGKNHIKNGCIRGYCSSGVCVSDNRSISCYVLPNNTELTSPSGSF EVA3(34.62%) AE 14 P1014_AMBCA DIIGGIPGCGDPTTTSAPEVPPKHFAVRTDKDGCTLMIIGTWMTTEDHN EVA1(30.23%); RLPPDIGEKRAPYGRVQLPASCKKNCHGKVKNLPNGTPCREVFGDPR EVA4(36.36%); RGRKHIKNGCTVGKCQSGLCVTDKRIISCYIPPNITDPIPTHGPWAE EVA3(33.33%) 15 P1015_AMBCA EEAPGPAPGCGEPEPTPPKPRRHGIVTNVNSCNSTILVWNGKEFPALCK EVA4(32.39%); VRCPHKSYRVSDFEPCLKFTNRRFLQERKDETPYKCKLGFCRHGTCIT EVA1(25.76%) SEHSRKVPCKVPADRLDPSE 16 P1030_AMBPA GPPSIPGNESIPGCGDAGTTTAPEDNPKHYGTLTDKKGCTLPIIGTWMT EVA1(24.59%); AVDHQHLQGTRGERRGPTGKVNLPASCRKNCHGRQEILRDGIPCRKV EVA3(37.93%) VGNPKGSKKHLKSGCLRGKCLAGQCVNDGRRISCYVPRNITDTEPTP GLLAE 17 P1063_AMBTR QSEVGKNVPGCGDTETLEAPPQEKPPYYEYKDEEGCTQKVLESWFQA EVA1(30.61%); GERSTGRGQKKRGHGRRPSRVLRTVDCRKNCTVGITALPDGHLCLVP EVA3(43.48%); RGDPFTRGGAIKYGCYLGDCASGHCQHRYETVSCRLPAPDTTAKPYY EVA4(26.42%) VTPEK 18 P1146_IXORI GPDTKGDEESDENELFTVEYCGTNCTQLENGSWTPCSGNNGNCRCFH None ESDKTVGLCLSTEYTDFSEYPDPNSSEIIAAAPLPRERLIQ detected 19 P1156_IXORI ADDDNELFTVQYCGMNCTKDEGGTWTGCTGKKEGCKCYHESGKNY EVA3(30.23%) GLCLSTEYTDFSQYGNPSDSEIEAAKPKRSDTLSH 20 P1180_AMBTR EEPKDGYDYTEGCPFVVLGNGTHAKPAGCSHLCNGAPETLDDNMEC EVA1(40.74%); YNVTEEVAKRMTPDIPYTCWLGWCSKGECKRDNRTEVCYRGSERE EVA4(28.74%) 21 P1181_AMBMA EEREDDNDYGGGCPFVVLGNGTHAKPAGCSHLCNGAPETLDNIECYN EVA1(45.05%); VTEEVAKRMTPDIPYTCWLGWCSKGECKRDNRTEVCYRGSERE EVA4(24.73%) 22 P1182_AMBMA EPKDDNDYGGGCPFVVLGNGTHAKPAGCSHLCNGAPETLDNIECYNV EVA1(44.19%); TEEVAKRMTPGIPYACWLGWCNKGECKRGNRTEVCYRGSEEE EVA4(24.18%) 23 P1183_AMBTR EAPKDDFEYDGGCPFVVLDNGTHVKPAGCSHLCNGAPETLDNIECYN EVA1(43.02%); VTEEVAKRMTPGIPYACWLGWCSKGECKRDNRTEVCYRGSEEE EVA4(25.00%) 24 P1209_AMBPA KTDTKNAAGELPPKVAIPGCEDPATTKAPLPDDPRYYGVTIDKDGCQ EVA1(35.59%); RKVLGSSQRQQRQVQNGRKPGRKGRGRRPVFVDLKLTVDCKRKCNG EVA4(22.22%) TYSQLPDGEPCLVCDGEPYGRHRTIKGGCYQGNCSSGQCHRGERKVN CYIPKNITNNVLNSVNLAE 25 P1215_AMBPA KTDTKNAAGELPPKVVIPGCEDPATTKAPLPDEPPYYGITIDKDGCQR EVA1(33.90%); KVLGSSQRQQRKVQNGRKLDGKKRGRRPVFVDLELTVDCKRKCNGT EVA4(20.83%) YSQLPDGENCLVSDGYPYGRWGTIKGGCYQGNCSSGQCHRGEKKVN CYLPKNITNDVPKSLNLAE 26 P1219_IXORI ASLAKETEDTTLPARALVDSPDSDNCSSPQLPYFDELTYMPLGFLAVN EVA4(32.00%) CTKTCPVGKNGTVVNGNKCIVTWSILDVSTITVLVGSCKNGYCISDGS SECRNITLAGEDSQEEEEEAEEDEEEDDGDEEEDEEEDEEENDDD 27 P1220_IXORI GSTPSAMKTEDILKVLGSTSSLENHTDSSHCRYQELLDITKNIENAGFL EVA3(30.43%) AINCQRSCPNGKQTMVEGYGCIFKIKHATKRGKVKVKEGSCRKGACV RGSTRPPWRLLVLLGESKEEEFL 28 P1224_IXORI SDLCKMEAESSPFKLPQSSLLDAPDEEGCKYQLLFVEAEGPLVVNCTK EVA1(25.33%); DCPNGKIRTVVEGELCIAMVKTSSSGEATGLVGSCKRGSCVKKDDPC EVA3(33.33%) RTFTLSEEGDDDEEDEEEEEDEEEDEEEDEEEEEEDEEEED 29 P1243_AMBAM RNHTEDNSTEYYDYEEARCACPARHLNNTNGTVLKLLGCHYFCNGT EVA1(32.79%); LCTAPDGYPCYNLTAQQVRTLTTYPNTSCAVGVCMKGTCVKNGTME EVA4(42.86%) QCFKTP 30 P1252_AMBAM RGGAASVPANASIPGCGDAQTTPAAPEDQPKHYVVYRDGNGCEVKII EVA1(30.00%); GTWMTTEDYNCLPDTFRKNRAPHGKVKLPASCKKTCGNAVQNLKD EVA4(24.24%) GTPCRKVFGDLGRRRNLIKNGCLVGACQSGLCVSGNRTISCYIPPNST DTRATPGSFAE 31 P1283_IXORI KEPEDTTLPPGALVDSPDSDNCSSPHLPYFDETTNMWMGFLAVNCTK None KCPVGKHVTVVDGNKCIGTWSFLDELTITVLVGSCKDGFCETDGSSEC detected RNITLAEEDSQEEEGAAAEEEDEEDEEDEEEEEAEEEREDDHDDA
TABLE-US-00012 TABLE 2A Evasin Class I: Novel Evasins binding CC-chemokines: CCL2, CCL13, or CCL20 in addition to other CC chemokines as indicated Binding assay BLI BLI BLI BLI BLI BLI BLI BLI SEQ UENCE ID NO. Previously described evasins 9 29 1 3 20 7 21 8 Chemokine EVASIN1 EVASIN4 EVASIN3 P991_AMBCA P1243_AMBAM P467_RHIPU P672_RHIPU P1180_AMBTR P983_AMBPA P1181_AMBMA P985_AMBPA CCL1_HUMAN .sup.2E10 2.13E08 5.34E08 8.3E09 CCL2_HUMAN No 1.22E08 1E12 9.1E09 5.3E08 1.4E08 7.4E08 1.7E08 Binding CCL3_HUMAN 1E10 .sup.6E11 1.08E09 5.3E09 3.63E10 2.6E09 1.1E09 3.5E09 2.2E09 8.9E09 CCL3L1_HUMAN 5E11 1.40E09 5.05E09 5.24E10 2.7E09 2.2E09 2.1E09 3.3E09 7.5E09 CCL4_HUMAN 5E10 No 5.82E09 1.53E08 1.36E08 6.6E08 .sup.8E09 5.3E08 4.6E08 Binding CCL4L1_HUMAN 8.27E10 3.54E08 4.72E09 .sup.2E08 2.9E09 3.5E08 2.1E08 CCL5_HUMAN .sup.9E11 1.47E09 1.74E09 7.67E09 3.5E09 CCL7_HUMAN .sup.7E10 5.14E10 8.66E09 2.15E09 1.6E08 9.8E08 3.2E08 1.2E07 6.1E08 CCL8_HUMAN 2.5E10 8.79E09 2.19E08 2.85E09 3.7E09 3.6E09 .sup.7E09 1.4E08 6.5E09 CCL11_HUMAN 3.4E10 3.43E09 6.03E09 1.4E09 3.3E08 2.1E08 .sup.2E08 .sup.8E09 CCL13_HUMAN No 4.19E10 7.88E10 2.56E09 .sup.9E09 1.7E08 1.9E08 8.9E08 Binding CCL14_HUMAN 1.4E10 4.30E10 8.16E10 4.13E09 5.5E09 4.4E09 8.1E08 4.7E08 CCL15_HUMAN 2.31E09 1.59E07 9.61E09 3.2E08 CCL16_HUMAN 2.6E10 1.28E09 9.26E10 1.41E08 3.3E09 4.5E08 CCL17_HUMAN 6.1E10 7.66E09 7.34E10 CCL18_HUMAN 3E09 .sup.3E11 2.09E10 5.01E12 1.66E08 5.8E09 .sup.1E08 4.3E07 CCL19_HUMAN 1.4E10 1.44E08 5.92E10 CCL20_HUMAN No 8.34E09 Binding CCL21_HUMAN .sup.1E11 6.54E09 CCL 2_HUMAN 4.3E10 3.97E0
2.23E0
CCL2
_HUMAN 4.43E09 5.58E0
6.62E09
CCL24_HUMAN 4.3E10 6.5
E09 7.
E09 4.1E0
CCL25_HUMAN 6.96E0
CCL26_HUMAN 8.
E10 CCL27_HUMAN No 3.
E08 1.51E08 Binding CCL28_HUMAN CX
CL
_HUMAN CXCL1_HUMAN 8.50E10 CXCL2_HUMAN CXCL3_HUMAN CXCL4_HUMAN CXCL5_HUMAN CXCL6_HUMAN CXCL7_HUMAN CXCL8_HUMAN 4.30E10 CXCL9_HUMAN CXCL10_HUMAN CXCL1
_HUMAN CXCL12_HUMAN CXCL13_HUMAN CXCL14_HUMAN CXCL1
_HUMAN CXCL17_HUMAN CXCL
_HUMAN KCL1_HUMAN KCL
_HUMAN Evasin Class I: Novel Evasins binding CC-chemokines: CCL2, CCL13, or CCL20 in addition to other CC chemokines as indicated Binding assay BLI BLI BLI BLI YSD YSD YSD YSD SEQ UENCE ID NO. 6 2 23 22 10 15 16 30 Chemokine P974_AMBCA P546_AMBCA P1183_AMBTR P1182_AMBMA P993_AMBPA P1015_AMBCA P1030_AMBPA P1252_AMBAM CCL1_HUMAN 7.05E08 1.6E07 CCL2_HUMAN 9.3E08 8.3E08 1.2E08 7.4E08 CCL3_HUMAN 7.97E09 1.5E08 5.4E09 YES CCL3L1_HUMAN 1.31E08 1.5E08 1.1E07 9.5E09 CCL4_HUMAN 3.02E08 2.7E08 7.8E08 6.3E08 CCL4L1_HUMAN 2.32E08 8.9E09 4.8E08 9.2E08 CCL5_HUMAN 1.6E07 YES YES CCL7_HUMAN 4.12E08 .sup.9E08 5.4E09 CCL8_HUMAN 2.58E09 1.3E09 1.1E06 2.9E08 YES CCL11_HUMAN 1.7E08 8.7E09 8.5E09 2.8E08 YES CCL13_HUMAN 2.29E08 1.3E08 5.7E09 5.6E08 CCL14_HUMAN 4.91E08 2.8E08 .sup.5E08 CCL15_HUMAN CCL16_HUMAN 1.1E08 6.7E09 CCL17_HUMAN 7.06E08 .sup.7E08 YES YES YES CCL18_HUMAN 1.7E08 1.6E08 3.3E08 CCL19_HUMAN CCL20_HUMAN YES YES YES YES CCL21_HUMAN CCL22_HUMAN 1.6
E08 2.3E
8 CCL23_HUMAN CCL24_HUMAN COL_25_HUMAN COL_26_HUMAN COL_27_HUMAN COL_28_HUMAN CX
CL
_HUMAN CXCL1_HUMAN CXCL2_HUMAN CXCL3_HUMAN CXCL4_HUMAN CXCL5_HUMAN CXCL6_HUMAN CXCL7_HUMAN CXCL8_HUMAN YES YES CXCL9_HUMAN CXCL10_HUMAN CXCL11_HUMAN CXCL12_HUMAN YES CXCL13_HUMAN CXCL14_HUMAN CXCL1
_HUMAN CXCL17_HUMAN CXCL
_HUMAN KCL1_HUMAN KCL
_HUMAN
indicates data missing or illegible when filed
TABLE-US-00013 TABLE 2B Evasin Class II: Novel Evasins binding CXC-chemokines, 3, 10 or 12 in addition to other CXC chemokines as indicated Binding assay BLI BLI YSD YSD YSD YSD YSD SEQ UENCE ID NO. Previously described evasins 5 19 24 25 26 28 31 Chemokine EVASIN1 EVASIN4 EVASIN3 P943_IXORI P1156_IXORI P1209_AMBPA P1215_AMBPA P1219_IXORI P1224_IXORI P1283_IXORI CCL1_HUMAN .sup.2E10 YES CCL2_HUMAN No Binding CCL3_HUMAN 1E10 .sup.6E11 CCL3L1_HUMAN 5E11 CCL4_HUMAN 5E10 No Binding CCL4L1_HUMAN CCL5_HUMAN .sup.9E11 YES YES CCL7_HUMAN .sup.7E10 CCL8_HUMAN 2.5E10 CCL11_HUMAN 3.4E10 YES YES CCL13_HUMAN No Binding CCL14_HUMAN 1.4E10 CCL15_HUMAN 2.31E09 CCL16_HUMAN 2.6E10 CCL17_HUMAN 6.1E10 CCL18_HUMAN 3E09 .sup.3E11 YES YES CCL22_HUMAN 4.3E10 CCL23_HUMAN 4.43E09 CCL24_HUMAN 4.1E10 CCL25_HUMAN 6.96E08 CCL26_HUMAN 8.8E10 CCL27_HUMAN No Binding CCL28_HUMAN CX3CL1_HUMAN CXCL1_HUMAN 8.50E10 5.4E07 3.25E09 CXCL2_HUMAN CXCL3_HUMAN 2.7E07 8.10E08 CXCL4_HUMAN CXCL5_HUMAN CXCL6_HUMAN CXCL7_HUMAN CXCL8_HUMAN 4.30E10 4.60E09 CXCL9_HUMAN CXCL10_HUMAN CXCL11_HUMAN CXCL12_HUMAN YES YES CXCL13_HUMAN CXCL14_HUMAN CXCL16_HUMAN CXCL17_HUMAN CXCL4L1_HUMAN XCL1_HUMAN XCL2_HUMAN
TABLE-US-00014 TABLE 2C Evasin Class III: Other novel evasin sequences Binding assay YSD YSD YSD YSD YSD YSD YSD YSD SEQ UENCE ID NO. Previously described evasins 4 11 12 13 14 17 18 27 Chemokine EVASIN1 EVASIN4 EVASIN3 P698_RHISA P1005_AMBMA P1006_AMBCA P1011_AMBTR P1014_AMBCA P1063_AMBTR P1146_IXORI P1220_IXORI CCL1_HUMAN .sup.2E10 YES CCL2_HUMAN No Binding CCL3_HUMAN 1E10 .sup.6E11 YES CCL3L1_HUMAN 5E11 CCL4_HUMAN 5E10 No YES Binding CCL4L1_HUMAN CCL5_HUMAN .sup.9E11 YES YES YES YES YES CCL7_HUMAN .sup.7E10 CCL8_HUMAN 2.5E10 YES CCL11_HUMAN 3.4E10 YES YES CCL13_HUMAN No Binding CCL14_HUMAN 1.4E10 CCL15_HUMAN 2.31E09 YES CCL16_HUMAN 2.6E10 CCL17_HUMAN 6.1E10 YES YES CCL18_HUMAN 3E09 .sup.3E11 YES CCL19_HUMAN 1.4E10 YES YES CCL24_HUMAN 4.1E10 CCL25_HUMAN 6.96E08 YES YES YES CCL26_HUMAN 8.8E10 CCL27_HUMAN No Binding CCL28_HUMAN CX3CL1_HUMAN CXCL1_HUMAN 8.50E10 CXCL2_HUMAN CXCL3_HUMAN CXCL4_HUMAN CXCL5_HUMAN CXCL6_HUMAN CXCL13_HUMAN CXCL14_HUMAN CXCL16_HUMAN CXCL17_HUMAN CXCL4L1_HUMAN XCL1_HUMAN XCL2_HUMAN
TABLE-US-00015 TABLE 3 SEQUENCE ID NO. 9 29 1 3 7 Chemokine P991_AMBCA P1243_AMBAM P467_RHIPU P672_RHIPU P983_AMBPA CCL2_HUMAN 4.78E09 3.26E09 5.95E09 CCL3_HUMAN 2.90E09 5.74E09 CCL3L1_HUMAN 1.17E09 CCL5_HUMAN 1.84E09 7.87E09 8.74E09 CCL7_HUMAN 6.51E09 1.11E08 CCL8_HUMAN 2.10E09 1.92E09 2.37E09
TABLE-US-00016 TABLE4 SEQID Previouslydescribed NO PeptideName,origin PeptideSequence chemokinebinding Notes 32 EVAI_RHISA(evasin1, EDDEDYGDLGGCPFLVAENKTGYPTI CCL3,CCL3L1,CCL4, fromRhipicephalus VACKQDCNGTTETAPNGTRCFSIGDE CCL18 sanguineus), GLRRMTANLPYDCPLGQCSNGDCIPK ETYEVCYRRNWRDKKN 33 EVA3_RHISA(evasin3, LVSTIESRTSGDGADNFDVVSCNKNC CXCL1,CXCL8. fromRhipicephalus TSGQNECPEGCFCGLLGQNKKGHCYK sanguineus) IIGNLSGEPPVVRR 34 EVA4_RHISA(evasin4, EVPQMTSSSAPDLEEEDDYTAYAPLT CCL1,CCL3,CCL5, fromRhipicephalus CYFTNSTLGLLAPPNCSVLCNSTTTW CCL7,CCL8,CCL11, sanguineus) FNETSPNNASCLLTVDFLTQDAILQE CCL14,CCL15,CCL16, NQPYNCSVGHCDNGTCAGPPRHAQCW CCL17,CCL18,CCL19, CCL21,CCL22,CCL23, CCL24,CCL25,CCL26 35 IRI-01,Ixodes GPAPSAKENEKAPLCLPQESLINNRD CCL11,CCL24,CCL26, ricinus PNGCNYQLLPYFTEDGMGGGFLAIDC CCL2,CCL8,CCL7 SKSCPEGTHETVVDGNS 36 IHO-01,Ixodes AFVSSSTEVEIGSTSEHNSNETDEYG CCL11,CCL24,CCL26, holocyclus YDYNADGLGCPVVGIGGLDNKTWHPN CCL2,CCL8 CTNECPNSTKLFLLENGTP 37 ATR-02,Amblyomma GNEVSDPPLTDEDCEYYDPSEDNITC CCL11,CCL24,CCL26, triste SIRSLNTTGRPIPVGCLATCENSTRR CCL2,CCL8,CCL7 LHNGTECLGISDQVANRMQGNVTYTC PVGLCYRGVCORNGLGIDCWHNTPPP NSTNVTTNASTTPLPTSSRDL 38 AMA-01,Amblyomma ECEESDTSESTECSTEDYSNRIRDNE CCL11,CCL24,CCL26, maculatum TCFIGALNTTGHPVPVGCTLDCGNST CCL2,CCL8,CCL7 RYLPNGTECIDLTQQASDVMQSDVPY YCPIGLCANGICKRSGLELNCWHDMP PPVSTDTAIENPTTSISSSAKL 39 ACA-02,Amblyomma GIEGSGNLATSHEMDDCLDDNSTCVI CCL11,CCL24,CCL26 cajennense QTLNTTGEPRPVGCVLKCKNSTQHLA NGTECLGIPELAGVRMQYNVSYTCAV GLCNAGVCERTGLWIGCWQNEPPPNS TDVTTTAPTTTTASTSSV 40 ACA-01,Amblyomma ENTQQEEQDYDYGTDTCPFPVLANKT CCL11,CCL24,CCL26, identicalto cajennense NKAKFVGCHQKCNGGDQKLTDGTACY CCL2,CCL8,CCL7 P974_AMBCA, VVERKVWDRMTPMLWYECPLGECKNG reportedin VCEDLRKKEDCRKGNGEEK PCT/GB2017/050563 andSinghetal. 41 AAM-02,Amblyomma RNHTEDNSTEYYDYEEARCACPARHL CCL11,CCL24,CCL26, identicalto americanum NNTNGTVLKLLGCHYFCNGTLCTAPD CCL2,CCL7 P1243_AMBAM, GYPCYNLTAQQVRTLTTYPNTSCAVG reportedin VCMKGTCVKNGTMEQCFKTP PCT/GB2017/050563 42 AAM-01,Amblyomma ESEGSVSTETEVISYEDDCQDDNSTC CCL11,CCL24,CCL26, americanum FIQTLNTTGEPRPVGCILECENSTQR CCL2,CCL8,CCL7 LPNGTECLGLPGLAAVKMQRNVSYTC SVGLCNGEGVCDRTGLWIGCWTNTPP PNSTNVTTKPPTTTTASPGTG 43 RPU-02,Rhipicephalus CEVQNTTLAEEDYDTGCGYNIVITKN CCL11,CCL24,CCL26, pulchellus KTLVVNCTMDCQPKMLMNESEPCLFN CCL2,CCL8,CCL7 SSVPYDHMQPHHNYTCMEGICKNGTC VSPSNNITCWLPPPPVRYYPNETMVT STIEPEA 44 RPU-01,Rhipicephalus AEKSLDSDSSGEDYELWTQGCPFLVA CCL11,CCL24,CCL26, identicalto pulchellus ENRTGFGTTVSCQHNCNGAIEKVPEG CCL2,CCL8,CCL7 P467_RHIPU, EPCYTIGEDGLGRMKLNLPYNCSLGE reportedin CSGGVCVPNGRSDVCFKRTWEENNKA PCT/GB2017/050563 MA andSinghetal.
TABLE-US-00017 TABLE5 SEQ ID Peptide NO: Name PeptideSequence 45 P458_IXORI GSKQPGAAGSSSDSVEAVFCPTNCTKGTNGAWS GCSDDCICVHVGENTEGSCMKFSGDYDYPTPEA 46 P675_IXORI GSNQLSGPQSSANSNDAVFCDTNCTQGTDGAWS GCRGDCFCVHVGNSTEGRCIELIGDFDYSTPGA ED 47 P942_IXORI NQLSGPQSSANSNEAVFCDTNCTQGTDEAWSGC RGDCFCVYVGNSTEGRCMMLSGDFDYSTPGAED 48 P1074_IXORI GSKESSAHQSSDDSIKAEFCDAKCTMKTDGKWT QCHGGCFCVHVGNETEGRCMRLDGDYDYPSTQP EE 49 P1077_IXORI GSKQLIGPQSSTNSIKAEFCDTNCTAGTNGIWN GCSGDCFCTHVGNSTEGRCMKITGFDEYPTSEA EE 50 P1078_IXORI GSKGSSAQQSSHDSIKAEFCETNCTMKTGGKWT QCHGGCFCVHVGNETVGRCIKLDGDYDYPSSKH EE 51 P1080_IXORI SAGSKGSSAPQSSGDSVVAEFCDTNCTMKKDGK WTECNGDCFCVHVGNETVGRCMRLDGDYDYTSS KTTRRNKKTRNGLCRLDRNRTTVDYPERNTREP 52 P1086_IXORI GSKGQRASQVSETSITAEFCDTSCTQGTDKTWS GCSGDCFCVHVGNDTEGRCMRWDGDYPSAEEEE 53 P1090_IXORI GSKELSGPESSENSIEAAFCDTNCTEGTDGVWS GCSAGCFCVHVGNSTVGRCMTFNGVDGG 54 P1095_IXORI HSPVAGSEVQKLTSDPNDDIDVSYCGMNCTVVN GKSDECSENCKCLHEGDDPKGICVAITYFGDWG DPNDDPKINEATPQTQIFEKKRK 55 P1096_IXORI HTTVTGSVEGKPNNPNEDIEVSYCRMNCTVENG VSSACSGDCVCVHRDNEPNGICVEITYFGDFGD PSQDPSIDEAAPRESVSKRRSNGES 56 P1100_IXORI GSKGSSASQSSDNSVVAKFCDTNCTINEGGKWT ECKGGCFCVHVGNETVGRCMKLDGDYDYPSPKP EE 57 P1101_IXORI HTTVAGSDEDIEVSYCGMNCTVESGKSSKCSPD CVCVHEGNERDGICISITYLGDLGNPLEDPSID LATPLAPVFQSSK 58 P1104_IXORI ESKEASASQGPGKSFKVEFCETNCTENNGVWSG CTGDCICVSVGDSKEGRCMDLGDKVIDTPVAQG 59 P1124_IXORI DSKGTSDSQDSTKSIKVDFCETNCTKTDGGWTG CTGDCICVSVGDSIEGRCMDFG 60 P1126_AMBCA KPQILQRTDKSTDSEWDPQTCPETCIPSKNITC SDGCVCVKLGEEEEGTCFNMTGVDWLGSPSDD 61 P1127_IXORI AGKDDEHFSVDYCGMNCTQQEDGSWTACSGRNG ECRCYHESGKRSGLCLSTTYIDFSEYGNLSDSD IAAASPRLSMKESH 62 P1128_IXORI KDDEHFSVDYCGMNCTQQEDGSWTACSGRNEEC RCYHESGKKNGLCLSTTYIDFSQYGNPSDSDIA AASPRP 63 P1132_IXORI LSDEDELFSVEYCGTNCTKQDTGSWTTCSGNCT CYHEDGKKVGLCLSTEYTDFTKFPKPTSEEIAN ARPLPKREKTLN 64 P1134_IXORI NEEVFTVEYCGMNCTQKSDGTWTECSGKNKDCR CYHESDAREGLCLSTEYTDFSQFETPSNSDLEA ATPRPRKTLYPVRNPHGPKTRGLGYDKRILRDR VKFLI 65 P1142_AMBCA KPQILQRTDHSTDSDWDPQMCPETCNPSKNISC SSECLCVTLGGGDETGTCFNMSGVDWLGHAQAS DGHNDG 66 P1162_IXORI LNDEELFTVDYCGTNCTQQPNGSWTTCPGNCSC YHEDGKTDGFCLSTEYTDFTQFPNLTSEEMDAA TPRPE 67 P1166_IXORI GPETKEDKKSDVYELFTVEYCGTNCTLLTNGRW TACTGKKGTCRCYHESGEKVGLCLSTEYTDFSE YPNPKSSEIDAAAPLPRETH 68 P1168_IXORI GQDTDGKEKSDEYELFTVEYCGTNCTQLENGSW TACTGKNGTCRCFHENDKKVGLCLSTEYTDFSE YPDPNSEEIKAASPLP 69 P1170_IXORI LGDEDQLFSVEYCGTNCTQQDDGKWTPCSGKNG KCKCYHEDGKRYGLCLYTEYTDFSQYPNPEGSE IENTRPRP 70 P1172_IXORI LHEDEIFTVDYCGTNCTKQSNGSWTTCPGNCSC YHEDGKTDGFCLSTEYTDFTQFPNLTSEEMDAA TPRPE 71 P1174_IXORI LNNENELFSVEYCGANCTQQDNGSWTKCKGNCT CYHEDGKRYGLCLSTEYTDFTQFPKPTSEEIAD ASPRPKETNSH 72 P1229_IXORI DDEFFTVDYCGMNCTLQQDGSWTPCTQKNAECK CYHESGSSVGLCLSTAYTDFNQFGDPNNSDLDA ATPRHPDASSR
TABLE-US-00018 TABLE 6 SEQ Chemokines bound in yeast surface display % Identity to EVA3, EVA4 or EVA1 ID NO Peptide Name and % cells over threshold fluorescence over alignment length in residues 45 P458_IXORI CXCL9_HUMAN 37% EVA3_RHISA: 33%_57 46 P675_IXORI CXCL11_HUMAN 55% EVA3_RHISA: 34%_53 47 P942_IXORI CXCL11_HUMAN 37% EVA3_RHISA: 32%_53 48 P1074_IXORI CXCL10_HUMAN 71%; CXCL11_HUMAN 33%; EVA3_RHISA: 27%_56 CXCL9_HUMAN 35% 49 P1077_IXORI CXCL1_HUMAN 50% EVA3_RHISA: 42%_38 50 P1078_IXORI CXCL11_HUMAN 38% EVA3_RHISA: 32%_47 51 P1080_IXORI CXCL10_HUMAN 70%; CXCL11_HUMAN 45%; EVA3_RHISA: 33%_40 CXCL12_HUMAN 53%; CXCL9_HUMAN 49% 52 P1086_IXORI CXCL10_HUMAN 63%; CXCL9_HUMAN 54% EVA3_RHISA: 30%_40 53 P1090_IXORI CXCL11_HUMAN 32% EVA3_RHISA: 31%_45 54 P1095_IXORI CXCL12_HUMAN 47% EVA3_RHISA: 37%_49 55 P1096_IXORI CXCL10_HUMAN 50% 56 P1100_IXORI CXCL9_HUMAN 55% EVA3_RHISA: 36%_45 57 P1101_IXORI CXCL10_HUMAN 75% EVA3_RHISA: 34%_56 58 P1104_IXORI CXCL1_HUMAN 65% EVA3_RHISA: 29%_63 59 P1124_IXORI CXCL9_HUMAN 31% EVA3_RHISA: 30%_47 60 P1126_AMBCA CXCL10_HUMAN 66%; CXCL7_HUMAN 74%; EVA3_RHISA: 31%_52 CXCL9_HUMAN 56% 61 P1127_IXORI CXCL8_HUMAN 43% EVA3_RHISA: 30%_50 62 P1128_IXORI CXCL8_HUMAN 53% EVA3_RHISA: 29%_45 63 P1132_IXORI CXCL1_HUMAN 68% 64 P1134_IXORI CXCL10_HUMAN 66% EVA3_RHISA: 34%_35 65 P1142_AMBCA CXCL10_HUMAN 80%; CXCL7_HUMAN 71% 66 P1162_IXORI CXCL1_HUMAN 72% EVA4_RHISA: 37%_35; EVA3_RHISA: 34%_38 67 P1166_IXORI CXCL1_HUMAN 63% 68 P1168_IXORI CXCL1_HUMAN 66%; CXCL8_HUMAN 24% EVA3_RHISA: 27%_44 69 P1170_IXORI CXCL8_HUMAN 81% EVA3_RHISA: 33%_49 70 P1172_IXORI CXCL1_HUMAN 65%; CXCL8_HUMAN 41% EVA3_RHISA: 34%_38; EVA4_RHISA: 34%_35 71 P1174_IXORI CXCL8_HUMAN 29% EVA4_RHISA: 26%_31 72 P1229_IXORI CXCL1_HUMAN 66%
TABLE-US-00019 TABLE 7 Sequence ID Peptide Name Diseases 1 P467_RHIPU alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 2 P546_AMBCA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, primary sclerosing cholangitis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 3 P672_RHIPU alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 4 P698_RHISA Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, rheumatoid arthritis, sarcoidosis, skin fibrosis, vasculitis 5 P943_IXORI alcoholic liver injury, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver allograft rejection, liver fibrosis, paracetamol liver injury, psoriasis, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury 6 P974_AMBCA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 7 P983_AMBCA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 8 P985_AMBPA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, autoimmune hepatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver allograft rejection, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 9 P991_AMBCA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, autoimmune hepatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, primary sclerosing cholangitis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 10 P993_AMBPA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 11 P1005_AMBMA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 12 P1006_AMBCA Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary sclerosing cholangitis, rheumatoid arthritis, sarcoidosis, skin fibrosis, vasculitis 13 P1011_AMBTR Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary sclerosing cholangitis, rheumatoid arthritis, sarcoidosis, skin fibrosis, vasculitis 14 P1014_AMBCA atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, multiple sclerosis, myocardial infarction, psoriasis, vasculitis 15 P1015_AMBCA alcoholic liver injury, atherosclerosis, autoimmune hepatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, multiple sclerosis, myocarditis, primary biliary cirrhosis, primary sclerosing cholangitis, psoriasis, rheumatoid arthritis, sarcoidosis, stroke, vasculitis 16 P1030_AMBPA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 17 P1063_AMBTR Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, rheumatoid arthritis, sarcoidosis, skin fibrosis, vasculitis 18 P1146_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 19 P1156_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 20 P1180_AMBTR alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 21 P1181_AMBMA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 22 P1182_AMBMA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 23 P1183_AMBTR alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 24 P1209_AMBPA alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, autoimmune hepatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, primary sclerosing cholangitis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 25 P1215_AMBPA Alzheimer's disease, atherosclerosis, atopic dermatitis, autoimmune hepatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, primary sclerosing cholangitis, rheumatoid arthritis, sarcoidosis, skin fibrosis, vasculitis 26 P1219_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 27 P1220_IXORI atherosclerosis, inflammatory bowel disease, primary sclerosing cholangitis 28 P1224_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 29 P1243_AMBAM alcoholic liver injury, Alzheimer's disease, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, kidney fibrosis, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 30 P1252_AMBAM alcoholic liver injury, atherosclerosis, atopic dermatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, myocarditis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis 31 P1283_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis
TABLE-US-00020 TABLE 8 Sequence ID Peptide Name Diseases 45 P458_IXORI atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, influenza, multiple sclerosis, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, rheumatoid arthritis, sarcoidosis, vasculitis 46 P675_IXORI atherosclerosis, influenza, liver allograft rejection, vasculitis 47 P942_IXORI atherosclerosis, influenza, liver allograft rejection, vasculitis 48 P1074_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver allograft rejection, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 49 P1077_IXORI alcoholic liver injury, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, liver fibrosis, paracetamol liver injury, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury 50 P1078_IXORI atherosclerosis, influenza, liver allograft rejection, vasculitis 51 P1080_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, breast cancer, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver allograft rejection, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 52 P1086_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 53 P1090_IXORI atherosclerosis, influenza, liver allograft rejection, vasculitis 54 P1095_IXORI atherosclerosis, autoimmune hepatitis, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, multiple sclerosis, myocarditis, primary biliary cirrhosis, primary sclerosing cholangitis, rheumatoid arthritis 55 P1096_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 56 P1100_IXORI atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, influenza, multiple sclerosis, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, rheumatoid arthritis, sarcoidosis, vasculitis 57 P1101_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 58 P1104_IXORI alcoholic liver injury, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, liver fibrosis, paracetamol liver injury, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury 59 P1124_IXORI atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, influenza, multiple sclerosis, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, rheumatoid arthritis, sarcoidosis, vasculitis 60 P1126_AMBCA alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 61 P1127_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 62 P1128_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 63 P1132_IXORI alcoholic liver injury, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, liver fibrosis, paracetamol liver injury, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury 64 P1134_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 65 P1142_AMBCA alcoholic liver injury, Alzheimer's disease, atherosclerosis, autoimmune hepatitis, colorectal cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, multiple sclerosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, vasculitis 66 P1162_IXORI alcoholic liver injury, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, liver fibrosis, paracetamol liver injury, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury 67 P1166_IXORI alcoholic liver injury, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, liver fibrosis, paracetamol liver injury, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury 68 P1168_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 69 P1170_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 70 P1172_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, liver fibrosis, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 71 P1174_IXORI alcoholic liver injury, Alzheimer's disease, atherosclerosis, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, influenza, myocardial infarction, myocarditis, nonalcoholic steatohepatitis, paracetamol liver injury, primary biliary cirrhosis, psoriasis, rheumatoid arthritis, sarcoidosis, skin fibrosis, stroke, vasculitis, acute lung injury 72 P1229_IXORI alcoholic liver injury, breast cancer, idiopathic pulmonary fibrosis, inflammatory bowel disease, liver fibrosis, paracetamol liver injury, rheumatoid arthritis, skin fibrosis, stroke, vasculitis, acute lung injury
TABLE-US-00021 TABLE 9 BK1.1.sub.FITC CCL8, K.sub.d 10.sup.9 (M) Fold change WT 156 12 E17A 188 30 1.2 D18A 387 45 2.5 E19A 331 35 2.1 D20A 238 85 1.5 Y21A 736 20 4.7 E22A 619 66 4.0 D23A 237 44 1.5 F24A 238 19 1.5 F25A 720 19 4.6 K26A 124 25 0.8 P27A V28A 601 55 3.8 T29A 317 13 2.0 Y31A 601 87 3.8 F32A 360 20 2.3 The mean s.e.m of three independent experiments is shown. () indicates no binding detected.
REFERENCES
[0431] 1. Frangogiannis, N. G. (2014) The inflammatory response in myocardial injury, repair, and remodelling. Nat Rev Cardiol 11, 255-265 [0432] 2. Leuschner, F., Katus, H. A., and Kaya, Z. (2009) Autoimmune myocarditis: past, present and future. Journal of autoimmunity 33, 282-289 [0433] 3. Zernecke, A., and Weber, C. (2014) Chemokines in atherosclerosis: proceedings resumed. Arteriosclerosis, thrombosis, and vascular biology 34, 742-750 [0434] 4. Mirabelli-Badenier, M., Braunersreuther, V., Viviani, G. L., Dallegri, F., Quercioli, A., Veneselli, E., Mach, F., and Montecucco, F. (2011) CC and CXC chemokines are pivotal mediators of cerebral injury in ischaemic stroke. Thrombosis and haemostasis 105, 409-420 [0435] 5. Garin, A., and Proudfoot, A. E. I. (2011) Chemokines as targets for therapy. Experimental Cell Research 317, 602-612 [0436] 6. Schall, T. J., and Proudfoot, A. E. (2011) Overcoming hurdles in developing successful drugs targeting chemokine receptors. Nat Rev Immunol 11, 355-363 [0437] 7. Allen, S. J., Crown, S. E., and Handel, T. M. (2007) Chemokine:Receptor Structure, Interactions, and Antagonism. Annu. Rev. Immunol. 25, 787-820 [0438] 8. Horuk, R. (2009) Chemokine receptor antagonists: overcoming developmental hurdles. Nature Reviews Drug Discovery 8, 23-33 [0439] 9. Szekanecz, Z., and Koch, A. E. (2016) Successes and failures of chemokine-pathway targeting in rheumatoid arthritis. Nat Rev Rheumatol 12, 5-13 [0440] 10. von Hundelshausen, P., Agten, S. M., Eckardt, V., Blanchet, X., Schmitt, M. M., Ippel, H., Neideck, C., Bidzhekov, K., Leberzammer, J., Wichapong, K., Faussner, A., Drechsler, M., Grommes, J., van Geffen, J. P., Li, H., Ortega-Gomez, A., Megens, R. T., Naumann, R., Dijkgraaf, I., Nicolaes, G. A., Doring, Y., Soehnlein, O., Lutgens, E., Heemskerk, J. W., Koenen, R. R., Mayo, K. H., Hackeng, T. M., and Weber, C. (2017) Chemokine interactome mapping enables tailored intervention in acute and chronic inflammation. Sci Transl Med 9 [0441] 11. Proudfoot, A. E., and Uguccioni, M. (2016) Modulation of Chemokine Responses: Synergy and Cooperativity. Front Immunol 7, 183 [0442] 12. Brandes, M., Klauschen, F., Kuchen, S., and Germain, R. N. (2013) A systems analysis identifies a feedforward inflammatory circuit leading to lethal influenza infection. Cell 154, 197-212 [0443] 13. Proudfoot, A. E., Bonvin, P., and Power, C. A. (2015) Targeting chemokines: Pathogens can, why can't we? Cytokine 74, 259-267 [0444] 14. Gonzalez-Motos, V., Kropp, K. A., and Viejo-Borbolla, A. (2016) Chemokine binding proteins: An immunomodulatory strategy going viral. Cytokine & growth factor reviews 30, 71-80 [0445] 15. Smith, P., Fallon, R. E., Mangan, N. E., Walsh, C. M., Saraiva, M., Sayers, J. R., McKenzie, A. N. J., Alcami, A., and Fallon, P. G. (2005) Schistosoma mansoni secretes a chemokine binding protein with antiinflammatory activity. J. Exp. Med. 202, 1319-1325 [0446] 16. Bonvin, P., Power, C. A., and Proudfoot, A. E. (2016) Evasins: Therapeutic Potential of a New Family of Chemokine-Binding Proteins from Ticks. Front Immunol 7, 208 [0447] 17. Singh, K., Davies, G., Alenazi, Y., Eaton, J. R. O., Kawamura, A., and Bhattacharya, S. (2017) Yeast surface display identifies a family of evasins from ticks with novel polyvalent CC chemokine-binding activities. Sci Rep 7, 4267 [0448] 18. Hayward, J., Sanchez, J., Perry, A., Huang, C., Rodriguez Valle, M., Canals, M., Payne, R. J., and Stone, M. J. (2017) Ticks from diverse genera encode chemokine-inhibitory evasin proteins. The Journal of biological chemistry 292, 15670-15680 [0449] 19. Heidarieh, H., Hernaez, B., and Alcami, A. (2015) Immune modulation by virus-encoded secreted chemokine binding proteins. Virus Res 209, 67-75 [0450] 20. Frauenschuh, A., Power, C. A., Druaz, M., Ferreira, B. R., Silva, J. S., Teixeira, M. M., Dias, J. M., Martin, T., Wells, T. N. C., and Proudfoot, A. E. I. (2007) Molecular cloning and characterization of a highly selective chemokine-binding protein from the tick Rhipicephalus sanguineus. J. Biol. Chem. 282, 27250-27258 [0451] 21. Deruaz, M., Frauenschuh, A., Alessandri, A. L., Dias, J. M., Coelho, F. M., Russo, R. C., Ferreira, B. R., Graham, G. J., Shaw, J. P., Wells, T. N., Teixeira, M. M., Power, C. A., and Proudfoot, A. E. (2008) Ticks produce highly selective chemokine binding proteins with antiinflammatory activity. J Exp Med 205, 2019-2031 [0452] 22. Dias, J. M., Losberger, C., Deruaz, M., Power, C. A., Proudfoot, A. E. I., and Shaw, J. P. (2009) Structural Basis of Chemokine Sequestration by a Tick Chemokine Binding Protein: The Crystal Structure of the Complex between Evasin-1 and CCL3. PLoS ONE 4, e8514 [0453] 23. Vieira, A. T., Fagundes, C. T., Alessandri, A. L., Castor, M. G., Guabiraba, R., Borges, V. O., Silveira, K. D., Vieira, E. L., Goncalves, J. L., Silva, T. A., Deruaz, M., Proudfoot, A. E., Sousa, L. P., and Teixeira, M. M. (2009) Treatment with a novel chemokine-binding protein or eosinophil lineage-ablation protects mice from experimental colitis. Am J Pathol 175, 2382-2391 [0454] 24. Castor, M. G. M., Rezende, B., Resende, C. B., Alessandri, A. L., Fagundes, C. T., Sousa, L. P., Arantes, R. M. E., Souza, D. G., Silva, T. A., Proudfoot, A. E. I., Teixeira, M. M., and Pinho, V. (2010) The CCL3/macrophage inflammatory protein-lalpha-binding protein evasin-1 protects from graft-versus-host disease but does not modify graft-versus-leukemia in mice. The Journal of Immunology 184, 2646-2654 [0455] 25. Montecucco, F., Lenglet, S., Braunersreuther, V., Pelli, G., Pellieux, C., Montessuit, C., Lerch, R., Deruaz, M., Proudfoot, A. E., and Mach, F. (2010) Single Administration of the CXC Chemokine-Binding Protein Evasin-3 During Ischemia Prevents Myocardial Reperfusion Injury in Mice. Arteriosclerosis, thrombosis, and vascular biology 30, 1371-1377 [0456] 26. Russo, R. C., Alessandri, A. L., Garcia, C. C., Cordeiro, B. F., Pinho, V., Cassali, G. D., Proudfoot, A. E. I., and Teixeira, M. M. (2011) Therapeutic Effects of Evasin-1, a Chemokine Binding Protein, in Bleomycin-Induced Pulmonary Fibrosis. Am J Respir Cell Mol Biol 45, 72-80 [0457] 27. Proudfoot, A., and Power, C. (2010) CXC-chemokine antagonists isolated from Rhipicephalus sanguineus. Google Patents [0458] 28. Deruaz, M., and Proudfoot, A. (WO2007051781A1. Publication number, 067221, 12067221, PCT/2006/67939, PCT/EP/2006/067939, PCT/EP/2006/67939,) CXC-chemokine antagonists isolated from Rhipicephalus sanguineus. US Patent Office [0459] 29. Deruaz, M., and Proudfoot, A. (WO2007093432 A1, PCT/EP2004/053638, EP1984392B1 2007) Novel cc-chemokine antagonists. US Patent Office [0460] 30. Braunersreuther, V., Montecucco, F., Pelli, G., Galan, K., Proudfoot, A. E., Belin, A., Vuilleumier, N., Burger, F., Lenglet, S., Caffa, I., Soncini, D., Nencioni, A., Vallee, J.-P., and Mach, F. (2013) Treatment with the CC chemokine-binding protein Evasin-4 improves post-infarction myocardial injury and survival in mice. Thromb. Haemost. 110, 807-825 [0461] 31. Copin, J.-C., da Silva, R. F., Fraga-Silva, R. A., Capettini, L., Quintao, S., Lenglet, S., Pelli, G., Galan, K., Burger, F., Braunersreuther, V., Schaller, K., Deruaz, M., Proudfoot, A. E., Dallegri, F., Stergiopulos, N., Santos, R. A. S., Gasche, Y., Mach, F., and Montecucco, F. (2013) Treatment with Evasin-3 reduces atherosclerotic vulnerability for ischemic stroke, but not brain injury in mice. J Cereb. Blood Flow Metab. 33, 490-498 [0462] 32. Deruaz, M., Bonvin, P., Severin, I. C., Johnson, Z., Krohn, S., Power, C. A., and Proudfoot, A. E. I. (2013) Evasin-4, a tick-derived chemokine-binding protein with broad selectivity can be modified for use in preclinical disease models. FEBS Journal 280, 4876-4887 [0463] 33. Bonvin, P., Dunn, S. M., Rousseau, F., Dyer, D. P., Shaw, J., Power, C. A., Handel, T. M., and Proudfoot, A. E. I. (2014) Identification of the Pharmacophore of the CC Chemokine-binding Proteins Evasin-1 and-4 Using Phage Display. Journal of Biological Chemistry 289, 31846-31855 [0464] 34. Montecucco, F., Mach, F., Lenglet, S., Vonlaufen, A., Gomes Quindere, A. L., Pelli, G., Burger, F., Galan, K., Dallegri, F., Carbone, F., Proudfoot, A. E., Vuilleumier, N., and Frossard, J.-L. (2014) Treatment with Evasin-3 abrogates neutrophil-mediated inflammation in mouse acute pancreatitis. Eur J Clin Invest 44, 940-950 [0465] 35. Weston-Davies, W. H., Nunn, M. A., Pinto, F. O., Ian J Mackie, S., Richards, J., Machin, S. J., Prudo, R., and Hillmen, P. (2014) Clinical and Immunological Characterisation of Coversin, a Novel Small Protein Inhibitor of Complement C5 with Potential As a Therapeutic Agent in PNH and Other Complement Mediated Disorders. Blood 124, 4280 [0466] 36. Lei, Y., Ripen, A. M., Ishimaru, N., Ohigashi, I., Nagasawa, T., Jeker, L. T., Bosl, M. R., Hollander, G. A., Hayashi, Y., Malefyt Rde, W., Nitta, T., and Takahama, Y. (2011) Aire-dependent production of XCL1 mediates medullary accumulation of thymic dendritic cells and contributes to regulatory T cell development. J Exp Med 208, 383-394 [0467] 37. Klein, R. S., Izikson, L., Means, T., Gibson, H. D., Lin, E., Sobel, R. A., Weiner, H. L., and Luster, A. D. (2004) IFN-inducible protein 10/CXC chemokine ligand 10-independent induction of experimental autoimmune encephalomyelitis. Journal of immunology 172, 550-559 [0468] 38. Turnbull, I. C., Eltoukhy, A. A., Fish, K. M., Nonnenmacher, M., Ishikawa, K., Chen, J., Hajjar, R. J., Anderson, D. G., and Costa, K. D. (2016) Myocardial Delivery of Lipidoid Nanoparticle Carrying modRNA Induces Rapid and Transient Expression. Mol Ther 24, 66-75 [0469] 39. Sultana, N., Magadum, A., Hadas, Y., Kondrat, J., Singh, N., Youssef, E., Calderon, D., Chepurko, E., Dubois, N., Hajjar, R. J., and Zangi, L. (2017) Optimizing Cardiac Delivery of Modified mRNA. Mol Ther 25, 1306-1315 [0470] 40. Kondrat, J., Sultana, N., and Zangi, L. (2017) Synthesis of Modified mRNA for Myocardial Delivery. Methods Mol Biol 1521, 127-138 [0471] 41. Turnbull, I. C., Eltoukhy, A. A., Anderson, D. G., and Costa, K. D. (2017) Lipidoid mRNA Nanoparticles for Myocardial Delivery in Rodents. Methods Mol Biol 1521, 153-166 [0472] 42. Escher, F., Vetter, R., Kuhl, U., Westermann, D., Schultheiss, H. P., and Tschope, C. (2011) Fractalkine in human inflammatory cardiomyopathy. Heart 97, 733-739 [0473] 43. Fuse, K., Kodama, M., Hanawa, H., Okura, Y., Ito, M., Shiono, T., Maruyama, S., Hirono, S., Kato, K., Watanabe, K., and Aizawa, Y. (2001) Enhanced expression and production of monocyte chemoattractant protein-1 in myocarditis. Clinical and experimental immunology 124, 346-352 [0474] 44. Lehmann, M. H., Kuhnert, H., Muller, S., and Sigusch, H. H. (1998) Monocyte chemoattractant protein 1 (MCP-1) gene expression in dilated cardiomyopathy. Cytokine 10, 739-746 [0475] 45. Nogueira, L. G., Santos, R. H., Ianni, B. M., Fiorelli, A. I., Mairena, E. C., Benvenuti, L.
[0476] A., Frade, A., Donadi, E., Dias, F., Saba, B., Wang, H. T., Fragata, A., Sampaio, M., Hirata, M. H., Buck, P., Mady, C., Bocchi, E. A., Stolf, N. A., Kalil, J., and Cunha-Neto, E. (2012) Myocardial chemokine expression and intensity of myocarditis in Chagas cardiomyopathy are controlled by polymorphisms in CXCL9 and CXCL10. PLoS neglected tropical diseases 6, e1867 [0477] 46. Kittleson, M. M., Minhas, K. M., Irizarry, R. A., Ye, S. Q., Edness, G., Breton, E., Conte, J. V., Tomaselli, G., Garcia, J. G., and Hare, J. M. (2005) Gene expression in giant cell myocarditis: Altered expression of immune response genes. International journal of cardiology 102, 333-340 [0478] 47. Lassner, D., Kuhl, U., Siegismund, C. S., Rohde, M., Elezkurtaj, S., Escher, F., Tschope, C., Gross, U. M., Poller, W., and Schultheiss, H. P. (2014) Improved diagnosis of idiopathic giant cell myocarditis and cardiac sarcoidosis by myocardial gene expression profiling. Eur Heart J 35, 2186-2195 [0479] 48. Satoh, M., Tamura, G., Segawa, I., Tashiro, A., Hiramori, K., and Satodate, R. (1996) Expression of cytokine genes and presence of enteroviral genomic RNA in endomyocardial biopsy tissues of myocarditis and dilated cardiomyopathy. Virchows Arch 427, 503-509 [0480] 49. Zuern, C. S., Walker, B., Sauter, M., Schaub, M., Chatterjee, M., Mueller, K., Rath, D., Vogel, S., Tegtmeyer, R., Seizer, P., Geisler, T., Kandolf, R., Lang, F., Klingel, K., Gawaz, M., and Borst, O. (2015) Endomyocardial expression of SDF-1 predicts mortality in patients with suspected myocarditis. Clin Res Cardiol 104, 1033-1043 [0481] 50. Borst, O., Schaub, M., Walker, B., Sauter, M., Muenzer, P., Gramlich, M., Mueller, K., Geisler, T., Lang, F., Klingel, K., Kandolf, R., Bigalke, B., Gawaz, M., and Zuern, C. S. (2014) CXCL16 is a novel diagnostic marker and predictor of mortality in inflammatory cardiomyopathy and heart failure. International journal of cardiology 176, 896-903 [0482] 51. de Lemos, J. A., Morrow, D. A., Blazing, M. A., Jarolim, P., Wiviott, S. D., Sabatine, M. S., Califf, R. M., and Braunwald, E. (2007) Serial measurement of monocyte chemoattractant protein-1 after acute coronary syndromes: results from the A to Z trial. Journal of the American College of Cardiology 50, 2117-2124 [0483] 52. Orn, S., Breland, U. M., Mollnes, T. E., Manhenke, C., Dickstein, K., Aukrust, P., and Ueland, T. (2009) The chemokine network in relation to infarct size and left ventricular remodeling following acute myocardial infarction. Am J Cardiol 104, 1179-1183 [0484] 53. Haque, N. S., Zhang, X., French, D. L., Li, J., Poon, M., Fallon, J. T., Gabel, B. R., Taubman, M. B., Koschinsky, M., and Harpel, P. C. (2000) CC chemokine I-309 is the principal monocyte chemoattractant induced by apolipoprotein(a) in human vascular endothelial cells. Circulation 102, 786-792 [0485] 54. Reape, T. J., and Groot, P. H. (1999) Chemokines and atherosclerosis. Atherosclerosis 147, 213-225 [0486] 55. Haley, K. J., Lilly, C. M., Yang, J. H., Feng, Y., Kennedy, S. P., Turi, T. G., Thompson, J. F., Sukhova, G. H., Libby, P., and Lee, R. T. (2000) Overexpression of eotaxin and the CCR3 receptor in human atherosclerosis: using genomic technology to identify a potential novel pathway of vascular inflammation. Circulation 102, 2185-2189 [0487] 56. Yu, R., Kim, C.-S., Kawada, T., Kwon, T.-W., Lim, T.-H., Kim, Y.-W., and Kwon, B.-S. (2004) Involvement of leukotactin-1, a novel CC chemokine, in human atherosclerosis. Atherosclerosis 174, 35-42 [0488] 57. Weber, C., Meiler, S., Doring, Y., Koch, M., Drechsler, M., Megens, R. T. A., Rowinska, Z., Bidzhekov, K., Fecher, C., Ribechini, E., van Zandvoort, M. A. M. J., Binder, C. J., Jelinek, I., Hristov, M., Boon, L., Jung, S., Kom, T., Lutz, M. B., Frster, I., Zenke, M., Hieronymus, T., Junt, T., and Zernecke, A. (2011) CCL17-expressing dendritic cells drive atherosclerosis by restraining regulatory T cell homeostasis in mice. J. Clin. Invest. 121, 2898-2910 [0489] 58. Calvayrac, O., Rodriguez-Calvo, R., Alonso, J., Orbe, J., Martin-Ventura, J. L., Guadall, A., Gentile, M., Juan-Babot, O., Egido, J., Beloqui, O., Paramo, J. A., Rodriguez, C., and Martinez-Gonzilez, J. (2011) CCL20 is increased in hypercholesterolemic subjects and is upregulated by LDL in vascular smooth muscle cells: role of NF-B. Arteriosclerosis, thrombosis, and vascular biology 31, 2733-2741 [0490] 59. Erbel, C., Sato, K., Meyer, F. B., Kopecky, S. L., Frye, R. L., Goronzy, J. J., and Weyand, C. M. (2007) Functional profile of activated dendritic cells in unstable atherosclerotic plaque. Basic Res Cardiol 102, 123-132 [0491] 60. Kimura, S., Tanimoto, A., Wang, K.-Y., Shimajiri, S., Guo, X., Tasaki, T., Yamada, S., and Sasaguri, Y. (2012) Expression of macrophage-derived chemokine (CCL22) in atherosclerosis and regulation by histamine via the H2 receptor. Pathol. Int. 62, 675-683 [0492] 61. Kim, C.-S., Kang, J.-H., Cho, H.-R., Blankenship, T. N., Erickson, K. L., Kawada, T., and Yu, R. (2011) Potential involvement of CCL23 in atherosclerotic lesion formation/progression by the enhancement of chemotaxis, adhesion molecule expression, and MMP-2 release from monocytes. Inflamm. Res. 60, 889-895 [0493] 62. Abd Alla, J., Langer, A., Elzahwy, S. S., Arman-Kalcek, G., Streichert, T., and Quitterer, U. (2010) Angiotensin-converting enzyme inhibition down-regulates the pro-atherogenic chemokine receptor 9 (CCR9)-chemokine ligand 25 (CCL25) axis. Journal of Biological Chemistry 285, 23496-23505 [0494] 63. Zhang, X., Feng, X., Cai, W., Liu, T., Liang, Z., Sun, Y., Yan, C., and Han, Y. (2015) Chemokine CX3CL1 and its receptor CX3CR1 are associated with human atherosclerotic lesion volnerability. Thromb. Res. 135, 1147-1153 [0495] 64. Mach, F., Sauty, A., Iarossi, A. S., Sukhova, G. K., Neote, K., Libby, P., and Luster, A. D. (1999) Differential expression of three T lymphocyte-activating CXC chemokines by human atheroma-associated cells. J Clin. Invest. 104, 1041-1050 [0496] 65. Abi-Younes, S., Sauty, A., Mach, F., Sukhova, G. K., Libby, P., and Luster, A. D. (2000) The stromal cell-derived factor-1 chemokine is a potent platelet agonist highly expressed in atherosclerotic plaques. Circ. Res. 86, 131-138 [0497] 66. Smedbakken, L. M., Halvorsen, B., Daissormont, I., Ranheim, T., Michelsen, A. E., Skjelland, M., Sagen, E. L., Folkersen, L., Krohg-Sorensen, K., Russell, D., Holm, S., Ueland, T., Fevang, B., Hedin, U., Yndestad, A., Gullestad, L., Hansson, G. K., Biessen, E. A., and Aukrust, P. (2012) Increased levels of the homeostatic chemokine CXCL13 in human atherosclerosisPotential role in plaque stabilization. Atherosclerosis 224, 266-273 [0498] 67. Minami, M., Kume, N., Shimaoka, T., Kataoka, H., Hayashida, K., Akiyama, Y., Nagata, I., Ando, K., Nobuyoshi, M., Hanyuu, M., Komeda, M., Yonehara, S., and Kita, T. (2001) Expression of SR-PSOX, a novel cell-surface scavenger receptor for phosphatidylserine and oxidized LDL in human atherosclerotic lesions. Arteriosclerosis, thrombosis, and vascular biology 21, 1796-1800 [0499] 68. Eardley, K. S., Smith, S. W., and Cockwell, P. (2009) Chemokines in vasculitis. Front Biosci (Elite Ed) 1, 26-35 [0500] 69. Brix, S. R., Stege, G., Disteldorf, E., Hoxha, E., Krebs, C., Krohn, S., Otto, B., Klatschke, K., Herden, E., Heymann, F., Lira, S. A., Tacke, F., Wolf, G., Busch, M., Jabs, W. J., Ozcan, F., Keller, F., Beige, J., Wagner, K., Helmchen, U., Noriega, M., Wiech, T., Panzer, U., and Stahl, R. A. (2015) CC Chemokine Ligand 18 in ANCA-Associated Crescentic GN. J Am Soc Nephrol 26, 2105-2117 [0501] 70. Dallos, T., Heiland, G. R., Strehl, J., Karonitsch, T., Gross, W. L., Moosig, F., Holl-Ulrich, C., Distler, J. H., Manger, B., Schett, G., and Zwerina, J. (2010) CCL17/thymus and activation-related chemokine in Churg-Strauss syndrome. Arthritis and rheumatism 62, 3496-3503 [0502] 71. Eriksson, P., Andersson, C., Cassel, P., Nystrom, S., and Ernerudh, J. (2015) Increase in Th17-associated CCL20 and decrease in Th2-associated CCL22 plasma chemokines in active ANCA-associated vasculitis. Scandinavian journal of rheumatology 44, 80-83 [0503] 72. Corbera-Bellalta, M., Planas-Rigol, E., Lozano, E., Terrades-Garca, N., Alba, M. A., Prieto-Gonzilez, S., Garcia-Martinez, A., Albero, R., Enjuanes, A., Espigol-Frigole, G., Hernindez-Rodriguez, J., Roux-Lombard, P., Ferlin, W. G., Dayer, J.-M., Kosco-Vilbois, M. H., and Cid, M. C. (2016) Blocking interferon reduces expression of chemokines CXCL9, CXCL10 and CXCL11 and decreases macrophage infiltration in ex vivo cultured arteries from patients with giant cell arteritis. Annals of the rheumatic diseases 75, 1177-1186 [0504] 73. Blaschke, S., Brandt, P., Wessels, J. T., and Muller, G. A. (2009) Expression and function of the C-class chemokine lymphotactin (XCL1) in Wegener's granulomatosis. J Rheumatol 36, 2491-2500 [0505] 74. Krumbholz, M., Theil, D., Cepok, S., Hemmer, B., Kivisakk, P., Ransohoff, R. M., Hofbauer, M., Farina, C., Derfuss, T., Hartle, C., Newcombe, J., Hohlfeld, R., and Meinl, E. (2006) Chemokines in multiple sclerosis: CXCL12 and CXCL13 up-regulation is differentially linked to CNS immune cell recruitment. Brain 129, 200-211 [0506] 75. Miyagishi, R., Kikuchi, S., Fukazawa, T., and Tashiro, K. (1995) Macrophage inflammatory protein-1 alpha in the cerebrospinal fluid of patients with multiple sclerosis and other inflammatory neurological diseases. J Neurol Sci 129, 223-227 [0507] 76. Simpson, J. E., Newcombe, J., Cuzner, M. L., and Woodroofe, M. N. (2000) Expression of the interferon-gamma-inducible chemokines IP-10 and Mig and their receptor, CXCR3, in multiple sclerosis lesions. Neuropathol Appl Neurobiol 26, 133-142 [0508] 77. Liu, C., Cui, G., Zhu, M., Kang, X., and Guo, H. (2014) Neuroinflammation in Alzheimer's disease: chemokines produced by astrocytes and chemokine receptors. Int J Clin Exp Pathol 7, 8342-8355 [0509] 78. Sasaki, M., Miyakoshi, M., Sato, Y., and Nakanuma, Y. (2014) Chemokine-chemokine receptor CCL2-CCR2 and CX3CL1-CX3CR1 axis may play a role in the aggravated inflammation in primary biliary cirrhosis. Dig Dis Sci 59, 358-364 [0510] 79. Dyson, J. K., Hirschfield, G. M., Adams, D. H., Beuers, U., Mann, D. A., Lindor, K. D., and Jones, D. E. (2015) Novel therapeutic targets in primary biliary cirrhosis. Nat Rev Gastroenterol Hepatol 12, 147-158 [0511] 80. Landi, A., Weismuller, T. J., Lankisch, T. O., Santer, D. M., Tyrrell, D. L., Manns, M. P., and Houghton, M. (2014) Differential serum levels of eosinophilic eotaxins in primary sclerosing cholangitis, primary biliary cirrhosis, and autoimmune hepatitis. J Interferon Cytokine Res 34, 204-214 [0512] 81. Borchers, A. T., Shimoda, S., Bowlus, C., Keen, C. L., and Gershwin, M. E. (2009) Lymphocyte recruitment and homing to the liver in primary biliary cirrhosis and primary sclerosing cholangitis. Semin Immunopathol 31, 309-322 [0513] 82. Hirschfield, G. M., and Gershwin, M. E. (2013) The immunobiology and pathophysiology of primary biliary cirrhosis. Annu Rev Pathol 8, 303-330 [0514] 83. Li, Y., Wang, W., Tang, L., He, X., Yan, X., Zhang, X., Zhu, Y., Sun, J., Shi, Y., Ma, X., Mackay, I. R., Gershwin, M. E., Han, Y., and Hou, J. (2015) Chemokine (C-X-C motif) ligand 13 promotes intrahepatic chemokine (C-X-C motif) receptor 5+ lymphocyte homing and aberrant B-cell immune responses in primary biliary cirrhosis. Hepatology 61, 1998-2007 [0515] 84. Heydtmann, M., Lalor, P. F., Eksteen, J. A., Hubscher, S. G., Briskin, M., and Adams, D. H. (2005) CXC Chemokine Ligand 16 Promotes Integrin-Mediated Adhesion of Liver-Infiltrating Lymphocytes to Cholangiocytes and Hepatocytes within the Inflamed Human Liver. The Journal of Immunology 174, 1055-1062 [0516] 85. Eksteen, B., Grant, A. J., Miles, A., Curbishley, S. M., Lalor, P. F., Hubscher, S. G., Briskin, M., Salmon, M., and Adams, D. H. (2004) Hepatic endothelial CCL25 mediates the recruitment of CCR9+ gut-homing lymphocytes to the liver in primary sclerosing cholangitis. J Exp Med 200, 1511-1517 [0517] 86. Sahin, H., and Wasmuth, H. E. (2013) Chemokines in tissue fibrosis. Biochim. Biophys. Acta 1832, 1041-1048 [0518] 87. Czaja, A. J. (2014) Review article: chemokines as orchestrators of autoimmune hepatitis and potential therapeutic targets. Alimentary pharmacology & therapeutics 40, 261-279 [0519] 88. Braunersreuther, V., Viviani, G. L., Mach, F., and Montecucco, F. (2012) Role of cytokines and chemokines in non-alcoholic fatty liver disease. World J Gastroenterol 18, 727-735 [0520] 89. Xu, Z., Zhang, X., Lau, J., and Yu, J. (2016) C-X-C motif chemokine 10 in non-alcoholic steatohepatitis: role as a pro-inflammatory factor and clinical implication. Expert Rev Mol Med 18, e16 [0521] 90. Krenkel, O., Mossanen, J. C., and Tacke, F. (2014) Immune mechanisms in acetaminophen-induced acute liver failure. Hepatobiliary Surg Nutr 3, 331-343 [0522] 91. Marra, F., and Tacke, F. (2014) Roles for chemokines in liver disease. Gastroenterology 147, 577-594 e571 [0523] 92. Hard, D., Griese, M., Nicolai, T., Zissel, G., Prell, C., Reinhardt, D., Schendel, D. J., and Krauss-Etschmann, S. (2005) A role for MCP-1/CCR2 in interstitial lung disease in children. Respir Res 6, 93 [0524] 93. Schmidt, K., Martinez-Gamboa, L., Meier, S., Witt, C., Meisel, C., Hanitsch, L. G., Becker, M. O., Huscher, D., Burmester, G. R., and Riemekasten, G. (2009) Bronchoalveoloar lavage fluid cytokines and chemokines as markers and predictors for the outcome of interstitial lung disease in systemic sclerosis patients. Arthritis research & therapy 11, R111 [0525] 94. Capelli, A., Di Stefano, A., Gnemmi, I., and Donner, C. F. (2005) CCR5 expression and CC chemokine levels in idiopathic pulmonary fibrosis. Eur Respir J 25, 701-707 [0526] 95. Willems, S., Verleden, S. E., Vanaudenaerde, B. M., Wynants, M., Dooms, C., Yserbyt, J., Somers, J., Verbeken, E. K., Verleden, G. M., and Wuyts, W. A. (2013) Multiplex protein profiling of bronchoalveolar lavage in idiopathic pulmonary fibrosis and hypersensitivity pneumonitis. Ann Thorac Med 8, 38-45 [0527] 96. DePianto, D. J., Chandriani, S., Abbas, A. R., Jia, G., N'Diaye, E. N., Caplazi, P., Kauder, S. E., Biswas, S., Karnik, S. K., Ha, C., Modrusan, Z., Matthay, M. A., Kukreja, J., Collard, H. R., Egen, J. G., Wolters, P. J., and Arron, J. R. (2015) Heterogeneous gene expression signatures correspond to distinct lung pathologies and biomarkers of disease severity in idiopathic pulmonary fibrosis. Thorax 70, 48-56 [0528] 97. Schupp, J. C., Binder, H., Jager, B., Cillis, G., Zissel, G., Muller-Quernheim, J., and Prasse, A. (2015) Macrophage activation in acute exacerbation of idiopathic pulmonary fibrosis. PLoS One 10, e0116775 [0529] 98. Petrek, M., Pantelidis, P., Southcott, A. M., Lympany, P., Safranek, P., Black, C. M., Kolek, V., Weigl, E., and du Bois, R. M. (1997) The source and role of RANTES in interstitial lung disease. Eur Respir J 10, 1207-1216 [0530] 99. Belperio, J. A., Dy, M., Murray, L., Burdick, M. D., Xue, Y. Y., Strieter, R. M., and Keane, M. P. (2004) The Role of the Th2 CC Chemokine Ligand CCL17 in Pulmonary Fibrosis. The Journal of Immunology 173, 4692-4698 [0531] 100. Antoniou, K. M., Tzouvelekis, A., Alexandrakis, M. G., Sfiridaki, K., Tsiligianni, I., Rachiotis, G., Tzanakis, N., Bouros, D., Milic-Emili, J., and Siafakas, N. M. (2006) Different angiogenic activity in pulmonary sarcoidosis and idiopathic pulmonary fibrosis. Chest 130, 982-988 [0532] 101. Vasakova, M., Sterclova, M., Kolesar, L., Slavcev, A., Pohunek, P., Sulc, J., Skibova, J., and Striz, I. (2009) Bronchoalveolar lavage fluid cellular characteristics, functional parameters and cytokine and chemokine levels in interstitial lung diseases. Scand J Immunol 69, 268-274 [0533] 102. Vuga, L. J., Tedrow, J. R., Pandit, K. V., Tan, J., Kass, D. J., Xue, J., Chandra, D., Leader, J. K., Gibson, K. F., Kaminski, N., Sciurba, F. C., and Duncan, S. R. (2014) C-X-C motif chemokine 13 (CXCL13) is a prognostic biomarker of idiopathic pulmonary fibrosis. Am J Respir Crit Care Med 189, 966-974 [0534] 103. Williams, A. E., Jose, R. J., Mercer, P. F., Brealey, D., Parekh, D., Thickett, D. R., O'Kane, C., McAuley, D. F., and Chambers, R. C. (2017) Evidence for chemokine synergy during neutrophil migration in ARDS. Thorax 72, 66-73 [0535] 104. Bhatia, M., Zemans, R. L., and Jeyaseelan, S. (2012) Role of chemokines in the pathogenesis of acute lung injury. Am J Respir Cell Mol Biol 46, 566-572 [0536] 105. Petrek, M., Kolek, V., Szotkowska, J., and du Bois, R. M. (2002) CC and C chemokine expression in pulmonary sarcoidosis. European Respiratory Journal 20, 1206-1212 [0537] 106. Palchevskiy, V., Hashemi, N., Weigt, S. S., Xue, Y. Y., Derhovanessian, A., Keane, M. P., Strieter, R. M., Fishbein, M. C., Deng, J. C., Lynch, J. P., 3rd, Elashoff, R., and Belperio, J. A. (2011) Immune response CC chemokines CCL2 and CCL5 are associated with pulmonary sarcoidosis. Fibrogenesis & tissue repair 4, 10 [0538] 107. Arakelyan, A., Kriegova, E., Kubistova, Z., Mrazek, F., Kverka, M., du Bois, R. M., Kolek, V., and Petrek, M. (2009) Protein levels of CC chemokine ligand (CCL)15, CCL16 and macrophage stimulating protein in patients with sarcoidosis. Clinical and experimental immunology 155, 457-465 [0539] 108. Cai, M., Bonella, F., He, X., Sixt, S. U., Sarria, R., Guzman, J., and Costabel, U. (2013) CCL18 in serum, BAL fluid and alveolar macrophage culture supernatant in interstitial lung diseases. Respir Med 107, 1444-1452 [0540] 109. Gibejova, A., Mrazek, F., Subrtova, D., Sekerova, V., Szotkowska, J., Kolek, V., du Bois, R. M., and Petrek, M. (2003) Expression of macrophage inflammatory protein-3 beta/CCL19 in pulmonary sarcoidosis. Am J Respir Crit Care Med 167, 1695-1703 [0541] 110. Facco, M., Baesso, I., Miorin, M., Bortoli, M., Cabrelle, A., Boscaro, E., Gurrieri, C., Trentin, L., Zambello, R., Calabrese, F., Cassatella, M. A., Semenzato, G., and Agostini, C. (2007) Expression and role of CCR6/CCL20 chemokine axis in pulmonary sarcoidosis. J Leukoc Biol 82, 946-955 [0542] 111. Agostini, C., Cassatella, M., Zambello, R., Trentin, L., Gasperini, S., Perin, A., Piazza, F., Siviero, M., Facco, M., Dziejman, M., Chilosi, M., Qin, S., Luster, A. D., and Semenzato, G. (1998) Involvement of the IP-10 chemokine in sarcoid granulomatous reactions. Journal of immunology 161, 6413-6420 [0543] 112. de Jong, M. D., Simmons, C. P., Thanh, T. T., Hien, V. M., Smith, G. J., Chau, T. N., Hoang, D. M., Chau, N. V., Khanh, T. H., Dong, V. C., Qui, P. T., Cam, B. V., Ha do, Q., Guan, Y., Peiris, J. S., Chinh, N. T., Hien, T. T., and Farrar, J. (2006) Fatal outcome of human influenza A (H5N1) is associated with high viral load and hypercytokinemia. Nat Med 12, 1203-1207 [0544] 113. Takano, T., Tajiri, H., Kashiwagi, Y., Kimura, S., and Kawashima, H. (2011) Cytokine and chemokine response in children with the 2009 pandemic influenza A (H1N1) virus infection. Eur J Clin Microbiol Infect Dis 30, 117-120 [0545] 114. Lee, N., Wong, C. K., Chan, P. K., Chan, M. C., Wong, R. Y., Lun, S. W., Ngai, K. L., Lui, G. C., Wong, B. C., Lee, S. K., Choi, K. W., and Hui, D. S. (2011) Cytokine response patterns in severe pandemic 2009 H1N1 and seasonal influenza among hospitalized adults. PLoS One 6, e26050 [0546] 115. Wang, Z., Zhang, A., Wan, Y., Liu, X., Qiu, C., Xi, X., Ren, Y., Wang, J., Dong, Y., Bao, M., Li, L., Zhou, M., Yuan, S., Sun, J., Zhu, Z., Chen, L., Li, Q., Zhang, Z., Zhang, X., Lu, S., Doherty, P. C., Kedzierska, K., and Xu, J. (2014) Early hypercytokinemia is associated with interferon-induced transmembrane protein-3 dysfunction and predictive of fatal H7N9 infection. Proceedings of the National Academy of Sciences of the United States of America 111, 769-774 [0547] 116. Gao, R., Bhatnagar, J., Blau, D. M., Greer, P., Rollin, D. C., Denison, A. M., Deleon-Carnes, M., Shieh, W. J., Sambhara, S., Tumpey, T. M., Patel, M., Liu, L., Paddock, C., Drew, C., Shu, Y., Katz, J. M., and Zaki, S. R. (2013) Cytokine and chemokine profiles in lung tissues from fatal cases of 2009 pandemic influenza A (H1N1): role of the host immune response in pathogenesis. Am J Pathol 183, 1258-1268 [0548] 117. Zeng, H., Belser, J. A., Goldsmith, C. S., Gustin, K. M., Veguilla, V., Katz, J. M., and Tumpey, T. M. (2015) A(H7N9) virus results in early induction of proinflammatory cytokine responses in both human lung epithelial and endothelial cells and shows increased human adaptation compared with avian H5N1 virus. J Virol 89, 4655-4667 [0549] 118. Marion, T., Elbahesh, H., Thomas, P. G., DeVincenzo, J. P., Webby, R., and Schughart, K. (2016) Respiratory Mucosal Proteome Quantification in Human Influenza Infections. PLoS One 11, e0153674 [0550] 119. Lee, N., Wong, C. K., Chan, P. K., Lun, S. W., Lui, G., Wong, B., Hui, D. S., Lam, C. W., Cockram, C. S., Choi, K. W., Yeung, A. C., Tang, J. W., and Sung, J. J. (2007) Hypercytokinemia and hyperactivation of phospho-p38 mitogen-activated protein kinase in severe human influenza A virus infection. Clin Infect Dis 45, 723-731 [0551] 120. Kim, Y. H., Kim, J. E., and Hyun, M. C. (2011) Cytokine response in pediatric patients with pandemic influenza H1N1 2009 virus infection and pneumonia: comparison with pediatric pneumonia without H1N1 2009 infection. Pediatr Pulmonol 46, 1233-1239 [0552] 121. Bian, J. R., Nie, W., Zang, Y. S., Fang, Z., Xiu, Q. Y., and Xu, X. X. (2014) Clinical aspects and cytokine response in adults with seasonal influenza infection. Int J Clin Exp Med 7, 5593-5602 [0553] 122. Hagau, N., Slavcovici, A., Gonganau, D. N., Oltean, S., Dirzu, D. S., Brezoszki, E. S., Maxim, M., Ciuce, C., Mlesnite, M., Gavrus, R. L., Laslo, C., Hagau, R., Petrescu, M., and Studnicska, D. M. (2010) Clinical aspects and cytokine response in severe H1N1 influenza A virus infection. Crit Care 14, R203 [0554] 123. Mazzucchelli, L., Hauser, C., Zgraggen, K., Wagner, H. E., Hess, M. W., Laissue, J. A., and Mueller, C. (1996) Differential in situ expression of the genes encoding the chemokines MCP-1 and RANTES in human inflammatory bowel disease. The Journal of pathology 178, 201-206 [0555] 124. Banks, C., Bateman, A., Payne, R., Johnson, P., and Sheron, N. (2003) Chemokine expression in IBD. Mucosal chemokine expression is unselectively increased in both ulcerative colitis and Crohn's disease. The Journal of pathology 199, 28-35 [0556] 125. Reinecker, H. C., Loh, E. Y., Ringler, D. J., Mehta, A., Rombeau, J. L., and MacDermott, R. P. (1995) Monocyte-chemoattractant protein 1 gene expression in intestinal epithelial cells and inflammatory bowel disease mucosa. Gastroenterology 108, 40-50 [0557] 126. Uguccioni, M., Gionchetti, P., Robbiani, D. F., Rizzello, F., Peruzzo, S., Campieri, M., and Baggiolini, M. (1999) Increased expression of IP-10, IL-8, MCP-1, and MCP-3 in ulcerative colitis. Am J Pathol 155, 331-336 [0558] 127. Ahrens, R., Waddell, A., Seidu, L., Blanchard, C., Carey, R., Forbes, E., Lampinen, M., Wilson, T., Cohen, E., Stringer, K., Ballard, E., Munitz, A., Xu, H., Lee, N., Lee, J. J., Rothenberg, M. E., Denson, L., and Hogan, S. P. (2008) Intestinal macrophage/epithelial cell-derived CCL11/eotaxin-1 mediates eosinophil recruitment and function in pediatric ulcerative colitis. Journal of immunology 181, 7390-7399 [0559] 128. Kotarsky, K., Sitnik, K. M., Stenstad, H., Kotarsky, H., Schmidtchen, A., Koslowski, M., Wehkamp, J., and Agace, W. W. (2010) A novel role for constitutively expressed epithelial-derived chemokines as antibacterial peptides in the intestinal mucosa. Mucosal immunology 3, 40-48 [0560] 129. Puleston, J., Cooper, M., Murch, S., Bid, K., Makh, S., Ashwood, P., Bingham, A. H., Green, H., Moss, P., Dhillon, A., Morris, R., Strobel, S., Gelinas, R., Pounder, R. E., and Platt, A. (2005) A distinct subset of chemokines dominates the mucosal chemokine response in inflammatory bowel disease. Alimentary pharmacology & therapeutics 21, 109-120 [0561] 130. Papadakis, K. A., Prehn, J., Moreno, S. T., Cheng, L., Kouroumalis, E. A., Deem, R., Breaverman, T., Ponath, P. D., Andrew, D. P., Green, P. H., Hodge, M. R., Binder, S. W., and Targan, S. R. (2001) CCR9-positive lymphocytes and thymus-expressed chemokine distinguish small bowel from colonic Crohn's disease. Gastroenterology 121, 246-254 [0562] 131. Sans, M., Danese, S., de la Motte, C., de Souza, H. S., Rivera-Reyes, B. M., West, G. A., Phillips, M., Katz, J. A., and Fiocchi, C. (2007) Enhanced recruitment of CX3CR1+ T cells by mucosal endothelial cell-derived fractalkine in inflammatory bowel disease. Gastroenterology 132, 139-153 [0563] 132. Izzo, R. S., Witkon, K., Chen, A. I., Hadjiyane, C., Weinstein, M. I., and Pellecchia, C. (1993) Neutrophil-activating peptide (interleukin-8) in colonic mucosa from patients with Crohn's disease. Scandinavian journal of gastroenterology 28, 296-300 [0564] 133. Mahida, Y. R., Ceska, M., Effenberger, F., Kurlak, L., Lindley, I., and Hawkey, C. J. (1992) Enhanced synthesis of neutrophil-activating peptide-1/interleukin-8 in active ulcerative colitis. Clinical science 82, 273-275 [0565] 134. Dotan, I., Werner, L., Vigodman, S., Weiss, S., Brazowski, E., Maharshak, N., Chen, O., Tulchinsky, H., Halpern, Z., and Guzner-Gur, H. (2010) CXCL12 is a constitutive and inflammatory chemokine in the intestinal immune system. Inflammatory bowel diseases 16, 583-592 [0566] 135. Rau, B., Baumgart, K., Kruger, C. M., Schilling, M., and Beger, H. G. (2003) CC-chemokine activation in acute pancreatitis: enhanced release of monocyte chemoattractant protein-1 in patients with local and systemic complications. Intensive Care Med 29, 622-629 [0567] 136. Saurer, L., Reber, P., Schaffner, T., Buchler, M. W., Buri, C., Kappeler, A., Walz, A., Friess, H., and Mueller, C. (2000) Differential expression of chemokines in normal pancreas and in chronic pancreatitis. Gastroenterology 118, 356-367 [0568] 137. Nomura, I., Gao, B., Boguniewicz, M., Darst, M. A., Travers, J. B., and Leung, D. Y. (2003) Distinct patterns of gene expression in the skin lesions of atopic dermatitis and psoriasis: a gene microarray analysis. The Journal of allergy and clinical immunology 112, 1195-1202 [0569] 138. Brunner, P. M., Glitzner, E., Reininger, B., Klein, I., Stary, G., Mildner, M., Uhrin, P., Sibilia, M., and Stingl, G. (2015) CCL7 contributes to the TNF-alpha-dependent inflammation of lesional psoriatic skin. Experimental dermatology 24, 522-528 [0570] 139. Hedrick, M. N., Lonsdorf, A. S., Hwang, S. T., and Farber, J. M. (2010) CCR6 as a possible therapeutic target in psoriasis. Expert Opin Ther Targets 14, 911-922 [0571] 140. Congjun, J., Yanmei, Z., Huiling, J., Zhen, Y., and Shuo, L. (2015) Elevated Local and Serum CX3CL1(Fractalkine) Expression and Its Association with Disease Severity in Patients with Psoriasis. Ann Clin Lab Sci 45, 556-561 [0572] 141. Ferrari, S. M., Ruffilli, I., Colaci, M., Antonelli, A., Ferri, C., and Fallahi, P. (2015) CXCL10 in psoriasis. Adv Med Sci 60, 349-354 [0573] 142. Owczarek, W., Paplinska, M., Targowski, T., Jahnz-Rozyk, K., Paluchowska, E., Kucharczyk, A., and Kasztalewicz, B. (2010) Analysis of eotaxin 1/CCL11, eotaxin 2/CCL24 and eotaxin 3/CCL26 expression in lesional and non-lesional skin of patients with atopic dermatitis. Cytokine 50, 181-185 [0574] 143. Hijnen, D., De Bruin-Weller, M., Oosting, B., Lebre, C., De Jong, E., Bruijnzeel-Koomen, C., and Knol, E. (2004) Serum thymus and activation-regulated chemokine (TARC) and cutaneous T cell-attracting chemokine (CTACK) levels in allergic diseases: TARC and CTACK are disease-specific markers for atopic dermatitis. The Journal of allergy and clinical immunology 113, 334-340 [0575] 144. Pivarcsi, A., Gombert, M., Dieu-Nosjean, M. C., Lauerma, A., Kubitza, R., Meller, S., Rieker, J., Muller, A., Da Cunha, L., Haahtela, A., Sonkoly, E., Fridman, W. H., Alenius, H., Kemeny, L., Ruzicka, T., Zlotnik, A., and Homey, B. (2004) CC chemokine ligand 18, an atopic dermatitis-associated and dendritic cell-derived chemokine, is regulated by staphylococcal products and allergen exposure. Journal of immunology 173, 5810-5817 [0576] 145. Park, C. O., Lee, H. J., Lee, J. H., Wu, W. H., Chang, N. S., Hua, L., Lee, M. G., and Lee, K. H. (2008) Increased expression of CC chemokine ligand 18 in extrinsic atopic dermatitis patients. Experimental dermatology 17, 24-29 [0577] 146. Kakinuma, T., Saeki, H., Tsunemi, Y., Fujita, H., Asano, N., Mitsui, H., Tada, Y., Wakugawa, M., Watanabe, T., Torii, H., Komine, M., Asahina, A., Nakamura, K., and Tamaki, K. (2003) Increased serum cutaneous T cell-attracting chemokine (CCL27) levels in patients with atopic dermatitis and psoriasis vulgaris. The Journal of allergy and clinical immunology 111, 592-597 [0578] 147. Echigo, T., Hasegawa, M., Shimada, Y., Takehara, K., and Sato, S. (2004) Expression of fractalkine and its receptor, CX3CR1, in atopic dermatitis: possible contribution to skin inflammation. The Journal of allergy and clinical immunology 113, 940-948 [0579] 148. Ueno, T., Toi, M., Saji, H., Muta, M., Bando, H., Kuroi, K., Koike, M., Inadera, H., and Matsushima, K. (2000) Significance of macrophage chemoattractant protein-1 in macrophage recruitment, angiogenesis, and survival in human breast cancer. Clin Cancer Res 6, 3282-3289 [0580] 149. Soria, G., Yaal-Hahoshen, N., Azenshtein, E., Shina, S., Leider-Trejo, L., Ryvo, L., Cohen-Hillel, E., Shtabsky, A., Ehrlich, M., Meshel, T., Keydar, I., and Ben-Baruch, A. (2008) Concomitant expression of the chemokines RANTES and MCP-1 in human breast cancer: a basis for tumor-promoting interactions. Cytokine 44, 191-200 [0581] 150. Chavey, C., Bibeau, F., Gourgou-Bourgade, S., Burlinchon, S., Boissiere, F., Laune, D., Roques, S., and Lazennec, G. (2007) Oestrogen receptor negative breast cancers exhibit high cytokine content. Breast Cancer Res 9, R15 [0582] 151. Luboshits, G., Shina, S., Kaplan, O., Engelberg, S., Nass, D., Lifshitz-Mercer, B., Chaitchik, S., Keydar, I., and Ben-Baruch, A. (1999) Elevated expression of the CC chemokine regulated on activation, normal T cell expressed and secreted (RANTES) in advanced breast carcinoma. Cancer Res 59, 4681-4687 [0583] 152. Chen, J., Yao, Y., Gong, C., Yu, F., Su, S., Chen, J., Liu, B., Deng, H., Wang, F., Lin, L., Yao, H., Su, F., Anderson, K. S., Liu, Q., Ewen, M. E., Yao, X., and Song, E. (2011) CCL18 from tumor-associated macrophages promotes breast cancer metastasis via PITPNM3. Cancer Cell 19, 541-555 [0584] 153. Bell, D., Chomarat, P., Broyles, D., Netto, G., Harb, G. M., Lebecque, S., Valladeau, J., Davoust, J., Palucka, K. A., and Banchereau, J. (1999) In breast carcinoma tissue, immature dendritic cells reside within the tumor, whereas mature dendritic cells are located in peritumoral areas. J Exp Med 190, 1417-1426 [0585] 154. Bieche, I., Chavey, C., Andrieu, C., Busson, M., Vacher, S., Le Corre, L., Guinebretiere, J. M., Burlinchon, S., Lidereau, R., and Lazennec, G. (2007) CXC chemokines located in the 4q21 region are up-regulated in breast cancer. Endocr Relat Cancer 14, 1039-1052 [0586] 155. Cho, Y. B., Lee, W. Y., Choi, S. J., Kim, J., Hong, H. K., Kim, S. H., Choi, Y. L., Kim, H. C., Yun, S. H., Chun, H. K., and Lee, K. U. (2012) CC chemokine ligand 7 expression in liver metastasis of colorectal cancer. Oncol Rep 28, 689-694 [0587] 156. Nomiyama, H., Hieshima, K., Nakayama, T., Sakaguchi, T., Fujisawa, R., Tanase, S., Nishiura, H., Matsuno, K., Takamori, H., Tabira, Y., Yamamoto, T., Miura, R., and Yoshie, O. (2001) Human CC chemokine liver-expressed chemokine/CCL16 is a functional ligand for CCR1, CCR2 and CCR5, and constitutively expressed by hepatocytes. International immunology 13, 1021-1029 [0588] 157. Rubie, C., Oliveira, V., Kempf, K., Wagner, M., Tilton, B., Rau, B., Kruse, B., Konig, J., and Schilling, M. (2006) Involvement of chemokine receptor CCR6 in colorectal cancer metastasis. Tumour Biol 27, 166-174 [0589] 158. Desurmont, T., Skrypek, N., Duhamel, A., Jonckheere, N., Millet, G., Leteurtre, E., Gosset, P., Duchene, B., Ramdane, N., Hebbar, M., Van Seuningen, I., Pruvot, F. R., Huet, G., and Truant, S. (2015) Overexpression of chemokine receptor CXCR2 and ligand CXCL7 in liver metastases from colon cancer is correlated to shorter disease-free and overall survival. Cancer Sci 106, 262-269 [0590] 159. Kim, J., Mori, T., Chen, S. L., Amersi, F. F., Martinez, S. R., Kuo, C., Turner, R. R., Ye, X., Bilchik, A. J., Morton, D. L., and Hoon, D. S. (2006) Chemokine receptor CXCR4 expression in patients with melanoma and colorectal cancer liver metastases and the association with disease outcome. Ann Surg 244, 113-120 [0591] 160. Webb, B., and Sali, A. (2014) Protein structure modeling with MODELLER. Methods Mol Biol 1137, 1-15 [0592] 161. Janson, G., Zhang, C., Prado, M. G., and Paiardini, A. (2017) PyMod 2.0: improvements in protein sequence-structure analysis and homology modeling within PyMOL. Bioinformatics 33, 444-446 [0593] 162. Krissinel, E., and Henrick, K. (2007) Inference of macromolecular assemblies from crystalline state. Journal of molecular biology 372, 774-797 [0594] 163. Alenazi, Y., Singh, K., Davies, G., Eaton, J. R. O., Elders, P., Kawamura, A., and Bhattacharya, S. (2018) Genetically engineered two-warhead evasins provide a method to achieve precision targeting of disease-relevant chemokine subsets. Sci Rep 8, 6333 [0595] 164. Bachelerie, F., Ben-Baruch, A., Burkhardt, A. M., Combadiere, C., Farber, J. M., Graham, G. J., Horuk, R., Sparre-Ulrich, A. H., Locati, M., Luster, A. D., Mantovani, A., Matsushima, K., Murphy, P. M., Nibbs, R., Nomiyama, H., Power, C. A., Proudfoot, A. E., Rosenkilde, M. M., Rot, A., Sozzani, S., Thelen, M., Yoshie, O., and Zlotnik, A. (2014) International Union of Basic and Clinical Pharmacology. LXXXIX. Update on the extended family of chemokine receptors and introducing a new nomenclature for atypical chemokine receptors. Pharmacol Rev 66, 1-79 [0596] 165. Concepcion, J., Witte, K., Wartchow, C., Choo, S., Yao, D., Persson, H., Wei, J., Li, P., Heidecker, B., Ma, W., Varma, R., Zhao, L. S., Perillat, D., Carricato, G., Recknor, M., Du, K., Ho, H., Ellis, T., Gamez, J., Howes, M., Phi-Wilson, J., Lockard, S., Zuk, R., and Tan, H. (2009) Label-free detection of biomolecular interactions using BioLayer interferometry for kinetic characterization. Comb Chem High Throughput Screen 12, 791-800 [0597] 166. Chao, G., Lau, W. L., Hackel, B. J., Sazinsky, S. L., Lippow, S. M., and Wittrup, K. D. (2006) Isolating and engineering human antibodies using yeast surface display. Nat Protoc 1, 755-768 [0598] 167. Webb, B., and Sali, A. (2014) Comparative Protein Structure Modeling Using MODELLER. Curr Protoc Bioinformatics 47, 561-5632 [0599] 168. Yang, J., and Zhang, Y. (2015) Protein Structure and Function Prediction Using I-TASSER. Curr Protoc Bioinformatics 52, 581-15 [0600] 169. Kelley, L. A., Mezulis, S., Yates, C. M., Wass, M. N., and Sternberg, M. J. (2015) The Phyre2 web portal for protein modeling, prediction and analysis. Nat Protoc 10, 845-858 [0601] 170. Bhatia, M., and Moochhala, S. (2004) Role of inflammatory mediators in the pathophysiology of acute respiratory distress syndrome. The Journal of pathology 202, 145-156 [0602] 171. Belperio, J. A., Keane, M. P., Burdick, M. D., Lynch, J. P., 3rd, Xue, Y. Y., Berlin, A., Ross, D. J., Kunkel, S. L., Charo, I. F., and Strieter, R. M. (2001) Critical role for the chemokine MCP-1/CCR2 in the pathogenesis of bronchiolitis obliterans syndrome. The Journal of clinical investigation 108, 547-556 [0603] 172. Belperio, J. A., Burdick, M. D., Keane, M. P., Xue, Y. Y., Lynch, J. P., Daugherty, B. L., Kunkel, S. L., and Strieter, R. M. (2000) The Role of the CC Chemokine, RANTES, in Acute Lung Allograft Rejection. The Journal of Immunology 165, 461-472 [0604] 173. Belperio, J. A., Keane, M. P., Burdick, M. D., Gomperts, B. N., Xue, Y. Y., Hong, K., Mestas, J., Zisman, D., Ardehali, A., Saggar, R., Lynch, J. P., Ross, D. J., and Strieter, R. M. (2005) CXCR2/CXCR2 Ligand Biology during Lung Transplant Ischemia-Reperfusion Injury. The Journal of Immunology 175, 6931-6939 [0605] 174. Ben-Abraham, R., Weinbroum, A. A., Dekel, B., and Paret, G. (2003) Chemokines and the inflammatory response following cardiopulmonary bypassa new target for therapeutic intervention?A review. Paediatr Anaesth 13, 655-661 [0606] 175. Tu, R., Peng, Y., Wang, Y., Tang, X., and Wang, S. (2018) The stromal cell-derived factor 1/C-X-C chemokine receptor type 4 axis is important in neutrophil migration caused by cardiopulmonary bypass in children. Interact Cardiovasc Thorac Surg 26, 431-437 [0607] 176. Morrison, M. I., Pither, T. L., and Fisher, A. J. (2017) Pathophysiology and classification of primary graft dysfunction after lung transplantation. J Thorac Dis 9, 4084-4097 [0608] 177. Sadaria, M. R., Smith, P. D., Fullerton, D. A., Justison, G. A., Lee, J. H., Puskas, F., Grover, F. L., Cleveland, J. C., Jr., Reece, T. B., and Weyant, M. J. (2011) Cytokine expression profile in human lungs undergoing normothermic ex-vivo lung perfusion. Ann Thorac Surg 92, 478-484 [0609] 178. Jansen, M. A., Otten, H. G., de Weger, R. A., and Huibers, M. M. (2015) Immunological and Fibrotic Mechanisms in Cardiac Allograft Vasculopathy. Transplantation 99, 2467-2475 [0610] 179. Shimizu, K., and Mitchell, R. N. (2008) The role of chemokines in transplant graft arterial disease. Arteriosclerosis, thrombosis, and vascular biology 28, 1937-1949 [0611] 180. Buch, M. H., Bingham, S. J., Bryer, D., and Emery, P. (2007) Long-term infliximab treatment in rheumatoid arthritis: subsequent outcome of initial responders. Rheumatology (Oxford) 46, 1153-1156 [0612] 181. McInnes, I. B., and Schett, G. (2011) The pathogenesis of rheumatoid arthritis. The New England journal of medicine 365, 2205-2219 [0613] 182. Feagan, B. G., Rutgeerts, P., Sands, B. E., Hanauer, S., Colombel, J. F., Sandborn, W. J., Van Assche, G., Axler, J., Kim, H. J., Danese, S., Fox, I., Milch, C., Sankoh, S., Wyant, T., Xu, J., Parikh, A., and Group, G. S. (2013) Vedolizumab as induction and maintenance therapy for ulcerative colitis. The New England journal of medicine 369, 699-710 [0614] 183. Boder, E. T., and Wittrup, K. D. (1997) Yeast surface display for screening combinatorial polypeptide libraries. Nat Biotechnol 15, 553-557 [0615] 184. Sleep, D., Cameron, J., and Evans, L. R. (2013) Albumin as a versatile platform for drug half-life extension. Biochim Biophys Acta 1830, 5526-5534 [0616] 185. Skalko-Basnet, N. (2014) Biologics: the role of delivery systems in improved therapy. Biologics 8, 107-114