ANTIBODY SPECIFIC FOR CD47 AND USES THEREOF
20240034790 ยท 2024-02-01
Assignee
Inventors
Cpc classification
A61K35/17
HUMAN NECESSITIES
C12N15/63
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
Abstract
The present invention relates to an antibody specific for CD47 and uses thereof, and more particularly, to an antibody that specifically binds to CD47, a chimeric antigen receptor comprising the antibody, and a pharmaceutical composition comprising the same for preventing or treating diseases mediated by CD47-expressing cells.
In the present invention, antibodies that more specifically binds to CD47 were screened to establish 7 new types of antibodies (7C7, 5H4, 5A4, 4E12, 3H3, 3A5, 1E7), and it was confirm that the novel antibodies can specifically binds with CD47 antigen.
In addition, since it was confirmed that the production of a chimeric antigen receptor (CAR) targeting CD47 is possible using the established antibody, the CD47-specific antibody of the present invention and the chimeric antigen receptor prepared using the same can be applied for use in preventing or treating a cancer or tumor expressing CD47.
Claims
1. An antibody specifically binding to CD47 or a fragment thereof, comprising: (1) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 1, a CDR2 region represented by an amino acid of SEQ ID NO: 2 and a CDR3 region represented by an amino acid of SEQ ID NO: 3, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 4, a CDR2 region represented by an amino acid of SEQ ID NO: 5 and a CDR3 region represented by an amino acid of SEQ ID NO: 6; (2) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 11, a CDR2 region represented by an amino acid of SEQ ID NO: 12 and a CDR3 region represented by an amino acid of SEQ ID NO: 13, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 14, a CDR2 region represented by an amino acid of SEQ ID NO: 15 and a CDR3 region represented by an amino acid of SEQ ID NO: 16; (3) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 21, a CDR2 region represented by an amino acid of SEQ ID NO: 22 and a CDR3 region represented by an amino acid of SEQ ID NO: 23, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 24, a CDR2 region represented by an amino acid of SEQ ID NO: 25 and a CDR3 region represented by an amino acid of SEQ ID NO: 26; (4) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 31, a CDR2 region represented by an amino acid of SEQ ID NO: 32 and a CDR3 region represented by an amino acid of SEQ ID NO: 33, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 34, a CDR2 region represented by an amino acid of SEQ ID NO: 35 and a CDR3 region represented by an amino acid of SEQ ID NO: 36; (5) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 41, a CDR2 region represented by an amino acid of SEQ ID NO: 42 and a CDR3 region represented by an amino acid of SEQ ID NO: 43, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 44, a CDR2 region represented by an amino acid of SEQ ID NO: 45 and a CDR3 region represented by an amino acid of SEQ ID NO: 46; (6) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 51, a CDR2 region represented by an amino acid of SEQ ID NO: 52 and a CDR3 region represented by an amino acid of SEQ ID NO: 53, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 54, a CDR2 region represented by an amino acid of SEQ ID NO: 55 and a CDR3 region represented by an amino acid of SEQ ID NO: 56; or (7) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 61, a CDR2 region represented by an amino acid of SEQ ID NO: 62 and a CDR3 region represented by an amino acid of SEQ ID NO: 63, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 64, a CDR2 region represented by an amino acid of SEQ ID NO: 65 and a CDR3 region represented by an amino acid of SEQ ID NO: 66.
2. The antibody specifically binding to CD47 or a fragment thereof of claim 1, wherein the (1) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 7 and a light chain variable region represented by an amino acid of SEQ ID NO: 8; the (2) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 17 and a light chain variable region represented by an amino acid of SEQ ID NO: 18; the (3) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 27 and a light chain variable region represented by an amino acid of SEQ ID NO: 28; the (4) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 37 and a light chain variable region represented by an amino acid of SEQ ID NO: 38; the (5) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 47 and a light chain variable region represented by an amino acid of SEQ ID NO: 48; the (6) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 57 and a light chain variable region represented by an amino acid of SEQ ID NO: 58; or the (7) antibody comprises a heavy chain variable region represented by an amino acid of SEQ ID NO: 67 and a light chain variable region represented by an amino acid of SEQ ID NO: 68.
3. A polynucleotide encoding the antibody specifically binding to CD47 or a fragment thereof of claim 1.
4. A vector comprising the polynucleotide encoding the antibody specifically binding to CD47 or a fragment thereof of claim 1.
5. A recombinant cell producing the antibody or fragment thereof specifically binding to CD47 or a fragment thereof transformed with the vector of claim 4.
6. A chimeric antigen receptor (CAR) comprising: a CD47-binding domain; a transmembrane domain; a costimulatory domain; and an intracellular signal transduction domain, wherein the CD47-binding domain is an antibody specifically binding to CD47 or a fragment thereof, comprising: (1) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 1, a CDR2 region represented by an amino acid of SEQ ID NO: 2 and a CDR3 region represented by an amino acid of SEQ ID NO: 3, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 4, a CDR2 region represented by an amino acid of SEQ ID NO: 5 and a CDR3 region represented by an amino acid of SEQ ID NO: 6; (2) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 11, a CDR2 region represented by an amino acid of SEQ ID NO: 12 and a CDR3 region represented by an amino acid of SEQ ID NO: 13, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 14, a CDR2 region represented by an amino acid of SEQ ID NO: 15 and a CDR3 region represented by an amino acid of SEQ ID NO: 16; (3) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 21, a CDR2 region represented by an amino acid of SEQ ID NO: 22 and a CDR3 region represented by an amino acid of SEQ ID NO: 23, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 24, a CDR2 region represented by an amino acid of SEQ ID NO: 25 and a CDR3 region represented by an amino acid of SEQ ID NO: 26; (4) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 31, a CDR2 region represented by an amino acid of SEQ ID NO: 32 and a CDR3 region represented by an amino acid of SEQ ID NO: 33, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 34, a CDR2 region represented by an amino acid of SEQ ID NO: 35 and a CDR3 region represented by an amino acid of SEQ ID NO: 36; (5) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 41, a CDR2 region represented by an amino acid of SEQ ID NO: 42 and a CDR3 region represented by an amino acid of SEQ ID NO: 43, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 44, a CDR2 region represented by an amino acid of SEQ ID NO: 45 and a CDR3 region represented by an amino acid of SEQ ID NO: 46; (6) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 51, a CDR2 region represented by an amino acid of SEQ ID NO: 52 and a CDR3 region represented by an amino acid of SEQ ID NO: 53, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 54, a CDR2 region represented by an amino acid of SEQ ID NO: 55 and a CDR3 region represented by an amino acid of SEQ ID NO: 56; or (7) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 61, a CDR2 region represented by an amino acid of SEQ ID NO: 62 and a CDR3 region represented by an amino acid of SEQ ID NO: 63, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 64, a CDR2 region represented by an amino acid of SEQ ID NO: 65 and a CDR3 region represented by an amino acid of SEQ ID NO: 66.
7. The chimeric antigen receptor of claim 6, wherein the transmembrane domain is a protein selected from the group consisting of CD8a, CD4, CD28, CD137, CD80, CD86, CD152 and PD1, the costimulatory domain is a protein selected from the group consisting of CD28, 4-1BB, OX-40 and ICOS, and the intracellular signal transduction domain is CD3.
8. The chimeric antigen receptor of claim 6, further comprising a hinge region between a C-terminus of the CD47-binding domain and an N-terminus of the transmembrane domain.
9. An immune effector call comprising a polynucleotide encoding the chimeric antigen receptor of claim 6 or a vector comprising the polynucleotide.
10. An immune effector cell comprising a polynucleotide encoding the chimeric antigen receptor of claim 7 or a vector comprising the polynucleotide.
11. An immune effector cell comprising a polynucleotide encoding the chimeric antigen receptor of claim 8 or a vector comprising the polynucleotide.
12. A pharmaceutical composition comprising the antibody specifically binding to CD47 or the fragment thereof of claim 1 and a pharmaceutically acceptable carrier.
13. A method for preventing or treating a cancer or tumor expressing CD47 comprising administering to a subject in need thereof the pharmaceutical composition according to claim 12.
14. The method according to claim 13, wherein the cancer or tumor is selected from the group consisting of blood cancer, ovarian cancer, colon cancer, breast cancer, lung cancer, myeloma, neuroblast-derived CNS cancer, monocytic leukemia, B-cell induced leukemia, T-cell leukemia, B-cell lymphoma, T-cell lymphoma, and mast cell-derived cancer.
15. A pharmaceutical composition comprising the immune effector cell of claim 9 and a pharmaceutically acceptable carrier.
16. A pharmaceutical composition comprising the immune effector cell of claim 10 and a pharmaceutically acceptable carrier.
17. A pharmaceutical composition comprising the immune effector cell of claim 11 and a pharmaceutically acceptable carrier.
18. A polynucleotide encoding the antibody specifically binding to CD47 or a fragment thereof of claim 2.
19. A vector comprising the polynucleotide encoding the antibody specifically binding to CD47 or a fragment thereof of claim 2.
Description
DESCRIPTION OF DRAWINGS
[0050]
[0051]
[0052]
[0053]
MODE OF THE INVENTION
[0054] Hereinafter, the present invention is described in detail.
Antibody that Specifically Binds to CD47
[0055] The present invention relates to an antibody specifically binding to CD47 or a fragment thereof, comprising:
[0056] (1) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 1, a CDR2 region represented by an amino acid of SEQ ID NO: 2 and a CDR3 region represented by an amino acid of SEQ ID NO: 3, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 4, a CDR2 region represented by an amino acid of SEQ ID NO: 5 and a CDR3 region represented by an amino acid of SEQ ID NO: 6;
[0057] (2) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 11, a CDR2 region represented by an amino acid of SEQ ID NO: 12 and a CDR3 region represented by an amino acid of SEQ ID NO: 13, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 14, a CDR2 region represented by an amino acid of SEQ ID NO: 15 and a CDR3 region represented by an amino acid of SEQ ID NO: 16;
[0058] (3) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 21, a CDR2 region represented by an amino acid of SEQ ID NO: 22 and a CDR3 region represented by an amino acid of SEQ ID NO: 23, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 24, a CDR2 region represented by an amino acid of SEQ ID NO: 25 and a CDR3 region represented by an amino acid of SEQ ID NO: 26;
[0059] (4) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 31, a CDR2 region represented by an amino acid of SEQ ID NO: 32 and a CDR3 region represented by an amino acid of SEQ ID NO: 33, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 34, a CDR2 region represented by an amino acid of SEQ ID NO: 35 and a CDR3 region represented by an amino acid of SEQ ID NO: 36;
[0060] (5) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 41, a CDR2 region represented by an amino acid of SEQ ID NO: 42 and a CDR3 region represented by an amino acid of SEQ ID NO: 43, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 44, a CDR2 region represented by an amino acid of SEQ ID NO: 45 and a CDR3 region represented by an amino acid of SEQ ID NO: 46;
[0061] (6) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 51, a CDR2 region represented by an amino acid of SEQ ID NO: 52 and a CDR3 region represented by an amino acid of SEQ ID NO: 53, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 54, a CDR2 region represented by an amino acid of SEQ ID NO: 55 and a CDR3 region represented by an amino acid of SEQ ID NO: 56; or
[0062] (7) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 61, a CDR2 region represented by an amino acid of SEQ ID NO: 62 and a CDR3 region represented by an amino acid of SEQ ID NO: 63, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 64, a CDR2 region represented by an amino acid of SEQ ID NO: 65 and a CDR3 region represented by an amino acid of SEQ ID NO: 66.
[0063] In the present invention, the antibody can prevent CD47 from interacting with signal-regulating-protein (SIRP) or promote macrophage-mediated phagocytosis on CD47-expressing cells.
[0064] In the present invention, the antibody may be a monoclonal antibody. In the present invention, the term monoclonal antibody may be an antibody produced by a single antibody-forming cell, with a uniform primary structure (amino acid sequence). It recognizes only one antigenic determinant and is generally produced by culturing a hybridoma cell in which cancer cells and an antibody-producing cell are fused.
[0065] The antibody of the present invention is prepared as a humanized antibody with increased similarity to a human antibody by making the remaining parts except for the CDR region, which is a key part for antigen binding, to an amino acid sequence corresponding to an antibody produced by humans. The most common method for humanizing antibody is a CDR-grafting method in which the CDR regions of an animal antibody are grafted into a human antibody, but is not limited thereto, and is known in the art.
[0066] As used herein, the term CDR (complementarity determining region), refers to a non-contiguous antigen binding site found within the variable region of both heavy and light chain polypeptides.
[0067] In the present invention, the term antibody can be used not only in a complete form having two full-length light chains and two full-length heavy chains, but also fragments of antibody molecule. A fragment of antibody molecule means a fragment having at least a peptide tag (epitope) binding function, and includes scFv, Fab, F(ab), F(ab).sub.2, a single domain, etc.
[0068] Among antibody fragments, Fab has a structure having variable regions of light and heavy chains, a constant region of light chain and the first constant region of heavy chain (CH1), and has one antigen-binding site. Fab differs from Fab in that it has a hinge region comprising one or more cysteine residues at the C terminus of the heavy chain CH1 domain. F(ab).sub.2 antibody is produced by forming a disulfide bond with a cysteine residue in the hinge region of Fab. Fv is a minimal antibody fragment having only a heavy chain variable region and a heavy chain variable region. Recombinant technology for generating an Fv fragment is described in International Patent Publications WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 and WO 88/09344. A double chain Fv (dsFv) has a disulfide bond, and a heavy chain variable region and a heavy chain variable region are connected, and a single chain Fv (scFv) is generally connected through a peptide linker, the variable region of the heavy chain and the variable region of the light chain are covalently bonded. Such an antibody fragment can be obtained using a proteolytic enzyme (for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab).sub.2 fragment can be obtained by digestion with pepsin). Preferably, it can be produced through genetic recombination technology.
[0069] The monoclonal antibody that specifically binds to CD47 of the present invention can be prepared by using all or part of the CD47 protein as an immunogen (or antigen). More specifically, as an immunogen, CD47, a fusion protein containing CD47 protein, or a carrier containing CD47 protein, if necessary, together with an adjuvant (e.g., Freund adjuvant), is injected once or more by subcutaneous, intramuscular, intravenous, intraperitoneal in mammals except for humans to achieve an immunization. The mammals other than humans are preferably mice, rats, hamsters, malmots, chickens, rabbits, cats, dogs, pigs, goats, sheep, donkeys, horses or cattle (including transgenic animals engineered to produce an antibody from other animals such as mice to produce human antibody), more preferably mouse, rat, hamster, malmot, chicken or rabbit. Antibody-producing cells can be obtained from the immune-sensitized mammal about 1 to 10 days after the final immunization by performing immunization 1 to 4 times every 1 to 21 days from the first immunization. The number of times and intervals for immunization can be appropriately changed depending on the characteristics of the immunogen to be used.
[0070] Preparation of a hybridoma secreting a monoclonal antibody can be carried out according to the method of Keira and Mirstein et al. (Nature, 1975, Vol. 256, p. 495-497) and a method similar thereto. Hybridomas can be produced by cell fusion of mammal-derived myeloma cells without autologous antibody-producing ability and antibody-producing cells contained in the group consisting of spleen, lymph node, bone marrow and tonsils, preferably spleen. The mammal may be a mouse, rat, malmot, hamster, chicken, rabbit or human, preferably a mouse, rat, chicken or human.
[0071] For cell fusion, for example, a fusion promoter including polyethylene glycol or Sendai virus or a method by electric pulse is used, for example, in a fusion medium containing a fusion promoter, antibody-producing cells and mammalian-derived cells capable of indefinite proliferation. Cells are suspended at a ratio of about 1:1 to 1:10, and in this state, cultured at about 30 to 40 C. for about 1 to 5 minutes. As the fusion medium, for example, MEM medium, RPMI1640 medium, and Iscove's Modified Dulbecco's Medium may be used, and it is preferable to exclude sera such as bovine serum.
[0072] In the method of screening the hybridoma clones producing the monoclonal antibody, first, the fusion cells obtained as described above are transferred to a selection medium such as HAT medium, and cultured at about 30 to 40 C. for about 3 days to 3 weeks to kill cells other than hybridomas. Then, after culturing the hybridoma on a microtiter plate, etc., the part with increased reactivity between the immunogen used for the immune response of animals other than humans described above and the culture supernatant was subjected to RIA (radioactive substance-marked immuno antibody) or ELISA (Enzyme-Linked Immunosorbent Assay). The clone producing the monoclonal antibody found above shows specific binding ability to the immunogen.
[0073] The monoclonal antibody of the present invention can be obtained by culturing such a hybridoma in vitro or in vivo. For culturing, a conventional method for culturing cells derived from mammals is used, and for collecting monoclonal antibody from a culture or the like, a conventional method in this field for purifying an antibody in general is used. As each method, for example, salting out, dialysis, filtration, concentration, centrifugation, fractional precipitation, gel filtration chromatography, ion exchange chromatography, affinity chromatography, high-performance liquid chromatography, gel electrophoresis or isoelectric point electrophoresis, etc. can be applied, and these are applied in combination as needed. The purified monoclonal antibody is then concentrated and dried to be in a liquid or solid state depending on the use.
[0074] In a specific embodiment of the present invention, in order to prepare the antibody that specifically binds to CD47, hybridomas that produce CD47 protein are prepared and screened, and 7 kinds of antibodies (scFvs) that specifically bind to CD47 were selected and designated as 7C7, 5H4, 5A4, 4E12, 3H3, 3A5 and 1E7, respectively.
[0075] (1) It was confirmed that 7C7 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 1 (GYTFTSYV), a CDR2 region represented by an amino acid of SEQ ID NO: 2 (INPYNDGT) and a CDR3 region represented by an amino acid of SEQ ID NO: 3 (ARGRNRYDSWFAY), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 4 (QDISNY), a CDR2 region represented by an amino acid of SEQ ID NO: 5 (YTS) and a CDR3 region represented by an amino acid of SEQ ID NO: 6 (QQGNTLPWT).
[0076] Specifically, 7C7 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 7 and a light chain variable region represented by the amino acid of SEQ ID NO: 8, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 9 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 10.
[0077] (2) It was confirmed that 5H4 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 11 (GYTFTNYW), a CDR2 region represented by an amino acid of SEQ ID NO: 12 (IDPSNSAT) and a CDR3 region represented by an amino acid of SEQ ID NO: 13 (ARGGFAFDS), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 14 (QSLVHSNGNTY), a CDR2 region represented by an amino acid of SEQ ID NO: 15 (KVS) and a CDR3 region represented by an amino acid of SEQ ID NO: 16 (SQSTHVPWT).
[0078] Specifically, 5H4 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 17 and a light chain variable region represented by the amino acid of SEQ ID NO: 18, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 19 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 20.
[0079] (3) It was confirmed that 5A4 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 21 (GYTFTNYW), a CDR2 region represented by an amino acid of SEQ ID NO: 22 (IDPSDSYT) and a CDR3 region represented by an amino acid of SEQ ID NO: 23 (TRGGKRAMDY), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 24 (QSLVHSNGNTY), a CDR2 region represented by an amino acid of SEQ ID NO: 25 (KVS) and a CDR3 region represented by an amino acid of SEQ ID NO: 26 (SQSTHVPFT).
[0080] Specifically, 5A4 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 27 and a light chain variable region represented by the amino acid of SEQ ID NO: 28, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 29 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 30.
[0081] (4) It was confirmed that 4E12 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 31 (GYTFTNYG), a CDR2 region represented by an amino acid of SEQ ID NO: 32 (INTYTGEP) and a CDR3 region represented by an amino acid of SEQ ID NO: 33 (ARGGGRGAMDY), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 34 (QSIVHSNGNTY), a CDR2 region represented by an amino acid of SEQ ID NO: 35 (KVS) and a CDR3 region represented by an amino acid of SEQ ID NO: 36 (FQGSHVPFT).
[0082] Specifically, 4E12 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 37 and a light chain variable region represented by the amino acid of SEQ ID NO: 38, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 39 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 40.
[0083] (5) It was confirmed that 3H3 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 41 (GYTFTNYW), a CDR2 region represented by an amino acid of SEQ ID NO: 42 (IDPSNSET) and a CDR3 region represented by an amino acid of SEQ ID NO: 43 (ARGGFAFDS), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 44 (QSLVHNNGNTY), a CDR2 region represented by an amino acid of SEQ ID NO: 45 (KVS) and a CDR3 region represented by an amino acid of SEQ ID NO: 46 (SQSTHVPWT).
[0084] Specifically, 3H3 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 47 and a light chain variable region represented by the amino acid of SEQ ID NO: 48, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 49 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 50.
[0085] (6) It was confirmed that 3A5 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 51 (GYTFTSYW), a CDR2 region represented by an amino acid of SEQ ID NO: 52 (IDPSDSYT) and a CDR3 region represented by an amino acid of SEQ ID NO: 53 (ARGGKRAMDY), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 54 (QSLVHSNGNTY), a CDR2 region represented by an amino acid of SEQ ID NO: 55 (KVS) and a CDR3 region represented by an amino acid of SEQ ID NO: 56 (SQSTHVPFT).
[0086] Specifically, 3A5 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 57 and a light chain variable region represented by the amino acid of SEQ ID NO: 58, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 59 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 60.
[0087] (7) It was confirmed that 1E7 antibody had a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 61 (GYIFTSYV), a CDR2 region represented by an amino acid of SEQ ID NO: 62 (INPYNDGT) and a CDR3 region represented by an amino acid of SEQ ID NO: 63 (ARGGFTTDY), and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 64 (QSLVHSNGNTY), a CDR2 region represented by an amino acid of SEQ ID NO: 65 (KVS) and a CDR3 region represented by an amino acid of SEQ ID NO: 66 (SQSTHVPYT).
[0088] Specifically, 1E7 antibody contained a heavy chain variable region represented by the amino acid of SEQ ID NO: 67 and a light chain variable region represented by the amino acid of SEQ ID NO: 68, wherein the heavy chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 69 and a light chain variable region was encoded with the nucleotide sequence of SEQ ID NO: 70.
[0089] The antibody specific for CD47 of the present invention is preferably scFv (single chain variable fragment), and can be produced through genetic recombination technology so that the heavy chain variable region and a light chain variable region can be linked with a linker. The linker may preferably be represented by the amino acid sequence of SEQ ID NO: 71 or the nucleotide sequence of SEQ ID NO: 72, but is not limited thereto.
[0090] When linked by a light chain variable region-linker-a heavy chain variable region, 7C7 antibody has the amino acid sequence of SEQ ID NO: 73 or the nucleotide sequence of SEQ ID NO: 74, and 5H4 antibody has the amino acid sequence of SEQ ID NO: 75 or the nucleotide sequence of SEQ ID NO: 76, 5A4 antibody has the amino acid sequence of SEQ ID NO: 77 or the nucleotide sequence of SEQ ID NO: 78, and 4E12 antibody has the amino acid sequence of SEQ ID NO: 79 or the nucleotide sequence of SEQ ID NO: 80, 3H3 antibody has the amino acid sequence of SEQ ID NO: 81 or the nucleotide sequence of SEQ ID NO: 82, 3A5 antibody has the amino acid sequence of SEQ ID NO: 83 or the nucleotide sequence of SEQ ID NO: 84, and 1E7 antibody has the amino acid sequence of SEQ ID NO: 85 or the nucleotide sequence of SEQ ID NO: 86.
[0091] In another aspect, the present invention relates to a polynucleotide encoding the antibody that specifically binds to CD47.
[0092] As used herein, the term polynucleotide generally refers to a nucleic acid molecule, deoxyribonucleotide or ribonucleotide, or an analog thereof, separated by any length. In some embodiments, a polynucleotide of the present invention can be prepared by (1) in-vitro amplification, such as polymerase chain reaction (PCR) amplification; (2) cloning and recombination; (3) purification such as digestion and gel electrophoretic separation; (4) synthesis such as chemical synthesis, and preferably, the isolated polynucleotide is prepared by recombinant DNA technology. In the present invention, the nucleic acid for encoding the antibody or antigen-binding fragment thereof can be prepared by various methods known in the art, including, but not limited to, restriction fragment operation of synthetic oligonucleotides or application of SOE PCR.
[0093] In another aspect, the present invention relates to a vector comprising the polynucleotide encoding the antibody that specifically binds to CD47, and a recombinant cell transformed with the vector.
[0094] In the present invention, the term vector (expression vector) refers to a gene preparation including essential regulatory elements such as a promoter so that a target gene can be expressed in an appropriate host cell. A vector may be selected from one or more of a plasmid, a retroviral vector, and a lentiviral vector. Upon transformation into an appropriate host, a vector can replicate and function independently of the host genome, or in some cases can be integrated into the genome itself.
[0095] In addition, a vector may contain expression control elements that allow the coding region to be accurately expressed in a suitable host. Such regulatory elements are well known to those skilled in the art and include, for example, promoters, ribosome-binding sites, enhancers and other regulatory elements for regulating gene transcription or mRNA translation. The specific structure of the expression control sequence may vary depending on the function of the species or cell type, but generally contains 5 non-translated sequence, and a 5 or 3 non-translated sequence participating in transcription initiation and translation initiation, respectively, such as TATA box, capped sequence, CAAT sequence, etc. For example, a 5 non-transcriptional expression control sequence can include a promoter region that can include a promoter sequence for transcription and control of a functionally linked nucleic acid.
[0096] As used herein, the term promoter means a minimal sequence sufficient to direct transcription. In addition, promoter constructs sufficient to allow expression of a regulatable promoter-dependent gene induced by cell type-specific or external signals or agents may be included, and these constructs may be located in the 5 or 3 portion of the gene. Both conservative and inducible promoters are included. Promoter sequences may be derived from prokaryotes, eukaryotes or viruses.
[0097] In the present invention, the term transformant refers to a cell transformed by introducing a vector having a polynucleotide encoding one or more target proteins into a host cell, and a method for introducing the expression a vector into the host cell to form a transformant are such as a calcium phosphate method or a calcium chloride/rubidium chloride method, an electroporation method, an electroinjection method, a chemical treatment method such as PEG, a method using a gene gun, and the like (Sambrook, J., et al., Molecular Cloning, A Laboratory Manual(2.sup.nd ed.), Cold Spring Harbor Laboratory, 1. 74, 1989).
[0098] When the transformant expressing the vector is cultured in a nutrient medium, an antibody protein can be produced and isolated in large quantities. Medium and culture conditions can be appropriately selected and used depending on the host cell. During culture, conditions such as temperature, medium pH, and culture time should be appropriately adjusted to be suitable for cell growth and mass production of proteins.
[0099] The vector according to the present invention can be transformed into a host cell, preferably a mammalian cell, for the production of the antibody. Suitable host cells capable of expressing fully glycosylated proteins include COS-1 (e.g., ATCC CRL 1650), COS-7 (e.g., ATCC CRL-1651), HEK293, BHK21 (e.g., ATCC CRL-10), CHO (e.g., ATCC CRL 1610) and BSC-1 (e.g., ATCC CRL-26) cell lines, Cos-7 cells, CHO cells, hep G2 cells, P3X63Ag8.653, SP2/0-Agl4, 293 cells, HeLa cells, etc., and these cells are readily available from, for example, ATCC (American Type Culture Collection, USA).
Chimeric Antigen Receptor Targeting CD47
[0100] The present invention also relates to a chimeric antigen receptor (CAR) comprising: a CD47-binding domain; a transmembrane domain; a costimulatory domain; and an intracellular signal transduction domain, [0101] wherein the CD47-binding domain is an antibody specifically binding to CD47 or a fragment thereof, comprising:
[0102] (1) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 1, a CDR2 region represented by an amino acid of SEQ ID NO: 2 and a CDR3 region represented by an amino acid of SEQ ID NO: 3, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 4, a CDR2 region represented by an amino acid of SEQ ID NO: 5 and a CDR3 region represented by an amino acid of SEQ ID NO: 6;
[0103] (2) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 11, a CDR2 region represented by an amino acid of SEQ ID NO: 12 and a CDR3 region represented by an amino acid of SEQ ID NO: 13, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 14, a CDR2 region represented by an amino acid of SEQ ID NO: 15 and a CDR3 region represented by an amino acid of SEQ ID NO: 16;
[0104] (3) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 21, a CDR2 region represented by an amino acid of SEQ ID NO: 22 and a CDR3 region represented by an amino acid of SEQ ID NO: 23, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 24, a CDR2 region represented by an amino acid of SEQ ID NO: 25 and a CDR3 region represented by an amino acid of SEQ ID NO: 26;
[0105] (4) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 31, a CDR2 region represented by an amino acid of SEQ ID NO: 32 and a CDR3 region represented by an amino acid of SEQ ID NO: 33, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 34, a CDR2 region represented by an amino acid of SEQ ID NO: 35 and a CDR3 region represented by an amino acid of SEQ ID NO: 36;
[0106] (5) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 41, a CDR2 region represented by an amino acid of SEQ ID NO: 42 and a CDR3 region represented by an amino acid of SEQ ID NO: 43, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 44, a CDR2 region represented by an amino acid of SEQ ID NO: 45 and a CDR3 region represented by an amino acid of SEQ ID NO: 46;
[0107] (6) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 51, a CDR2 region represented by an amino acid of SEQ ID NO: 52 and a CDR3 region represented by an amino acid of SEQ ID NO: 53, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 54, a CDR2 region represented by an amino acid of SEQ ID NO: 55 and a CDR3 region represented by an amino acid of SEQ ID NO: 56; or
[0108] (7) a heavy chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 61, a CDR2 region represented by an amino acid of SEQ ID NO: 62 and a CDR3 region represented by an amino acid of SEQ ID NO: 63, and a light chain variable region including a CDR1 region represented by an amino acid of SEQ ID NO: 64, a CDR2 region represented by an amino acid of SEQ ID NO: 65 and a CDR3 region represented by an amino acid of SEQ ID NO: 66.
[0109] As used herein, the term chimeric antigen receptor (CAR) generally refers to a fusion protein containing an extracellular domain having the ability to bind an antigen and one or more intracellular domains. A CAR is a core part of a chimeric antigen receptor T cell (CAR-T) and may contain an antigen binding domain, a transmembrane domain, a co-stimulatory domain, and an intracellular signal transduction domain. A CAR can be combined with a T cell receptor-activating intracellular domain based on the antigen (e.g., CD47) specificity of the antibody. Genetically modified CAR-expressing T cells can specifically identify and eliminate target antigen-expressing malignant cells.
[0110] In the present invention, the term CD47-binding domain generally refers to a domain capable of specifically binding to a CD47 protein. For example, the CD47-binding domain may contain an anti-CD47 antibody or a fragment thereof capable of specifically binding to a human CD47 polypeptide or a fragment thereof expressed in B cells.
[0111] In the present invention, the term binding domain can be used interchangeably refers to extracellular domain, extracellular binding domain, antigen-specific binding domain and extracellular antigen-specific binding domain and refers to a CAR domain or fragment that has the ability to specifically bind to a target antigen (e.g., CD47).
[0112] In the present invention, anti-CD47 antibody or a fragment thereof is the aforementioned anti-CD47 antibody, a monoclonal antibody, preferably a single chain variable fragment (scFv). Specifically, it can be prepared using 7C7, 5H4, 5A4, 4E12, 3H3, 3A5 and 1E7 antibody specific for CD47 of the present invention.
[0113] In the present invention, a signal peptide may be further included at the N-terminus of the CD47-binding domain, and the signal peptide generally refers to a peptide chain for guiding protein transduction. The signal peptide may be a short peptide having a length of 5 to 30 amino acids, preferably represented by the amino acid sequence of SEQ ID NO: 94.
[0114] In the present invention, it may further include a hinge region located between the C terminus of the CD47-binding domain and the N terminus of a transmembrane domain, wherein the hinge region is derived from CD8, and preferably, it can be represented by the amino acid sequence of SEQ ID NO: 95. The hinge region generally refers to the linking region between an antigen-binding region and an immune cell Fc receptor (FcR)-binding region.
[0115] In the present invention, a transmembrane domain refers to a domain of a CAR that generally passes through a cell membrane and is connected to an intracellular signal transduction domain to play a role in signal transduction. The transmembrane domain may be derived from a protein selected from the group consisting of CD8, CD4, CD28, CD137, CD80, CD86, CD152 and PD1, and preferably may be represented by the amino acid sequence of SEQ ID NO: 96.
[0116] In the present invention, costimulatory domain generally refers to an intracellular domain capable of providing immune-stimulatory molecules, which are cell surface molecules necessary for an effective response of lymphocytes to antigens. The costimulatory domain described above may comprise a costimulatory domain of CD28, and may comprise a costimulatory domain of the TNF receptor family, such as the costimulatory domain of OX40 and 4-1BB, preferably it may be 4-1BB represented by the amino acid sequence of SEQ ID NO: 97.
[0117] In the present invention, intracellular signal transduction domain generally refers to a domain located inside a cell and capable of transmitting a signal. In the present invention, the intracellular signal transduction domain is an intracellular signal transduction domain of the chimeric antigen receptor. For example, the intracellular signal transduction domain may be selected from CD3 intracellular domain, CD28 intracellular domain, CD28 intracellular domain, 4-1BB intracellular domain and OX40 intracellular domain, and preferably it may be CD3 represented by the amino acid sequence of SEQ ID NO: 98.
[0118] The chimeric antigen receptor targeting CD47 of the present invention (CD47-CAR) can be preferably prepared as shown in the schematic diagram shown in
Polynucleotide Coding Chimeric Antigen Receptor and Vector Expressing Chimeric Antigen Receptor
[0119] In another aspect, the present invention relates to a polynucleotide encoding the chimeric antigen receptor (CAR).
[0120] In the present invention, the polynucleotide encoding a chimeric antigen receptor
[0121] (CAR) is a polynucleotide encoding a CD47-binding domain; a polynucleotide encoding a transmembrane domain; a polynucleotide encoding a costimulatory domain; and a polynucleotide encoding an intracellular signal transduction domain.
[0122] A polynucleotide encoding the CD47-binding domain may be a polynucleotide encoding the antibody specific for CD47 of the present invention, 7C7, 5H4, 5A4, 4E12, 3H3, 3A5 and/or 1E7, and a light chain variable region and a heavy chain variable region may be in the form of scFv linked by a linker, and the specific nucleotide sequence may be the same as described above.
[0123] Preferably, a polynucleotide encoding a chimeric antigen receptor (CAR) of the present invention may has: [0124] a signal peptide represented by the nucleotide sequence of SEQ ID NO: 88; [0125] 7C7 antibody represented by the nucleotide sequence of SEQ ID NO: 74, 5H4 antibody represented by the nucleotide sequence of SEQ ID NO: 76, 5A4 antibody represented by the nucleotide sequence of SEQ ID NO: 78, 4E12 antibody represented by the nucleotide sequence of SEQ ID NO: SEQ ID NO: 80, 3H3 antibody represented by the nucleotide sequence of SEQ ID NO: 82, 3A5 antibody represented by the nucleotide sequence of SEQ ID NO: 84, or 1E7 antibody represented by the nucleotide sequence of SEQ ID NO: 86; [0126] a transmembrane domain represented by the nucleotide sequence of 90; [0127] 4-1BB (a costimulatory domain) represented by the nucleotide sequence of SEQ ID
[0128] NO: 91; and [0129] an intracellular signal transduction domain (CD3) represented by the nucleotide sequence of SEQ ID NO: 92.
[0130] In addition, a polynucleotide encoding a hinge region may be additionally included between a polynucleotide encoding the CD47-binding domain and a transmembrane domain, and preferably It may be a CD8 hinge region represented by the nucleotide sequence of SEQ ID NO: 89.
[0131] In another aspect, the present invention relates to a vector comprising a polynucleotide encoding the chimeric antigen receptor (CAR).
[0132] In a specific embodiment of the present invention, the vector is a recombinant virus a vector, preferably a lentivirus vector, and comprises an operably linked EF1a promoter; a polynucleotide encoding a signal peptide; a polynucleotide encoding a CD47-binding domain; a polynucleotide encoding a transmembrane domain; and a polynucleotide encoding an intracellular signal transduction domain, and may further include a woodchuck hepatitis virus post-transcriptional regulatory element (WPRE) to increase protein expression (refer to
[0133] The EF1 promoter may be represented by the nucleotide sequence of SEQ ID NO: 87, and if necessary, has 90% or more, 93% or more, 95% or more, 96% or more, 97% or more, 98% or more, or 99% or more identical sequences of the nucleotide sequence of SEQ ID NO: 87.
[0134] In addition, the promoter is operably linked to induce expression of an anti-CD47 antibody (scFv), which is a CD47-binding domain.
[0135] In a specific embodiment of the present invention, as shown in
[0136] Biological methods for introducing polynucleotides into host cells include the use of DNA and RNA vectors. Viral vectors, and in particular retroviral vectors, have become the most widely used methods for inserting genes into mammalian, e.g., human cells. Other virus vector may be derived from lentiviruses, poxviruses, herpes simplex viruses, adenoviruses and adeno-associated viruses, and the like.
[0137] Chemical means for introducing polynucleotides into host cells include colloidal dispersion systems such as macromolecular complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
[0138] When a non-viral delivery system is used, an exemplary delivery vehicle is a liposome. The use of lipid preparations is contemplated for the introduction of nucleic acids into host cells (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. Nucleic acids associated with lipids may be encapsulated within the aqueous interior of the liposome, interspersed within the lipid bilayer of the liposome, attached to the liposome via a linking molecule associated with both the liposome and oligonucleotide, captured within the liposome, complexed with the liposome, dispersed in a lipid-containing solution, mixed with a lipid or combined with a lipid, contained as a suspension in a lipid, contained or complexed with micelles, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression a vector association composition is not limited to any particular structure in solution.
Immune Effector Cell Expressing Chimeric Antigen Receptor (CAR)
[0139] In another aspect, the present invention relates to an immune effector cell expressing the chimeric antigen receptor (CAR), and includes a vector comprising a polynucleotide encoding a chimeric antigen receptor (CAR), or a polynucleotide encoding a chimeric antigen receptor (CAR).
[0140] In the present invention, the immune effector cell may be a mammalian-derived cell, preferably a T cell or a natural killer (NK) cell.
[0141] In the present invention, an immune effector cell expressing the chimeric antigen receptor (CAR) can be prepared by introducing the CAR vector of the present invention into an immune effector cell, for example, a T cell or NK cell.
[0142] Specifically, CAR vector can be introduced into cells by methods known in the art, such as electroporation, lipofectamine (lipofectamine 2000, Invitrogen), and the like. For example, an immune effector cell can be transformed by a lentiviral vector to integrate the viral genome carrying the CAR molecule into the host genome to ensure long-term and stable expression of the target gene. For another example, a transposon can be used to introduce a CAR transport plasmid and a transferase transport plasmid into a target cell. For another example, a CAR molecule can be added to the genome by a gene editing method (e.g., CRISPRCas9).
[0143] An immune effector cell for the production of immune effector cell expressing a chimeric antigen receptor (CAR) can be obtained from a subject, wherein the subject includes a living organism (e.g., a mammal from which an immune response can be elicited). Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. T cells can be obtained from numerous sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, umbilical cord blood, thymus tissue, tissue from the site of infection, ascites, pleural effusion, splenic tissue, and tumors.
[0144] Such T cells can be obtained from blood units collected from a subject using any of a number of techniques known to those of ordinary skill in the art, for example, Ficoll isolation. Cells from blood are obtained by apheresis, and apheresis products typically contain T cells, monocytes, granulocytes, lymphocytes including B cells, other nucleated leukocytes, red blood cells, and platelets.
[0145] Cells collected by apheresis can be washed to remove the plasma fraction and place the cells in an appropriate buffer or medium for subsequent processing steps. T cells are isolated from peripheral blood lymphocytes by lysing red blood cells and depleting monocytes, for example by centrifugation through a PERCOLL gradient or by countercurrent centrifugation.
Composition for Preventing or Treating Diseases Mediated by CD47 Expression
[0146] In another aspect, the present invention includes a pharmaceutical composition for use in preventing or treating a cancer or tumor expressing CD47, comprising: the antibody specifically binding to CD47 or the fragment thereof; or the immune effector cell expressing a chimeric antigen receptor targeting CD47.
[0147] In the present invention, the cancer or tumor expressing CD47 is hematological cancer, ovarian cancer, colon cancer, breast cancer, lung cancer, myeloma, neuroblast-derived CNS tumor, monocytic leukemia, B-cell leukemia, T-cell leukemia leukemia, B-cell lymphoma, T-cell lymphoma, and mast cell tumor.
[0148] In the present invention, the composition may include a therapeutic agent for a disease mediated by cells expressing CD47, wherein the therapeutic agent may be covalently bound to the heavy and/or light chain of antibody that specifically binds to CD47, it can be administered in combination with antibody or CD47-CAR-T cell specific for CD47 of the present invention
[0149] The therapeutic agent includes a small molecule drug, a peptide drug, a toxin (e.g., a cytotoxin), and the like.
[0150] In addition, the therapeutic agent may be an anticancer agent. Anticancer agents reduce the proliferation of cancer cells and include non-peptidyl (i.e., non-protein) compounds, including cytotoxic agents and cytostatic agents. Non-limiting examples of anticancer agents include alkylating agents, nitrosourea, antimetabolites, antitumor antibiotics, plant (vinca) alkaloids, and steroid hormones. Peptide compounds may also be used.
[0151] In the pharmaceutical composition, the antibody that specifically binds to CD47 or an immune effector cell expressing a chimeric antigen receptor targeting CD47 may be the only active ingredient in the composition for treatment or diagnosis, or, can be used with other active ingredients for example, an anti-T cell, other antibody components such as anti-IFN or anti-LPS antibody, or non-antibody components such as xanthine.
[0152] The pharmaceutical composition preferably contains a therapeutically effective amount of antibody of the present invention. As used herein, the term therapeutically effective amount refers to an amount of a therapeutic agent required to treat, ameliorate, or prevent a target disease or condition, or the amount of a therapeutic agent required to exhibit a detectable therapeutic or prophylactic effect. For any antibody, a therapeutically effective dose can be initially determined by cell culture assays or animal models, usually rodents, rabbits, dogs, pigs, or primates. Animal models can also be used to determine appropriate concentration ranges and routes of administration. Such information can be used to determine useful dosages and routes for dosing in humans.
[0153] The precise effective amount for a human patient can vary depending on the severity of the disease state, the patient's general health, the patient's age, weight and sex, diet, administration time, administration frequency, drug composition, response sensitivity, and tolerance/response to treatment. The amount can be determined by routine experimentation and is within the scope of the clinician's judgment. In general, an effective dosage is 0.01-50 mg/kg, preferably 0.1-20 mg/kg, more preferably about 15 mg/kg.
[0154] The compositions may be administered to the patient individually or in combination with other preparations, agents, or hormones.
[0155] The dosage at which the antibody of the present invention is administered depends on the nature of the condition to be treated, the grade of malignant lymphoma or leukemia, and whether the antibody is used to prevent disease or to treat an existing condition.
[0156] The frequency of administration depends on the half-life of the antibody molecule and the duration of the drug's effect. If an antibody molecule has a short half-life (e.g., 2 to 10 hours), it may be necessary to provide one or more doses per day. Alternatively, if an antibody molecule has a long half-life (e.g., 2 to 15 days), it may be necessary to provide a dose once a day, once a week, or once every 1 or 2 months.
[0157] In addition, the pharmaceutical composition may contain a pharmaceutically acceptable carrier for administration of an antibody. The carrier itself must not cause the production of an antibody that is harmful to the subject receiving the composition, and must be non-toxic. Suitable carriers may be slowly metabolized macromolecules, such as proteins, polypeptides, liposomes, polysaccharides, polylactic acid, polyglycolic acid, amino acid polymers, amino acid copolymers and inactive viral particles.
[0158] A pharmaceutically acceptable salt may be used, and it contains for example, mineral acid salts such as hydrochloride, hydrobromide, phosphate and sulfate, or salts of organic acids such as acetic acid, propionic acid, malonic acid and benzoic acid.
[0159] A pharmaceutically acceptable carrier in therapeutic compositions may additionally include liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances such as wetting agents, emulsifying agents or pH buffering agents may be present in such compositions. The carrier may be formulated as tablets, pills, sugar-coated tablets, capsules, liquids, gels, syrups, slurries and suspensions for ingestion of the pharmaceutical composition by a patient.
[0160] Preferred forms for administration may include those suitable for parenteral administration, for example by injection or infusion. When the product is intended for infusion or injection, it may take the form of suspensions, solutions or emulsions in oil or water-soluble excipients, which may contain prescription agents such as suspending, preservative, stabilizing and/or dispersing agents. Alternatively, an antibody molecule may be in anhydrous form and reconstituted with an appropriate sterile solution prior to use.
[0161] Once formulated, the compositions of the present invention can be administered directly to a patient. The patients to be treated may be animals. However, the composition is preferably adapted for administration to human patients.
[0162] The pharmaceutical composition of the present invention is not limited, but oral, intravenous, intramuscular, intraarterial, intramedullary, intrathecal, intraventricular, transdermal, transcutaneous, subcutaneous, intraperitoneal, intranasal, intestinal, topical, sublingual, intravaginal or rectal routes. Typically, the therapeutic composition may be prepared as injectable forms as liquid solutions or suspensions. In addition, solid forms suitable for solution or suspension in liquid excipients prior to injection may be prepared.
[0163] Direct delivery of the composition may generally be achieved by injection, subcutaneous injection, intraperitoneal injection, intravenous injection, intramuscular injection, or may be delivered to the interstitial space of a tissue. In addition, the composition may be administered to the wound site. Dosage treatment may be a single dose schedule or a multiple dose schedule.
Diagnosis or Monitoring of Diseases Mediated by Cells Expressing CD47
[0164] In another aspect, the present invention relates to a composition for diagnosing or monitoring a disease mediated by cells expressing CD47, comprising the antibody that specifically binds to CD47.
[0165] The antibody that specifically binds to CD47 may be directly or indirectly labeled. An indirect label includes a secondary antibody comprising a detectable label, wherein the secondary antibody binds to an antibody that specifically binds to CD47. Another indirect label includes biotin, wherein an antibody that specifically binds to biotinylated CD47 can be detected using avidin or streptavidin containing a detectable label.
[0166] A suitable detectable label includes any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means. A suitable labels includes, but are not limited to, magnetic beads, fluorescent dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, red fluorescent protein, yellow fluorescent protein, etc.), radioactive labels (e.g., For example, .sup.3H, .sup.125I, .sup.35S, .sup.14C or .sup.32 P), enzymes (e.g., mustard radish peroxidase, alkaline phosphatase, luciferase and the ones commonly used for enzyme-linked immunosorbent assay (ELISA)) and colorimetric labels such as colloidal gold or tinted glass or plastic (e.g., polystyrene, polypropylene, latex, etc.) beads.
[0167] In addition, for diagnosis or monitoring, the antibody may be labeled with a fluorescent protein, and may contain a contrast agent or a radioisotope.
[0168] When the antibody that specifically binds to CD47 of the present invention is used in a diagnostic kit, the antibody is immobilized on a support, and the support may be a microplate, microarray, chip, glass, bead or particle, or a membrane.
[0169] Hereinafter, preferred examples are presented to help the understanding of the present invention. However, the following examples are only provided for easier understanding of the present invention, and the contents of the present invention are not limited by the following examples.
Example 1
Preparation and Selection of the Antibody that Specifically Binds to CD47
[0170] To select the antibody specific for CD47 peptide, a hybridoma producing the antibody that can bind to CD47 was prepared and the antibody was selected.
[0171] First, splenocytes were extracted by immunization with CD47 protein (Acrobiosystems, cat#CD7-HA2E9), and hybridoma cells were prepared through cell fusion with mouse myeloma cells and splenocytes.
[0172] Mouse myeloma cells for cell fusion cannot survive in HAT medium because they do not have HGPRT (HypoxanthineGuanidine-Phosphoribosyl-Transferase), but hybridomas can survive in HAT medium by fusion with splenocytes. Since only hybridomas could be grown using this, it is usually grown in HAT medium until hybridomas were established.
[0173] The limiting dilution method was used to select hybridomas that produced the antibody that binds to CD47 from among the grown hybridomas. First, it was made to be less than one cell per 96 well, and then, it was confirmed by ELISA whether the antibody obtained from clones proliferated from one cell binds to CD47, and clones that bind to CD47 were selected. The above process was repeated three times to select hybridomas producing the antibody that binds to CD47. In this way, seven types of antibodies that bind to CD47 were obtained.
[0174] The seven types of antibodies were named 7C7, 5H4, 5A4, 4E12, 3H3, 3A5 and 1E7, respectively, and their base and amino acid sequences were analyzed. Sequence information for a heavy chain variable region and a heavy chain variable region of each antibody according to the sequencing result was shown in Tables 1 to 7 below, and the underlined parts in Tables 1 to 7 are complementary determining regions (CDR).
TABLE-US-00001 TABLE1 Sequenceinformationof7C7antibody SEQID 7C7 sequenceinformation NO: Heavychain GYTFSYV SEQID variableregion NO:1 CDR1 Heavychain INPYNDGT SEQID variableregion NO:2 CDR2 Heavychain ARGRNRYDSWFAY SEQID variableregion NO:3 CDR3 Lightchain QDISNY SEQID variableregion NO:4 CDR1 Lightchain YTS SEQID variableregion NO:5 CDR2 Lightchain QQGNTLPWT SEQID variableregion NO:6 CDR3 aminoacid EVQLQQSGPELVKPGASVRMSCKASGYTFTSYVMHWV SEQID sequenceof KQKPGQGLEWIGYINPYNDGTKYNEKFKGKSTLTSDKSS NO:7 heavychain STAYMELSSLTSEDSAVYCCARGRNRYDSWFAYWGQG variableregion TLVTVSA aminoacid DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQK SEQID sequenceoflight PDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQ NO:8 chainvariable EDIATYFCQQGNTLPWTFGGGTKLEIK region nucleotide gaggtccagctgcaacagtctggacctgagctggtaaagcctggggcc SEQID sequenceof tcagtgaggatgtcctgcaaggcttctggatacacattcactagctatg NO:9 heavychain ttatgcactgggtgaagcagaagcctgggcagggccttgagtggattg variableregion gatatattaatccttacaatgatggtactaagtacaatgagaagttcaa aggcaagtccacactgacttcagacaaatcctccagcacagcctacat ggagctcagcagcctgacctctgaggactctgcggtctattgctgtgca agagggaggaataggtacgactcctggtttgcttactggggccaaggg actctggtcactgtctctgca nucleotide gatatccagatgacacagactacatcctccctgtctgcctctctgggag SEQID sequenceoflight acagagtcaccatcagttgcagggcaagtcaggacattagcaattatt NO:10 chainvariable taaactggtatcagcagaaaccagatggaactgttaaactcctgatct region actacacatcaagattacactcaggagtcccatcaaggttcagtggca gtgggtctggaacagattactctctcaccattagcaacctggagcaag aagatattgccacttacttttgccaacagggtaatacgcttccgtggac gttcggtggaggcaccaagctggaaatcaaa
TABLE-US-00002 TABLE2 Sequenceinformationof5H4antibody SEQID 5H4 sequenceinformation NO: Heavychain GYTFTNYW SEQID variableregion NO:11 CDR1 Heavychain IDPSDSYT SEQID variableregion NO:12 CDR2 Heavychain TRGGKRAMDY SEQID variableregion NO:13 CDR3 Lightchain QSLVHSNGNTY SEQID variableregion NO:14 CDR1 Lightchain KVS SEQID variableregion NO:15 CDR2 Lightchain SQSTHVPFT SEQID variableregion NO:16 CDR3 aminoacid QVQLQQPGAELVKPGTSVKMSCKAS SEQID sequenceof GYTFTNYWMHWVKQRPGQVLEWIGV NO:17 heavychain IDPSDSYTSYNQKFKGKATLTVDTSSTTAYMQLSSLTSED variableregion SAVYYCTRGGKRAMDYWGQGTSVTVSS aminoacid DVLMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLH SEQID sequenceoflight WYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTL NO:18 chain KISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIK variableregion nucleotide caggtccaactgcagcagcctggggctgagctggtgaagcctgggact SEQID sequenceof tcagtgaagatgtcctgcaaggcttctggctacaccttcaccaactact NO:19 heavychain ggatgcactgggtgaagcagaggcctggacaagtccttgagtggatc variableregion ggagtgattgatccttctgatagttatactagctacaatcaaaagttca agggcaaggccacattgactgtagacacatcctccaccacagcctaca tgcagctcagcagcctgacatctgaggactctgcggtctattactgtac aagagggggtaagagagctatggactactggggtcaaggaacctcag tcaccgtctcctca nucleotide gatgttttgatgacccaaactccactctccctgcctgtcagtcttggaga SEQID sequenceoflight tcaagcctccatctcttgcagatctagtcagagccttgtacacagtaat NO:20 chainvariable ggaaacacctatttacattggtacctgcagaagccaggccagtctcca region aagctcctgatctacaaagtttccaaccgattttctggggtcccagaca ggttcagtggcagtggatcagggacagatttcacactcaagatcagca gagtggaggctgaggatctgggagtttatttctgctctcaaagtacaca tgttccattcacgttcggctcggggacaaagttggaaataaaa
TABLE-US-00003 TABLE3 Sequenceinformationof5A4antibody SEQID 5A4 sequenceinformation NO: Heavychain GYTFTNYW SEQID variableregion NO:21 CDR1 Heavychain IDPSNSAT SEQID variableregion NO:22 CDR2 Heavychain ARGGFAFDS SEQID variableregion NO:23 CDR3 Lightchainvariable QSLVHSNGNTY SEQID regionCDR1 NO:24 Lightchainvariable KVS SEQID regionCDR2 NO:25 Lightchainvariable SQSTHVPWT SEQID regionCDR3 NO:26 aminoacid QVQLQQPGPELVRPGASVKMSCKAS SEQID sequenceofheavy GYTFTNYWIHWVKQRPGQGLEWIGM NO:27 chainvariable IDPSNSATRLNQKFKDKATLNVDKSSNTAYMQLSSLTS region EDSAVYYCARGGFAFDSWGQGTTLTVSS aminoacid DVLMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYL SEQID sequenceof HWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDF NO:28 lightchainvariable TLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK region nucleotide caggtccaactgcagcagcctgggcctgagctggtgaggcctgggg SEQID sequenceofheavy cttcagtgaagatgtcctgcaaggcttcaggctataccttcaccaact NO:29 chainvariable actggattcactgggtgaaacagaggcctggacaaggccttgagtg region gattggcatgattgatccttccaatagtgcaactaggttaaatcaga agttcaaggacaaggccacattgaatgtagacaaatcctccaacac agcctacatgcagctcagcagcctgacatctgaggactctgcagtct attactgtgcaagaggagggttcgcctttgactcctggggccaaggc accactctcacagtctcctca nucleotide gatgttttgatgacccaaactccactctccctgcctgtcagtcttggag SEQID sequenceoflight atcaagcctccatctcttgcagatctagtcagagccttgtacatagta NO:30 chainvariable atggaaacacctatttacattggtacctgcagaagccaggccagtct region ccaaagctcctgatctacaaagtttccaaccgattttctggggtccca gacaggttcagtggcagtggatcagggacagatttcacactcaaga tcagcagagtggaggctgaggatctgggagtttatttctgctctcaaa gtacacatgttccgtggacgttcggtggaggcaccaagctggaaatc aaa
TABLE-US-00004 TABLE4 Sequenceinformationof4E12antibody SEQID 4E12 sequenceinformation NO: Heavychainvariable GYTFTNYG SEQID regionCDR1 NO:31 Heavychainvariable INTYTGEP SEQID regionCDR2 NO:32 Heavychainvariable ARGGGRGAMDY SEQID regionCDR3 NO:33 Lightchainvariable QSIVHSNGNTY SEQID regionCDR1 NO:34 Lightchainvariable KVS SEQID regionCDR2 NO:35 Lightchainvariable FQGSHVPFT SEQID regionCDR3 NO:36 aminoacidsequence QIQFAQSGPELKKSGETVKISCRAS SEQID of GYTFTNYGMNWVKQAPGKGLKWMGW NO:37 heavychainvariable INTYTGEPTYADDFKGRFAFSLETSASTAYLQINNLKN region EDMATYFCARGGGRGAMDYWGQGTTLTVSS aminoacidsequence DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTY SEQID of LDWYLQKPGQSPKLLIYKVSKRFSGVPDRFSGSGSGT NO:38 lightchainvariable DFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIK region nucleotidesequence cagatccagttcgcgcagtctggacctgagctgaagaagtctgga SEQID ofheavychain gagacagtcaagatctcctgcagggcttctgggtataccttcacaa NO:39 variableregion actatggaatgaactgggtgaagcaggctccaggaaagggtttaa agtggatgggctggataaacacctacactggagagccaacatatg ctgatgacttcaagggacggtttgccttctctttggaaacctctgcc agcactgcctatttgcagatcaacaacctcaaaaatgaggacatg gctacatatttctgtgcaagagggggtgggaggggtgctatggact actggggccaaggcaccactctcacagtctcctca nucleotidesequence gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg SEQID oflightchain agatcaagcctccatctcttgcagatctagtcagagcattgtacat NO:40 variableregion agtaatggaaacacctatttagactggtacctgcagaaaccaggc cagtctccaaagctcctgatctacaaagtttccaaacgattttctgg ggtcccagacaggttcagtggcagtggatcagggacagatttcac actcaagatcagcagagtggaggctgaggatctgggagtttatta ctgctttcaaggttcacatgttccattcacgttcggctcggggacaa agttggaaataaaa
TABLE-US-00005 TABLE5 Sequenceinformationof3H3antibody SEQID 3H3 sequenceinformation NO: Heavychainvariable GYTFTNYW SEQID regionCDR1 NO:41 Heavychainvariable IDPSNSET SEQID regionCDR2 NO:42 Heavychainvariable ARGGFAFDS SEQID regionCDR3 NO:43 Lightchainvariable QSLVHNNGNTY SEQID regionCDR1 NO:44 Lightchainvariable KVS SEQID regionCDR2 NO:45 Lightchainvariable SQSTHVPWT SEQID regionCDR3 NO:46 aminoacidsequence EVQLQQPGPELVRPGASVKMSCKAS SEQID of GYTFTNYWMHWVKQRPGQGLEWIGM NO:47 heavychainvariable IDPSNSETRLNQKFKDKATLNVDKSSNTAYMQLSSLT region SEDSAVYSCARGGFAFDSWGQGTTLTVSS aminoacidsequence DVLMTQTPLSLPVSLGDQASISCRSSQSLVHNNGNT SEQID of YLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFRGSGS NO:48 lightchainvariable GTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKL region EIK nucleotidesequence gaggtccagctgcagcagcctgggcctgagctggtgaggcctggg SEQID ofheavychain gcttcagtgaagatgtcctgcaaggcttcaggctataccttcacca NO:49 variableregion actactggatgcactgggtgaaacagaggcctggacaaggccttg agtggattggcatgattgatccttccaatagtgaaactaggttaaa tcagaagttcaaggacaaggccacattgaatgtagacaaatcctc caacacagcctacatgcagctcagcagcctgacatctgaggactc tgcagtctattcctgtgcaagaggagggttcgcctttgactcctggg gccaaggcaccactctcacagtctcctca nucleotidesequence gatgttttgatgacccaaactccactctccctgcctgtcagtcttgg SEQID oflightchain agatcaagcctccatctcttgcagatctagtcagagccttgtacac NO:50 variableregion aataatggaaacacctatttacattggtacctgcagaagccaggc cagtctccaaagctcctgatctacaaagtttccaaccgattttctgg ggtcccagacaggttccgtggcagtggatcggggacagatttcac actcaagatcagcagagtggaggctgaggatctgggagtttatttc tgctctcaaagtacacatgttccgtggacgttcggtggaggcacca agctggaaatcaaa
TABLE-US-00006 TABLE6 Sequenceinformationof3A5antibody SEQID 3A5 sequenceinformation NO: Heavychain GYTFSYW SEQID variableregion NO:51 CDR1 Heavychain IDPSDSYT SEQID variableregion NO:52 CDR2 Heavychain ARGGKRAMDY SEQID variableregion NO:53 CDR3 Lightchainvariable QSLVHSNGNTY SEQID regionCDR1 NO:54 Lightchainvariable KVS SEQID regionCDR2 NO:55 Lightchainvariable SQSTHVPFT SEQID regionCDR3 NO:56 aminoacid EVQLQQPGAELVKPGASVKMSCKAS SEQID sequenceof GYTFTSYWMHWMNQRPGQGLEWIGV NO:57 heavychain IDPSDSYTSYNQKFKGKATLTVDTSSSTAYMQLSSLTSE variableregion DSAVYYCARGGKRAMDYWGQGTSVTVSS aminoacid DVLMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYL SEQID sequenceof HWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDF NO:58 lightchainvariable TLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIK region nucleotide gaggtccagctgcagcagcctggggctgagctggtgaagcctgggg SEQID sequenceofheavy cttcagtgaagatgtcctgcaaggcttctggctacaccttcaccagct NO:59 chainvariable actggatgcactggatgaaccagaggcctggacaaggccttgagtg region gatcggagtgattgatccttctgatagttatactagctacaatcaaaa gttcaagggcaaggccacattgactgtagacacatcctccagcaca gcctacatgcagctcagcagcctgacatctgaggactctgcggtcta ttactgtgcaagagggggtaagagagctatggactactggggtcaa ggaacctcagtcaccgtctcctca nucleotide gatgttttgatgacccaaactccactctccctgcctgtcagtcttggag SEQID sequenceoflight atcaagcctccatctcttgcagatctagtcagagccttgtacacagta NO:60 chainvariable atggaaacacctatttacattggtacctgcagaagccaggccagtct region ccaaagctcctgatctacaaagtttccaaccgattttctggggtccca gacaggttcagtggcagtggatcagggacagatttcacactcaaga tcagcagagtggaggctgaggatctgggagtttatttctgctctcaaa gtacacatgttccattcacgttcggctcggggacaaagttggaaata aaa
TABLE-US-00007 TABLE7 Sequenceinformationof1E7antibody SEQID 1E7 sequenceinformation NO: Heavychain GYIFTSYV SEQID variableregion NO:61 CDR1 Heavychain INPYNDGT SEQID variableregion NO:62 CDR2 Heavychain ARGGFTTDY SEQID variableregion NO:63 CDR3 Lightchainvariable QSLVHSNGNTY SEQID regionCDR1 NO:64 Lightchainvariable KVS SEQID regionCDR2 NO:65 CDR3onthelight SQSTHVPYT SEQID chainvariable NO:66 region aminoacid EVQLQQSGPELIKPGASVKMSCKAS SEQID sequenceof GYIFTSYVVYWVKQKPGQGLEWIGY NO:67 heavychain INPYNDGTKYNEKFKGKATLTSYKSSSTAYMELSSLTSA variableregion DSAVYYCARGGFTTDYWGQGTTLTVSS aminoacid DVLMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYL SEQID sequenceof HWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDF NO:68 lightchainvariable TLKISRVEAEDLGVYFCSQSTHVPYTFGGGTKLEIK region nucleotide gaggtccagctgcaacagtctggacctgagctgataaagcctgggg SEQID sequenceofheavy cttcagtgaagatgtcctgcaaggcttctggatacatattcactagtt NO:69 chainvariable atgttgtgtattgggtgaagcagaagcctgggcagggccttgagtgg region attggatatattaatccttacaatgatggtactaagtacaatgagaa gttcaagggcaaggccacactgacttcatacaaatcctccagcaca gcctacatggagctcagcagcctgacctctgcggactctgcggtctat tactgtgcaagaggggggtttactactgactactggggccaaggcac cactctcacagtctcctca nucleotide gatgttttgatgacccaaactccactctccctgcctgtcagtcttggag SEQID sequenceoflight atcaagcctccatctcttgcagatctagtcagagccttgtacacagta NO:70 chainvariable atggaaacacctatttacattggtacctgcagaagccaggccagtct region ccaaagctcctgatctacaaagtttccaaccgattttctggggtccca gacaggttcagtggcagtggatcagggacagatttcacactcaaga tcagcagagtggaggctgaggatctgggagtttatttctgctctcaaa gtacacatgttccttacacgttcggaggggggaccaagctggaaata aaa
Example 2
Confirmation of Specificity of the Selected Antibody for CD47ELISA Analysis
[0175] In the present invention, in order to confirm the specificity of 7C7, 5H4, 5A4, 4E12, 3H3, 3A5 and 1E7 antibodies established in Example 1 for CD47, ELISA analysis was performed.
[0176] First, in order to encode the CD47 peptide, CD47 protein (Acrobiosystems, cat#CD7-HA2E9) was dispensed in a 96-well plate at a concentration of 100 ng/well, and then reacted at 4 C. overnight. Then, after treatment with 1 PBST containing 3% BSA, blocking at room temperature for 30 minutes.
[0177] 3 l of hybridoma cell culture solution of each clone for producing 7C7, 5H4, 5A4, 4E12, 3H3, 3A5, or 1E7 antibody was treated in each well, and then reacted at room temperature for 2 hours, and then washed 3 times with 1 PBST. Secondary antibody (anti-HRP, 1:10,000) was treated and reacted at room temperature for 30 minutes, washed 3 times with 1 PBST, and then treated with TMB for color development and reacted at room temperature for 5 minutes. Finally, the reaction was terminated by treatment with a stop solution of 1N H.sub.2SO.sub.4, and then the absorbance was measured at 450 nm.
TABLE-US-00008 TABLE 8 ELISA Experimental Conditions ELISA reader Infinite F50 Measurement Filter 450 nm Measurement Mode Single Point Photo Antigen Coating 100 ng/well 2nd Antibody (Anti-mIgG-HRP) 1:10,000 dilution Substrate TMB
TABLE-US-00009 TABLE 9 ELISA test results antibody type OD450 measurements 7C7 1.980 5H4 1.914 5A4 1.932 4E12 2.155 3H3 1.966 3A5 2.010 1E7 2.137
[0178] As a result, as shown in Table 9, it was confirmed that all of the antibodies selected in the present invention specifically bound to CD47.
Example 3
Confirmation of Specificity of the Selected Antibody for CD47Flow Cytometer
[0179] To confirm the specificity of 5H4, 5A4, 4E12, 3H3, 3A5 and 1E7 antibodies for CD47 established in Example 1, flow cytometer was performed.
[0180] First, 110.sup.7 of breast cancer cell line MCF-7 expressing CD47 and 1 g of 7C7, 5H4, 5A4E12, 3H3, 3A5, and 1E7 antibody were reacted for 30 minutes, respectively, and then stained on surface with a secondary antibody. After staining, it was measured by flow cytometry.
[0181] As a positive control, CD47 antibody (Biolegend PE anti-human CD47, cat# 323108, 5 l) was used, and as a secondary antibody, PE-conjugated anti-mouse IgG antibody (PE-conjugated goat anti-mouse IgG; Biolegend Inc., cat# 405307, USA, 5 l) was used.
TABLE-US-00010 TABLE 10 Flow cytometry results antibody type Count Median Mean 7C7 11544 6113 6816 5H4 11244 14313 15493 5A4 11298 14668 15992 4E12 11239 5385 6026 3H3 11164 16536 18001 3A5 11285 13866 14951 1E7 11231 14921 16140 positive 11535 10972 11930 2nd Ab alone 11285 73.9 80 none 11077 24.5 25.0
[0182] As a result, as shown in
[0183] Since the antibody selected in the present invention specifically recognized CD47-expressing cells, it can effectively induce cytotoxicity or death by immune cells/macrophages by inhibiting immune evasion of CD47-expressing cancer or tumor cells. Therefore, the anti-CD47 antibody of the present invention can be usefully used as a composition for preventing or treating a cancer or tumor expressing CD47.
Example 4
Vector Construction Expressing Chimeric Antigen Receptor Targeting CD47 (CD47-CAR)
[0184] In the present invention, a lentivirus vector (CD47-CAR lentivirus) expressing a chimeric antigen receptor (CAR) targeting CD47 was prepared using the CD47 antibody prepared in Example 1.
[0185] As shown in the schematic diagram of
[0195] Lentivirus vector DNA (0.5 g) was transferred to HEK293FT cells (510.sup.5 cells/500 l), and 293HEK cells expressing the CD47-CAR gene were prepared. Lipofectamine 3000 transfection kit (Invitrogen, cat# L3000-015) was used to transfer genes into 293HEK cells, and cultured in Opti-MEM (gibco, cat# 51985-034) medium for 4 hours.
[0196] In HEK293FT transformed with lentivirus vector DNA, it was confirmed by flow cytometry whether CD47-specific CAR was normally expressed and bound to CD47 peptide (
INDUSTRIAL APPLICABILITY
[0197] It was confirmed that seven types of CD47-specific antibodies (7C7, 5H4, 5A4, 4E12, 3H3, 3A5, 1E7) selected in the present invention specifically bound to CD47 antigen, and it is possible to produce a chimeric antigen receptor (CAR) that target CD47 using the established antibody. Thus, the present of CD47-specific antibodies and chimeric antigen receptors prepared by the above antibody can be applied for use in preventing or treating a cancer or tumor expressing CD47.