SHARED NEOANTIGEN VACCINES
20230020089 · 2023-01-19
Inventors
- Andrew Ferguson (Hingham, MA, US)
- Raphael Rousseau (Los Altos, CA, US)
- Roman Yelensky (Newton, MA, US)
- James Xin Sun (Newton, MA, US)
- Matthew Joseph Davis (Scituate, MA, US)
- Karin Jooss (Emeryville, CA, US)
- Amy Rachel Rappaport (Daly City, CA, US)
- Ciaran Daniel Scallan (San Francisco, CA, US)
- Leonid Gitlin (Foster City, CA, US)
- Christine Denise Palmer (Cambridge, MA, US)
- Jennifer Busby (Burlington, MA, US)
- Brendan Bulik-Sullivan (Cambridge, MA, US)
- Mojca Skoberne (Cambridge, MA)
- Wade Blair (Gaithersburg, MD, US)
Cpc classification
C12N2740/16034
CHEMISTRY; METALLURGY
C12N2740/16334
CHEMISTRY; METALLURGY
C12N2770/36143
CHEMISTRY; METALLURGY
C12N2740/14034
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C12N2770/24234
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2039/6037
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
C12N2710/16234
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C12N2710/10334
CHEMISTRY; METALLURGY
C12N2760/16134
CHEMISTRY; METALLURGY
C12N2730/10134
CHEMISTRY; METALLURGY
A61K39/39
HUMAN NECESSITIES
C12N2710/16134
CHEMISTRY; METALLURGY
C12N15/625
CHEMISTRY; METALLURGY
C12N2770/36134
CHEMISTRY; METALLURGY
C12N2740/16234
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
C12N2710/20034
CHEMISTRY; METALLURGY
International classification
A61K39/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Disclosed herein are compositions that include antigen-encoding nucleic acid sequences and/or antigen peptides. Also disclosed are nucleotides, cells, and methods associated with the compositions including their use as vaccines, including vectors and methods for a heterologous prime/boost vaccincation strategy.
Claims
1. A composition for delivery of a self-amplifying alphavirus-based expression system, wherein the composition for delivery of the self-amplifying alphavirus-based expression system comprises: (A) the self-amplifying alphavirus-based expression system, wherein the self-amplifying alphavirus-based expression system comprises one or more vectors, wherein the one or more vectors comprises: (a) an RNA alphavirus backbone, wherein the RNA alphavirus backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence comprising: a. an epitope-encoding nucleic acid sequence, optionally comprising at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, b. optionally a 5′ linker sequence, and c. optionally a 3′ linker sequence; (ii) optionally, a second promoter nucleotide sequence operably linked to the at least one antigen-encoding nucleic acid sequence; and (iii) optionally, at least one second poly(A) sequence, wherein the second poly(A) sequence is a native poly(A) sequence or an exogenous poly(A) sequence to the alphavirus, and (B) a lipid-nanoparticle (LNP), wherein the LNP encapsulates the self-amplifying alphavirus-based expression system, and wherein the composition comprises at least 10 μg of each of the one or more vectors.
2. (canceled)
3. The composition of claim 1, wherein the composition for delivery of the self-amplifying alphavirus-based expression system comprises at least 30 μg of each of the one or more vectors.
4. The composition of claim 1, wherein the composition for delivery of the self-amplifying alphavirus-based expression system comprises at least 100 μg of each of the one or more vectors.
5. (canceled)
6. (canceled)
7. The composition of claim 1, wherein the composition for delivery of the self-amplifying alphavirus-based expression system comprises between 10-30 μg, 10-100 μg, or 10-300 μg of each of the one or more vectors.
8-15. (canceled)
16. The composition claim 1, wherein the one or more vectors is at a concentration of 1 mg/mL.
17-89. (canceled)
90. A composition for delivery of a chimpanzee adenovirus (ChAdV)-based expression system, wherein the composition for delivery of the ChAdV-based expression system comprises: the ChAdV-based expression system, wherein the ChAdV-based expression system comprises a viral particle comprising a ChAdV vector, wherein the ChAdV vector comprises: (a) a ChAdV backbone, wherein the ChAdV backbone comprises: (i) at least one promoter nucleotide sequence, and (ii) at least one polyadenylation (poly(A)) sequence; and (b) a cassette, wherein the cassette comprises: (i) at least one antigen-encoding nucleic acid sequence comprising: a. an epitope-encoding nucleic acid sequence, optionally comprising at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, b. optionally a 5′ linker sequence, and c. optionally a 3′ linker sequence; and wherein the cassette is operably linked to the at least one promoter nucleotide sequence and the at least one poly(A) sequence, and wherein the composition comprises 1×10.sup.12 or less of the viral particles.
91. (canceled)
92. (canceled)
93. The composition of claim 90, wherein the composition for delivery of the ChAdV-based expression system comprises at least 1×10.sup.11 of the viral particles.
94. The composition of claim 90, wherein the composition for delivery of the ChAdV-based expression system comprises between 1×10.sup.12.
95. The composition of claim 90, wherein the composition for delivery of the ChAdV-based expression system comprises 1×10.sup.11, 3×10.sup.11, or 1×10.sup.12 of the viral particles.
96. The composition of claim 90, wherein the viral particles are at a concentration of at 5×10.sup.11 vp/mL.
97. The composition of claim 1, wherein the epitope-encoding nucleic acid sequence encodes an epitope known or suspected to be presented by MHC class I on a surface of a cell, wherein the surface of the cell is a tumor cell surface or an infected cell surface, and optionally wherein the cell is a subject's cell.
98. The composition of claim 97, wherein the cell is a tumor cell selected from the group consisting of: lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer, or wherein the cell is an infected cell selected from the group consisting of: a pathogen infected cell, a virally infected cell, a bacterially infected cell, an fungally infected cell, and a parasitically infected cell.
99-112. (canceled)
113. The composition of claim 90, wherein the ChAdV backbone comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1, wherein the nucleotides 2 to 36,518 lack: (1) nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion; (2) nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion; and (3) nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1 corresponding to a partial E4 deletion; optionally wherein the antigen cassette is inserted within the E1 deletion.
114-132. (canceled)
133. The composition of claim 1, wherein the epitope-encoding nucleic acid sequence encodes an epitope known or suspected to be expressed in a subject known or suspected to have cancer selected from the group consisting of: MSS-CRC, NSCLC, and PDA.
134-178. (canceled)
179. The composition of claim 1, wherein the composition for delivery of the expression system is formulated in a pharmaceutical composition comprising a pharmaceutically acceptable carrier.
180. A kit comprising the composition for delivery of the expression system of claim 1, and instructions for use.
181. (canceled)
182. (canceled)
183. (canceled)
184. (canceled)
185. The composition of claim 1, wherein the epitope-encoding nucleic acid sequence comprises an epitope selected from the group consisting of SEQ ID NO: 57-29,357 and SEQ ID NO: 29,512-29,519.
186. (canceled)
187. (canceled)
188. (canceled)
189. The composition of claim 1, wherein the at least one antigen-encoding nucleic acid sequence comprises at least each of: (A) a KRAS_G12C MHC class I epitope encoding nucleic acid sequence, (B) a KRAS_G12D MHC class I epitope encoding nucleic acid sequence, and (C) a KRAS_G12V MHC class I epitope encoding nucleic acid sequence.
190. (canceled)
191. (canceled)
192. (canceled)
193. (canceled)
194. (canceled)
195. (canceled)
196. A method for stimulating an immune response in a subject, the method comprising administering to the subject a composition for delivery of a self-amplifying alphavirus-based expression system and administering to the subject a composition for delivery of a chimpanzee adenovirus (ChAdV)-based expression system, and wherein either: a. the composition for delivery of the ChAdV-based expression system comprises the ChAdV-based expression system, wherein the ChAdV-based expression system comprises a viral particle comprising a ChAdV vector, and wherein the composition comprises 1×10.sup.12 or less of the viral particles, b. wherein the composition for delivery of the self-amplifying alphavirus-based expression system comprises the self-amplifying alphavirus-based expression system, wherein the self-amplifying alphavirus-based expression system comprises one or more vectors, and wherein the composition comprises at least 10 μg of each of the one or more vectors, or c. the composition for delivery of the ChAdV-based expression system comprises the ChAdV-based expression system, wherein the ChAdV-based expression system comprises a viral particle comprising a ChAdV vector, and wherein the composition comprises 1×10.sup.12 or less of the viral particles and wherein the composition for delivery of the self-amplifying alphavirus-based expression system comprises the self-amplifying alphavirus-based expression system, wherein the self-amplifying alphavirus-based expression system comprises one or more vectors, and wherein the composition comprises at least 10 μg of each of the one or more vectors.
197. The method of claim 196, wherein the composition for delivery of the ChAdV-based expression system is administered as a priming dose and the composition for delivery of the self-amplifying alphavirus-based expression system is administered as one or more boosting doses.
198-434. (canceled)
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0120] These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings, where:
[0121] Figure (FIG.) 1 illustrates development of an in vitro T cell activation assay. Schematic of the assay in which the delivery of a vaccine cassette to antigen presenting cells, leads to expression, processing and MHC-restricted presentation of distinct peptide antigens. Reporter T cells engineered with T cell receptors that match the specific peptide-MHC combination become activated resulting in luciferase expression.
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
[0200]
[0201]
[0202]
[0203]
[0204]
[0205]
[0206]
[0207]
[0208]
[0209]
[0210]
[0211]
[0212]
DETAILED DESCRIPTION
I. Definitions
[0213] In general, terms used in the claims and the specification are intended to be construed as having the plain meaning understood by a person of ordinary skill in the art. Certain terms are defined below to provide additional clarity. In case of conflict between the plain meaning and the provided definitions, the provided definitions are to be used.
[0214] As used herein the term “antigen” is a substance that induces an immune response. An antigen can be a neoantigen. An antigen can be a “shared antigen” that is an antigen found among a specific population, e.g., a specific population of cancer patients.
[0215] As used herein the term “neoantigen” is an antigen that has at least one alteration that makes it distinct from the corresponding wild-type antigen, e.g., via mutation in a tumor cell or post-translational modification specific to a tumor cell. A neoantigen can include a polypeptide sequence or a nucleotide sequence. A mutation can include a frameshift or nonframeshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF. A mutations can also include a splice variant. Post-translational modifications specific to a tumor cell can include aberrant phosphorylation. Post-translational modifications specific to a tumor cell can also include a proteasome-generated spliced antigen. See Liepe et al., A large fraction of HLA class I ligands are proteasome-generated spliced peptides; Science. 2016 Oct. 21;354(6310):354-358. Exemplary shared neoantigens are shown in Table A and in the AACR GENIE Results (SEQ ID NO:10,755-29,357); corresponding HLA allele(s) for each antigen are also shown. Such shared neoantigens are useful for inducing an immune response in a subject via administration. The subject can be identified for administration through the use of various diagnostic methods, e.g., patient selection methods described further below.
[0216] As used herein the term “tumor antigen” is an antigen present in a subject's tumor cell or tissue but not in the subject's corresponding normal cell or tissue, or derived from a polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.
[0217] As used herein the term “antigen-based vaccine” is a vaccine composition based on one or more antigens, e.g., a plurality of antigens. The vaccines can be nucleotide-based (e.g., virally based, RNA based, or DNA based), protein-based (e.g., peptide based), or a combination thereof.
[0218] As used herein the term “candidate antigen” is a mutation or other aberration giving rise to a sequence that may represent an antigen.
[0219] As used herein the term “coding region” is the portion(s) of a gene that encode protein.
[0220] As used herein the term “coding mutation” is a mutation occurring in a coding region.
[0221] As used herein the term “ORF” means open reading frame.
[0222] As used herein the term “NEO-ORF” is a tumor-specific ORF arising from a mutation or other aberration such as splicing.
[0223] As used herein the term “missense mutation” is a mutation causing a substitution from one amino acid to another.
[0224] As used herein the term “nonsense mutation” is a mutation causing a substitution from an amino acid to a stop codon or causing removal of a canonical start codon.
[0225] As used herein the term “frameshift mutation” is a mutation causing a change in the frame of the protein.
[0226] As used herein the term “indel” is an insertion or deletion of one or more nucleic acids.
[0227] As used herein, the term percent “identity,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the percent “identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
[0228] For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. Alternatively, sequence similarity or dissimilarity can be established by the combined presence or absence of particular nucleotides, or, for translated sequences, amino acids at selected sequence positions (e.g., sequence motifs).
[0229] Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., infra).
[0230] One example of an algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
[0231] As used herein the term “non-stop or read-through” is a mutation causing the removal of the natural stop codon.
[0232] As used herein the term “epitope” is the specific portion of an antigen typically bound by an antibody or T cell receptor.
[0233] As used herein the term “immunogenic” is the ability to elicit an immune response, e.g., via T cells, B cells, or both.
[0234] As used herein the term “HLA binding affinity” “MHC binding affinity” means affinity of binding between a specific antigen and a specific MHC allele.
[0235] As used herein the term “bait” is a nucleic acid probe used to enrich a specific sequence of DNA or RNA from a sample.
[0236] As used herein the term “variant” is a difference between a subject's nucleic acids and the reference human genome used as a control.
[0237] As used herein the term “variant call” is an algorithmic determination of the presence of a variant, typically from sequencing.
[0238] As used herein the term “polymorphism” is a germline variant, i.e., a variant found in all DNA-bearing cells of an individual.
[0239] As used herein the term “somatic variant” is a variant arising in non-germline cells of an individual.
[0240] As used herein the term “allele” is a version of a gene or a version of a genetic sequence or a version of a protein.
[0241] As used herein the term “HLA type” is the complement of HLA gene alleles.
[0242] As used herein the term “nonsense-mediated decay” or “NMD” is a degradation of an mRNA by a cell due to a premature stop codon.
[0243] As used herein the term “truncal mutation” is a mutation originating early in the development of a tumor and present in a substantial portion of the tumor's cells.
[0244] As used herein the term “subclonal mutation” is a mutation originating later in the development of a tumor and present in only a subset of the tumor's cells.
[0245] As used herein the term “exome” is a subset of the genome that codes for proteins. An exome can be the collective exons of a genome.
[0246] As used herein the term “logistic regression” is a regression model for binary data from statistics where the logit of the probability that the dependent variable is equal to one is modeled as a linear function of the dependent variables.
[0247] As used herein the term “neural network” is a machine learning model for classification or regression consisting of multiple layers of linear transformations followed by element-wise nonlinearities typically trained via stochastic gradient descent and back-propagation.
[0248] As used herein the term “proteome” is the set of all proteins expressed and/or translated by a cell, group of cells, or individual.
[0249] As used herein the term “peptidome” is the set of all peptides presented by MHC-I or MHC-II on the cell surface. The peptidome may refer to a property of a cell or a collection of cells (e.g., the tumor peptidome, meaning the union of the peptidomes of all cells that comprise the tumor).
[0250] As used herein the term “ELISpot” means Enzyme-linked immunosorbent spot assay—which is a common method for monitoring immune responses in humans and animals.
[0251] As used herein the term “dextramers” is a dextran-based peptide-MHC multimers used for antigen-specific T-cell staining in flow cytometry.
[0252] As used herein the term “tolerance or immune tolerance” is a state of immune non-responsiveness to one or more antigens, e.g. self-antigens.
[0253] As used herein the term “central tolerance” is a tolerance affected in the thymus, either by deleting self-reactive T-cell clones or by promoting self-reactive T-cell clones to differentiate into immunosuppressive regulatory T-cells (Tregs).
[0254] As used herein the term “peripheral tolerance” is a tolerance affected in the periphery by downregulating or energizing self-reactive T-cells that survive central tolerance or promoting these T cells to differentiate into Tregs.
[0255] The term “sample” can include a single cell or multiple cells or fragments of cells or an aliquot of body fluid, taken from a subject, by means including venipuncture, excretion, ejaculation, massage, biopsy, needle aspirate, lavage sample, scraping, surgical incision, or intervention or other means known in the art.
[0256] The term “subject” encompasses a cell, tissue, or organism, human or non-human, whether in vivo, ex vivo, or in vitro, male or female. The term subject is inclusive of mammals including humans.
[0257] The term “mammal” encompasses both humans and non-humans and includes but is not limited to humans, non-human primates, canines, felines, murines, bovines, equines, and porcines.
[0258] The term “clinical factor” refers to a measure of a condition of a subject, e.g., disease activity or severity. “Clinical factor” encompasses all markers of a subject's health status, including non-sample markers, and/or other characteristics of a subject, such as, without limitation, age and gender. A clinical factor can be a score, a value, or a set of values that can be obtained from evaluation of a sample (or population of samples) from a subject or a subject under a determined condition. A clinical factor can also be predicted by markers and/or other parameters such as gene expression surrogates. Clinical factors can include tumor type, tumor sub-type, and smoking history.
[0259] The term “antigen-encoding nucleic acid sequences derived from a tumor” refers to nucleic acid sequences directly extracted from the tumor, e.g. via RT-PCR; or sequence data obtained by sequencing the tumor and then synthesizing the nucleic acid sequences using the sequencing data, e.g., via various synthetic or PCR-based methods known in the art.
[0260] The term “alphavirus” refers to members of the family Togaviridae, and are positive-sense single-stranded RNA viruses. Alphaviruses are typically classified as either Old World, such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses, or New World, such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis and its derivative strain TC-83. Alphaviruses are typically self-replicating RNA viruses.
[0261] The term “alphavirus backbone” refers to minimal sequence(s) of an alphavirus that allow for self-replication of the viral genome. Minimal sequences can include conserved sequences for nonstructural protein-mediated amplification, a nonstructural protein 1 (nsP1) gene, a nsP2 gene, a nsP3 gene, a nsP4 gene, and a polyA sequence, as well as sequences for expression of subgenomic viral RNA including a 26S promoter element.
[0262] The term “sequences for nonstructural protein-mediated amplification” includes alphavirus conserved sequence elements (CSE) well known to those in the art. CSEs include, but are not limited to, an alphavirus 5′ UTR, a 51-nt CSE, a 24-nt CSE, or other 26S subgenomic promoter sequence, a 19-nt CSE, and an alphavirus 3′ UTR.
[0263] The term “RNA polymerase” includes polymerases that catalyze the production of RNA polynucleotides from a DNA template. RNA polymerases include, but are not limited to, bacteriophage derived polymerases including T3, T7, and SP6.
[0264] The term “lipid” includes hydrophobic and/or amphiphilic molecules. Lipids can be cationic, anionic, or neutral. Lipids can be synthetic or naturally derived, and in some instances biodegradable. Lipids can include cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethylenegly col (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, fats, and fat-soluble vitamins. Lipids can also include dilinoleylmethyl-4-dimethylaminobutyrate (MC3) and MC3-like molecules.
[0265] The term “lipid nanoparticle” or “LNP” includes vesicle like structures formed using a lipid containing membrane surrounding an aqueous interior, also referred to as liposomes. Lipid nanoparticles includes lipid-based compositions with a solid lipid core stabilized by a surfactant. The core lipids can be fatty acids, acylglycerols, waxes, and mixtures of these surfactants. Biological membrane lipids such as phospholipids, sphingomyelins, bile salts (sodium taurocholate), and sterols (cholesterol) can be utilized as stabilizers. Lipid nanoparticles can be formed using defined ratios of different lipid molecules, including, but not limited to, defined ratios of one or more cationic, anionic, or neutral lipids. Lipid nanoparticles can encapsulate molecules within an outer-membrane shell and subsequently can be contacted with target cells to deliver the encapsulated molecules to the host cell cytosol. Lipid nanoparticles can be modified or functionalized with non-lipid molecules, including on their surface. Lipid nanoparticles can be single-layered (unilamellar) or multi-layered (multilamellar). Lipid nanoparticles can be complexed with nucleic acid. Unilamellar lipid nanoparticles can be complexed with nucleic acid, wherein the nucleic acid is in the aqueous interior. Multilamellar lipid nanoparticles can be complexed with nucleic acid, wherein the nucleic acid is in the aqueous interior, or to form or sandwiched between.
[0266] The term “pharmaceutically effective amount” is an amount of a vaccine component (such as a peptide, engineered vector, and/or adjuvant) that is effective in a route of administration to provide a cell with sufficient levels of protein, protein expression, and/or cell-signaling activity (e.g., adjuvant-mediated activation) to provide a vaccinal benefit, i.e., some measurable level of immunity.
[0267] Abbreviations: MHC: major histocompatibility complex; HLA: human leukocyte antigen, or the human MHC gene locus; NGS: next-generation sequencing; PPV: positive predictive value; TSNA: tumor-specific neoantigen; FFPE: formalin-fixed, paraffin-embedded; NMD: nonsense-mediated decay; NSCLC: non-small-cell lung cancer; DC: dendritic cell.
[0268] It should be noted that, as used in the specification and the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise.
[0269] Unless specifically stated or otherwise apparent from context, as used herein the term “about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
[0270] Any terms not directly defined herein shall be understood to have the meanings commonly associated with them as understood within the art of the invention. Certain terms are discussed herein to provide additional guidance to the practitioner in describing the compositions, devices, methods and the like of aspects of the invention, and how to make or use them. It will be appreciated that the same thing may be said in more than one way. Consequently, alternative language and synonyms may be used for any one or more of the terms discussed herein. No significance is to be placed upon whether or not a term is elaborated or discussed herein. Some synonyms or substitutable methods, materials and the like are provided. Recital of one or a few synonyms or equivalents does not exclude use of other synonyms or equivalents, unless it is explicitly stated. Use of examples, including examples of terms, is for illustrative purposes only and does not limit the scope and meaning of the aspects of the invention herein.
[0271] All references, issued patents and patent applications cited within the body of the specification are hereby incorporated by reference in their entirety, for all purposes.
II. Methods of Identifying Antigens
[0272] Methods for identifying shared antigens (e.g., neoantigens) include identifying antigens from a tumor of a subject that are likely to be presented on the cell surface of the tumor or immune cells, including professional antigen presenting cells such as dendritic cells, and/or are likely to be immunogenic. As an example, one such method may comprise the steps of: obtaining at least one of exome, transcriptome or whole genome tumor nucleotide sequencing and/or expression data from the tumor cell of the subject, wherein the tumor nucleotide sequencing and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens (e.g., in the case of neoantigens wherein the peptide sequence of each neoantigen comprises at least one alteration that makes it distinct from the corresponding wild-type peptide sequence or in cases of shared antigens without a mutation where peptides are derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue); inputting the peptide sequence of each antigen into one or more presentation models to generate a set of numerical likelihoods that each of the antigens is presented by one or more MHC alleles on the tumor cell surface of the tumor cell of the subject or cells present in the tumor, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and selecting a subset of the set of antigens based on the set of numerical likelihoods to generate a set of selected antigens.
[0273] The presentation model can comprise a statistical regression or a machine learning (e.g., deep learning) model trained on a set of reference data (also referred to as a training data set) comprising a set of corresponding labels, wherein the set of reference data is obtained from each of a plurality of distinct subjects where optionally some subjects can have a tumor, and wherein the set of reference data comprises at least one of: data representing exome nucleotide sequences from tumor tissue, data representing exome nucleotide sequences from normal tissue, data representing transcriptome nucleotide sequences from tumor tissue, data representing proteome sequences from tumor tissue, and data representing MHC peptidome sequences from tumor tissue, and data representing MHC peptidome sequences from normal tissue. The reference data can further comprise mass spectrometry data, sequencing data, RNA sequencing data, expression profiling data, and proteomics data for single-allele cell lines engineered to express a predetermined MHC allele that are subsequently exposed to synthetic protein, normal and tumor human cell lines, and fresh and frozen primary samples, and T cell assays (e.g., ELISpot). In certain aspects, the set of reference data includes each form of reference data.
[0274] The presentation model can comprise a set of features derived at least in part from the set of reference data, and wherein the set of features comprises at least one of allele dependent-features and allele-independent features. In certain aspects each feature is included.
[0275] Methods for identifying shared antigens also include generating an output for constructing a personalized cancer vaccine by identifying one or more antigens from one or more tumor cells of a subject that are likely to be presented on a surface of the tumor cells. As an example, one such method may comprise the steps of: obtaining at least one of exome, transcriptome, or whole genome nucleotide sequencing and/or expression data from the tumor cells and normal cells of the subject, wherein the nucleotide sequencing and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens identified by comparing the nucleotide sequencing and/or expression data from the tumor cells and the nucleotide sequencing and/or expression data from the normal cells (e.g., in the case of neoantigens wherein the peptide sequence of each neoantigen comprises at least one alteration that makes it distinct from the corresponding wild-type peptide sequence or in cases of shared antigens without a mutation where peptides are derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue), peptide sequence identified from the normal cells of the subject; encoding the peptide sequences of each of the antigens into a corresponding numerical vector, each numerical vector including information regarding a plurality of amino acids that make up the peptide sequence and a set of positions of the amino acids in the peptide sequence; inputting the numerical vectors, using a computer processor, into a deep learning presentation model to generate a set of presentation likelihoods for the set of antigens, each presentation likelihood in the set representing the likelihood that a corresponding antigen is presented by one or more class II MHC alleles on the surface of the tumor cells of the subject, the deep learning presentation model; selecting a subset of the set of antigens based on the set of presentation likelihoods to generate a set of selected antigens; and generating the output for constructing the personalized cancer vaccine based on the set of selected antigens.
[0276] Specific methods for identifying antigens, including neoantigens, are known to those skilled in the art, for example the methods described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
[0277] A method of treating a subject having a tumor is disclosed herein, comprising performing the steps of any of the antigen identification methods described herein, and further comprising obtaining a tumor vaccine comprising the set of selected antigens, and administering the tumor vaccine to the subject.
[0278] A method disclosed herein can also include identifying one or more T cells that are antigen-specific for at least one of the antigens in the subset. In some embodiments, the identification comprises co-culturing the one or more T cells with one or more of the antigens in the subset under conditions that expand the one or more antigen-specific T cells. In further embodiments, the identification comprises contacting the one or more T cells with a tetramer comprising one or more of the antigens in the subset under conditions that allow binding between the T cell and the tetramer. In even further embodiments, the method disclosed herein can also include identifying one or more T cell receptors (TCR) of the one or more identified T cells. In certain embodiments, identifying the one or more T cell receptors comprises sequencing the T cell receptor sequences of the one or more identified T cells. The method disclosed herein can further comprise genetically engineering a plurality of T cells to express at least one of the one or more identified T cell receptors; culturing the plurality of T cells under conditions that expand the plurality of T cells; and infusing the expanded T cells into the subject. In some embodiments, genetically engineering the plurality of T cells to express at least one of the one or more identified T cell receptors comprises cloning the T cell receptor sequences of the one or more identified T cells into an expression vector; and transfecting each of the plurality of T cells with the expression vector. In some embodiments, the method disclosed herein further comprises culturing the one or more identified T cells under conditions that expand the one or more identified T cells; and infusing the expanded T cells into the subject.
[0279] Also disclosed herein is an isolated T cell that is antigen-specific for at least one selected antigen in the subset.
[0280] Also disclosed herein is a methods for manufacturing a tumor vaccine, comprising the steps of: obtaining at least one of exome, transcriptome or whole genome tumor nucleotide sequencing and/or expression data from the tumor cell of the subject, wherein the tumor nucleotide sequencing and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens (e.g., in the case of neoantigens wherein the peptide sequence of each neoantigen comprises at least one alteration that makes it distinct from the corresponding wild-type peptide sequence or in cases of shared antigens without a mutation where peptides are derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue); inputting the peptide sequence of each antigen into one or more presentation models to generate a set of numerical likelihoods that each of the antigens is presented by one or more MHC alleles on the tumor cell surface of the tumor cell of the subject, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and selecting a subset of the set of antigens based on the set of numerical likelihoods to generate a set of selected antigens; and producing or having produced a tumor vaccine comprising the set of selected antigens.
[0281] Also disclosed herein is a tumor vaccine including a set of selected antigens selected by performing the method comprising the steps of: obtaining at least one of exome, transcriptome or whole genome tumor nucleotide sequencing and/or expression data from the tumor cell of the subject, wherein the tumor nucleotide sequencing and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens, and wherein the peptide sequence of each antigen (e.g., in the case of neoantigens wherein the peptide sequence of each neoantigen comprises at least one alteration that makes it distinct from the corresponding wild-type peptide sequence or in other cases of shared antigens without a mutation where peptides are derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue); inputting the peptide sequence of each antigen into one or more presentation models to generate a set of numerical likelihoods that each of the antigens is presented by one or more MHC alleles on the tumor cell surface of the tumor cell of the subject, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and selecting a subset of the set of antigens based on the set of numerical likelihoods to generate a set of selected antigens; and producing or having produced a tumor vaccine comprising the set of selected antigens.
[0282] The tumor vaccine may include one or more of a nucleotide sequence, a polypeptide sequence, RNA, DNA, a cell, a plasmid, or a vector.
[0283] The tumor vaccine may include one or more antigens presented on the tumor cell surface.
[0284] The tumor vaccine may include one or more antigens that is immunogenic in the subject.
[0285] The tumor vaccine may not include one or more antigens that induce an autoimmune response against normal tissue in the subject.
[0286] The tumor vaccine may include an adjuvant.
[0287] The tumor vaccine may include an excipient.
[0288] A method disclosed herein may also include selecting antigens that have an increased likelihood of being presented on the tumor cell surface relative to unselected antigens based on the presentation model.
[0289] A method disclosed herein may also include selecting antigens that have an increased likelihood of being capable of inducing a tumor-specific immune response in the subject relative to unselected antigens based on the presentation model.
[0290] A method disclosed herein may also include selecting antigens that have an increased likelihood of being capable of being presented to naïve T cells by professional antigen presenting cells (APCs) relative to unselected antigens based on the presentation model, optionally wherein the APC is a dendritic cell (DC).
[0291] A method disclosed herein may also include selecting antigens that have a decreased likelihood of being subject to inhibition via central or peripheral tolerance relative to unselected antigens based on the presentation model.
[0292] A method disclosed herein may also include selecting antigens that have a decreased likelihood of being capable of inducing an autoimmune response to normal tissue in the subject relative to unselected antigens based on the presentation model.
[0293] The exome or transcriptome nucleotide sequencing and/or expression data may be obtained by performing sequencing on the tumor tissue.
[0294] The sequencing may be next generation sequencing (NGS) or any massively parallel sequencing approach.
[0295] The set of numerical likelihoods may be further identified by at least MHC-allele interacting features comprising at least one of: the predicted affinity with which the MHC allele and the antigen encoded peptide bind; the predicted stability of the antigen encoded peptide-MHC complex; the sequence and length of the antigen encoded peptide; the probability of presentation of antigen encoded peptides with similar sequence in cells from other individuals expressing the particular MHC allele as assessed by mass-spectrometry proteomics or other means; the expression levels of the particular MHC allele in the subject in question (e.g. as measured by RNA-seq or mass spectrometry); the overall neoantigen encoded peptide-sequence-independent probability of presentation by the particular MHC allele in other distinct subjects who express the particular MHC allele; the overall neoantigen encoded peptide-sequence-independent probability of presentation by MHC alleles in the same family of molecules (e.g., HLA-A, HLA-B, HLA-C, HLA-DQ, HLA-DR, HLA-DP) in other distinct subjects.
[0296] The set of numerical likelihoods are further identified by at least MHC-allele noninteracting features comprising at least one of: the C- and N-terminal sequences flanking the neoantigen encoded peptide within its source protein sequence; the presence of protease cleavage motifs in the neoantigen encoded peptide, optionally weighted according to the expression of corresponding proteases in the tumor cells (as measured by RNA-seq or mass spectrometry); the turnover rate of the source protein as measured in the appropriate cell type; the length of the source protein, optionally considering the specific splice variants (“isoforms”) most highly expressed in the tumor cells as measured by RNA-seq or proteome mass spectrometry, or as predicted from the annotation of germline or somatic splicing mutations detected in DNA or RNA sequence data; the level of expression of the proteasome, immunoproteasome, thymoproteasome, or other proteases in the tumor cells (which may be measured by RNA-seq, proteome mass spectrometry, or immunohistochemistry); the expression of the source gene of the neoantigen encoded peptide (e.g., as measured by RNA-seq or mass spectrometry); the typical tissue-specific expression of the source gene of the neoantigen encoded peptide during various stages of the cell cycle; a comprehensive catalog of features of the source protein and/or its domains as can be found in e.g. uniProt or PDB http://www.rcsb.org/pdb/home/home.do; features describing the properties of the domain of the source protein containing the peptide, for example: secondary or tertiary structure (e.g., alpha helix vs beta sheet); alternative splicing; the probability of presentation of peptides from the source protein of the neoantigen encoded peptide in question in other distinct subjects; the probability that the peptide will not be detected or over-represented by mass spectrometry due to technical biases; the expression of various gene modules/pathways as measured by RNASeq (which need not contain the source protein of the peptide) that are informative about the state of the tumor cells, stroma, or tumor-infiltrating lymphocytes (TILs); the copy number of the source gene of the neoantigen encoded peptide in the tumor cells; the probability that the peptide binds to the TAP or the measured or predicted binding affinity of the peptide to the TAP; the expression level of TAP in the tumor cells (which may be measured by RNA-seq, proteome mass spectrometry, immunohistochemistry); presence or absence of tumor mutations, including, but not limited to: driver mutations in known cancer driver genes such as EGFR, KRAS, ALK, RET, ROS1, TP53, CDKN2A, CDKN2B, NTRK1, NTRK2, NTRK3, and in genes encoding the proteins involved in the antigen presentation machinery (e.g., B2M, HLA-A, HLA-B, HLA-C, TAP-1, TAP-2, TAPBP, CALR, CNX, ERP57, HLA-DM, HLA-DMA, HLA-DMB, HLA-DO, HLA-DOA, HLA-DOB, HLA-DP, HLA-DPA1, HLA-DPB1, HLA-DQ, HLA-DQA1, HLA-DQA2, HLA-DQB1, HLA-DQB2, HLA-DR, HLA-DRA, HLA-DRB1, HLA-DRB3, HLA-DRB4, HLA-DRB5 or any of the genes coding for components of the proteasome or immunoproteasome). Peptides whose presentation relies on a component of the antigen-presentation machinery that is subject to loss-of-function mutation in the tumor have reduced probability of presentation; presence or absence of functional germline polymorphisms, including, but not limited to: in genes encoding the proteins involved in the antigen presentation machinery (e.g., B2M, HLA-A, HLA-B, HLA-C, TAP-1, TAP-2, TAPBP, CALR, CNX, ERP57, HLA-DM, HLA-DMA, HLA-DMB, HLA-DO, HLA-DOA, HLA-DOB, HLA-DP, HLA-DPA1, HLA-DPB1, HLA-DQ, HLA-DQA1, HLA-DQA2, HLA-DQB1, HLA-DQB2, HLA-DR, HLA-DRA, HLA-DRB1, HLA-DRB3, HLA-DRB4, HLA-DRB5 or any of the genes coding for components of the proteasome or immunoproteasome); tumor type (e.g., NSCLC, melanoma); clinical tumor subtype (e.g., squamous lung cancer vs. non-squamous); smoking history; the typical expression of the source gene of the peptide in the relevant tumor type or clinical subtype, optionally stratified by driver mutation.
[0297] The at least one alteration may be a frameshift or nonframeshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF.
[0298] The tumor cell may be selected from the group consisting of: lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, and T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer.
[0299] A method disclosed herein may also include obtaining a tumor vaccine comprising the set of selected neoantigens or a subset thereof, optionally further comprising administering the tumor vaccine to the subject.
[0300] At least one of neoantigens in the set of selected neoantigens, when in polypeptide form, may include at least one of: a binding affinity with MHC with an IC50 value of less than 1000 nM, for MHC Class I polypeptides a length of 8-15, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, for MHC Class II polypeptides a length of 6-30, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids, presence of sequence motifs within or near the polypeptide in the parent protein sequence promoting proteasome cleavage, and presence of sequence motifs promoting TAP transport. For MHC Class II, presence of sequence motifs within or near the peptide promoting cleavage by extracellular or lysosomal proteases (e.g., cathepsins) or HLA-DM catalyzed HLA binding.
[0301] Disclosed herein is are methods for identifying one or more neoantigens that are likely to be presented on a tumor cell surface of a tumor cell, comprising executing the steps of: receiving mass spectrometry data comprising data associated with a plurality of isolated peptides eluted from major histocompatibility complex (MHC) derived from a plurality of fresh or frozen tumor samples; obtaining a training data set by at least identifying a set of training peptide sequences present in the tumor samples and presented on one or more MHC alleles associated with each training peptide sequence; obtaining a set of training protein sequences based on the training peptide sequences; and training a set of numerical parameters of a presentation model using the training protein sequences and the training peptide sequences, the presentation model providing a plurality of numerical likelihoods that peptide sequences from the tumor cell are presented by one or more MHC alleles on the tumor cell surface.
[0302] The presentation model may represent dependence between: presence of a pair of a particular one of the MHC alleles and a particular amino acid at a particular position of a peptide sequence; and likelihood of presentation on the tumor cell surface, by the particular one of the MHC alleles of the pair, of such a peptide sequence comprising the particular amino acid at the particular position.
[0303] A method disclosed herein can also include selecting a subset of neoantigens, wherein the subset of neoantigens is selected because each has an increased likelihood that it is presented on the cell surface of the tumor relative to one or more distinct tumor neoantigens.
[0304] A method disclosed herein can also include selecting a subset of neoantigens, wherein the subset of neoantigens is selected because each has an increased likelihood that it is capable of inducing a tumor-specific immune response in the subject relative to one or more distinct tumor neoantigens.
[0305] A method disclosed herein can also include selecting a subset of neoantigens, wherein the subset of neoantigens is selected because each has an increased likelihood that it is capable of being presented to naïve T cells by professional antigen presenting cells (APCs) relative to one or more distinct tumor neoantigens, optionally wherein the APC is a dendritic cell (DC).
[0306] A method disclosed herein can also include selecting a subset of neoantigens, wherein the subset of neoantigens is selected because each has a decreased likelihood that it is subject to inhibition via central or peripheral tolerance relative to one or more distinct tumor neoantigens.
[0307] A method disclosed herein can also include selecting a subset of neoantigens, wherein the subset of neoantigens is selected because each has a decreased likelihood that it is capable of inducing an autoimmune response to normal tissue in the subject relative to one or more distinct tumor neoantigens.
[0308] A method disclosed herein can also include selecting a subset of neoantigens, wherein the subset of neoantigens is selected because each has a decreased likelihood that it will be differentially post-translationally modified in tumor cells versus APCs, optionally wherein the APC is a dendritic cell (DC).
[0309] The practice of the methods herein will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3.sup.rd Ed. (Plenum Press) Vols A and B (1992).
III. Identification of Tumor Specific Mutations in Neoantigens
[0310] Also disclosed herein are methods for the identification of certain mutations (e.g., the variants or alleles that are present in cancer cells). In particular, these mutations can be present in the genome, transcriptome, proteome, or exome of cancer cells of a subject having cancer but not in normal tissue from the subject. Specific methods for identifying neoantigens, including shared neoantigens, that are specific to tumors are known to those skilled in the art, for example the methods described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
[0311] Genetic mutations in tumors can be considered useful for the immunological targeting of tumors if they lead to changes in the amino acid sequence of a protein exclusively in the tumor. Useful mutations include: (1) non-synonymous mutations leading to different amino acids in the protein; (2) read-through mutations in which a stop codon is modified or deleted, leading to translation of a longer protein with a novel tumor-specific sequence at the C-terminus; (3) splice site mutations that lead to the inclusion of an intron in the mature mRNA and thus a unique tumor-specific protein sequence; (4) chromosomal rearrangements that give rise to a chimeric protein with tumor-specific sequences at the junction of 2 proteins (i.e., gene fusion); (5) frameshift mutations or deletions that lead to a new open reading frame with a novel tumor-specific protein sequence. Mutations can also include one or more of nonframeshift indel, missense or nonsense substitution, splice site alteration, genomic rearrangement or gene fusion, or any genomic or expression alteration giving rise to a neoORF.
[0312] Peptides with mutations or mutated polypeptides arising from for example, splice-site, frameshift, readthrough, or gene fusion mutations in tumor cells can be identified by sequencing DNA, RNA or protein in tumor versus normal cells.
[0313] Also mutations can include previously identified tumor specific mutations. Known tumor mutations can be found at the Catalogue of Somatic Mutations in Cancer (COSMIC) database.
[0314] A variety of methods are available for detecting the presence of a particular mutation or allele in an individual's DNA or RNA. Advancements in this field have provided accurate, easy, and inexpensive large-scale SNP genotyping. For example, several techniques have been described including dynamic allele-specific hybridization (DASH), microplate array diagonal gel electrophoresis (MADGE), pyrosequencing, oligonucleotide-specific ligation, the TaqMan system as well as various DNA “chip” technologies such as the Affymetrix SNP chips. These methods utilize amplification of a target genetic region, typically by PCR. Still other methods, based on the generation of small signal molecules by invasive cleavage followed by mass spectrometry or immobilized padlock probes and rolling-circle amplification. Several of the methods known in the art for detecting specific mutations are summarized below.
[0315] PCR based detection means can include multiplex amplification of a plurality of markers simultaneously. For example, it is well known in the art to select PCR primers to generate PCR products that do not overlap in size and can be analyzed simultaneously. Alternatively, it is possible to amplify different markers with primers that are differentially labeled and thus can each be differentially detected. Of course, hybridization based detection means allow the differential detection of multiple PCR products in a sample. Other techniques are known in the art to allow multiplex analyses of a plurality of markers.
[0316] Several methods have been developed to facilitate analysis of single nucleotide polymorphisms in genomic DNA or cellular RNA. For example, a single base polymorphism can be detected by using a specialized exonuclease-resistant nucleotide, as disclosed, e.g., in Mundy, C. R. (U.S. Pat. No. 4,656,127). According to the method, a primer complementary to the allelic sequence immediately 3′ to the polymorphic site is permitted to hybridize to a target molecule obtained from a particular animal or human. If the polymorphic site on the target molecule contains a nucleotide that is complementary to the particular exonuclease-resistant nucleotide derivative present, then that derivative will be incorporated onto the end of the hybridized primer. Such incorporation renders the primer resistant to exonuclease, and thereby permits its detection. Since the identity of the exonuclease-resistant derivative of the sample is known, a finding that the primer has become resistant to exonucleases reveals that the nucleotide(s) present in the polymorphic site of the target molecule is complementary to that of the nucleotide derivative used in the reaction. This method has the advantage that it does not require the determination of large amounts of extraneous sequence data.
[0317] A solution-based method can be used for determining the identity of a nucleotide of a polymorphic site. Cohen, D. et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087). As in the Mundy method of U.S. Pat. No. 4,656,127, a primer is employed that is complementary to allelic sequences immediately 3′ to a polymorphic site. The method determines the identity of the nucleotide of that site using labeled dideoxynucleotide derivatives, which, if complementary to the nucleotide of the polymorphic site will become incorporated onto the terminus of the primer.
[0318] An alternative method, known as Genetic Bit Analysis or GBA is described by Goelet, P. et al. (PCT Appln. No. 92/15712). The method of Goelet, P. et al. uses mixtures of labeled terminators and a primer that is complementary to the sequence 3′ to a polymorphic site. The labeled terminator that is incorporated is thus determined by, and complementary to, the nucleotide present in the polymorphic site of the target molecule being evaluated. In contrast to the method of Cohen et al. (French Patent 2,650,840; PCT Appln. No. WO91/02087) the method of Goelet, P. et al. can be a heterogeneous phase assay, in which the primer or the target molecule is immobilized to a solid phase.
[0319] Several primer-guided nucleotide incorporation procedures for assaying polymorphic sites in DNA have been described (Komher, J. S. et al., Nucl. Acids. Res. 17:7779-7784 (1989); Sokolov, B. P., Nucl. Acids Res. 18:3671 (1990); Syvanen, A.-C., et al., Genomics 8:684-692 (1990); Kuppuswamy, M. N. et al., Proc. Natl. Acad. Sci. (U.S.A.) 88:1143-1147 (1991); Prezant, T. R. et al., Hum. Mutat. 1:159-164 (1992); Ugozzoli, L. et al., GATA 9:107-112 (1992); Nyren, P. et al., Anal. Biochem. 208:171-175 (1993)). These methods differ from GBA in that they utilize incorporation of labeled deoxynucleotides to discriminate between bases at a polymorphic site. In such a format, since the signal is proportional to the number of deoxynucleotides incorporated, polymorphisms that occur in runs of the same nucleotide can result in signals that are proportional to the length of the run (Syvanen, A.-C., et al., Amer. J. Hum. Genet. 52:46-59 (1993)).
[0320] A number of initiatives obtain sequence information directly from millions of individual molecules of DNA or RNA in parallel. Real-time single molecule sequencing-by-synthesis technologies rely on the detection of fluorescent nucleotides as they are incorporated into a nascent strand of DNA that is complementary to the template being sequenced. In one method, oligonucleotides 30-50 bases in length are covalently anchored at the 5′ end to glass cover slips. These anchored strands perform two functions. First, they act as capture sites for the target template strands if the templates are configured with capture tails complementary to the surface-bound oligonucleotides. They also act as primers for the template directed primer extension that forms the basis of the sequence reading. The capture primers function as a fixed position site for sequence determination using multiple cycles of synthesis, detection, and chemical cleavage of the dye-linker to remove the dye. Each cycle adds the polymerase/labeled nucleotide mixture, rinsing, imaging and cleavage of dye. In an alternative method, polymerase is modified with a fluorescent donor molecule and immobilized on a glass slide, while each nucleotide is color-coded with an acceptor fluorescent moiety attached to a gamma-phosphate. The system detects the interaction between a fluorescently-tagged polymerase and a fluorescently modified nucleotide as the nucleotide becomes incorporated into the de novo chain. Other sequencing-by-synthesis technologies also exist.
[0321] Any suitable sequencing-by-synthesis platform can be used to identify mutations. As described above, four major sequencing-by-synthesis platforms are currently available: the Genome Sequencers from Roche/454 Life Sciences, the 1 G Analyzer from Illumina/Solexa, the SOLiD system from Applied BioSystems, and the Heliscope system from Helicos Biosciences. Sequencing-by-synthesis platforms have also been described by Pacific BioSciences and VisiGen Biotechnologies. In some embodiments, a plurality of nucleic acid molecules being sequenced is bound to a support (e.g., solid support). To immobilize the nucleic acid on a support, a capture sequence/universal priming site can be added at the 3′ and/or 5′ end of the template. The nucleic acids can be bound to the support by hybridizing the capture sequence to a complementary sequence covalently attached to the support. The capture sequence (also referred to as a universal capture sequence) is a nucleic acid sequence complementary to a sequence attached to a support that may dually serve as a universal primer.
[0322] As an alternative to a capture sequence, a member of a coupling pair (such as, e.g., antibody/antigen, receptor/ligand, or the avidin-biotin pair as described in, e.g., US Patent Application No. 2006/0252077) can be linked to each fragment to be captured on a surface coated with a respective second member of that coupling pair.
[0323] Subsequent to the capture, the sequence can be analyzed, for example, by single molecule detection/sequencing, e.g., as described in the Examples and in U.S. Pat. No. 7,283,337, including template-dependent sequencing-by-synthesis. In sequencing-by-synthesis, the surface-bound molecule is exposed to a plurality of labeled nucleotide triphosphates in the presence of polymerase. The sequence of the template is determined by the order of labeled nucleotides incorporated into the 3′ end of the growing chain. This can be done in real time or can be done in a step-and-repeat mode. For real-time analysis, different optical labels to each nucleotide can be incorporated and multiple lasers can be utilized for stimulation of incorporated nucleotides.
[0324] Sequencing can also include other massively parallel sequencing or next generation sequencing (NGS) techniques and platforms. Additional examples of massively parallel sequencing techniques and platforms are the Illumina HiSeq or MiSeq, Thermo PGM or Proton, the Pac Bio RS II or Sequel, Qiagen's Gene Reader, and the Oxford Nanopore MinION. Additional similar current massively parallel sequencing technologies can be used, as well as future generations of these technologies.
[0325] Any cell type or tissue can be utilized to obtain nucleic acid samples for use in methods described herein. For example, a DNA or RNA sample can be obtained from a tumor or a bodily fluid, e.g., blood, obtained by known techniques (e.g. venipuncture) or saliva. Alternatively, nucleic acid tests can be performed on dry samples (e.g. hair or skin). In addition, a sample can be obtained for sequencing from a tumor and another sample can be obtained from normal tissue for sequencing where the normal tissue is of the same tissue type as the tumor. A sample can be obtained for sequencing from a tumor and another sample can be obtained from normal tissue for sequencing where the normal tissue is of a distinct tissue type relative to the tumor.
[0326] Tumors can include one or more of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, and T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer.
[0327] Alternatively, protein mass spectrometry can be used to identify or validate the presence of mutated peptides bound to MHC proteins on tumor cells. Peptides can be acid-eluted from tumor cells or from HLA molecules that are immunoprecipitated from tumor, and then identified using mass spectrometry.
IV. Antigens
[0328] Antigens can include nucleotides or polypeptides. For example, an antigen can be an RNA sequence that encodes for a polypeptide sequence. Antigens useful in vaccines can therefore include nucleotide sequences or polypeptide sequences. Shared neoantigens are shown in Table A (see SEQ ID NO:10,755-21,015) and in the AACR GENIE results (see SEQ ID NO: 21,016-29,357). Shared antigens are shown in Table 1.2 (see SEQ ID NO:57-10,754).
[0329] Disclosed herein are isolated peptides that comprise tumor specific mutations identified by the methods disclosed herein, peptides that comprise known tumor specific mutations, and mutant polypeptides or fragments thereof identified by methods disclosed herein. Neoantigen peptides can be described in the context of their coding sequence where a neoantigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.
[0330] Also disclosed herein are peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue, for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue. Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database. COSMIC curates comprehensive information on somatic mutations in human cancer. The peptide contains the tumor specific mutation.
[0331] One or more polypeptides encoded by an antigen nucleotide sequence can comprise at least one of: a binding affinity with MHC with an IC50 value of less than 1000 nM, for MHC Class I peptides a length of 8-15, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, presence of sequence motifs within or near the peptide promoting proteasome cleavage, and presence or sequence motifs promoting TAP transport. For MHC Class II peptides a length 6-30, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids, presence of sequence motifs within or near the peptide promoting cleavage by extracellular or lysosomal proteases (e.g., cathepsins) or HLA-DM catalyzed HLA binding.
[0332] One or more antigens can be presented on the surface of a tumor.
[0333] One or more antigens can be is immunogenic in a subject having a tumor, e.g., capable of eliciting a T cell response or a B cell response in the subject.
[0334] One or more antigens that induce an autoimmune response in a subject can be excluded from consideration in the context of vaccine generation for a subject having a tumor.
[0335] The size of at least one antigenic peptide molecule can comprise, but is not limited to, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 60, about 70, about 80, about 90, about 100, about 110, about 120 or greater amino molecule residues, and any range derivable therein. In specific embodiments the antigenic peptide molecules are equal to or less than 50 amino acids.
[0336] Antigenic peptides and polypeptides can be: for MHC Class 115 residues or less in length and usually consist of between about 8 and about 11 residues, particularly 9 or 10 residues; for MHC Class II, 6-30 residues, inclusive.
[0337] If desirable, a longer peptide can be designed in several ways. In one case, when presentation likelihoods of peptides on HLA alleles are predicted or known, a longer peptide could consist of either: (1) individual presented peptides with an extensions of 2-5 amino acids toward the N- and C-terminus of each corresponding gene product; (2) a concatenation of some or all of the presented peptides with extended sequences for each. In another case, when sequencing reveals a long (>10 residues) neoepitope sequence present in the tumor (e.g. due to a frameshift, read-through or intron inclusion that leads to a novel peptide sequence), a longer peptide would consist of: (3) the entire stretch of novel tumor-specific amino acids—thus bypassing the need for computational or in vitro test-based selection of the strongest HLA-presented shorter peptide. In both cases, use of a longer peptide allows endogenous processing by patient cells and may lead to more effective antigen presentation and induction of T cell responses.
[0338] Antigenic peptides and polypeptides can be presented on an HLA protein. In some aspects antigenic peptides and polypeptides are presented on an HLA protein with greater affinity than a wild-type peptide. In some aspects, an antigenic peptide or polypeptide can have an IC50 of at least less than 5000 nM, at least less than 1000 nM, at least less than 500 nM, at least less than 250 nM, at least less than 200 nM, at least less than 150 nM, at least less than 100 nM, at least less than 50 nM or less.
[0339] In some aspects, antigenic peptides and polypeptides do not induce an autoimmune response and/or invoke immunological tolerance when administered to a subject.
[0340] Also provided are compositions comprising at least two or more antigenic peptides. In some embodiments the composition contains at least two distinct peptides. At least two distinct peptides can be derived from the same polypeptide. By distinct polypeptides is meant that the peptide vary by length, amino acid sequence, or both. The peptides are derived from any polypeptide known to or have been found to contain a tumor specific mutation or peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue, for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue. Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database or the AACR Genomics Evidence Neoplasia Information Exchange (GENIE) database. COSMIC curates comprehensive information on somatic mutations in human cancer. AACR GENIE aggregates and links clinical-grade cancer genomic data with clinical outcomes from tens of thousands of cancer patients. The peptide contains the tumor specific mutation. In some aspects the tumor specific mutation is a driver mutation for a particular cancer type.
[0341] Antigenic peptides and polypeptides having a desired activity or property can be modified to provide certain desired attributes, e.g., improved pharmacological characteristics, while increasing or at least retaining substantially all of the biological activity of the unmodified peptide to bind the desired MHC molecule and activate the appropriate T cell. For instance, antigenic peptide and polypeptides can be subject to various changes, such as substitutions, either conservative or non-conservative, where such changes might provide for certain advantages in their use, such as improved MHC binding, stability or presentation. By conservative substitutions is meant replacing an amino acid residue with another which is biologically and/or chemically similar, e.g., one hydrophobic residue for another, or one polar residue for another. The substitutions include combinations such as Gly, Ala; Val, Ile, Leu, Met; Asp, Glu; Asn, Gln; Ser, Thr; Lys, Arg; and Phe, Tyr. The effect of single amino acid substitutions may also be probed using D-amino acids. Such modifications can be made using well known peptide synthesis procedures, as described in e.g., Merrifield, Science 232:341-347 (1986), Barany & Merrifield, The Peptides, Gross & Meienhofer, eds. (N.Y., Academic Press), pp. 1-284 (1979); and Stewart & Young, Solid Phase Peptide Synthesis, (Rockford, Ill., Pierce), 2d Ed. (1984).
[0342] Modifications of peptides and polypeptides with various amino acid mimetics or unnatural amino acids can be particularly useful in increasing the stability of the peptide and polypeptide in vivo. Stability can be assayed in a number of ways. For instance, peptidases and various biological media, such as human plasma and serum, have been used to test stability. See, e.g., Verhoef et al., Eur. J. Drug Metab Pharmacokin. 11:291-302 (1986). Half-life of the peptides can be conveniently determined using a 25% human serum (v/v) assay. The protocol is generally as follows. Pooled human serum (Type AB, non-heat inactivated) is delipidated by centrifugation before use. The serum is then diluted to 25% with RPMI tissue culture media and used to test peptide stability. At predetermined time intervals a small amount of reaction solution is removed and added to either 6% aqueous trichloracetic acid or ethanol. The cloudy reaction sample is cooled (4 degrees C.) for 15 minutes and then spun to pellet the precipitated serum proteins. The presence of the peptides is then determined by reversed-phase HPLC using stability-specific chromatography conditions.
[0343] The peptides and polypeptides can be modified to provide desired attributes other than improved serum half-life. For instance, the ability of the peptides to induce CTL activity can be enhanced by linkage to a sequence which contains at least one epitope that is capable of inducing a T helper cell response. Immunogenic peptides/T helper conjugates can be linked by a spacer molecule. The spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions. The spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids. It will be understood that the optionally present spacer need not be comprised of the same residues and thus can be a hetero- or homo-oligomer. When present, the spacer will usually be at least one or two residues, more usually three to six residues. Alternatively, the peptide can be linked to the T helper peptide without a spacer.
[0344] An antigenic peptide can be linked to the T helper peptide either directly or via a spacer either at the amino or carboxy terminus of the peptide. The amino terminus of either the antigenic peptide or the T helper peptide can be acylated. Exemplary T helper peptides include tetanus toxoid 830-843, influenza 307-319, malaria circumsporozoite 382-398 and 378-389.
[0345] Proteins or peptides can be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, or the chemical synthesis of proteins or peptides. The nucleotide and protein, polypeptide and peptide sequences corresponding to various genes have been previously disclosed, and can be found at computerized databases known to those of ordinary skill in the art. One such database is the National Center for Biotechnology Information's Genbank and GenPept databases located at the National Institutes of Health website. The coding regions for known genes can be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art. Alternatively, various commercial preparations of proteins, polypeptides and peptides are known to those of skill in the art.
[0346] In a further aspect an antigen includes a nucleic acid (e.g. polynucleotide) that encodes an antigenic peptide or portion thereof. The polynucleotide can be, e.g., DNA, cDNA, PNA, CNA, RNA (e.g., mRNA), either single- and/or double-stranded, or native or stabilized forms of polynucleotides, such as, e.g., polynucleotides with a phosphorothiate backbone, or combinations thereof and it may or may not contain introns. A still further aspect provides an expression vector capable of expressing a polypeptide or portion thereof. Expression vectors for different cell types are well known in the art and can be selected without undue experimentation. Generally, DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression. If necessary, DNA can be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host, although such controls are generally available in the expression vector. The vector is then introduced into the host through standard techniques. Guidance can be found e.g. in Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
V. Vaccine Compositions
[0347] Also disclosed herein is an immunogenic composition, e.g., a vaccine composition, capable of raising a specific immune response, e.g., a tumor-specific immune response. Vaccine compositions typically comprise one or a plurality of antigens, e.g., selected using a method described herein or as set forth in Table A, Table 1.2, or AACR GENIE Results. Vaccine compositions can also be referred to as vaccines.
[0348] A vaccine can contain between 1 and 30 peptides, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 different peptides, 6, 7, 8, 9, 10 11, 12, 13, or 14 different peptides, or 12, 13 or 14 different peptides. Peptides can include post-translational modifications. A vaccine can contain between 1 and 100 or more nucleotide sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more different nucleotide sequences, 6, 7, 8, 9, 10 11, 12, 13, or 14 different nucleotide sequences, or 12, 13 or 14 different nucleotide sequences. A vaccine can contain between 1 and 30 antigen sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more different antigen sequences, 6, 7, 8, 9, 10 11, 12, 13, or 14 different antigen sequences, or 12, 13 or 14 different antigen sequences.
[0349] A vaccine can contain at least two repeats of an epitope-encoding nucleic acid sequence. A used herein, a “repeat” refers to two or more iterations of an identical nucleic acid epitope-encoding nucleic acid sequence (inclusive of the optional 5′ linker sequence and/or the optional 3′ linker sequences described herein) within an antigen-encoding nucleic acid sequence. In one example, the antigen-encoding nucleic acid sequence portion of a cassette encodes at least two repeats of an epitope-encoding nucleic acid sequence. In further non-limiting examples, the antigen-encoding nucleic acid sequence portion of a cassette encodes more than one distinct epitope, and at least one of the distinct epitopes is encoded by at least two repeats of the nucleic acid sequence encoding the distinct epitope (i.e., at least two distinct epitope-encoding nucleic acid sequences). In illustrative non-limiting examples, an antigen-encoding nucleic acid sequence encodes epitopes A, B, and C encoded by epitope-encoding nucleic acid sequences epitope-encoding sequence A (E.sub.A), epitope-encoding sequence B (E.sub.B), and epitope-encoding sequence C (E.sub.C), and exemplary antigen-encoding nucleic acid sequences having repeats of at least one of the distinct epitopes are illustrated by, but is not limited to, the formulas below:
[0350] Repeat of one distinct epitope (repeat of epitope A):
[0351] E.sub.A-E.sub.B-E.sub.C-E.sub.A; or
[0352] E.sub.A-E.sub.A-E.sub.B-E.sub.C
[0353] Repeat of multiple distinct epitopes (repeats of epitopes A, B, and C):
[0354] E.sub.A-E.sub.B-E.sub.C-E.sub.A-E.sub.B-E.sub.C; or
[0355] E.sub.A-E.sub.A-E.sub.B-E.sub.B-E.sub.C-E.sub.C
[0356] Multiple repeats of multiple distinct epitopes (repeats of epitopes A, B, and C):
[0357] E.sub.A-E.sub.B-E.sub.C-E.sub.A-E.sub.B-E.sub.C-E.sub.A-E.sub.B-E.sub.C; or
[0358] E.sub.A-E.sub.A-E.sub.A-E.sub.B-E.sub.B-E.sub.B-E.sub.C-E.sub.C-E.sub.C
[0359] The above examples are not limiting and the antigen-encoding nucleic acid sequences having repeats of at least one of the distinct epitopes can encode each of the distinct epitopes in any order or frequency. For example, the order and frequency can be a random arrangement of the distinct epitopes, e.g., in an example with epitopes A, B, and C, by the formula E.sub.A-E.sub.B-E.sub.C-E.sub.C-E.sub.A-E.sub.B-E.sub.A-E.sub.C-E.sub.A-E.sub.C-E.sub.C-E.sub.B.
[0360] Also provided for herein is an antigen-encoding cassette, the antigen-encoding cassette having at least one antigen-encoding nucleic acid sequence described, from 5′ to 3′, by the formula:
(E.sub.x-(E.sup.N.sub.n).sub.y).sub.z
where E represents a nucleotide sequence comprising at least one of the at least one distinct epitope-encoding nucleic acid sequences,
n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0,
E.sup.N represents a nucleotide sequence comprising the separate distinct epitope-encoding nucleic acid sequence for each corresponding n,
for each iteration of z: x=0 or 1, y=0 or 1 for each n, and at least one of x or y=1, and z=2 or greater, wherein the antigen-encoding nucleic acid sequence comprises at least two iterations of E, a given E.sup.N, or a combination thereof.
[0361] Each E or E.sup.N can independently comprise any epitope-encoding nucleic acid sequence described herein. For example, Each E or E.sup.N can independently comprises a nucleotide sequence described, from 5′ to 3′, by the formula (L5.sub.b-N.sub.c-L3.sub.d), where N comprises the distinct epitope-encoding nucleic acid sequence associated with each E or E.sup.N, where c=1, L5 comprises a 5′ linker sequence, where b=0 or 1, and L3 comprises a 3′ linker sequence, where d=0 or 1. Epitopes and linkers that can be used are further described herein, e.g., see V.A. Antigen Cassette.
[0362] Repeats of an epitope-encoding nucleic acid sequences (inclusive of optional 5′ linker sequence and/or the optional 3′ linker sequences) can be linearly linked directly to one another (e.g., E.sub.A-E.sub.A- . . . as illustrated above). Repeats of an epitope-encoding nucleic acid sequences can be separated by one or more additional nucleotides sequences. In general, repeats of an epitope-encoding nucleic acid sequences can be separated by any size nucleotide sequence applicable for the compositions described herein. In one example, repeats of an epitope-encoding nucleic acid sequences can be separated by a separate distinct epitope-encoding nucleic acid sequence (e.g., E.sub.A-E.sub.B-E.sub.C-E.sub.A . . . , as illustrated above). In examples where repeats are separated by a single separate distinct epitope-encoding nucleic acid sequence, and each epitope-encoding nucleic acid sequences (inclusive of optional 5′ linker sequence and/or the optional 3′ linker sequences) encodes a peptide 25 amino acids in length, the repeats can be separated by 75 nucleotides, such as in antigen-encoding nucleic acid represented by E.sub.A-E.sub.B-E.sub.A . . . , E.sub.A is separated by 75 nucleotides. In an illustrative example, an antigen-encoding nucleic acid having the sequence VTNTEMFVTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDTVTNTEM FVTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDT encoding repeats of 25mer antigens Trp1 (VTNTEMFVTAPDNLGYMYEVQWPGQ) and Trp2 (TQPQIANCSVYDFFVWLHYYSVRDT), the repeats of Trp1 are separated by the 25mer Trp2 and thus the repeats of the Trp1 epitope-encoding nucleic acid sequences are separated the 75 nucleotide Trp2 epitope-encoding nucleic acid sequence. In examples where repeats are separated by 2, 3, 4, 5, 6, 7, 8, or 9 separate distinct epitope-encoding nucleic acid sequence, and each epitope-encoding nucleic acid sequences (inclusive of optional 5′ linker sequence and/or the optional 3′ linker sequences) encodes a peptide 25 amino acids in length, the repeats can be separated by 150, 225, 300, 375, 450, 525, 600, or 675 nucleotides, respectively.
[0363] In some instances, an antigen or epitope in a cassette encoding additional antigens and/or epitopes may be an immunodominant epitope relative to the others encoded. Immunodominance, in general, is the skewing of an immune response towards only one or a few specific immunogenic peptides. Immunodominance can be assessed as part of an immune monitoring protocol. For example, immunodominance can be assessed through evaluating T cell and/or B cell responses to the encoded antigens.
[0364] In some instances, it may be desired to avoid vaccine compositions containing immunodominant epitope. For example, it may be desired to avoid designing a vaccine cassette encoding an immunodominant epitope. Without wishing to be bound by theory, administering and/or encoding an immunodominant epitope together with additional epitope may reduce the immune response to the additional epitopes, including potentially ultimately reducing vaccine efficacy against the additional epitopes. As an illustrative non-limiting example, vaccine compositions including TP53-associated neoepitopes may have the immune response, e.g., a T cell response, skewed towards the TP53-associated neoepitope negatively impacting the immune response to other antigens or epitopes in the vaccine composition (e.g., one or more KRAS-associated neoepitopes in a vaccine composition.)
[0365] In one embodiment, different peptides and/or polypeptides or nucleotide sequences encoding them are selected so that the peptides and/or polypeptides capable of associating with different MHC molecules, such as different MHC class I molecules and/or different MHC class II molecules. In some aspects, one vaccine composition comprises coding sequence for peptides and/or polypeptides capable of associating with the most frequently occurring MHC class I molecules and/or different MHC class II molecules. Hence, vaccine compositions can comprise different fragments capable of associating with at least 2 preferred, at least 3 preferred, or at least 4 preferred MHC class I molecules and/or different MHC class II molecules.
[0366] The vaccine composition can be capable of raising a specific cytotoxic T-cells response and/or a specific helper T-cell response.
[0367] A vaccine composition can further comprise an adjuvant and/or a carrier. Examples of useful adjuvants and carriers are given herein below. A composition can be associated with a carrier such as e.g. a protein or an antigen-presenting cell such as e.g. a dendritic cell (DC) capable of presenting the peptide to a T-cell.
[0368] Adjuvants are any substance whose admixture into a vaccine composition increases or otherwise modifies the immune response to an antigen. Carriers can be scaffold structures, for example a polypeptide or a polysaccharide, to which an antigen, is capable of being associated. Optionally, adjuvants are conjugated covalently or non-covalently.
[0369] The ability of an adjuvant to increase an immune response to an antigen is typically manifested by a significant or substantial increase in an immune-mediated reaction, or reduction in disease symptoms. For example, an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen, and an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion. An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th response into a primarily cellular, or Th response.
[0370] Suitable adjuvants include, but are not limited to 1018 ISS, alum, aluminium salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, JuvImmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTel vector system, PLG microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Aquila's QS21 stimulon (Aquila Biotech, Worcester, Mass., USA) which is derived from saponin, mycobacterial extracts and synthetic bacterial cell wall mimics, and other proprietary adjuvants such as Ribi's Detox. Quil or Superfos. Adjuvants such as incomplete Freund's or GM-CSF are useful. Several immunological adjuvants (e.g., MF59) specific for dendritic cells and their preparation have been described previously (Dupuis M, et al., Cell Immunol. 1998; 186(1):18-27; Allison A C; Dev Biol Stand. 1998; 92:3-11). Also cytokines can be used. Several cytokines have been directly linked to influencing dendritic cell migration to lymphoid tissues (e.g., TNF-alpha), accelerating the maturation of dendritic cells into efficient antigen-presenting cells for T-lymphocytes (e.g., GM-CSF, IL-1 and IL-4) (U.S. Pat. No. 5,849,589, specifically incorporated herein by reference in its entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).
[0371] CpG immunostimulatory oligonucleotides have also been reported to enhance the effects of adjuvants in a vaccine setting. Other TLR binding molecules such as RNA binding TLR 7, TLR 8 and/or TLR 9 may also be used.
[0372] Other examples of useful adjuvants include, but are not limited to, chemically modified CpGs (e.g. CpR, Idera), Poly(I:C)(e.g. polyi:CI2U), non-CpG bacterial DNA or RNA as well as immunoactive small molecules and antibodies such as cyclophosphamide, sunitinib, bevacizumab, celebrex, NCX-4016, sildenafil, tadalafil, vardenafil, sorafinib, XL-999, CP-547632, pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175, which may act therapeutically and/or as an adjuvant. The amounts and concentrations of adjuvants and additives can readily be determined by the skilled artisan without undue experimentation. Additional adjuvants include colony-stimulating factors, such as Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, sargramostim).
[0373] A vaccine composition can comprise more than one different adjuvant. Furthermore, a therapeutic composition can comprise any adjuvant substance including any of the above or combinations thereof. It is also contemplated that a vaccine and an adjuvant can be administered together or separately in any appropriate sequence.
[0374] A carrier (or excipient) can be present independently of an adjuvant. The function of a carrier can for example be to increase the molecular weight of in particular mutant to increase activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half-life. Furthermore, a carrier can aid presenting peptides to T-cells. A carrier can be any suitable carrier known to the person skilled in the art, for example a protein or an antigen presenting cell. A carrier protein could be but is not limited to keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid. For immunization of humans, the carrier is generally a physiologically acceptable carrier acceptable to humans and safe. However, tetanus toxoid and/or diptheria toxoid are suitable carriers. Alternatively, the carrier can be dextrans for example sepharose.
[0375] Cytotoxic T-cells (CTLs) recognize an antigen in the form of a peptide bound to an MHC molecule rather than the intact foreign antigen itself. The MHC molecule itself is located at the cell surface of an antigen presenting cell. Thus, an activation of CTLs is possible if a trimeric complex of peptide antigen, MHC molecule, and APC is present. Correspondingly, it may enhance the immune response if not only the peptide is used for activation of CTLs, but if additionally APCs with the respective MHC molecule are added. Therefore, in some embodiments a vaccine composition additionally contains at least one antigen presenting cell.
[0376] Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616-629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev. (2011) 239(1): 45-61, Sakuma et al., Lentiviral vectors: basic to translational, Biochem J. (2012) 443(3):603-18, Cooper et al., Rescue of splicing-mediated intron loss maximizes expression in lentiviral vectors containing the human ubiquitin C promoter, Nucl. Acids Res. (2015) 43 (1): 682-690, Zufferey et al., Self-Inactivating Lentivirus Vector for Safe and Efficient In Vivo Gene Delivery, J. Virol. (1998) 72 (12): 9873-9880). Dependent on the packaging capacity of the above mentioned viral vector-based vaccine platforms, this approach can deliver one or more nucleotide sequences that encode one or more neoantigen peptides. The sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science. (2016) 352 (6291):1337-41, Lu et al., Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions, Clin Cancer Res. (2014) 20(13):3401-10). Upon introduction into a host, infected cells express the antigens, and thereby elicit a host immune (e.g., CTL) response against the peptide(s). Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)). A wide variety of other vaccine vectors useful for therapeutic administration or immunization of antigens, e.g., Salmonella typhi vectors, and the like will be apparent to those skilled in the art from the description herein.
V.A. Antigen Cassette
[0377] The methods employed for the selection of one or more antigens, the cloning and construction of a “cassette” and its insertion into a viral vector are within the skill in the art given the teachings provided herein. By “antigen cassette” is meant the combination of a selected antigen or plurality of antigens and the other regulatory elements necessary to transcribe the antigen(s) and express the transcribed product. An antigen or plurality of antigens can be operatively linked to regulatory components in a manner which permits transcription. Such components include conventional regulatory elements that can drive expression of the antigen(s) in a cell transfected with the viral vector. Thus the antigen cassette can also contain a selected promoter which is linked to the antigen(s) and located, with other, optional regulatory elements, within the selected viral sequences of the recombinant vector. Cassettes can include one or more neoantigens shown in Table A and/or AACR GENIE Results, and/or one or more antigens shown in Table 1.2.
[0378] Useful promoters can be constitutive promoters or regulated (inducible) promoters, which will enable control of the amount of antigen(s) to be expressed. For example, a desirable promoter is that of the cytomegalovirus immediate early promoter/enhancer [see, e.g., Boshart et al, Cell, 41:521-530 (1985)]. Another desirable promoter includes the Rous sarcoma virus LTR promoter/enhancer. Still another promoter/enhancer sequence is the chicken cytoplasmic beta-actin promoter [T. A. Kost et al, Nucl. Acids Res., 11(23):8287 (1983)]. Other suitable or desirable promoters can be selected by one of skill in the art.
[0379] The antigen cassette can also include nucleic acid sequences heterologous to the viral vector sequences including sequences providing signals for efficient polyadenylation of the transcript (poly(A), poly-A or pA) and introns with functional splice donor and acceptor sites. A common poly-A sequence which is employed in the exemplary vectors of this invention is that derived from the papovavirus SV-40. The poly-A sequence generally can be inserted in the cassette following the antigen-based sequences and before the viral vector sequences. A common intron sequence can also be derived from SV-40, and is referred to as the SV-40 T intron sequence. An antigen cassette can also contain such an intron, located between the promoter/enhancer sequence and the antigen(s). Selection of these and other common vector elements are conventional [see, e.g., Sambrook et al, “Molecular Cloning. A Laboratory Manual.”, 2d edit., Cold Spring Harbor Laboratory, New York (1989) and references cited therein] and many such sequences are available from commercial and industrial sources as well as from Genbank.
[0380] An antigen cassette can have one or more antigens. For example, a given cassette can include 1-10, 1-20, 1-30, 10-20, 15-25, 15-20, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more antigens. Antigens can be linked directly to one another. Antigens can also be linked to one another with linkers. Antigens can be in any orientation relative to one another including N to C or C to N.
[0381] As above stated, the antigen cassette can be located in the site of any selected deletion in the viral vector, such as the site of the E1 gene region deletion or E3 gene region deletion, among others which may be selected.
[0382] The antigen cassette can be described using the following formula to describe the ordered sequence of each element, from 5′ to 3′:
(P.sub.a-(L5.sub.b-N.sub.c-L3.sub.d).sub.X).sub.Z-(P2.sub.h-(G5.sub.e-U.sub.f).sub.Y).sub.W-G3.sub.g
[0383] wherein P and P2 comprise promoter nucleotide sequences, N comprises an MHC class I epitope encoding nucleic acid sequence, L5 comprises a 5′ linker sequence, L3 comprises a 3′ linker sequence, G5 comprises a nucleic acid sequences encoding an amino acid linker, G3 comprises one of the at least one nucleic acid sequences encoding an amino acid linker, U comprises an MHC class II antigen-encoding nucleic acid sequence, where for each X the corresponding N.sub.c is a epitope encoding nucleic acid sequence, where for each Y the corresponding U.sub.f is an antigen-encoding nucleic acid sequence. The composition and ordered sequence can be further defined by selecting the number of elements present, for example where a=0 or 1, where b=0 or 1, where c=1, where d=0 or 1, where e=0 or 1, where f=1, where g=0 or 1, where h=0 or 1, X=1 to 400, Y=0, 1, 2, 3, 4 or 5, Z=1 to 400, and W=0, 1, 2, 3, 4 or 5.
[0384] In one example, elements present include where a=0, b=1, d=1, e=1, g=1, h=0, X=10, Y=2, Z=1, and W=1, describing where no additional promoter is present (i.e. only the promoter nucleotide sequence provided by the RNA alphavirus backbone is present), 20 MHC class I epitope are present, a 5′ linker is present for each N, a 3′ linker is present for each N, 2 MHC class II epitopes are present, a linker is present linking the two MHC class II epitopes, a linker is present linking the 5′ end of the two MHC class II epitopes to the 3′ linker of the final MHC class I epitope, and a linker is present linking the 3′ end of the two MHC class II epitopes to the to the RNA alphavirus backbone. Examples of linking the 3′ end of the antigen cassette to the RNA alphavirus backbone include linking directly to the 3′ UTR elements provided by the RNA alphavirus backbone, such as a 3′ 19-nt CSE. Examples of linking the 5′ end of the antigen cassette to the RNA alphavirus backbone include linking directly to a 26S promoter sequence, an alphavirus 5′ UTR, a 51-nt CSE, or a 24-nt CSE.
[0385] Other examples include: where a=1 describing where a promoter other than the promoter nucleotide sequence provided by the RNA alphavirus backbone is present; where a=1 and Z is greater than 1 where multiple promoters other than the promoter nucleotide sequence provided by the RNA alphavirus backbone are present each driving expression of 1 or more distinct MHC class I epitope encoding nucleic acid sequences; where h=1 describing where a separate promoter is present to drive expression of the MHC class II antigen-encoding nucleic acid sequences; and where g=0 describing the MHC class II antigen-encoding nucleic acid sequence, if present, is directly linked to the RNA alphavirus backbone.
[0386] Other examples include where each MHC class I epitope that is present can have a 5′ linker, a 3′ linker, neither, or both. In examples where more than one MHC class I epitope is present in the same antigen cassette, some MHC class I epitopes may have both a 5′ linker and a 3′ linker, while other MHC class I epitopes may have either a 5′ linker, a 3′ linker, or neither. In other examples where more than one MHC class I epitope is present in the same antigen cassette, some MHC class I epitopes may have either a 5′ linker or a 3′ linker, while other MHC class I epitopes may have either a 5′ linker, a 3′ linker, or neither.
[0387] In examples where more than one MHC class II epitope is present in the same antigen cassette, some MHC class II epitopes may have both a 5′ linker and a 3′ linker, while other MHC class II epitopes may have either a 5′ linker, a 3′ linker, or neither. In other examples where more than one MHC class II epitope is present in the same antigen cassette, some MHC class II epitopes may have either a 5′ linker or a 3′ linker, while other MHC class II epitopes may have either a 5′ linker, a 3′ linker, or neither.
[0388] The promoter nucleotide sequences P and/or P2 can be the same as a promoter nucleotide sequence provided by the RNA alphavirus backbone. For example, the promoter sequence provided by the RNA alphavirus backbone, Pn and P2, can each comprise a 26S subgenomic promoter. The promoter nucleotide sequences P and/or P2 can be different from the promoter nucleotide sequence provided by the RNA alphavirus backbone, as well as can be different from each other.
[0389] The 5′ linker L5 can be a native sequence or a non-natural sequence. Non-natural sequence include, but are not limited to, AAY, RR, and DPP. The 3′ linker L3 can also be a native sequence or a non-natural sequence. Additionally, L5 and L3 can both be native sequences, both be non-natural sequences, or one can be native and the other non-natural. For each X, the amino acid linkers can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more amino acids in length. For each X, the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
[0390] The amino acid linker G5, for each Y, can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more amino acids in length. For each Y, the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
[0391] The amino acid linker G3 can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100 or more amino acids in length. G3 can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
[0392] For each X, each N can encodes a MHC class I epitope 7-15 amino acids in length. For each X, each N can also encodes a MHC class I epitope 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids in length. For each X, each N can also encodes a MHC class I epitope at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
V.B. Immune Checkpoints
[0393] Vectors described herein, such as C68 vectors described herein or alphavirus vectors described herein, can comprise a nucleic acid which encodes at least one antigen and the same or a separate vector can comprise a nucleic acid which encodes at least one immune modulator (e.g., an antibody such as an scFv) which binds to and blocks the activity of an immune checkpoint molecule. Vectors can comprise an antigen cassette and one or more nucleic acid molecules encoding a checkpoint inhibitor.
[0394] Illustrative immune checkpoint molecules that can be targeted for blocking or inhibition include, but are not limited to, CTLA-4, 4-1BB (CD137), 4-1BBL (CD137L), PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, γδ, and memory CD8+(αβ) T cells), CD160 (also referred to as BY55), and CGEN-15049. Immune checkpoint inhibitors include antibodies, or antigen binding fragments thereof, or other binding proteins, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4, CD160, and CGEN-15049. Illustrative immune checkpoint inhibitors include Tremelimumab (CTLA-4 blocking antibody), anti-OX40, PD-L1 monoclonal Antibody (Anti-B7-H1; MED14736), ipilimumab, MK-3475 (PD-1 blocker), Nivolumab (anti-PD1 antibody), CT-011 (anti-PD1 antibody), BY55 monoclonal antibody, AMP224 (anti-PDL1 antibody), BMS-936559 (anti-PDL1 antibody), MPLDL3280A (anti-PDL1 antibody), MSB0010718C (anti-PDL1 antibody) and Yervoy/ipilimumab (anti-CTLA-4 checkpoint inhibitor). Antibody-encoding sequences can be engineered into vectors such as C68 using ordinary skill in the art. An exemplary method is described in Fang et al., Stable antibody expression at therapeutic levels using the 2A peptide. Nat Biotechnol. 2005 May; 23(5):584-90. Epub 2005 Apr. 17; herein incorporated by reference for all purposes.
V.C. Additional Considerations for Vaccine Design and Manufacture
V.C.1. Determination of a Set of Peptides that Cover all Tumor Subclones
[0395] Truncal peptides, meaning those presented by all or most tumor subclones, can be prioritized for inclusion into the vaccine..sup.53 Optionally, if there are no truncal peptides predicted to be presented and immunogenic with high probability, or if the number of truncal peptides predicted to be presented and immunogenic with high probability is small enough that additional non-truncal peptides can be included in the vaccine, then further peptides can be prioritized by estimating the number and identity of tumor subclones and choosing peptides so as to maximize the number of tumor subclones covered by the vaccine..sup.54
V.C.2. Antigen Prioritization
[0396] After all of the above antigen filters are applied, more candidate antigens may still be available for vaccine inclusion than the vaccine technology can support. Additionally, uncertainty about various aspects of the antigen analysis may remain and tradeoffs may exist between different properties of candidate vaccine antigens. Thus, in place of predetermined filters at each step of the selection process, an integrated multi-dimensional model can be considered that places candidate antigens in a space with at least the following axes and optimizes selection using an integrative approach. [0397] 1. Risk of auto-immunity or tolerance (risk of germline) (lower risk of auto-immunity is typically preferred) [0398] 2. Probability of sequencing artifact (lower probability of artifact is typically preferred) [0399] 3. Probability of immunogenicity (higher probability of immunogenicity is typically preferred) [0400] 4. Probability of presentation (higher probability of presentation is typically preferred) [0401] 5. Gene expression (higher expression is typically preferred) [0402] 6. Coverage of HLA genes (larger number of HLA molecules involved in the presentation of a set of antigens may lower the probability that a tumor will escape immune attack via downregulation or mutation of HLA molecules) [0403] 7. Coverage of HLA classes (covering both HLA-I and HLA-II may increase the probability of therapeutic response and decrease the probability of tumor escape)
[0404] Additionally, optionally, antigens can be deprioritized (e.g., excluded) from the vaccination if they are predicted to be presented by HLA alleles lost or inactivated in either all or part of the patient's tumor. HLA allele loss can occur by either somatic mutation, loss of heterozygosity, or homozygous deletion of the locus. Methods for detection of HLA allele somatic mutation are well known in the art, e.g. (Shukla et al., 2015). Methods for detection of somatic LOH and homozygous deletion (including for HLA locus) are likewise well described. (Carter et al., 2012; McGranahan et al., 2017; Van Loo et al., 2010). Antigens can also be deprioritized if mass-spectrometry data indicates a predicted antigen is not presented by a predicted HLA allele.
V.D. Alphavirus
V.D.1. Alphavirus Biology
[0405] Alphaviruses are members of the family Togaviridae, and are positive-sense single stranded RNA viruses. Members are typically classified as either Old World, such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses, or New World, such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis virus and its derivative strain TC-83 (Strauss Microbrial Review 1994). A natural alphavirus genome is typically around 12 kb in length, the first two-thirds of which contain genes encoding non-structural proteins (nsPs) that form RNA replication complexes for self-replication of the viral genome, and the last third of which contains a subgenomic expression cassette encoding structural proteins for virion production (Frolov RNA 2001).
[0406] A model lifecycle of an alphavirus involves several distinct steps (Strauss Microbrial Review 1994, Jose Future Microbiol 2009). Following virus attachment to a host cell, the virion fuses with membranes within endocytic compartments resulting in the eventual release of genomic RNA into the cytosol. The genomic RNA, which is in a plus-strand orientation and comprises a 5′ methylguanylate cap and 3′ polyA tail, is translated to produce non-structural proteins nsP1-4 that form the replication complex. Early in infection, the plus-strand is then replicated by the complex into a minus-stand template. In the current model, the replication complex is further processed as infection progresses, with the resulting processed complex switching to transcription of the minus-strand into both full-length positive-strand genomic RNA, as well as the 26S subgenomic positive-strand RNA containing the structural genes. Several conserved sequence elements (CSEs) of alphavirus have been identified to potentially play a role in the various RNA replication steps including; a complement of the 5′ UTR in the replication of plus-strand RNAs from a minus-strand template, a 51-nt CSE in the replication of minus-strand synthesis from the genomic template, a 24-nt CSE in the junction region between the nsPs and the 26S RNA in the transcription of the subgenomic RNA from the minus-strand, and a 3′ 19-nt CSE in minus-strand synthesis from the plus-strand template.
[0407] Following the replication of the various RNA species, virus particles are then typically assembled in the natural lifecycle of the virus. The 26S RNA is translated and the resulting proteins further processed to produce the structural proteins including capsid protein, glycoproteins E1 and E2, and two small polypeptides E3 and 6K (Strauss 1994). Encapsidation of viral RNA occurs, with capsid proteins normally specific for only genomic RNA being packaged, followed by virion assembly and budding at the membrane surface.
V.D.2. Alphavirus as a Delivery Vector
[0408] Alphaviruses (including alphavirus sequences, features, and other elements) can be used to generate alphavirus-based delivery vectors (also be referred to as alphavirus vectors, alphavirus viral vectors, alphavirus vaccine vectors, self-replicating RNA (srRNA) vectors, or self-amplifying RNA (samRNA) vectors). Alphaviruses have previously been engineered for use as expression vector systems (Pushko 1997, Rheme 2004). Alphaviruses offer several advantages, particularly in a vaccine setting where heterologous antigen expression can be desired. Due to its ability to self-replicate in the host cytosol, alphavirus vectors are generally able to produce high copy numbers of the expression cassette within a cell resulting in a high level of heterologous antigen production. Additionally, the vectors are generally transient, resulting in improved biosafety as well as reduced induction of immunological tolerance to the vector. The public, in general, also lacks pre-existing immunity to alphavirus vectors as compared to other standard viral vectors, such as human adenovirus. Alphavirus based vectors also generally result in cytotoxic responses to infected cells. Cytotoxicity, to a certain degree, can be important in a vaccine setting to properly illicit an immune response to the heterologous antigen expressed. However, the degree of desired cytotoxicity can be a balancing act, and thus several attenuated alphaviruses have been developed, including the TC-83 strain of VEE. Thus, an example of an antigen expression vector described herein can utilize an alphavirus backbone that allows for a high level of antigen expression, elicits a robust immune response to antigen, does not elicit an immune response to the vector itself, and can be used in a safe manner. Furthermore, the antigen expression cassette can be designed to elicit different levels of an immune response through optimization of which alphavirus sequences the vector uses, including, but not limited to, sequences derived from VEE or its attenuated derivative TC-83.
[0409] Several expression vector design strategies have been engineered using alphavirus sequences (Pushko 1997). In one strategy, a alphavirus vector design includes inserting a second copy of the 26S promoter sequence elements downstream of the structural protein genes, followed by a heterologous gene (Frolov 1993). Thus, in addition to the natural non-structural and structural proteins, an additional subgenomic RNA is produced that expresses the heterologous protein. In this system, all the elements for production of infectious virions are present and, therefore, repeated rounds of infection of the expression vector in non-infected cells can occur.
[0410] Another expression vector design makes use of helper virus systems (Pushko 1997). In this strategy, the structural proteins are replaced by a heterologous gene. Thus, following self-replication of viral RNA mediated by still intact non-structural genes, the 26S subgenomic RNA provides for expression of the heterologous protein. Traditionally, additional vectors that expresses the structural proteins are then supplied in trans, such as by co-transfection of a cell line, to produce infectious virus. A system is described in detail in U.S. Pat. No. 8,093,021, which is herein incorporated by reference in its entirety, for all purposes. The helper vector system provides the benefit of limiting the possibility of forming infectious particles and, therefore, improves biosafety. In addition, the helper vector system reduces the total vector length, potentially improving the replication and expression efficiency. Thus, an example of an antigen expression vector described herein can utilize an alphavirus backbone wherein the structural proteins are replaced by an antigen cassette, the resulting vector both reducing biosafety concerns, while at the same time promoting efficient expression due to the reduction in overall expression vector size.
V.D.3. Alphavirus Production In Vitro
[0411] Alphavirus delivery vectors are generally positive-sense RNA polynucleotides. A convenient technique well-known in the art for RNA production is in vitro transcription IVT. In this technique, a DNA template of the desired vector is first produced by techniques well-known to those in the art, including standard molecular biology techniques such as cloning, restriction digestion, ligation, gene synthesis, and polymerase chain reaction (PCR). The DNA template contains a RNA polymerase promoter at the 5′ end of the sequence desired to be transcribed into RNA. Promoters include, but are not limited to, bacteriophage polymerase promoters such as T3, T7, or SP6. The DNA template is then incubated with the appropriate RNA polymerase enzyme, buffer agents, and nucleotides (NTPs). The resulting RNA polynucleotide can optionally be further modified including, but limited to, addition of a 5′ cap structure such as 7-methylguanosine or a related structure, and optionally modifying the 3′ end to include a polyadenylate (polyA) tail. The RNA can then be purified using techniques well-known in the field, such as phenol-chloroform extraction.
V.D.4. Delivery Via Lipid Nanoparticle
[0412] An important aspect to consider in vaccine vector design is immunity against the vector itself (Riley 2017). This may be in the form of preexisting immunity to the vector itself, such as with certain human adenovirus systems, or in the form of developing immunity to the vector following administration of the vaccine. The latter is an important consideration if multiple administrations of the same vaccine are performed, such as separate priming and boosting doses, or if the same vaccine vector system is to be used to deliver different antigen cassettes.
[0413] In the case of alphavirus vectors, the standard delivery method is the previously discussed helper virus system that provides capsid, E1, and E2 proteins in trans to produce infectious viral particles. However, it is important to note that the E1 and E2 proteins are often major targets of neutralizing antibodies (Strauss 1994). Thus, the efficacy of using alphavirus vectors to deliver antigens of interest to target cells may be reduced if infectious particles are targeted by neutralizing antibodies.
[0414] An alternative to viral particle mediated gene delivery is the use of nanomaterials to deliver expression vectors (Riley 2017). Nanomaterial vehicles, importantly, can be made of non-immunogenic materials and generally avoid eliciting immunity to the delivery vector itself. These materials can include, but are not limited to, lipids, inorganic nanomaterials, and other polymeric materials. Lipids can be cationic, anionic, or neutral. The materials can be synthetic or naturally derived, and in some instances biodegradable. Lipids can include fats, cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethyleneglycol (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, and fat soluable vitamins.
[0415] Lipid nanoparticles (LNPs) are an attractive delivery system due to the amphiphilic nature of lipids enabling formation of membranes and vesicle like structures (Riley 2017). In general, these vesicles deliver the expression vector by absorbing into the membrane of target cells and releasing nucleic acid into the cytosol. In addition, LNPs can be further modified or functionalized to facilitate targeting of specific cell types. Another consideration in LNP design is the balance between targeting efficiency and cytotoxicity. Lipid compositions generally include defined mixtures of cationic, neutral, anionic, and amphipathic lipids. In some instances, specific lipids are included to prevent LNP aggregation, prevent lipid oxidation, or provide functional chemical groups that facilitate attachment of additional moieties. Lipid composition can influence overall LNP size and stability. In an example, the lipid composition comprises dilinoleylmethyl-4-dimethylaminobutyrate (MC3) or MC3-like molecules. MC3 and MC3-like lipid compositions can be formulated to include one or more other lipids, such as a PEG or PEG-conjugated lipid, a sterol, or neutral lipids.
[0416] Nucleic-acid vectors, such as expression vectors, exposed directly to serum can have several undesirable consequences, including degradation of the nucleic acid by serum nucleases or off-target stimulation of the immune system by the free nucleic acids. Therefore, encapsulation of the alphavirus vector can be used to avoid degradation, while also avoiding potential off-target affects. In certain examples, an alphavirus vector is fully encapsulated within the delivery vehicle, such as within the aqueous interior of an LNP. Encapsulation of the alphavirus vector within an LNP can be carried out by techniques well-known to those skilled in the art, such as microfluidic mixing and droplet generation carried out on a microfluidic droplet generating device. Such devices include, but are not limited to, standard T-junction devices or flow-focusing devices. In an example, the desired lipid formulation, such as MC3 or MC3-like containing compositions, is provided to the droplet generating device in parallel with the alphavirus delivery vector and other desired agents, such that the delivery vector and desired agents are fully encapsulated within the interior of the MC3 or MC3-like based LNP. In an example, the droplet generating device can control the size range and size distribution of the LNPs produced. For example, the LNP can have a size ranging from 1 to 1000 nanometers in diameter, e.g., 1, 10, 50, 100, 500, or 1000 nanometers. Following droplet generation, the delivery vehicles encapsulating the expression vectors can be further treated or modified to prepare them for administration.
V.E. Chimpanzee Adenovirus (ChAd
V.E.1. Viral Delivery with Chimpanzee Adenovirus
[0417] Vaccine compositions for delivery of one or more antigens (e.g., via an antigen cassette and including one or more neoantigens shown in Table A and/or AACR GENIE Results, and/or one or more antigens shown in Table 1.2) can be created by providing adenovirus nucleotide sequences of chimpanzee origin, a variety of novel vectors, and cell lines expressing chimpanzee adenovirus genes. A nucleotide sequence of a chimpanzee C68 adenovirus (also referred to herein as ChAdV68) can be used in a vaccine composition for antigen delivery (See SEQ ID NO: 1). Use of C68 adenovirus derived vectors is described in further detail in U.S. Pat. No. 6,083,716, which is herein incorporated by reference in its entirety, for all purposes.
[0418] In a further aspect, provided herein is a recombinant adenovirus comprising the DNA sequence of a chimpanzee adenovirus such as C68 and an antigen cassette operatively linked to regulatory sequences directing its expression. The recombinant virus is capable of infecting a mammalian, preferably a human, cell and capable of expressing the antigen cassette product in the cell. In this vector, the native chimpanzee E1 gene, and/or E3 gene, and/or E4 gene can be deleted. An antigen cassette can be inserted into any of these sites of gene deletion. The antigen cassette can include an antigen against which a primed immune response is desired.
[0419] In another aspect, provided herein is a mammalian cell infected with a chimpanzee adenovirus such as C68.
[0420] In still a further aspect, a novel mammalian cell line is provided which expresses a chimpanzee adenovirus gene (e.g., from C68) or functional fragment thereof.
[0421] In still a further aspect, provided herein is a method for delivering an antigen cassette into a mammalian cell comprising the step of introducing into the cell an effective amount of a chimpanzee adenovirus, such as C68, that has been engineered to express the antigen cassette.
[0422] Still another aspect provides a method for eliciting an immune response in a mammalian host to treat cancer. The method can comprise the step of administering to the host an effective amount of a recombinant chimpanzee adenovirus, such as C68, comprising an antigen cassette that encodes one or more antigens from the tumor against which the immune response is targeted.
[0423] Also disclosed is a non-simian mammalian cell that expresses a chimpanzee adenovirus gene obtained from the sequence of SEQ ID NO: 1. The gene can be selected from the group consisting of the adenovirus E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 of SEQ ID NO: 1.
[0424] Also disclosed is a nucleic acid molecule comprising a chimpanzee adenovirus DNA sequence comprising a gene obtained from the sequence of SEQ ID NO: 1. The gene can be selected from the group consisting of said chimpanzee adenovirus ETA, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 genes of SEQ ID NO: 1. In some aspects the nucleic acid molecule comprises SEQ ID NO: 1. In some aspects the nucleic acid molecule comprises the sequence of SEQ ID NO: 1, lacking at least one gene selected from the group consisting of ETA, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 genes of SEQ ID NO: 1.
[0425] Also disclosed is a vector comprising a chimpanzee adenovirus DNA sequence obtained from SEQ ID NO: 1 and an antigen cassette operatively linked to one or more regulatory sequences which direct expression of the cassette in a heterologous host cell, optionally wherein the chimpanzee adenovirus DNA sequence comprises at least the cis-elements necessary for replication and virion encapsidation, the cis-elements flanking the antigen cassette and regulatory sequences. In some aspects, the chimpanzee adenovirus DNA sequence comprises a gene selected from the group consisting of E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4 and L5 gene sequences of SEQ ID NO: 1. In some aspects the vector can lack the E1A and/or E1B gene.
[0426] Also disclosed herein is a adenovirus vector comprising: a partially deleted E4 gene comprising a deleted or partially-deleted E4orf2 region and a deleted or partially-deleted E4orf3 region, and optionally a deleted or partially-deleted E4orf4 region. The partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of nucleotides 34,916 to 34,942 of the sequence shown in SEQ ID NO:1, at least a partial deletion of nucleotides 34,952 to 35,305 of the sequence shown in SEQ ID NO: 1, and at least a partial deletion of nucleotides 35,302 to 35,642 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1 The partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,980 to 36,516 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1. The partially deleted E4 can comprise an E4 deletion of at least nucleotides 34,979 to 35,642 of the sequence shown in SEQ ID NO:1, and wherein the vector comprises at least nucleotides 2 to 36,518 of the sequence set forth in SEQ ID NO:1. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf2, a fully deleted E4Orf3, and at least a partial deletion of E4Orf4. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf2, at least a partial deletion of E4Orf3, and at least a partial deletion of E4Orf4. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf1, a fully deleted E4Orf2, and at least a partial deletion of E4Orf3. The partially deleted E4 can comprise an E4 deletion of at least a partial deletion of E4Orf2 and at least a partial deletion of E4Orf3. The partially deleted E4 can comprise an E4 deletion between the start site of E4Orf1 to the start site of E4Orf5. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf1. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf2. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf3. The partially deleted E4 can be an E4 deletion adjacent to the start site of E4Orf4. The E4 deletion can be at least 50, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, at least 1200, at least 1300, at least 1400, at least 1500, at least 1600, at least 1700, at least 1800, at least 1900, or at least 2000 nucleotides. The E4 deletion can be at least 700 nucleotides. The E4 deletion can be at least 1500 nucleotides. The E4 deletion can be 50 or less, 100 or less, 200 or less, 300 or less, 400 or less, 500 or less, 600 or less, 700 or less, 800 or less, 900 or less, 1000 or less, 1100 or less, 1200 or less, 1300 or less, 1400 or less, 1500 or less, 1600 or less, 1700 or less, 1800 or less, 1900 or less, or 2000 or less nucleotides. The E4 deletion can be 750 nucleotides or less. The E4 deletion can be at least 1550 nucleotides or less.
[0427] The partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 that lacks at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1. The partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 that lacks the E4 gene sequence shown in SEQ ID NO:1 and that lacks at least nucleotides 34,916 to 34,942, nucleotides 34,952 to 35,305 of the sequence shown in SEQ ID NO: 1, and nucleotides 35,302 to 35,642 of the sequence shown in SEQ ID NO:1. The partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 and that lacks at least nucleotides 34,980 to 36,516 of the sequence shown in SEQ ID NO:1. The partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 and that lacks at least nucleotides 34,979 to 35,642 of the sequence shown in SEQ ID NO:1. The adenovirus vector having the partially deleted E4 gene can have a cassette, wherein the cassette comprises at least one payload nucleic acid sequence, and wherein the cassette comprises at least one promoter sequence operably linked to the at least one payload nucleic acid sequence. The adenovirus vector having the partially deleted E4 gene can have one or more genes or regulatory sequences of the ChAdV68 sequence shown in SEQ ID NO: 1, optionally wherein the one or more genes or regulatory sequences comprise at least one of the chimpanzee adenovirus inverted terminal repeat (ITR), E1A, E1B, E2A, E2B, E3, E4, L1, L2, L3, L4, and L5 genes of the sequence shown in SEQ ID NO: 1. The adenovirus vector having the partially deleted E4 gene can have nucleotides 2 to 34,916 of the sequence shown in SEQ ID NO:1, wherein the partially deleted E4 gene is 3′ of the nucleotides 2 to 34,916, and optionally the nucleotides 2 to 34,916 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and/or lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion. The adenovirus vector having the partially deleted E4 gene can have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO:1, and wherein the partially deleted E4 gene is 5′ of the nucleotides 35,643 to 36,518. The adenovirus vector having the partially deleted E4 gene can have nucleotides 2 to 34,916 of the sequence shown in SEQ ID NO:1, wherein the partially deleted E4 gene is 3′ of the nucleotides 2 to 34,916, the nucleotides 2 to 34,916 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion. The adenovirus vector having the partially deleted E4 gene can have nucleotides 2 to 34,916 of the sequence shown in SEQ ID NO:1, wherein the partially deleted E4 gene is 3′ of the nucleotides 2 to 34,916, the nucleotides 2 to 34,916 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion, and have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO:1, and wherein the partially deleted E4 gene is 5′ of the nucleotides 35,643 to 36,518.
[0428] The partially deleted E4 gene can be the E4 gene sequence shown in SEQ ID NO:1 that lacks at least nucleotides 34,916 to 35,642 of the sequence shown in SEQ ID NO:1, nucleotides 2 to 34,916 of the sequence shown in SEQ ID NO:1, wherein the partially deleted E4 gene is 3′ of the nucleotides 2 to 34,916, the nucleotides 2 to 34,916 additionally lack nucleotides 577 to 3403 of the sequence shown in SEQ ID NO:1 corresponding to an E1 deletion and lack nucleotides 27,125 to 31,825 of the sequence shown in SEQ ID NO:1 corresponding to an E3 deletion, and have nucleotides 35,643 to 36,518 of the sequence shown in SEQ ID NO:1, and wherein the partially deleted E4 gene is 5′ of the nucleotides 35,643 to 36,518.
[0429] Also disclosed herein is a host cell transfected with a vector disclosed herein such as a C68 vector engineered to expression an antigen cassette. Also disclosed herein is a human cell that expresses a selected gene introduced therein through introduction of a vector disclosed herein into the cell.
[0430] Also disclosed herein is a method for delivering an antigen cassette to a mammalian cell comprising introducing into said cell an effective amount of a vector disclosed herein, such as a ChAd vector or self-amplifying RNA vector engineered to express an antigen cassette.
[0431] Also disclosed herein is a method for producing an antigen comprising introducing a vector disclosed herein into a mammalian cell, culturing the cell under suitable conditions and producing the antigen.
V.E.2. E1-Expressing Complementation Cell Lines
[0432] To generate recombinant chimpanzee adenoviruses (Ad) deleted in any of the genes described herein, the function of the deleted gene region, if essential to the replication and infectivity of the virus, can be supplied to the recombinant virus by a helper virus or cell line, i.e., a complementation or packaging cell line. For example, to generate a replication-defective chimpanzee adenovirus vector, a cell line can be used which expresses the E1 gene products of the human or chimpanzee adenovirus; such a cell line can include HEK293 or variants thereof. The protocol for the generation of the cell lines expressing the chimpanzee E1 gene products (Examples 3 and 4 of U.S. Pat. No. 6,083,716) can be followed to generate a cell line which expresses any selected chimpanzee adenovirus gene.
[0433] An AAV augmentation assay can be used to identify a chimpanzee adenovirus E1-expressing cell line. This assay is useful to identify E1 function in cell lines made by using the E1 genes of other uncharacterized adenoviruses, e.g., from other species. That assay is described in Example 4B of U.S. Pat. No. 6,083,716.
[0434] A selected chimpanzee adenovirus gene, e.g., E1, can be under the transcriptional control of a promoter for expression in a selected parent cell line. Inducible or constitutive promoters can be employed for this purpose. Among inducible promoters are included the sheep metallothionine promoter, inducible by zinc, or the mouse mammary tumor virus (MMTV) promoter, inducible by a glucocorticoid, particularly, dexamethasone. Other inducible promoters, such as those identified in International patent application WO95/13392, incorporated by reference herein can also be used in the production of packaging cell lines. Constitutive promoters in control of the expression of the chimpanzee adenovirus gene can be employed also.
[0435] A parent cell can be selected for the generation of a novel cell line expressing any desired C68 gene. Without limitation, such a parent cell line can be HeLa [ATCC Accession No. CCL 2], A549 [ATCC Accession No. CCL 185], KB [CCL 17], Detroit [e.g., Detroit 510, CCL 72] and WI-38 [CCL 75] cells. Other suitable parent cell lines can be obtained from other sources. Parent cell lines can include CHO, HEK293 or variants thereof, 911, HeLa, A549, LP-293, PER.C6, or AE1-2a.
[0436] An E1-expressing cell line can be useful in the generation of recombinant chimpanzee adenovirus E1 deleted vectors. Cell lines constructed using essentially the same procedures that express one or more other chimpanzee adenoviral gene products are useful in the generation of recombinant chimpanzee adenovirus vectors deleted in the genes that encode those products. Further, cell lines which express other human Ad E1 gene products are also useful in generating chimpanzee recombinant Ads.
V.E.3. Recombinant Viral Particles as Vectors
[0437] The compositions disclosed herein can comprise viral vectors, that deliver at least one antigen to cells. Such vectors comprise a chimpanzee adenovirus DNA sequence such as C68 and an antigen cassette operatively linked to regulatory sequences which direct expression of the cassette. The C68 vector is capable of expressing the cassette in an infected mammalian cell. The C68 vector can be functionally deleted in one or more viral genes. An antigen cassette comprises at least one antigen under the control of one or more regulatory sequences such as a promoter. Optional helper viruses and/or packaging cell lines can supply to the chimpanzee viral vector any necessary products of deleted adenoviral genes.
[0438] The term “functionally deleted” means that a sufficient amount of the gene region is removed or otherwise altered, e.g., by mutation or modification, so that the gene region is no longer capable of producing one or more functional products of gene expression. Mutations or modifications that can result in functional deletions include, but are not limited to, nonsense mutations such as introduction of premature stop codons and removal of canonical and non-canonical start codons, mutations that alter mRNA splicing or other transcriptional processing, or combinations thereof. If desired, the entire gene region can be removed.
[0439] Modifications of the nucleic acid sequences forming the vectors disclosed herein, including sequence deletions, insertions, and other mutations may be generated using standard molecular biological techniques and are within the scope of this invention.
V.E.4. Construction of the Viral Plasmid Vector
[0440] The chimpanzee adenovirus C68 vectors useful in this invention include recombinant, defective adenoviruses, that is, chimpanzee adenovirus sequences functionally deleted in the E1a or E1b genes, and optionally bearing other mutations, e.g., temperature-sensitive mutations or deletions in other genes. It is anticipated that these chimpanzee sequences are also useful in forming hybrid vectors from other adenovirus and/or adeno-associated virus sequences. Homologous adenovirus vectors prepared from human adenoviruses are described in the published literature [see, for example, Kozarsky I and II, cited above, and references cited therein, U.S. Pat. No. 5,240,846].
[0441] In the construction of useful chimpanzee adenovirus C68 vectors for delivery of an antigen cassette to a human (or other mammalian) cell, a range of adenovirus nucleic acid sequences can be employed in the vectors. A vector comprising minimal chimpanzee C68 adenovirus sequences can be used in conjunction with a helper virus to produce an infectious recombinant virus particle. The helper virus provides essential gene products required for viral infectivity and propagation of the minimal chimpanzee adenoviral vector. When only one or more selected deletions of chimpanzee adenovirus genes are made in an otherwise functional viral vector, the deleted gene products can be supplied in the viral vector production process by propagating the virus in a selected packaging cell line that provides the deleted gene functions in trans.
V.E.5. Recombinant Minimal Adenovirus
[0442] A minimal chimpanzee Ad C68 virus is a viral particle containing just the adenovirus cis-elements necessary for replication and virion encapsidation. That is, the vector contains the cis-acting 5′ and 3′ inverted terminal repeat (ITR) sequences of the adenoviruses (which function as origins of replication) and the native 5′ packaging/enhancer domains (that contain sequences necessary for packaging linear Ad genomes and enhancer elements for the E1 promoter). See, for example, the techniques described for preparation of a “minimal” human Ad vector in International Patent Application WO96/13597 and incorporated herein by reference.
V.E.6. Other Defective Adenoviruses
[0443] Recombinant, replication-deficient adenoviruses can also contain more than the minimal chimpanzee adenovirus sequences. These other Ad vectors can be characterized by deletions of various portions of gene regions of the virus, and infectious virus particles formed by the optional use of helper viruses and/or packaging cell lines.
[0444] As one example, suitable vectors may be formed by deleting all or a sufficient portion of the C68 adenoviral immediate early gene Ela and delayed early gene Elb, so as to eliminate their normal biological functions. Replication-defective E1-deleted viruses are capable of replicating and producing infectious virus when grown on a chimpanzee adenovirus-transformed, complementation cell line containing functional adenovirus Ela and Elb genes which provide the corresponding gene products in trans. Based on the homologies to known adenovirus sequences, it is anticipated that, as is true for the human recombinant E1-deleted adenoviruses of the art, the resulting recombinant chimpanzee adenovirus is capable of infecting many cell types and can express antigen(s), but cannot replicate in most cells that do not carry the chimpanzee E1 region DNA unless the cell is infected at a very high multiplicity of infection.
[0445] As another example, all or a portion of the C68 adenovirus delayed early gene E3 can be eliminated from the chimpanzee adenovirus sequence which forms a part of the recombinant virus.
[0446] Chimpanzee adenovirus C68 vectors can also be constructed having a deletion of the E4 gene. Still another vector can contain a deletion in the delayed early gene E2a.
[0447] Deletions can also be made in any of the late genes L1 through L5 of the chimpanzee C68 adenovirus genome. Similarly, deletions in the intermediate genes IX and IVa2 can be useful for some purposes. Other deletions may be made in the other structural or non-structural adenovirus genes.
[0448] The above discussed deletions can be used individually, i.e., an adenovirus sequence can contain deletions of E1 only. Alternatively, deletions of entire genes or portions thereof effective to destroy or reduce their biological activity can be used in any combination. For example, in one exemplary vector, the adenovirus C68 sequence can have deletions of the E1 genes and the E4 gene, or of the E1, E2a and E3 genes, or of the E1 and E3 genes, or of E1, E2a and E4 genes, with or without deletion of E3, and so on. As discussed above, such deletions can be used in combination with other mutations, such as temperature-sensitive mutations, to achieve a desired result.
[0449] The cassette comprising antigen(s) be inserted optionally into any deleted region of the chimpanzee C68 Ad virus. Alternatively, the cassette can be inserted into an existing gene region to disrupt the function of that region, if desired.
V.E.7. Helper Viruses
[0450] Depending upon the chimpanzee adenovirus gene content of the viral vectors employed to carry the antigen cassette, a helper adenovirus or non-replicating virus fragment can be used to provide sufficient chimpanzee adenovirus gene sequences to produce an infective recombinant viral particle containing the cassette.
[0451] Useful helper viruses contain selected adenovirus gene sequences not present in the adenovirus vector construct and/or not expressed by the packaging cell line in which the vector is transfected. A helper virus can be replication-defective and contain a variety of adenovirus genes in addition to the sequences described above. The helper virus can be used in combination with the E1-expressing cell lines described herein.
[0452] For C68, the “helper” virus can be a fragment formed by clipping the C terminal end of the C68 genome with SspI, which removes about 1300 bp from the left end of the virus. This clipped virus is then co-transfected into an E1-expressing cell line with the plasmid DNA, thereby forming the recombinant virus by homologous recombination with the C68 sequences in the plasmid.
[0453] Helper viruses can also be formed into poly-cation conjugates as described in Wu et al, J. Biol. Chem., 264:16985-16987 (1989); K. J. Fisher and J. M. Wilson, Biochem. J., 299:49 (Apr. 1, 1994). Helper virus can optionally contain a reporter gene. A number of such reporter genes are known to the art. The presence of a reporter gene on the helper virus which is different from the antigen cassette on the adenovirus vector allows both the Ad vector and the helper virus to be independently monitored. This second reporter is used to enable separation between the resulting recombinant virus and the helper virus upon purification.
V.E.8. Assembly of Viral Particle and Infection of a Cell Line
[0454] Assembly of the selected DNA sequences of the adenovirus, the antigen cassette, and other vector elements into various intermediate plasmids and shuttle vectors, and the use of the plasmids and vectors to produce a recombinant viral particle can all be achieved using conventional techniques. Such techniques include conventional cloning techniques of cDNA, in vitro recombination techniques (e.g., Gibson assembly), use of overlapping oligonucleotide sequences of the adenovirus genomes, polymerase chain reaction, and any suitable method which provides the desired nucleotide sequence. Standard transfection and co-transfection techniques are employed, e.g., CaPO4 precipitation techniques or liposome-mediated transfection methods such as lipofectamine. Other conventional methods employed include homologous recombination of the viral genomes, plaquing of viruses in agar overlay, methods of measuring signal generation, and the like.
[0455] For example, following the construction and assembly of the desired antigen cassette-containing viral vector, the vector can be transfected in vitro in the presence of a helper virus into the packaging cell line. Homologous recombination occurs between the helper and the vector sequences, which permits the adenovirus-antigen sequences in the vector to be replicated and packaged into virion capsids, resulting in the recombinant viral vector particles.
[0456] The resulting recombinant chimpanzee C68 adenoviruses are useful in transferring an antigen cassette to a selected cell. In in vivo experiments with the recombinant virus grown in the packaging cell lines, the E1-deleted recombinant chimpanzee adenovirus demonstrates utility in transferring a cassette to a non-chimpanzee, preferably a human, cell.
V.E.9. Use of the Recombinant Virus Vectors
[0457] The resulting recombinant chimpanzee C68 adenovirus containing the antigen cassette (produced by cooperation of the adenovirus vector and helper virus or adenoviral vector and packaging cell line, as described above) thus provides an efficient gene transfer vehicle which can deliver antigen(s) to a subject in vivo or ex vivo.
[0458] The above-described recombinant vectors are administered to humans according to published methods for gene therapy. A chimpanzee viral vector bearing an antigen cassette can be administered to a patient, preferably suspended in a biologically compatible solution or pharmaceutically acceptable delivery vehicle. A suitable vehicle includes sterile saline. Other aqueous and non-aqueous isotonic sterile injection solutions and aqueous and non-aqueous sterile suspensions known to be pharmaceutically acceptable carriers and well known to those of skill in the art may be employed for this purpose.
[0459] The chimpanzee adenoviral vectors are administered in sufficient amounts to transduce the human cells and to provide sufficient levels of antigen transfer and expression to provide a therapeutic benefit without undue adverse or with medically acceptable physiological effects, which can be determined by those skilled in the medical arts. Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, direct delivery to the liver, intranasal, intravenous, intramuscular, subcutaneous, intradermal, oral and other parental routes of administration. Routes of administration may be combined, if desired.
[0460] Dosages of the viral vector will depend primarily on factors such as the condition being treated, the age, weight and health of the patient, and may thus vary among patients. The dosage will be adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed. The levels of expression of antigen(s) can be monitored to determine the frequency of dosage administration.
[0461] Recombinant, replication defective adenoviruses can be administered in a pharmaceutically effective amount, that is, an amount of recombinant adenovirus that is effective in a route of administration to transfect the desired cells and provide sufficient levels of expression of the selected gene to provide a vaccinal benefit, i.e., some measurable level of immunity. C68 vectors comprising an antigen cassette can be co-administered with adjuvant. Adjuvant can be separate from the vector (e.g., alum) or encoded within the vector, in particular if the adjuvant is a protein. Adjuvants are well known in the art.
[0462] Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, intranasal, intramuscular, intratracheal, subcutaneous, intradermal, rectal, oral and other parental routes of administration. Routes of administration may be combined, if desired, or adjusted depending upon the immunogen or the disease. For example, in prophylaxis of rabies, the subcutaneous, intratracheal and intranasal routes are preferred. The route of administration primarily will depend on the nature of the disease being treated.
[0463] The levels of immunity to antigen(s) can be monitored to determine the need, if any, for boosters. Following an assessment of antibody titers in the serum, for example, optional booster immunizations may be desired
VI. Therapeutic and Manufacturing Methods
[0464] Also provided is a method of inducing a tumor specific immune response in a subject, vaccinating against a tumor, treating and or alleviating a symptom of cancer in a subject by administering to the subject one or more antigens such as a plurality of antigens identified using methods disclosed herein.
[0465] In some aspects, a subject has been diagnosed with cancer or is at risk of developing cancer. A subject can have been previously treated for cancer, such as previously undergone surgery to remove a tumor and/or cancerous tissue, chemotherapy, immunotherapy (e.g., immune checkpoint inhibitor therapy), radiation therapy, or combinations thereof. A subject can be a human, dog, cat, horse or any animal in which a tumor specific immune response is desired. A tumor can be any solid tumor such as breast, ovarian, prostate, lung, kidney, gastric, colon, testicular, head and neck, pancreas, brain, melanoma, and other tumors of tissue organs and hematological tumors, such as lymphomas and leukemias, including acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, and B cell lymphomas.
[0466] An antigen can be administered in an amount sufficient to induce a CTL response.
[0467] An antigen can be administered alone or in combination with other therapeutic agents. The therapeutic agent is for example, a chemotherapeutic agent, radiation, or immunotherapy. Any suitable therapeutic treatment for a particular cancer can be administered. A therapeutically effective amount of the therapeutic agent can be administered. An amount of the therapeutic agent can be administered that alone is not generally considered a therapeutically effective amount but demonstrates a beneficial property when co-administered with any of the vaccine compositions described herein.
[0468] In addition, a subject can be further administered an anti-immunosuppressive/immunostimulatory agent such as a checkpoint inhibitor. For example, the subject can be further administered an anti-CTLA antibody or anti-PD-1 or anti-PD-L1. Blockade of CTLA-4 or PD-L1 by antibodies can enhance the immune response to cancerous cells in the patient. In particular, CTLA-4 blockade has been shown effective when following a vaccination protocol.
[0469] The optimum amount of each antigen to be included in a vaccine composition and the optimum dosing regimen can be determined. For example, an antigen or its variant can be prepared for intravenous (i.v.) injection, sub-cutaneous (s.c.) injection, intradermal (i.d.) injection, intraperitoneal (i.p.) injection, intramuscular (i.m.) injection. Methods of injection include s.c., i.d., i.p., i.m., and i.v. Methods of DNA or RNA injection include i.d., i.m., s.c., i.p. and i.v. Other methods of administration of the vaccine composition are known to those skilled in the art.
[0470] A vaccine can be compiled so that the selection, number and/or amount of antigens present in the composition is/are tissue, cancer, and/or patient-specific. For instance, the exact selection of peptides can be guided by expression patterns of the parent proteins in a given tissue or guided by mutation status of a patient. The selection can be dependent on the specific type of cancer, the status of the disease, earlier treatment regimens, the immune status of the patient, and, of course, the HLA-haplotype of the patient. Furthermore, a vaccine can contain individualized components, according to personal needs of the particular patient. Examples include varying the selection of antigens according to the expression of the antigen in the particular patient or adjustments for secondary treatments following a first round or scheme of treatment.
[0471] A patient can be identified for administration of an antigen vaccine through the use of various diagnostic methods, e.g., patient selection methods described further below. Patient selection can involve identifying mutations in, or expression patterns of, one or more genes. In some cases, patient selection involves identifying the haplotype of the patient. The various patient selection methods can be performed in parallel, e.g., a sequencing diagnostic can identify both the mutations and the haplotype of a patient. The various patient selection methods can be performed sequentially, e.g., one diagnostic test identifies the mutations and separate diagnostic test identifies the haplotype of a patient, and where each test can be the same (e.g., both high-throughput sequencing) or different (e.g., one high-throughput sequencing and the other Sanger sequencing) diagnostic methods.
[0472] For a composition to be used as a vaccine for cancer, antigens with similar normal self-peptides that are expressed in high amounts in normal tissues can be avoided or be present in low amounts in a composition described herein. On the other hand, if it is known that the tumor of a patient expresses high amounts of a certain antigen, the respective pharmaceutical composition for treatment of this cancer can be present in high amounts and/or more than one antigen specific for this particularly antigen or pathway of this antigen can be included.
[0473] Compositions comprising an antigen can be administered to an individual already suffering from cancer. In therapeutic applications, compositions are administered to a patient in an amount sufficient to stimulate an immune response, such as eliciting an effective CTL response to the tumor antigen and to cure or at least partially arrest symptoms and/or complications. An immune response can include a reduction in tumor size or volume. Reduction in tumor size or volume can include at least a 5%, at least a 10%, at least a 15%, at least a 20%, at least a 25%, at least a 30%, at least a 35%, at least a 40%, at least a 45%, at least a 50%, at least a 55%, at least a 60%, at least a 65%, at least a 70%, at least a 75%, at least a 80%, at least a 85%, at least a 90%, or at least a 95% reduction. Reduction in tumor size or volume can include at least a 15% reduction. Reduction in tumor size or volume can include at least a 20% reduction. An immune response can include stabilization of tumor size or volume. An immune response can result in amelioration of a subject's disease, such a complete response (CR), partial response (PR), or stable disease (SD) (e.g., as assessed by criteria set forth in a clinical study). An amount adequate to accomplish this is defined as a “therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician. It should be kept in mind that compositions can generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations, especially when the cancer has metastasized. In such cases, in view of the minimization of extraneous substances and the relative nontoxic nature of an antigen, it is possible and can be felt desirable by the treating physician to administer substantial excesses of these compositions.
[0474] For therapeutic use, administration can begin at the detection or surgical removal of tumors. This is followed by boosting doses until at least symptoms are substantially abated and for a period thereafter.
[0475] Compositions comprising an antigen (e.g., any of the compositions for delivery of a self-replicating alphavirus-based expression system or a chimpanzee adenovirus (ChAdV)-based expression system described herein) can be administered as an adjuvant therapy to a subject having already received a primary therapy. Compositions comprising an antigen can be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 days following a primary therapy, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more weeks following a primary therapy. For example, compositions comprising an antigen can be administered as an adjuvant therapy following surgery to remove tumors and/or cancerous tissues, including 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, days following surgery, or 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more weeks following surgery. Compositions comprising an antigen can be administered as an adjuvant therapy as a combination therapy with an additional therapy, such as administered in combination with chemotherapy, immune checkpoint inhibitor therapy, radiation therapy, or combinations thereof.
[0476] The pharmaceutical compositions (e.g., vaccine compositions) for therapeutic treatment are intended for parenteral, topical, nasal, oral or local administration. A pharmaceutical compositions can be administered parenterally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly. The compositions can be administered at the site of surgical excision to induce a local immune response to the tumor. Disclosed herein are compositions for parenteral administration which comprise a solution of the antigen and vaccine compositions are dissolved or suspended in an acceptable carrier, e.g., an aqueous carrier. A variety of aqueous carriers can be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like. These compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered. The resulting aqueous solutions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
[0477] Antigens can also be administered via liposomes, which target them to a particular cells tissue, such as lymphoid tissue. Liposomes are also useful in increasing half-life. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations the antigen to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to, e.g., a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions. Thus, liposomes filled with a desired antigen can be directed to the site of lymphoid cells, where the liposomes then deliver the selected therapeutic/immunogenic compositions. Liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka et al., Ann. Rev. Biophys. Bioeng. 9; 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728, 4,501,728, 4,837,028, and 5,019,369.
[0478] For targeting to the immune cells, a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells. A liposome suspension can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.
[0479] For therapeutic or immunization purposes, nucleic acids encoding a peptide and optionally one or more of the peptides described herein can also be administered to the patient. A number of methods are conveniently used to deliver the nucleic acids to the patient. For instance, the nucleic acid can be delivered directly, as “naked DNA”. This approach is described, for instance, in Wolff et al., Science 247: 1465-1468 (1990) as well as U.S. Pat. Nos. 5,580,859 and 5,589,466. The nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of DNA can be administered. Alternatively, DNA can be adhered to particles, such as gold particles. Approaches for delivering nucleic acid sequences can include viral vectors, mRNA vectors, and DNA vectors with or without electroporation.
[0480] The nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids. Lipid-mediated gene delivery methods are described, for instance, in 9618372WOAWO 96/18372; 9324640WOAWO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682-691 (1988); U.S. Pat. No. 5,279,833 Rose U.S. Pat. Nos. 5,279,833; 9,106,309WOAWO 91/06309; and Felgner et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).
[0481] Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616-629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g., Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev. (2011) 239(1): 45-61, Sakuma et al., Lentiviral vectors: basic to translational, Biochem J. (2012) 443(3):603-18, Cooper et al., Rescue of splicing-mediated intron loss maximizes expression in lentiviral vectors containing the human ubiquitin C promoter, Nucl. Acids Res. (2015) 43 (1): 682-690, Zufferey et al., Self-Inactivating Lentivirus Vector for Safe and Efficient In Vivo Gene Delivery, J. Virol. (1998) 72 (12): 9873-9880). Dependent on the packaging capacity of the above mentioned viral vector-based vaccine platforms, this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides. The sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science. (2016) 352 (6291):1337-41, Lu et al., Efficient identification of mutated cancer antigens recognized by T cells associated with durable tumor regressions, Clin Cancer Res. (2014) 20(13):3401-10). Upon introduction into a host, infected cells express the antigens, and thereby elicit a host immune (e.g., CTL) response against the peptide(s). Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al. (Nature 351:456-460 (1991)). A wide variety of other vaccine vectors useful for therapeutic administration or immunization of antigens, e.g., Salmonella typhi vectors, and the like will be apparent to those skilled in the art from the description herein.
[0482] A means of administering nucleic acids uses minigene constructs encoding one or multiple epitopes. To create a DNA sequence encoding the selected CTL epitopes (minigene) for expression in human cells, the amino acid sequences of the epitopes are reverse translated. A human codon usage table is used to guide the codon choice for each amino acid. These epitope-encoding DNA sequences are directly adjoined, creating a continuous polypeptide sequence. To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design. Examples of amino acid sequence that could be reverse translated and included in the minigene sequence include: helper T lymphocyte, epitopes, a leader (signal) sequence, and an endoplasmic reticulum retention signal. In addition, MHC presentation of CTL epitopes can be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL epitopes. The minigene sequence is converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) are synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides are joined using T4 DNA ligase. This synthetic minigene, encoding the CTL epitope polypeptide, can then cloned into a desired expression vector.
[0483] Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). A variety of methods have been described, and new techniques can become available. As noted above, nucleic acids are conveniently formulated with cationic lipids. In addition, glycolipids, fusogenic liposomes, peptides and compounds referred to collectively as protective, interactive, non-condensing (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
[0484] Also disclosed is a method of manufacturing a tumor vaccine, comprising performing the steps of a method disclosed herein; and producing a tumor vaccine comprising a plurality of antigens or a subset of the plurality of antigens.
[0485] Antigens disclosed herein can be manufactured using methods known in the art. For example, a method of producing an antigen or a vector (e.g., a vector including at least one sequence encoding one or more antigens) disclosed herein can include culturing a host cell under conditions suitable for expressing the antigen or vector wherein the host cell comprises at least one polynucleotide encoding the antigen or vector, and purifying the antigen or vector. Standard purification methods include chromatographic techniques, electrophoretic, immunological, precipitation, dialysis, filtration, concentration, and chromatofocusing techniques.
[0486] Host cells can include a Chinese Hamster Ovary (CHO) cell, NS0 cell, yeast, or a HEK293 cell. Host cells can be transformed with one or more polynucleotides comprising at least one nucleic acid sequence that encodes an antigen or vector disclosed herein, optionally wherein the isolated polynucleotide further comprises a promoter sequence operably linked to the at least one nucleic acid sequence that encodes the antigen or vector. In certain embodiments the isolated polynucleotide can be cDNA.
VI. Antigen Use and Administration
[0487] A vaccination protocol can be used to dose a subject with one or more antigens. A priming vaccine and a boosting vaccine can be used to dose the subject. The priming vaccine can be based on C68 (e.g., the sequences shown in SEQ ID NO:1 or 2) or srRNA (e.g., the sequences shown in SEQ ID NO:3 or 4) and the boosting vaccine can be based on C68 (e.g., the sequences shown in SEQ ID NO:1 or 2) or srRNA (e.g., the sequences shown in SEQ ID NO:3 or 4). Each vector typically includes a cassette that includes antigens. Cassettes can include about 20 antigens, separated by spacers such as the natural sequence that normally surrounds each antigen or other non-natural spacer sequences such as AAY. Cassettes can also include MHCII antigens such a tetanus toxoid antigen and PADRE antigen, which can be considered universal class II antigens. Cassettes can also include a targeting sequence such as a ubiquitin targeting sequence. In addition, each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a checkpoint inhibitor (CPI). CPI's can include those that inhibit CTLA4, PD1, and/or PDL1 such as antibodies or antigen-binding portions thereof. Such antibodies can include tremelimumab or durvalumab.
[0488] A priming vaccine can be injected (e.g., intramuscularly) in a subject. Bilateral injections per dose can be used. For example, one or more injections of ChAdV68 (C68) can be used (e.g., total dose 1×10.sup.12 viral particles); one or more injections of self-amplifying RNA (SAM) at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used; or one or more injections of SAM at high vaccine dose selected from the range 1 to 1000 ug RNA, in particular 30 μg, 100 μg, or 300 μg RNA can be used. For ChAdV68 priming, 1×10.sup.12 or less of viral particles can be administered. For ChAdV68 priming, 3×10.sup.11 or less of the viral particles can be administered. For ChAdV68 priming, at least 1×10.sup.11 of the viral particles can be administered. For ChAdV68 priming, between 1×10.sup.11 and 1×10.sup.12, between 3×10.sup.11 and 1×10.sup.12, or between 1×10.sup.11 and 3×10.sup.11 of the viral particles can be administered. For ChAdV68 priming, 1×10.sup.11, 3×10.sup.11, or 1×10.sup.12 of the viral particles can be administered. For ChAdV68 priming, the viral particles can be at a concentration of at 5×10.sup.11 vp/mL.
[0489] A vaccine boost (boosting vaccine) can be injected (e.g., intramuscularly) after prime vaccination. A boosting vaccine can be administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks, e.g., every 4 weeks and/or 8 weeks after the prime. Bilateral injections per dose can be used. For example, one or more injections of ChAdV68 (C68) can be used (e.g., total dose 1×10.sup.12 viral particles); one or more injections of self-amplifying RNA (SAM) at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used; or one or more injections of SAM at high vaccine dose selected from the range 1 to 100 μg RNA, in particular 10 or 100 ug can be used. A SAM boost of between 10-30 μg, 10-100 μg, 10-300 μg, 30-100 μg, 30-300 μg, or 100-300 μg RNA can be administered. A SAM boost of between 10-500 μg, 10-1000 μg, 30-500 μg, 30-1000 μg, or 500-1000 μg RNA can be administered. A SAM boost of at least 400 μg, at least 500 μg, at least 600 μg, at least 700 μg, at least 800 μg, at least 900 μg, at least 1000 μg RNA can be administered. A SAM boost of 10 μg, 30 μg, 100 μg, or 300 μg RNA can be administered. A SAM boost of 300 μg RNA can be administered. A SAM boost of 100 μg RNA can be administered. A SAM boost of 30 μg RNA can be administered. A SAM boost of 10 μg RNA can be administered. A SAM boost of at least 300 μg RNA can be administered. A SAM boost of at least 100 μg RNA can be administered. A SAM boost of at least 30 μg RNA can be administered. A SAM boost of at least 10 μg RNA can be administered. A SAM boost of less than or equal to 300 μg RNA can be administered.
[0490] Anti-CTLA-4 (e.g., tremelimumab) can also be administered to the subject. For example, anti-CTLA4 can be administered subcutaneously near the site of the intramuscular vaccine injection (ChAdV68 prime or srRNA low doses) to ensure drainage into the same lymph node. Tremelimumab is a selective human IgG2 mAb inhibitor of CTLA-4. Target Anti-CTLA-4 (tremelimumab) subcutaneous dose is typically 70-75 mg (in particular 75 mg) with a dose range of, e.g., 1-100 mg or 5-420 mg.
[0491] In certain instances an anti-PD-L1 antibody can be used such as durvalumab (MEDI 4736). Durvalumab is a selective, high affinity human IgG1 mAb that blocks PD-L1 binding to PD-1 and CD80. Durvalumab is generally administered at 20 mg/kg i.v. every 4 weeks.
[0492] Immune monitoring can be performed before, during, and/or after vaccine administration. Such monitoring can inform safety and efficacy, among other parameters.
[0493] To perform immune monitoring, PBMCs are commonly used. PBMCs can be isolated before prime vaccination, and after prime vaccination (e.g. 4 weeks and 8 weeks). PBMCs can be harvested just prior to boost vaccinations and after each boost vaccination (e.g. 4 weeks and 8 weeks).
[0494] T cell responses can be assessed as part of an immune monitoring protocol. For example, the ability of a vaccine composition described herein to stimulate an immune response can be monitored and/or assessed. As used herein, “stimulate an immune response” refers to any increase in a immune response, such as initiating an immune response (e.g., a priming vaccine stimulating the initiation of an immune response in a naïve subject) or enhancement of an immune response (e.g., a boosting vaccine stimulating the enhancement of an immune response in a subject having a pre-existing immune response to an antigen, such as a pre-existing immune response initiated by a priming vaccine). T cell responses can be measured using one or more methods known in the art such as ELISpot, intracellular cytokine staining, cytokine secretion and cell surface capture, T cell proliferation, MHC multimer staining, or by cytotoxicity assay. T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines, such as IFN-gamma, using an ELISpot assay. Specific CD4 or CD8 T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines captured intracellularly or extracellularly, such as IFN-gamma, using flow cytometry. Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring T cell populations expressing T cell receptors specific for epitope/MHC class I complexes using MHC multimer staining. Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring the ex vivo expansion of T cell populations following 3H-thymidine, bromodeoxyuridine and carboxyfluoresceine-diacetate-succinimidylester (CFSE) incorporation. The antigen recognition capacity and lytic activity of PBMC-derived T cells that are specific for epitopes encoded in vaccines can be assessed functionally by chromium release assay or alternative colorimetric cytotoxicity assays.
[0495] B cell responses can be measured using one or more methods known in the art such as assays used to determine B cell differentiation (e.g., differentiation into plasma cells), B cell or plasma cell proliferation, B cell or plasma cell activation (e.g., upregulation of costimulatory markers such as CD80 or CD86), antibody class switching, and/or antibody production (e.g., an ELISA).
[0496] Disease status of a subject can be monitored following administration of any of the vaccine compositions described herein. For example, disease status may be monitored using isolated cell-free DNA (cfDNA) from a subject. In addition, the efficacy of a vaccine therapy may be monitored using isolated cfDNA from a subject. cfDNA monitoring can include the steps of: a. isolating or having isolated cfDNA from a subject; b. sequencing or having sequenced the isolated cfDNA; c. determining or having determined a frequency of one or more mutations in the cfDNA relative to a wild-type germline nucleic acid sequence of the subject, and d. assessing or having assessed from step (c) the status of a disease in the subject. The method can also include, following step (c) above, d. performing more than one iteration of steps (a)-(c) for the given subject and comparing the frequency of the one or more mutations determined in the more than one iterations; and f. assessing or having assessed from step (d) the status of a disease in the subject. The more than one iterations can be performed at different time points, such as a first iteration of steps (a)-(c) performed prior to administration of the vaccine composition and a second iteration of steps (a)-(c) is performed subsequent to administration of the vaccine composition. Step (c) can include comparing: the frequency of the one or more mutations determined in the more than one iterations, or the frequency of the one or more mutations determined in the first iteration to the frequency of the one or more mutations determined in the second iteration. An increase in the frequency of the one or more mutations determined in subsequent iterations or the second iteration can be assessed as disease progression. A decrease in the frequency of the one or more mutations determined in subsequent iterations or the second iteration can be assessed as a response. In some aspects, the response is a Complete Response (CR) or a Partial Response (PR). A therapy can be administered to a subject following an assessment step, such as where assessment of the frequency of the one or more mutations in the cfDNA indicates the subject has the disease. The cfDNA isolation step can use centrifugation to separate cfDNA from cells or cellular debris. cfDNA can be isolated from whole blood, such as by separating the plasma layer, buffy coat, and red bloods. cfDNA sequencing can use next generation sequencing (NGS), Sanger sequencing, duplex sequencing, whole-exome sequencing, whole-genome sequencing, de novo sequencing, phased sequencing, targeted amplicon sequencing, shotgun sequencing, or combinations thereof, and may include enriching the cfDNA for one or more polynucleotide regions of interest prior to sequencing (e.g., polynucleotides known or suspected to encode the one or more mutations, coding regions, and/or tumor exome polynucleotides). Enriching the cfDNA may include hybridizing one or more polynucleotide probes, which may be modified (e.g., biotinylated), to the one or more polynucleotide regions of interest. In general, any number of mutations may be monitored simultaneously or in parallel.
VIII. Antigen Identification
VIII.A. Antigen Candidate Identification
[0497] Research methods for NGS analysis of tumor and normal exome and transcriptomes have been described and applied in the antigen identification space..sup.6,14,15 Certain optimizations for greater sensitivity and specificity for antigen identification in the clinical setting can be considered. These optimizations can be grouped into two areas, those related to laboratory processes and those related to the NGS data analysis. Examples of optimizations are known to those skilled in the art, for example the methods described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
VIII.B. Isolation and Detection of HLA Peptides
[0498] Isolation of HLA-peptide molecules was performed using classic immunoprecipitation (IP) methods after lysis and solubilization of the tissue sample (55-58). A clarified lysate was used for HLA specific IP.
[0499] Immunoprecipitation was performed using antibodies coupled to beads where the antibody is specific for HLA molecules. For a pan-Class I HLA immunoprecipitation, a pan-Class I CR antibody is used, for Class II HLA-DR, an HLA-DR antibody is used. Antibody is covalently attached to NHS-sepharose beads during overnight incubation. After covalent attachment, the beads were washed and aliquoted for IP. (59, 60) Immunoprecipitations can also be performed with antibodies that are not covalently attached to beads. Typically this is done using sepharose or magnetic beads coated with Protein A and/or Protein G to hold the antibody to the column. Some antibodies that can be used to selectively enrich MHC/peptide complex are listed below.
TABLE-US-00001 Antibody Name Specificity W6/32 Class I HLA-A, B, C L243 Class II-HLA-DR Tu36 Class II-HLA-DR LN3 Class II-HLA-DR Tu39 Class II-HLA-DR, DP, DQ SPVL3 Class II-HLA-DQ B7/21 Class II-HLA-DP
[0500] The clarified tissue lysate is added to the antibody beads for the immunoprecipitation. After immunoprecipitation, the beads are removed from the lysate and the lysate stored for additional experiments, including additional IPs. The IP beads are washed to remove non-specific binding and the HLA/peptide complex is eluted from the beads using standard techniques. The protein components are removed from the peptides using a molecular weight spin column or C18 fractionation. The resultant peptides are taken to dryness by SpeedVac evaporation and in some instances are stored at −20C prior to MS analysis. HLA IPs can also be performed in 96 well plate format using plates that contain filter bottoms. Use of the plates allows for multiple IPs to be performed in tandem.
[0501] Dried peptides are reconstituted in an HPLC buffer suitable for reverse phase chromatography and loaded onto a C-18 microcapillary HPLC column for gradient elution in a Fusion Lumos mass spectrometer (Thermo). MS1 spectra of peptide mass/charge (m/z) were collected in the Orbitrap detector at high resolution followed by MS2 low resolution scans collected in the ion trap detector after HCD fragmentation of the selected ion. Additionally, MS2 spectra can be obtained using either CID or ETD fragmentation methods or any combination of the three techniques to attain greater amino acid coverage of the peptide. MS2 spectra can also be measured with high resolution mass accuracy in the Orbitrap detector. MS2 spectra from each analysis are searched against a protein database using Comet (61, 62) and the peptide identification are scored using Percolator (63-65). Additional sequencing is performed using PEAKS studio (Bioinformatics Solutions Inc.) and other search engines or sequencing methods can be used including spectral matching and de novo sequencing (97).
VIII.B.1. MS Limit of Detection Studies in Support of Comprehensive HLA Peptide Sequencing
[0502] Using the peptide YVYVADVAAK (SEQ ID NO: 29364) it was determined what the limits of detection are using different amounts of peptide loaded onto the LC column. The amounts of peptide tested were 1 pmol, 100 fmol, 10 fmol, 1 fmol, and 100 amol. (Table 1) The results are shown in
TABLE-US-00002 TABLE 1 Peptide m/z Loaded on Column Copies/Cell in 1e9cells 566.830 1 pmol 600 562.823 100 fmol 60 559.816 10 fmol 6 556.810 1 fmol 0.6 553.802 100 amol 0.06
IX. Presentation Model
[0503] Presentation models can be used to identify likelihoods of peptide presentation in patients. Various presentation models are known to those skilled in the art, for example the presentation models described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, WO/2018/208856, WO2016187508, and US patent application US20110293637, each herein incorporated by reference, in their entirety, for all purposes.
X. Training Module
[0504] Training modules can be used to construct one or more presentation models based on training data sets that generate likelihoods of whether peptide sequences will be presented by MHC alleles associated with the peptide sequences. Various training modules are known to those skilled in the art, for example the presentation models described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes. A training module can construct a presentation model to predict presentation likelihoods of peptides on a per-allele basis. A training module can also construct a presentation model to predict presentation likelihoods of peptides in a multiple-allele setting where two or more MHC alleles are present.
XI. Prediction Module
[0505] A prediction module can be used to receive sequence data and select candidate antigens in the sequence data using a presentation model. Specifically, the sequence data may be DNA sequences, RNA sequences, and/or protein sequences extracted from tumor tissue cells of patients. A prediction module may identify candidate neoantigens that are mutated peptide sequences by comparing sequence data extracted from normal tissue cells of a patient with the sequence data extracted from tumor tissue cells of the patient to identify portions containing one or more mutations. A prediction module may identify candidate antigens that have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue by comparing sequence data extracted from normal tissue cells of a patient with the sequence data extracted from tumor tissue cells of the patient to identify improperly expressed candidate antigens.
[0506] A presentation module can apply one or more presentation model to processed peptide sequences to estimate presentation likelihoods of the peptide sequences. Specifically, the prediction module may select one or more candidate antigen peptide sequences that are likely to be presented on tumor HLA molecules by applying presentation models to the candidate antigens. In one implementation, the presentation module selects candidate antigen sequences that have estimated presentation likelihoods above a predetermined threshold. In another implementation, the presentation model selects the N candidate antigen sequences that have the highest estimated presentation likelihoods (where Nis generally the maximum number of epitopes that can be delivered in a vaccine). A vaccine including the selected candidate antigens for a given patient can be injected into the patient to induce immune responses.
XI.B. Cassette Design Module
XI.B.1 Overview
[0507] A cassette design module can be used to generate a vaccine cassette sequence based on selected candidate peptides for injection into a patient. Various cassette design modules are known to those skilled in the art, for example the cassette design modules described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
[0508] A set of therapeutic epitopes may be generated based on the selected peptides determined by a prediction module associated with presentation likelihoods above a predetermined threshold, where the presentation likelihoods are determined by the presentation models. However it is appreciated that in other embodiments, the set of therapeutic epitopes may be generated based on any one or more of a number of methods (alone or in combination), for example, based on binding affinity or predicted binding affinity to HLA class I or class II alleles of the patient, binding stability or predicted binding stability to HLA class I or class II alleles of the patient, random sampling, and the like.
[0509] Therapeutic epitopes may correspond to selected peptides themselves Therapeutic epitopes may also include C- and/or N-terminal flanking sequences in addition to the selected peptides. N- and C-terminal flanking sequences can be the native N- and C-terminal flanking sequences of the therapeutic vaccine epitope in the context of its source protein. Therapeutic epitopes can represent a fixed-length epitope Therapeutic epitopes can represent a variable-length epitope, in which the length of the epitope can be varied depending on, for example, the length of the C- or N-flanking sequence. For example, the C-terminal flanking sequence and the N-terminal flanking sequence can each have varying lengths of 2-5 residues, resulting in 16 possible choices for the epitope.
[0510] A cassette design module can also generate cassette sequences by taking into account presentation of junction epitopes that span the junction between a pair of therapeutic epitopes in the cassette. Junction epitopes are novel non-self but irrelevant epitope sequences that arise in the cassette due to the process of concatenating therapeutic epitopes and linker sequences in the cassette. The novel sequences of junction epitopes are different from the therapeutic epitopes of the cassette themselves.
[0511] A cassette design module can generate a cassette sequence that reduces the likelihood that junction epitopes are presented in the patient. Specifically, when the cassette is injected into the patient, junction epitopes have the potential to be presented by HLA class I or HLA class II alleles of the patient, and stimulate a CD8 or CD4 T-cell response, respectively. Such reactions are often times undesirable because T-cells reactive to the junction epitopes have no therapeutic benefit, and may diminish the immune response to the selected therapeutic epitopes in the cassette by antigenic competition..sup.76
[0512] A cassette design module can iterate through one or more candidate cassettes, and determine a cassette sequence for which a presentation score of junction epitopes associated with that cassette sequence is below a numerical threshold. The junction epitope presentation score is a quantity associated with presentation likelihoods of the junction epitopes in the cassette, and a higher value of the junction epitope presentation score indicates a higher likelihood that junction epitopes of the cassette will be presented by HLA class I or HLA class II or both.
[0513] In one embodiment, a cassette design module may determine a cassette sequence associated with the lowest junction epitope presentation score among the candidate cassette sequences.
[0514] A cassette design module may iterate through one or more candidate cassette sequences, determine the junction epitope presentation score for the candidate cassettes, and identify an optimal cassette sequence associated with a junction epitope presentation score below the threshold.
[0515] A cassette design module may further check the one or more candidate cassette sequences to identify if any of the junction epitopes in the candidate cassette sequences are self-epitopes for a given patient for whom the vaccine is being designed. To accomplish this, the cassette design module checks the junction epitopes against a known database such as BLAST. In one embodiment, the cassette design module may be configured to design cassettes that avoid junction self-epitopes.
[0516] A cassette design module can perform a brute force approach and iterate through all or most possible candidate cassette sequences to select the sequence with the smallest junction epitope presentation score. However, the number of such candidate cassettes can be prohibitively large as the capacity of the vaccine increases. For example, for a vaccine capacity of 20 epitopes, the cassette design module has to iterate through ˜10.sup.18 possible candidate cassettes to determine the cassette with the lowest junction epitope presentation score. This determination may be computationally burdensome (in terms of computational processing resources required), and sometimes intractable, for the cassette design module to complete within a reasonable amount of time to generate the vaccine for the patient. Moreover, accounting for the possible junction epitopes for each candidate cassette can be even more burdensome. Thus, a cassette design module may select a cassette sequence based on ways of iterating through a number of candidate cassette sequences that are significantly smaller than the number of candidate cassette sequences for the brute force approach.
[0517] A cassette design module can generate a subset of randomly or at least pseudo-randomly generated candidate cassettes, and selects the candidate cassette associated with a junction epitope presentation score below a predetermined threshold as the cassette sequence. Additionally, the cassette design module may select the candidate cassette from the subset with the lowest junction epitope presentation score as the cassette sequence. For example, the cassette design module may generate a subset of ˜1 million candidate cassettes for a set of 20 selected epitopes, and select the candidate cassette with the smallest junction epitope presentation score. Although generating a subset of random cassette sequences and selecting a cassette sequence with a low junction epitope presentation score out of the subset may be sub-optimal relative to the brute force approach, it requires significantly less computational resources thereby making its implementation technically feasible. Further, performing the brute force method as opposed to this more efficient technique may only result in a minor or even negligible improvement in junction epitope presentation score, thus making it not worthwhile from a resource allocation perspective. A cassette design module can determine an improved cassette configuration by formulating the epitope sequence for the cassette as an asymmetric traveling salesman problem (TSP). Given a list of nodes and distances between each pair of nodes, the TSP determines a sequence of nodes associated with the shortest total distance to visit each node exactly once and return to the original node. For example, given cities A, B, and C with known distances between each other, the solution of the TSP generates a closed sequence of cities, for which the total distance traveled to visit each city exactly once is the smallest among possible routes. The asymmetric version of the TSP determines the optimal sequence of nodes when the distance between a pair of nodes are asymmetric. For example, the “distance” for traveling from node A to node B may be different from the “distance” for traveling from node B to node A. By solving for an improved optimal cassette using an asymmetric TSP, the cassette design module can find a cassette sequence that results in a reduced presentation score across the junctions between epitopes of the cassette. The solution of the asymmetric TSP indicates a sequence of therapeutic epitopes that correspond to the order in which the epitopes should be concatenated in a cassette to minimize the junction epitope presentation score across the junctions of the cassette. A cassette sequence determined through this approach can result in a sequence with significantly less presentation of junction epitopes while potentially requiring significantly less computational resources than the random sampling approach, especially when the number of generated candidate cassette sequences is large. Illustrative examples of different computational approaches and comparisons for optimizing cassette design are described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
XI.B.2 Shared Antigen Vaccine Sequence Selection
[0518] Shared antigen sequences for inclusion in a shared antigen vaccine and appropriate patients for treatment with such vaccine can be chosen by one of skill in the art using the detailed disclosure provided herein. For example, Tables: A, 1.2, Additional MS Validated Neoantigens, or AACR GENIE Results can be used for sequence selection. In certain instances a particular mutation and HLA allele combination can be preferred (e.g., based on sequencing data available from a given subject indicating that each are present in the subject) and subsequently used in combination together to identify a shared neoantigen sequence using Table A, Additional MS Validated Neoantigens, or AACR GENIE Results for inclusion in a vaccine. Exemplary mutations and their matched HLA alleles are shown in Tables 32A, 32B, and 34.
[0519] For example, for KRAS_G13D, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list KRAS_G13D and C0802 and A1101.
[0520] For example, for KRAS_Q61K or NRAS_Q61K, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list (1) KRAS_Q61K and A0101; or (2) NRAS Q61K, and A0101.
[0521] For example, for TP53_R249M, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list TP53_R249M and at least one of B3512, B3503, and B3501.
[0522] For example, for CTNNB1_S45P, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list CTNNB1_S45P and at least one of A0301, A6801, A0302, and A1101. For example, see relevant sequences shown in Table 32A and Table 32B.
[0523] For example, for CTNNB1_S45F, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list CTNNB1_S45F and at least one of A0301, A1101, and A6801.
[0524] For example, for ERBB2_Y772_A775dup, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list ERBB2_Y772_A775dup and B1801.
[0525] For example, for KRAS_G12D or NRAS_G12D, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list (1) KRAS_G12D and at least one of A1101, A0301, and C0802; or (2) NRAS_G12D and at least one of A1101, A0301, and C0802. For example, see relevant sequences shown in Table 32A or Table 32B.
[0526] For example, for KRAS_Q61R or NRAS_Q61R, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list (1) KRAS_Q61R and A0101; or (2) NRAS_Q61R and A0101. For example, see relevant sequence shown in Table 32B.
[0527] For example, for CTNNB1_T41A, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list CTNNB1_T41A and at least one of A0301, A0302, A1101, B1510, C0303, and C0304. For example, see relevant sequence shown in Table 32B.
[0528] For example, for TP53_K132N, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list TP53_K132N and at least one of A2402 and A2301. For example, see relevant sequence shown in Table 32A.
[0529] For example, for KRAS_G12A, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list KRAS_G12A and at least one of A0301 and A1101.
[0530] For example, for KRAS_Q61L or NRAS_Q61L, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list (1) KRAS_Q61L and A0101; or (2) NRAS_Q61L and A0101.
[0531] For example, for TP53_R213L, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list TP53_R213L and at least one of A0207, C0802, and A0201. For example, see relevant sequence shown in Table 32B.
[0532] For example, for BRAF_G466V, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list BRAF_G466V and at least one of B1501 and B1503.
[0533] For example, for KRAS_G12V, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list KRAS_G12V and at least one of A0301, A1101, C0102, and A0302. For example, see relevant sequences shown in Table 32A and Table 32B.
[0534] For example, for KRAS_Q61H or NRAS_Q61H, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list (1) KRAS_Q61H and A0101; or (2) NRAS_Q61H and A0101.
[0535] For example, for CTNNB1_S37F, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list CTNNB1_S37F and at least one of A0101, A2301, A2402, B1510, B3906, C0501, C1402, and C1403.
[0536] For example, for TP53_S127Y, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list TP53_S127Y and at least one of A1101 and A0301.
[0537] For example, for TP53_K132E, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list TP53_K132E and at least one of A2402, C1403, and A2301.
[0538] For example, for KRAS_G12C or NRAS_G12C, a shared neoantigen or shared neoantigen-encoding sequence for inclusion in a vaccine can be selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion is selected by identifying all rows that list (1) KRAS_G12C and at least one of A0201, A0301, and A1101; or (2) NRAS_G12C and at least one of A0201, A0301, and A1101. For example, see relevant sequences shown in Table 32A.
XII. Example Computer
[0539] A computer can be used for any of the computational methods described herein. One skilled in the art will recognize a computer can have different architectures. Examples of computers are known to those skilled in the art, for example the computers described in more detail in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes.
XIV. Antigen Delivery Vector Example
[0540] Below are examples of specific embodiments for carrying out the present invention. The examples are offered for illustrative purposes only, and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for.
[0541] The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature. See, e.g., T. E. Creighton, Proteins: Structures and Molecular Properties (W.H. Freeman and Company, 1993); A. L. Lehninger, Biochemistry (Worth Publishers, Inc., current addition); Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Methods In Enzymology (S. Colowick and N. Kaplan eds., Academic Press, Inc.); Remington's Pharmaceutical Sciences, 18th Edition (Easton, Pa.: Mack Publishing Company, 1990); Carey and Sundberg Advanced Organic Chemistry 3.sup.rd Ed. (Plenum Press) Vols A and B (1992).
XIV.A. Neoantigen Cassette Design
[0542] Through vaccination, multiple class I MHC restricted tumor-specific neoantigens (TSNAs) that stimulate the corresponding cellular immune response(s) can be delivered. In one example, a vaccine cassette was engineered to encode multiple epitopes as a single gene product where the epitopes were either embedded within their natural, surrounding peptide sequence or spaced by non-natural linker sequences. Several design parameters were identified that could potentially impact antigen processing and presentation and therefore the magnitude and breadth of the TSNA specific CD8 T cell responses. In the present example, several model cassettes were designed and constructed to evaluate: (1) whether robust T cell responses could be generated to multiple epitopes incorporated in a single expression cassette; (2) what makes an optimal linker placed between the TSNAs within the expression cassette—that leads to optimal processing and presentation of all epitopes; (3) if the relative position of the epitopes within the cassette impact T cell responses; (4) whether the number of epitopes within a cassette influences the magnitude or quality of the T cell responses to individual epitopes; (5) if the addition of cellular targeting sequences improves T cell responses.
[0543] Two readouts were developed to evaluate antigen presentation and T cell responses specific for marker epitopes within the model cassettes: (1) an in vitro cell-based screen which allowed assessment of antigen presentation as gauged by the activation of specially engineered reporter T cells (Aarnoudse et al., 2002; Nagai et al., 2012); and (2) an in vivo assay that used HLA-A2 transgenic mice (Vitiello et al., 1991) to assess post-vaccination immunogenicity of cassette-derived epitopes of human origin by their corresponding epitope-specific T cell responses (Comet et al., 2006; Depla et al., 2008; Ishioka et al., 1999).
XIV.B. Antigen Cassette Design Evaluation
XIV.B.1. Methods and Materials
TCR and Cassette Design and Cloning
[0544] The selected TCRs recognize peptides NLVPMVATV (SEQ ID NO: 29365) (PDB #5D2N), CLGGLLTMV (SEQ ID NO: 29366) (PDB #3REV), GILGFVFTL (SEQ ID NO: 29367) (PDB #1OGA) LLFGYPVYV (SEQ ID NO: 29368) (PDB #1AO7) when presented by A*0201. Transfer vectors were constructed that contain 2A peptide-linked TCR subunits (beta followed by alpha), the EMCV IRES, and 2A-linked CD8 subunits (beta followed by alpha and by the puromycin resistance gene). Open reading frame sequences were codon-optimized and synthesized by GeneArt.
Cell Line Generation for In Vitro Epitope Processing and Presentation Studies
[0545] Peptides were purchased from ProImmune or Genscript diluted to 10 mg/mL with 10 mM tris(2-carboxyethyl)phosphine (TCEP) in water/DMSO (2:8, v/v). Cell culture medium and supplements, unless otherwise noted, were from Gibco. Heat inactivated fetal bovine serum (FBShi) was from Seradigm. QUANTI-Luc Substrate, Zeocin, and Puromycin were from InvivoGen. Jurkat-Lucia NFAT Cells (InvivoGen) were maintained in RPMI 1640 supplemented with 10% FBShi, Sodium Pyruvate, and 100 μg/mL Zeocin. Once transduced, these cells additionally received 0.3 μg/mL Puromycin. T2 cells (ATCC CRL-1992) were cultured in Iscove's Medium (IMDM) plus 20% FBShi. U-87 MG (ATCC HTB-14) cells were maintained in MEM Eagles Medium supplemented with 10% FBShi.
[0546] Jurkat-Lucia NFAT cells contain an NFAT-inducible Lucia reporter construct. The Lucia gene, when activated by the engagement of the T cell receptor (TCR), causes secretion of a coelenterazine-utilizing luciferase into the culture medium. This luciferase can be measured using the QUANTI-Luc luciferase detection reagent. Jurkat-Lucia cells were transduced with lentivirus to express antigen-specific TCRs. The HIV-derived lentivirus transfer vector was obtained from GeneCopoeia, and lentivirus support plasmids expressing VSV-G (pCMV-VsvG), Rev (pRSV-Rev) and Gag-pol (pCgpV) were obtained from Cell Design Labs.
[0547] Lentivirus was prepared by transfection of 50-80% confluent T75 flasks of HEK293 cells with Lipofectamine 2000 (Thermo Fisher), using 40 μl of lipofectamine and 20 μg of the DNA mixture (4:2:1:1 by weight of the transfer plasmid:pCgpV:pRSV-Rev:pCMV-VsvG). 8-10 mL of the virus-containing media were concentrated using the Lenti-X system (Clontech), and the virus resuspended in 100-200 μl of fresh medium. This volume was used to overlay an equal volume of Jurkat-Lucia cells (5×10E4-1×10E6 cells were used in different experiments). Following culture in 0.3 μg/ml puromycin-containing medium, cells were sorted to obtain clonality. These Jurkat-Lucia TCR clones were tested for activity and selectivity using peptide loaded T2 cells.
In Vitro Epitope Processing and Presentation Assay
[0548] T2 cells are routinely used to examine antigen recognition by TCRs. T2 cells lack a peptide transporter for antigen processing (TAP deficient) and cannot load endogenous peptides in the endoplasmic reticulum for presentation on the MHC. However, the T2 cells can easily be loaded with exogenous peptides. The five marker peptides (NLVPMVATV (SEQ ID NO: 29365), CLGGLLTMV (SEQ ID NO: 29366), GLCTLVAML (SEQ ID NO: 29369), LLFGYPVYV (SEQ ID NO: 29368), GILGFVFTL (SEQ ID NO: 29367)) and two irrelevant peptides (WLSLLVPFV (SEQ ID NO: 29370), FLLTRICT (SEQ ID NO: 29371)) were loaded onto T2 cells. Briefly, T2 cells were counted and diluted to 1×106 cells/mL with IMDM plus 1% FBShi. Peptides were added to result in 10 μg peptide/1×106 cells. Cells were then incubated at 37° C. for 90 minutes. Cells were washed twice with IMDM plus 20% FBShi, diluted to 5×10E5 cells/mL and 100 μL plated into a 96-well Costar tissue culture plate. Jurkat-Lucia TCR clones were counted and diluted to 5×10E5 cells/mL in RPMI 1640 plus 10% FBShi and 100 μL added to the T2 cells. Plates were incubated overnight at 37° C., 5% CO2. Plates were then centrifuged at 400 μg for 3 minutes and 20 μL supernatant removed to a white flat bottom Greiner plate. QUANTI-Luc substrate was prepared according to instructions and 50 μL/well added. Luciferase expression was read on a Molecular Devices SpectraMax iE3×.
[0549] To test marker epitope presentation by the adenoviral cassettes, U-87 MG cells were used as surrogate antigen presenting cells (APCs) and were transduced with the adenoviral vectors. U-87 MG cells were harvested and plated in culture media as 5×10E5 cells/100 μl in a 96-well Costar tissue culture plate. Plates were incubated for approximately 2 hours at 37° C. Adenoviral cassettes were diluted with MEM plus 10% FBShi to an MOI of 100, 50, 10, 5, 1 and 0 and added to the U-87 MG cells as 5 μl/well. Plates were again incubated for approximately 2 hours at 37° C. Jurkat-Lucia TCR clones were counted and diluted to 5×10E5 cells/mL in RPMI plus 10% FBShi and added to the U-87 MG cells as 100 μL/well. Plates were then incubated for approximately 24 hours at 37° C., 5% CO2. Plates were centrifuged at 400 μg for 3 minutes and 20 μL supernatant removed to a white flat bottom Greiner plate. QUANTI-Luc substrate was prepared according to instructions and 50 μL/well added. Luciferase expression was read on a Molecular Devices SpectraMax iE3×.
Mouse Strains for Immunogenicity Studies
[0550] Transgenic HLA-A2.1 (HLA-A2 Tg) mice were obtained from Taconic Labs, Inc. These mice carry a transgene consisting of a chimeric class I molecule comprised of the human HLA-A2.1 leader, α1, and α2 domains and the murine H2-Kb α3, transmembrane, and cytoplasmic domains (Vitiello et al., 1991). Mice used for these studies were the first generation offspring (F1) of wild type BALB/cAnNTac females and homozygous HLA-A2.1 Tg males on the C57B1/6 background.
Adenovirus Vector (Ad5v) Immunizations
[0551] HLA-A2 Tg mice were immunized with 1×10.sup.10 to 1×10.sup.6 viral particles of adenoviral vectors via bilateral intramuscular injection into the tibialis anterior. Immune responses were measured at 12 days post-immunization.
Lymphocyte Isolation
[0552] Lymphocytes were isolated from freshly harvested spleens and lymph nodes of immunized mice. Tissues were dissociated in RPMI containing 10% fetal bovine serum with penicillin and streptomycin (complete RPMI) using the GentleMACS tissue dissociator according to the manufacturer's instructions.
Ex Vivo Enzyme-Linked Immunospot (ELISpot) Analysis
[0553] ELISpot analysis was performed according to ELISpot harmonization guidelines (Janetzki et al., 2015) with the mouse IFNg ELISpotPLUS kit (MABTECH). 1×10.sup.5 splenocytes were incubated with 10 uM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was quenched by running the plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISpot analysis, wells with saturation >50% were recorded as “too numerous to count”. Samples with deviation of replicate wells >10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count+2 x (spot count x % confluence/[100%−% confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.
Ex Vivo Intracellular Cytokine Staining (ICS) and Flow Cytometry Analysis
[0554] Freshly isolated lymphocytes at a density of 2-5×10.sup.6 cells/mL were incubated with 10 uM of the indicated peptides for 2 hours. After two hours, brefeldin A was added to a concentration of 5 ug/ml and cells were incubated with stimulant for an additional 4 hours. Following stimulation, viable cells were labeled with fixable viability dye eFluor780 according to manufacturer's protocol and stained with anti-CD8 APC (clone 53-6.7, BioLegend) at 1:400 dilution. Anti-IFNg PE (clone XMG1.2, BioLegend) was used at 1:100 for intracellular staining. Samples were collected on an Attune NxT Flow Cytometer (Thermo Scientific). Flow cytometry data was plotted and analyzed using FlowJo. To assess degree of antigen-specific response, both the percent IFNg+ of CD8+ cells and the total IFNg+ cell number/1×10.sup.6 live cells were calculated in response to each peptide stimulant.
XIV.B.2. In Vitro Evaluation of Antigen Cassette Designs
[0555] As an example of antigen cassette design evaluation, an in vitro cell-based assay was developed to assess whether selected human epitopes within model vaccine cassettes were being expressed, processed, and presented by antigen-presenting cells (
[0556] Individual Jurkat-Lucia reporter lines were modified by lentiviral transduction with an expression construct that includes an antigen-specific TCR beta and TCR alpha chain separated by a P2A ribosomal skip sequence to ensure equimolar amounts of translated product (Banu et al., 2014). The addition of a second CD8 beta-P2A-CD8 alpha element to the lentiviral construct provided expression of the CD8 co-receptor, which the parent reporter cell line lacks, as CD8 on the cell surface is crucial for the binding affinity to target pMHC molecules and enhances signaling through engagement of its cytoplasmic tail (Lyons et al., 2006; Yachi et al., 2006).
[0557] After lentiviral transduction, the Jurkat-Lucia reporters were expanded under puromycin selection, subjected to single cell fluorescence assisted cell sorting (FACS), and the monoclonal populations tested for luciferase expression. This yielded stably transduced reporter cell lines for specific peptide antigens 1, 2, 4, and 5 with functional cell responses. (Table 2).
TABLE-US-00003 TABLE 2 Development of an in vitro T cell activation assay. Peptide-specific T cell recognition as measured by induction of luciferase indicates effective processing and presentation of the vaccine cassette antigens. Short Cassette Design Epitope AAY 1 24.5 ± 0.5 2 11.3 ± 0.4 3* n/a 4 26.1 ± 3.1 5 46.3 ± 1.9 *Reporter T cell for epitope 3 not yet generated
[0558] In another example, a series of short cassettes, all marker epitopes were incorporated in the same position (
TABLE-US-00004 TABLE 3 Evaluation of linker sequences in short cassettes. Luciferase induction in the in vitro T cell activation assay indicated that, apart from the DPP-based cassette, all linkers facilitated efficient release of the cassette antigens. T cell epitope only (no linker) = 9AA, natural linker one side = 17AA, natural linker both sides = 25AA, non-natural linkers = AAY, RR, DPP Short Cassette Designs Epitope 9AA 17AA 25AA AAY RR DPP 1 33.6 ± 0.9 42.8 ± 2.1 42.3 ± 2.3 24.5 ± 0.5 21.7 ± 0.9 0.9 ± 0.1 2 12.0 ± 0.9 10.3 ± 0.6 14.6 ± 04 11.3 ± 0.4 8.5 ± 0.3 1.1 ± 0.2 3* n/a n/a n/a n/a n/a n/a 4 26.6 ± 2.5 16.1 ± 0.6 16.6 ± 0.8 26.1 ± 3.1 12.5 ± 0.8 1.3 ± 0.2 5 29.7 ± 0.6 21.2 ± 0.7 24.3 ± 1.4 46.3 ± 1.9 19.7 ± 0.4 1.3 ± 0.1 *Reporter T cell for epitope 3 not yet generated
[0559] In another example, an additional series of short cassettes were constructed that, besides human and mouse epitopes, contained targeting sequences such as ubiquitin (Ub), MHC and Ig-kappa signal peptides (SP), and/or MHC transmembrane (TM) motifs positioned on either the N- or C-terminus of the cassette. (
TABLE-US-00005 TABLE 4 Evaluation of cellular targeting sequences added to model vaccine cassettes. Employing the in vitro T cell activation assay demonstrated that the four HLA-A*0201 restricted marker epitopes are liberated efficiently from the model cassettes and targeting sequences did not substantially improve T cell recognition and activation. Short Cassette Designs Epitope A B C D E F G H 1 J 1 32.5 ± 1.5 31.8 ± 0.8 29.1 ± 1.2 29.1 ± 1.1 28.4 ± 0.7 20.4 ± 0.5 35.0 ± 1.3 30.3 ± 2.0 22.5 ± 0.9 38.1 ± 1.6 2 6.1 ± 0.2 6.3 ± 0.2 7.6 ± 0.4 7.0 ± 0.5 5.9 ± 0.2 3.7 ± 0.2 7.6 ± 0.4 5.4 ± 0.3 6.2 ± 0.4 6.4 ± 0.3 3* n/a n/a n/a n/a n/a n/a n/a n/a n/a n/a 4 12.3 ± 1.1 14.1 ± 0.7 12.2 ± 0.8 13.7 ± 1.0 11.7 ± 0.8 10.6 ± 0.4 11.0 ± 0.6 7.6 ± 0.6 16.1 ± 0.5 8.7 ± 0.5 5 44.4 ± 2.8 53.6 ± 1.6 49.9 ± 3.3 50.5 ± 2.8 41.7 ± 2.8 36.1 ± 1.1 46.5 ± 2.1 31.4 ± 0.6 75.4 ± 1.6 35.7 ± 2.2 * Reporter.sup.r [ cell for epitope 3 not yet generated
XIV.B.3. In Vivo Evaluation of Antigen Cassette Designs
[0560] As another example of antigen cassette design evaluation, vaccine cassettes were designed to contain 5 well-characterized human class I MHC epitopes known to stimulate CD8 T cells in an HLA-A*02:01 restricted fashion (
[0561] For the short cassettes, all marker epitopes generated a T cell response, as determined by IFN-gamma ELISpot, that was approximately 10-50× stronger of what has been commonly reported (Comet et al., 2006; Depla et al., 2008; Ishioka et al., 1999). Of all the linkers evaluated, the concatamer of 25mer sequences, each containing a minimal epitope flanked by their natural amino acids sequences, generated the largest and broadest T cell response (Table 5). Intracellular cytokine staining (ICS) and flow cytometry analysis revealed that the antigen-specific T cell responses are derived from CD8 T cells.
TABLE-US-00006 TABLE 5 In vivo evaluation of linker sequences in short cassettes. ELISpot data indicated that HLA-A2 transgenic mice, 17 days post-infection with lell adenovirus viral particles, generated a T cell response to all class I MHC restricted epitopes in the cassette. Short Cassette Designs Epitope 9AA 17AA 25AA AAY RR DPP 1 2020 +/− 583 2505 +/− 1281 6844 +/− 956 1489 +/− 762 1675 +/− 690 1781 +/− 774 2 4472 +/− 755 3792 +/− 1319 7629 +/− 996 3851 +/− 1748 4726 +/− 1715 5868 +/− 1427 3 5830 +/− 315 3629 +/− 862 7253 +/− 491 4813 +/− 1761 6779 +/− 1033 7328 +/− 1700 4 5536 +/− 375 2446 +/− 955 2961 +/− 1487 4230 +/− 1759 6518 +/− 909 7222 +/− 1824 5 8800 +/− 0 7943 +/− 821 8423+7-442 8312 +/− 696 8800 +/− 0 1836 +/− 328
[0562] In another example, a series of long vaccine cassettes was constructed and incorporated in adenoviral vectors that, next to the original 5 marker epitopes, contained an additional 16 HLA-A*02:01, A*03:01 and B*44:05 epitopes with known CD8 T cell reactivity (
TABLE-US-00007 TABLE 6 In vivo evaluation of the impact of epitope position in long cassettes. ELISpot data indicated that HLA-A2 transgenic mice, 17 days post-infection with 5e10 adenovirus viral particles, generated a T cell response comparable in magnitude for both long and short vaccine cassettes. Long Cassette Designs Epitope Standard Scrambled Short 1 863 +/− 1080 804 +/− 1113 1871 +/− 2859 2 6425 +/− 1594 28 +/− 62 5390 +/− 1357 3* 23 +/− 30 36 +/− 18 0 +/− 48 4 2224 +/− 1074 2727 +/− 644 2637 +/− 1673 5 7952 +/− 297 8100 +/− 0 8100 +/− 0 *Suspected technical error caused an absence of a T cell response.
XIV.B.4. Antigen Cassette Design for Immunogenicity and Toxicology Studies
[0563] In summary, the findings of the model cassette evaluations (
[0564] As a further example, based on the in vitro and in vivo data obtained with model cassettes (
XIV.B.5. Antigen Cassette Design and Evaluation for 30, 40, and 50 Antigens
[0565] Large antigen cassettes were designed that had either 30 (L), 40 (XL) or 50 (XXL) epitopes, each 25 amino acids in length. The epitopes were a mix of human, NHP and mouse epitopes to model disease antigens including tumor antigens.
[0566] These cassettes were cloned into the chAd68 and alphavirus vaccine vectors as described to evaluate the efficacy of longer multiple-epitope cassettes.
[0567] Mice were immunized as described to evaluate the efficacy of the large cassettes. T cell responses were analyzed by ICS and tetramer staining following immunization with a chAd68 vector (
TABLE-US-00008 TABLE 37 Human epitopes in large cassettes (SEQ ID NO 29367-29369, 29365-29366, 29402-29414, 29374, and 29415-29425, respectively, in order of columns) Epitope position in each cassette Minimal L XL XXL Name epitope 25 mer MHC Restriction Strain Species 3 3 3 5.influenza GILGFVFTL PILSPLTKGILGF Class 1 A*02:01 Human Human M VFTLTVPSERGL 6 6 6 4.HTLV-1 Tax LLFGYPVYV HFPGFGQSLLFGY Class 1 A*02:01 Human Human PVYVFGDCVQGD 9 9 9 3.EBV BMLF1 GLCTLVAML RMQAIQNAGLCTL Class 1 A*02:01 Human Human VAMLEETIFWLQ 12 12 12 1.HCMV pp65 NLVPMVATV WQAGILARNLVPM Class 1 A*02:01 Human Human VATVQGQNLKYQ 15 15 15 2.EBV LMP2A CLGGLLTMV RTYGPVFMCLGGL Class 1 A*02:01 Human Human LTMVAGAVWLTV 18 18 18 CT83 NTDNNLAVY SSSGLINSNTDNN Class 1 A*01:01 Human Human LAVYDLSRDILN 21 21 MAGEA6 EVDPIGHVY LVFGIELMEVDPI Class 1 B*35:01 Human Human GHVYIFATCLGL 21 25 25 CT83 LLASSILCA MNFYLLLASSILC Class 1 A*02:01 Human Human ALIVFWKYRRFQ 24 31 28 FOXE1 AIFPGAVPAA AAAAAAAAIFPGA Class 1 A*02:01 Human Human VPAARPPYPGAV 27 35 32 CT83 VYDLSRDIL SNTDNNLAVYDLS Class 1 A*24:02 Human Human RDILNNFPHSIA 30 38 36 MAGE3/6 ASSLPTTMNY DPPQSPQGASSLP Class 1 A*01:01 Human Human TTMNYPLWSQSY 40 40 Influenza PKYVKQNTLK ITYGACPKYVKQN Class 11 DRB1*0101 Human Human HA LAT TLKLATGMRNVP 44 CMV pp65 LPLKMLNIPS SIYVYALPLKMLN Class 11 DRBl*0101 Human Human INVH IPSINVHHYPSA 47 EBV EBNA3A PEQWMFQGAP EGPWVPEQWMFQG Class 11 DRBl*0102 Human Human PSQGT APPSQGTDVVQH 50 CMV pp65 EHPTFTSQYR RGPQYSEHPTFTS Class II DRBl*1101 Human Human IQGKL QYRIQGKLEYRH
TABLE-US-00009 TABLE 38 NHP epitopes in large cassettes (SEQ ID NO 29426-29455, respectively, in order of columns) Epitope position in each cassette Minimal L XL XXL Name epitope 25 mer MHC Restriction Strain Species 1 1 1 Gag CM9 CTPYDINQM MFQALSEGCTPYD Class I Mamu-A*01 Rhesus NHP INQMLNVLGDHQ 4 4 4 Tat TL8 TTPESANL SCISEADATTPES Class I Mamu-A*01 Rhesus NHP ANLGEEILSQLY 7 7 7 EnvCL9 CAPPGYALL WDAIRFRYCAPPG Class I Mamu-A*01 Rhesus NHP YALLRCNDTNYS 10 10 10 Pol SV9 SGPKTNIIV AFLMALTDSGPKT Class I Mamu-A*01 Rhesus NHP NIIVDSQYVMGI 13 13 13 Gag LW9 LSPRTLNAW GNVWVHTPLSPRT Class I Mamu-A*01 Rhesus NHP LNAWVKAVEEKK 16 Env_TL9 TVPWPNASL AFRQVCHTTVPWP Class I Mamu-A*01 Rhesus NHP NASLTPKWNNET 16 16 19 Ag85B PNGTHSWEYW VFNFPPNGTHSWE Class II Mamu-DR*W Rhesus NHP GAQLN YWGAQLNAMKGD 19 19 23 HIV-1 Env YKYKVVKIEP NWRSELYKYKVVK Class II Mamu-DR*W Rhesus NHP LGV IEPLGVAPTKAK 26 Gag TE15 TEEAKQIVQR EKVKHTEEAKQIV Class II Mamu-DRB* Rhesus NHP HLVVE QRHLVVETGTTE 23 30 CFP-10 36-48 AGSLQGQWRG DQVESTAGSLQGQ Class II Mafa-DRB1* Cyno NHP AAG WRGAAGTAAQAA 27 34 CFP-10 71-86 EISTNIRQAG QELDEISTNIRQA Class II Mafa-DRBI* Cyno NHP VQYSRA GVQYSRADEEQQ 22 29 38 Env 338-346 RPKQAWCWF FHSQPINERPKQA Class I Mafa-A1*06 Cyno NHP WCWFGGSWKEAI 25 33 42 Nef 103-111 RPKVPLRTM DDIDEEDDDLVGV Class I Mafa-A1*06 Cyno NHP SVRPKVPLRTMS 28 37 45 Gag 386-394 GPRKPIKCW PFAAAQQRGPRKP Class I Mafa-A1*06 Cyno NHP IKCWNCGKEGHS 48 Nef LT9 LNMADKKET RRLTARGLLNMAD Class I Mafa-B*104 Cyno NHP KKETRTPKKAKA
TABLE-US-00010 TABLE 39 Mouse epitopes in large cassettes (SEQ ID NOS 29362, 29456-29458, 29363, 29459-29493, respectively, in order of columns) Epitope position in each cassette Minimal L XL XXL Name epitope 25 mer MHC Restriction Strain Species 2 2 2 OVA257 SIINFEKL VSGLEQLESIINF Class I H2-Kb B6 Mouse EKLTEWTSSNVM 5 B16-EGP EGPRNQDWL ALLAVGALEGPRN Class I H2-Db B6 Mouse QDWLGVPRQLVT 8 B16-TRP1 TAPDNLGYM VTNTEMFVTAPDN Class I H2-Db B6 Mouse 455-463 LGYMYEVQWPGQ 11 Trp2180-188 SVYDFFVWL TQPQIANCSVYDF Class I H2-Kb B6 Mouse FVWLHYYSVRDT 5 5 14 CT26 AH1-A5 SPSYAYHQF LWPRVTYHSPSYA Class I H2-Ld Balb/C Mouse YHQFERRAKYKR 8 17 CT26 AH1-39 MNKYAYHML LWPRVTYHMNKYA Class I H2-Ld Balb/C Mouse YHMLERRAKYKR 11 20 MC38 Dpagt1 SIIVFNLL GQSLVISASIIVF Class I H2-Kb B6 Mouse NLLELEGDYRDD 14 22 MC38 Adpgk ASMTNMELM GIPVHLELASMTN Class I H2-Db B6 Mouse MELMSSIVHQQV 17 24 MC38 Reps1 AQLANDVVL RVLELFRAAQLAN Class I H2-Db B6 Mouse DVVLQIMELCGA 8 20 27 P815 P1A LPYLGWLVF HRYSLEEILPYLG Class I H2-Ld DBA/2 Mouse 35-44 WLVFAVVTTSFL 11 22 29 P815 P1E GYCGLRGTGV YLSKNPDGYCGLR Class I H2-Kd DBA/2 Mouse GTGVSCPMAIKK 14 24 31 Panc02 LSIFKHKL NEIPFTYEQLSIF Class I H2-Kb B6 Mouse Mesothelir KHKLDKTYPQGY 17 26 33 Panc02 LIWIPALL SRASLLGPGFVLI Class I H2-Kb B6 Mouse Mesothelir WIPALLPALRLS 20 28 35 ID8 FRa SSGHNECPV NWHKGWNWSSGHN Class I H2-Kb B6 Mouse 161-169 ECPVGASCHPFT 23 30 37 ID8 GQKMNAQAI KTLLKVSKGQKMN Class I H2-Db B6 Mouse Mesothelin AQAIALVACYLR 40 26 32 39 OVA-II ISQAVHAAHA ESLKISQAVHAAH Class II I-Ab, I-Ad B6 Mouse EINEAGR AEINEAGREVVG 29 34 41 ESAT-6 MTEQQWNFAG MTEQQWNFAGIEA Class II I-Ab B6 Mouse IEAAASAIQ AASAIQGNVTSI 36 43 TT p30 FNNFTVSFWL DMFNNFTVSFWLR Class II I-Ab Balb/C Mouse RVPKVSASHL VPKVSASHLEQY 39 46 HEL DGSTDYGILQ TNRNTDGSTDYGI Class II I-Ak CBA Mouse INSRW LQINSRWWCNDG 49 MOG MEVGWYRSPF TGMEVGWYRSPFS Class II I-Ab B6 Mouse SRVVHLYRN RVVHLYRNGKDQ
TABLE-US-00011 TABLE 40 Average IFNg+ cells in response to AH1 and SIINFEKL (SEQ ID NO: 29362) peptides in ChAd large cassette treated mice. Data is presented as % of total CD8 cells. Shown is average and standard deviation per group and p-value by ANOVA with Tukey’s test. All p-values compared to MAG 20-antigen cassette. # antigens Antigen Average Standard deviation p-value N 20 SIINFEKL 5.308 0.660 n/a 8 30 SIINFEKL 4.119 1.019 0.978 8 40 SIINFEKL 6.324 0.954 0.986 8 50 SIINFEKL 8.169 1.469 0.751 8 20 AH1 6.405 2.664 n/a 8 30 AH1 4.373 1.442 0.093 8 40 AH1 4.126 1.135 0.050 8 50 AH1 4.216 0.808 0.063 8
TABLE-US-00012 TABLE 41 Average tetramer+ cells for AH1 and SIINFEKL (SEQ ID NO: 29362) antigens in ChAd large cassette treated mice. Data is presented as % of total CD8 cells. Shown is average and standard deviation per group and p-value by ANOVA with Tukey’s test. All p-values compared to MAG 20-antigen cassette. # antigens Antigen Average Standard deviation p-value N 20 SIINFEKL 10.314 2.384 n/a 8 30 SIINFEKL 4.551 2.370 0.003 8 40 SIINFEKL 5.186 3.254 0.009 8 50 SIINFEKL 14.113 3.660 0.072 8 20 AH1 6.864 2.207 n/a 8 30 AH1 4.713 0.922 0.036 8 40 AH1 5.393 1.452 0.223 8 50 AH1 5.860 1.041 0.543 8
TABLE-US-00013 TABLE 42 Average IFNg+ cells in response to AH1 and SIINFEKL (SEQ ID NO: 29362) peptides in SAM large cassette treated mice. Data is presented as % of total CD8 cells. Shown is average and standard deviation per group and p-value by ANOVA with Tukey’s test. All p-values compared to MAG 20-antigen cassette. # antigens Antigen Average Standard deviation p-value N 20 SIINFEKL 1.843 0.422 n/a 8 30 SIINFEKL 2.112 0.522 0.879 7 40 SIINFEKL 1.754 0.978 0.995 7 50 SIINFEKL 1.409 0.766 0.606 8 20 AH1 3.050 0.909 n/a 8 30 AH1 0.618 0.427 1.91E−05 7 40 AH1 1.286 0.284 0.001 7 50 AH1 1.309 1.149 0.001 8
XV. ChAd Antigen Cassette Delivery Vector
XV.A. ChAd Antigen Cassette Delivery Vector Construction
[0568] In one example, Chimpanzee adenovirus (ChAd) was engineered to be a delivery vector for antigen cassettes. In a further example, a full-length ChAdV68 vector was synthesized based on AC_000011.1 (sequence 2 from U.S. Pat. No. 6,083,716) with E1 (nt 457 to 3014) and E3 (nt 27,816-31,332) sequences deleted. Reporter genes under the control of the CMV promoter/enhancer were inserted in place of the deleted E1 sequences. Transfection of this clone into HEK293 cells did not yield infectious virus. To confirm the sequence of the wild-type C68 virus, isolate VR-594 was obtained from the ATCC, passaged, and then independently sequenced (SEQ ID NO:10). When comparing the AC_000011.1 sequence to the ATCC VR-594 sequence (SEQ ID NO:10) of wild-type ChAdV68 virus, 6 nucleotide differences were identified. In one example, a modified ChAdV68 vector was generated based on AC_000011.1, with the corresponding ATCC VR-594 nucleotides substituted at five positions (ChAdV68.5WTnt SEQ ID NO:1).
[0569] In another example, a modified ChAdV68 vector was generated based on AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,816-31,332) sequences deleted and the corresponding ATCC VR-594 nucleotides substituted at four positions. A GFP reporter (ChAdV68.4WTnt.GFP; SEQ ID NO:11) or model neoantigen cassette (ChAdV68.4WTnt.MAG25mer; SEQ ID NO:12) under the control of the CMV promoter/enhancer was inserted in place of deleted E1 sequences.
[0570] In another example, a modified ChAdV68 vector was generated based on AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,125-31,825) sequences deleted and the corresponding ATCC VR-594 nucleotides substituted at five positions. A GFP reporter (ChAdV68.5WTnt.GFP; SEQ ID NO:13) or model neoantigen cassette (ChAdV68.5WTnt.MAG25mer; SEQ ID NO:2) under the control of the CMV promoter/enhancer was inserted in place of deleted E1 sequences.
[0571] Relevant vectors are described below: [0572] Full-Length ChAdVC68 sequence “ChAdV68.5WTnt” (SEQ ID NO:1); AC_000011.1 sequence with corresponding ATCC VR-594 nucleotides substituted at five positions. [0573] ATCC VR-594 C68 (SEQ ID NO:10); Independently sequenced; Full-Length C68 [0574] ChAdV68.4WTnt.GFP (SEQ ID NO:11); AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,816-31,332) sequences deleted; corresponding ATCC VR-594 nucleotides substituted at four positions; GFP reporter under the control of the CMV promoter/enhancer inserted in place of deleted E1 [0575] ChAdV68.4WTnt.MAG25mer (SEQ ID NO:12); AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,816-31,332) sequences deleted; corresponding ATCC VR-594 nucleotides substituted at four positions; model neoantigen cassette under the control of the CMV promoter/enhancer inserted in place of deleted E1 [0576] ChAdV68.5WTnt.GFP (SEQ ID NO:13); AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,125-31,825) sequences deleted; corresponding ATCC VR-594 nucleotides substituted at five positions; GFP reporter under the control of the CMV promoter/enhancer inserted in place of deleted E1
XV.B. ChAd Antigen Cassette Delivery Vector Testing
XV.B.1. ChAd Vector Evaluation Methods and Materials
Transfection of HEK293A Cells Using Lipofectamine
[0577] DNA for the ChAdV68 constructs (ChAdV68.4WTnt.GFP, ChAdV68.5WTnt.GFP, ChAdV68.4WTnt.MAG25mer and ChAdV68.5WTnt.MAG25mer) was prepared and transfected into HEK293A cells using the following protocol.
[0578] 10 ug of plasmid DNA was digested with PacI to liberate the viral genome. DNA was then purified using GeneJet DNA cleanup Micro columns (Thermo Fisher) according to manufacturer's instructions for long DNA fragments, and eluted in 20 ul of pre-heated water; columns were left at 37 degrees for 0.5-1 hours before the elution step.
[0579] HEK293A cells were introduced into 6-well plates at a cell density of 10.sup.6 cells/well 14-18 hours prior to transfection. Cells were overlaid with 1 ml of fresh medium (DMEM-10% hiFBS with pen/strep and glutamate) per well. 1-2 ug of purified DNA was used per well in a transfection with twice the ul volume (2-4 ul) of Lipofectamine2000, according to the manufacturer's protocol. 0.5 ml of OPTI-MEM medium containing the transfection mix was added to the 1 ml of normal growth medium in each well, and left on cells overnight.
[0580] Transfected cell cultures were incubated at 37° C. for at least 5-7 days. If viral plaques were not visible by day 7 post-transfection, cells were split 1:4 or 1:6, and incubated at 37° C. to monitor for plaque development. Alternatively, transfected cells were harvested and subjected to 3 cycles of freezing and thawing and the cell lysates were used to infect HEK293A cells and the cells were incubated until virus plaques were observed.
Transfection of ChAdV68 Vectors into HEK293A Cells Using Calcium Phosphate and Generation of the Tertiary Viral Stock
[0581] DNA for the ChAdV68 constructs (ChAdV68.4WTnt.GFP, ChAdV68.5WTnt.GFP, ChAdV68.4WTnt.MAG25mer, ChAdV68.5WTnt.MAG25mer) was prepared and transfected into HEK293A cells using the following protocol.
[0582] HEK293A cells were seeded one day prior to the transfection at 10.sup.6 cells/well of a 6 well plate in 5% BS/DMEM/1×P/S, 1× Glutamax. Two wells are needed per transfection. Two to four hours prior to transfection the media was changed to fresh media. The ChAdV68.4WTnt.GFP plasmid was linearized with PacI. The linearized DNA was then phenol chloroform extracted and precipitated using one tenth volume of 3M Sodium acetate pH 5.3 and two volumes of 100% ethanol. The precipitated DNA was pelleted by centrifugation at 12,000×g for 5 min before washing 1× with 70% ethanol. The pellet was air dried and re-suspended in 50 μL of sterile water. The DNA concentration was determined using a NanoDrop™ (ThermoFisher) and the volume adjusted to 5 μg of DNA/50 μL.
[0583] 169 μL of sterile water was added to a microfuge tube. 5 μL of 2M CaCl.sub.2) was then added to the water and mixed gently by pipetting. 50 μL of DNA was added dropwise to the CaCl.sub.2) water solution. Twenty six L of 2M CaCl.sub.2) was then added and mixed gently by pipetting twice with a micro-pipetor. This final solution should consist of 5 μg of DNA in 250 μL of 0.25M CaCl.sub.2). A second tube was then prepared containing 250 μL of 2×HBS (Hepes buffered solution). Using a 2 mL sterile pipette attached to a Pipet-Aid air was slowly bubbled through the 2×HBS solution. At the same time the DNA solution in the 0.25M CaCl.sub.2) solution was added in a dropwise fashion. Bubbling was continued for approximately 5 seconds after addition of the final DNA droplet. The solution was then incubated at room temperature for up to 20 minutes before adding to 293A cells. 250 μL of the DNA/Calcium phosphate solution was added dropwise to a monolayer of 293A cells that had been seeded one day prior at 10.sup.6 cells per well of a 6 well plate. The cells were returned to the incubator and incubated overnight. The media was changed 24 h later. After 72 h the cells were split 1:6 into a 6 well plate. The monolayers were monitored daily by light microscopy for evidence of cytopathic effect (CPE). 7-10 days post transfection viral plaques were observed and the monolayer harvested by pipetting the media in the wells to lift the cells. The harvested cells and media were transferred to a 50 mL centrifuge tube followed by three rounds of freeze thawing (at −80° C. and 37° C.). The subsequent lysate, called the primary virus stock was clarified by centrifugation at full speed on a bench top centrifuge (4300×g) and a proportion of the lysate 10-50%) used to infect 293A cells in a T25 flask. The infected cells were incubated for 48 h before harvesting cells and media at complete CPE. The cells were once again harvested, freeze thawed and clarified before using this secondary viral stock to infect a T150 flask seeded at 1.5×10.sup.7 cells per flask. Once complete CPE was achieved at 72 h the media and cells were harvested and treated as with earlier viral stocks to generate a tertiary stock.
Production in 293F Cells
[0584] ChAdV68 virus production was performed in 293F cells grown in 293 FreeStyle™ (ThermoFisher) media in an incubator at 8% C02. On the day of infection cells were diluted to 10.sup.6 cells per mL, with 98% viability and 400 mL were used per production run in 1 L Shake flasks (Corning). 4 mL of the tertiary viral stock with a target MOI of >3.3 was used per infection. The cells were incubated for 48-72 h until the viability was <70% as measured by Trypan blue. The infected cells were then harvested by centrifugation, full speed bench top centrifuge and washed in 1×PBS, re-centrifuged and then re-suspended in 20 mL of 10 mM Tris pH7.4. The cell pellet was lysed by freeze thawing 3× and clarified by centrifugation at 4,300×g for 5 minutes.
Purification by CsCl Centrifugation
[0585] Viral DNA was purified by CsCl centrifugation. Two discontinuous gradient runs were performed. The first to purify virus from cellular components and the second to further refine separation from cellular components and separate defective from infectious particles.
[0586] 10 mL of 1.2 (26.8 μg CsCl dissolved in 92 mL of 10 mM Tris pH 8.0) CsCl was added to polyallomer tubes. Then 8 mL of 1.4 CsCl (53 μg CsCl dissolved in 87 mL of 10 mM Tris pH 8.0) was carefully added using a pipette delivering to the bottom of the tube. The clarified virus was carefully layered on top of the 1.2 layer. If needed more 10 mM Tris was added to balance the tubes. The tubes were then placed in a SW-32Ti rotor and centrifuged for 2 h 30 min at 10° C. The tube was then removed to a laminar flow cabinet and the virus band pulled using an 18 gauge needle and a 10 mL syringe. Care was taken not to remove contaminating host cell DNA and protein. The band was then diluted at least 2× with 10 mM Tris pH 8.0 and layered as before on a discontinuous gradient as described above. The run was performed as described before except that this time the run was performed overnight. The next day the band was pulled with care to avoid pulling any of the defective particle band. The virus was then dialyzed using a Slide-a-Lyzer™ Cassette (Pierce) against ARM buffer (20 mM Tris pH 8.0, 25 mM NaCl, 2.5% Glycerol). This was performed 3×, 1 h per buffer exchange. The virus was then aliquoted for storage at −80° C.
Viral Assays
[0587] VP concentration was performed by using an OD 260 assay based on the extinction coefficient of 1.1×10.sup.12 viral particles (VP) is equivalent to an Absorbance value of 1 at OD260 nm. Two dilutions (1:5 and 1:10) of adenovirus were made in a viral lysis buffer (0.1% SDS, 10 mM Tris pH 7.4, 1 mM EDTA). OD was measured in duplicate at both dilutions and the VP concentration/mL was measured by multiplying the OD260 value X dilution factor X 1.1×10.sup.12VP.
[0588] An infectious unit (IU) titer was calculated by a limiting dilution assay of the viral stock. The virus was initially diluted 100× in DMEM/5% NS/1×PS and then subsequently diluted using 10-fold dilutions down to 1×10.sup.−7. 100 μL of these dilutions were then added to 293A cells that were seeded at least an hour before at 3e5 cells/well of a 24 well plate. This was performed in duplicate. Plates were incubated for 48 h in a CO2 (5%) incubator at 37° C. The cells were then washed with 1×PBS and were then fixed with 100% cold methanol (−20° C.). The plates were then incubated at −20° C. for a minimum of 20 minutes. The wells were washed with 1×PBS then blocked in 1×PBS/0.1% BSA for 1 h at room temperature. A rabbit anti-Ad antibody (Abcam, Cambridge, Mass.) was added at 1:8,000 dilution in blocking buffer (0.25 ml per well) and incubated for 1 h at room temperature. The wells were washed 4× with 0.5 mL PBS per well. A HRP conjugated Goat anti-Rabbit antibody (Bethyl Labs, Montgomery Texas) diluted 1000× was added per well and incubated for 1 h prior to a final round of washing. 5 PBS washes were performed and the plates were developed using DAB (Diaminobenzidine tetrahydrochloride) substrate in Tris buffered saline (0.67 mg/mL DAB in 50 mM Tris pH 7.5, 150 mM NaCl) with 0.01% H.sub.2O.sub.2. Wells were developed for 5 min prior to counting. Cells were counted under a 10× objective using a dilution that gave between 4-40 stained cells per field of view. The field of view that was used was a 0.32 mm.sup.2 grid of which there are equivalent to 625 per field of view on a 24 well plate. The number of infectious viruses/mL can be determined by the number of stained cells per grid multiplied by the number of grids per field of view multiplied by a dilution factor 10. Similarly, when working with GFP expressing cells florescent can be used rather than capsid staining to determine the number of GFP expressing virions per mL.
Immunizations
[0589] C57BL/6J female mice and Balb/c female mice were injected with 1×10.sup.8 viral particles (VP) of ChAdV68.5WTnt.MAG25mer in 100 uL volume, bilateral intramuscular injection (50 uL per leg).
Splenocyte Dissociation
[0590] Spleen and lymph nodes for each mouse were pooled in 3 mL of complete RPMI (RPMI, 10% FBS, penicillin/streptomycin). Mechanical dissociation was performed using the gentleMACS Dissociator (Miltenyi Biotec), following manufacturer's protocol. Dissociated cells were filtered through a 40 micron filter and red blood cells were lysed with ACK lysis buffer (150 mM NH.sub.4Cl, 10 mM KHCO.sub.3, 0.1 mM Na.sub.2EDTA). Cells were filtered again through a 30 micron filter and then resuspended in complete RPMI. Cells were counted on the Attune N×T flow cytometer (Thermo Fisher) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis.
Ex Vivo Enzyme-Linked Immunospot (ELISpot) Analysis
[0591] ELISpot analysis was performed according to ELISpot harmonization guidelines {DOI: 10.1038/nprot.2015.068} with the mouse IFNg ELISpotPLUS kit (MABTECH). 5×10.sup.4 splenocytes were incubated with 10 uM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was terminated by running plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISpot analysis, wells with saturation >50% were recorded as “too numerous to count”. Samples with deviation of replicate wells >10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count+2 x (spot count x % confluence/[100%−% confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.
XV.B.2. Production of ChAdV68 Viral Delivery Particles after DNA Transfection
[0592] In one example, ChAdV68.4WTnt.GFP (
XV.B.3. ChAdV68 Viral Delivery Particles Expansion
[0593] In one example, ChAdV68.4WTnt.GFP, ChAdV68.5WTnt.GFP, and ChAdV68.5WTnt.MAG25mer viruses were expanded in HEK293F cells and a purified virus stock produced 18 days after transfection (
TABLE-US-00014 TABLE 7 Adenoviral vector production in 293F suspension cells Construct Average VP/cell +/− SD Ad5-Vectors (Multiple vectors) 2.96e4 +/− 2.26e4 Ad5-GFP 3.89e4 chAdY25-GFP 1.75e3 +/− 6.03e1 ChAdV68.4WTnt.GFP 1.2e4 +/− 6.5e3 ChAdV68.5WTnt.GFP 1.8e3 ChAdV68.5WTnt.MAG25mer 1.39e3 +/− 1.1e3 *SD is only reported where multiple Production runs have been performed
XV.B.4. Evaluation of Immunogenicity in Tumor Models
[0594] C68 vector expressing mouse tumor antigens were evaluated in mouse immunogenicity studies to demonstrate the C68 vector elicits T-cell responses. T-cell responses to the MHC class I epitope SIINFEKL (SEQ ID NO: 29362) were measured in C57BL/6J female mice and the MHC class I epitope AH1-A5 (Slansky et al., 2000, Immunity 13:529-538) measured in Balb/c mice. As shown in
[0595] Tumor infiltrating lymphocytes were also evaluated in CT26 tumor model evaluating ChAdV and co-administration of an anti-CTLA4 antibody. Mice were implanted with CT26 tumors cells and 7 days after implantation, were immunized with ChAdV vaccine and treated with anti-CTLA4 antibody (clone 9D9) or IgG as a control. Tumor infiltrating lymphocytes were analyzed 12 days after immunization. Tumors from each mouse were dissociated using the gentleMACS Dissociator (Miltenyi Biotec) and mouse tumor dissociation kit (Miltenyi Biotec). Dissociated cells were filtered through a 30 micron filter and resuspended in complete RPMI. Cells were counted on the Attune N×T flow cytometer (Thermo Fisher) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis. Antigen specific cells were identified by MHC-tetramer complexes and co-stained with anti-CD8 and a viability marker. Tumors were harvested 12 days after prime immunization.
[0596] Antigen-specific CD8+ T cells within the tumor comprised a median of 3.3%, 2.2%, or 8.10% of the total live cell population in ChAdV, anti-CTLA4, and ChAdV+anti-CTLA4 treated groups, respectively (
TABLE-US-00015 TABLE 45 Tetramer+ infiltrating CD8 T cell frequencies in CT26 tumors Treatment Median % tetramer+ ChAdV68.5 WTnt.MAG25mer 3.3 (ChAdV) Anti-CTLA4 2.2 ChAdV68.5 WTnt.MAG25mer 8.1 (ChAdV) + anti-CTLA4
XVI. Alphavirus Antigen Cassette Delivery Vector
XVI.A. Alphavirus Delivery Vector Evaluation Materials and Methods
In Vitro Transcription to Generate RNA
[0597] For in vitro testing: plasmid DNA was linearized by restriction digest with PmeI, column purified following manufacturer's protocol (GeneJet DNA cleanup kit, Thermo) and used as template. In vitro transcription was performed using the RiboMAX Large Scale RNA production System (Promega) with the m.sup.7G cap analog (Promega) according to manufacturer's protocol. mRNA was purified using the RNeasy kit (Qiagen) according to manufacturer's protocol.
[0598] For in vivo studies: RNA was generated and purified by TriLInk Biotechnologies and capped with Enzymatic Cap1.
Transfection of RNA
[0599] HEK293A cells were seeded at 6e4 cells/well for 96 wells and 2e5 cells/well for 24 wells, ˜16 hours prior to transfection. Cells were transfected with mRNA using MessengerMAX lipofectamine (Invitrogen) and following manufacturer's protocol. For 96-wells, 0.15 uL of lipofectamine and 10 ng of mRNA was used per well, and for 24-wells, 0.75 uL of lipofectamine and 150 ng of mRNA was used per well. A GFP expressing mRNA (TriLink Biotechnologies) was used as a transfection control.
Luciferase Assay
[0600] Luciferase reporter assay was performed in white-walled 96-well plates with each condition in triplicate using the ONE-Glo luciferase assay (Promega) following manufacturer's protocol. Luminescence was measured using the SpectraMax.
qRT-PCR
[0601] Transfected cells were rinsed and replaced with fresh media 2 hours post transfection to remove any untransfected mRNA. Cells were then harvested at various timepoints in RLT plus lysis buffer (Qiagen), homogenized using a QiaShredder (Qiagen) and RNA was extracted using the RNeasy kit (Qiagen), all according to manufacturer's protocol. Total RNA was quantified using a Nanodrop (Thermo Scientific). qRT-PCR was performed using the Quantitect Probe One-Step RT-PCR kit (Qiagen) on the qTower.sup.3 (Analytik Jena) according to manufacturer's protocol, using 20 ng of total RNA per reaction. Each sample was run in triplicate for each probe. Actin or GusB were used as reference genes. Custom primer/probes were generated by IDT (Table 8).
TABLE-US-00016 TABLE 8 qPCR primers/probes Target Luci Primer1 GTGGTGTGCAGCGAGAATAG (SEQ ID NO: 29376) Primer2 CGCTCGTTGTAGATGTCGTTAG (SEQ ID NO: 29377) Probe /56-FAM/TTGCAGTTC/ZEN/ TTCATGCCCGTGTTG/3IABkFQ/ (SEQ ID NO: 29378) GusB Primer1 GTTTTTGATCCAGACCCAGATG (SEQ ID NO: 29379) Primer2 GCCCATTATTCAGAGCGAGTA (SEQ ID NO: 29380) Probe /56-FAM/TGCAGGGTT/ZEN/ TCACCAGGATCCAC/3IABkFQ/ (SEQ ID NO: 29381) ActB Primer1 CCTTGCACATGCCGGAG (SEQ ID NO: 29382) Primer2 ACAGAGCCTCGCCTTTG (SEQ ID NO: 29383) Probe /56-FAM/TCATCCATG/ ZEN/GTGAGCTGGCGG/3IABkFQ/ (SEQ ID NO: 29384) MAG-25mer Primer1 CTGAAAGCTCGGTTTGCTAATG (SEQ ID NO: 29385) Set1 Primer2 CCATGCTGGAAGAGACAATCT (SEQ ID NO: 29386) Probe /56-FAM/CGTTTCTGA/ZEN/ TGGCGCTGACCGATA/3IABkFQ/ (SEQ ID NO: 29387) MAG-25mer Primer1 TATGCCTATCCTGTCTCCTCTG (SEQ ID NO: 29388) Set2 Primer2 GCTAATGCAGCTAAGTCCTCTC (SEQ ID NO: 29389) Probe /56-FAM/TGTTTACCC/ZEN/ TGACCGTGCCTTCTG/3IABkFQ/ (SEQ ID NO: 29390)
B16-OVA Tumor Model
[0602] C57BL/6J mice were injected in the lower left abdominal flank with 10.sup.5 B16-OVA cells/animal. Tumors were allowed to grow for 3 days prior to immunization.
CT26 Tumor Model
[0603] Balb/c mice were injected in the lower left abdominal flank with 10.sup.6 CT26 cells/animal. Tumors were allowed to grow for 7 days prior to immunization.
Immunizations
[0604] For srRNA vaccine, mice were injected with 10 ug of RNA in 100 uL volume, bilateral intramuscular injection (50 uL per leg). For Ad5 vaccine, mice were injected with 5×10.sup.10 viral particles (VP) in 100 uL volume, bilateral intramuscular injection (50 uL per leg). Animals were injected with anti-CTLA-4 (clone 9D9, BioXcell), anti-PD-1 (clone RMP1-14, BioXcell) or anti-IgG (clone MPC-11, BioXcell), 250 ug dose, 2 times per week, via intraperitoneal injection.
In Vivo Bioluminescent Imaging
[0605] At each timepoint mice were injected with 150 mg/kg luciferin substrate via intraperitoneal injection and bioluminescence was measured using the IVIS In vivo imaging system (PerkinElmer) 10-15 minutes after injection.
Splenocyte Dissociation
[0606] Spleen and lymph nodes for each mouse were pooled in 3 mL of complete RPMI (RPMI, 10% FBS, penicillin/streptomycin). Mechanical dissociation was performed using the gentleMACS Dissociator (Miltenyi Biotec), following manufacturer's protocol. Dissociated cells were filtered through a 40 micron filter and red blood cells were lysed with ACK lysis buffer (150 mM NH.sub.4Cl, 10 mM KHCO.sub.3, 0.1 mM Na.sub.2EDTA). Cells were filtered again through a 30 micron filter and then resuspended in complete RPMI. Cells were counted on the Attune N×T flow cytometer (Thermo Fisher) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis.
Ex Vivo Enzyme-Linked Immunospot (ELISpot) Analysis
[0607] ELISpot analysis was performed according to ELISpot harmonization guidelines {DOI: 10.1038/nprot.2015.068} with the mouse IFNg ELISpotPLUS kit (MABTECH). 5×10.sup.4 splenocytes were incubated with 10 uM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was terminated by running plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISpot analysis, wells with saturation >50% were recorded as “too numerous to count”. Samples with deviation of replicate wells >10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count+2 x (spot count x % confluence/[100%−% confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.
XVI.B. Alphavirus Vector
XVI.B.1. Alphavirus Vector In Vitro Evaluation
[0608] In one implementation of the present invention, a RNA alphavirus backbone for the antigen expression system was generated from a Venezuelan Equine Encephalitis (VEE) (Kinney, 1986, Virology 152: 400-413) based self-replicating RNA (srRNA) vector. In one example, the sequences encoding the structural proteins of VEE located 3′ of the 26S subgenomic promoter were deleted (VEE sequences 7544 to 11,175 deleted; numbering based on Kinney et al 1986; SEQ ID NO:6) and replaced by antigen sequences (SEQ ID NO:14 and SEQ ID NO:4) or a luciferase reporter (e.g., VEE-Luciferase, SEQ ID NO:15) (
TABLE-US-00017 TABLE 9 Expression of luciferase from VEE self-replicating vector increases over time. HEK293A cells transfected with 10 ng of VEE-Luciferase srRNA or 10 ng of non-replicating luciferase mRNA (TriLink L-6307) per well in 96 wells. Luminescence was measured at various times post transfection. Luciferase expression is reported as relative luminescence units (RLU). Each data point is the mean +/− SD of 3 transfected wells. Standard Dev Construct Timepoint (hr) Mean RLU (triplicate wells) mRNA 2 878.6666667 120.7904522 mRNA 5 1847.333333 978.515372 mRNA 9 4847 868.3271273 mRNA 23 8639.333333 751.6816702 SRRNA 2 27 15 SRRNA 5 4884.333333 2955.158935 SRRNA 9 182065.5 16030.81784 SRRNA 23 783658.3333 68985.05538
[0609] In another example, replication of the srRNA was confirmed directly by measuring RNA levels after transfection of either the luciferase encoding srRNA (VEE-Luciferase) or an srRNA encoding a multi-epitope cassette (VEE-MAG25mer) using quantitative reverse transcription polymerase chain reaction (qRT-PCR). An ˜150-fold increase in RNA was observed for the VEE-luciferase srRNA (Table 10), while a 30-50-fold increase in RNA was observed for the VEE-MAG25mer srRNA (Table 11). These data confirm that the VEE srRNA vectors replicate when transfected into cells.
TABLE-US-00018 TABLE 10 Direct measurement of RNA replication in VEE-Luciferase srRNA transfected cells HEK293A cells transfected with VEE-Luciferase srRNA (150 ng per well, 24-well) and RNA levels quantified by qRT-PCR at various times after transfection. Each measurement was normalized based on the Actin reference gene and fold-change relative to the 2 hour timepoint is presented. Timepoint Relative Fold (hr) Luciferase Ct Actin Ct dCt RefdCt ddCt change 2 20.51 18.14 2.38 2.38 0.00 1.00 4 20.09 18.39 1.70 2.38 −0.67 1.59 6 15.50 18.19 −2.69 2.38 5.07 33.51 8 13.51 18.36 −4.85 2.38 −7.22 149.43
TABLE-US-00019 TABLE 11 Direct measurement of RNA replication in VEE-MAG25mer srRNA transfected cells. HEK293 cells transfected with VEE-MAG25mer srRNA (150 ng per well, 24-well) and RNA levels quantified by qRT−PCR at various times after transfection. Each measurement was normalized based on the GusB reference gene and fold-change relative to the 2 hour timepoint is presented. Different lines on the graph represent 2 different qPCR primer/probe sets, both of which detect the epitope cassette region of the srRNA. Primer/ Timepoint GusB Relative probe (hr) Ct Ct dCt RefdCt ddCt Fold-Change Setl 2 18.96 22.41 −3.45 −3.45 0.00 1.00 Setl 4 17.46 22.27 −4.81 −3.45 −1.37 2.58 Setl 6 14.87 22.04 −7.17 −3.45 −3.72 13.21 Setl 8 14.16 22.19 −8.02 −3.45 −4.58 23.86 Setl 24 13.16 22.01 −8.86 −3.45 −5.41 42.52 Setl 36 13.53 22.63 −9.10 −3.45 −5.66 50.45 Set2 2 17.75 22.41 −4.66 −4.66 0.00 1.00 Set2 4 16.66 22.27 −5.61 −4.66 −0.94 1.92 Set2 6 14.22 22.04 −7.82 −4.66 −3.15 8.90 Set2 8 13.18 22.19 −9.01 −4.66 −4.35 20.35 Set2 24 12.22 22.01 −9.80 −4.66 −5.13 35.10 Set2 36 13.08 22.63 −9.55 −4.66 −4.89 29.58
XVI.B.2. Alphavirus Vector In Vivo Evaluation
[0610] In another example, VEE-Luciferase reporter expression was evaluated in vivo. Mice were injected with 10 ug of VEE-Luciferase srRNA encapsulated in lipid nanoparticle (MC3) and imaged at 24 and 48 hours, and 7 and 14 days post injection to determine bioluminescent signal. Luciferase signal was detected at 24 hours post injection and increased over time and appeared to peak at 7 days after srRNA injection (
XVI.B.3. Alphavirus Vector Tumor Model Evaluation
[0611] In one implementation, to determine if the VEE srRNA vector directs antigen-specific immune responses in vivo, a VEE srRNA vector was generated (VEE-UbAAY, SEQ ID NO:14) that expresses 2 different MHC class I mouse tumor epitopes, SIINFEKL (SEQ ID NO: 29362) and AH1-A5 (Slansky et al., 2000, Immunity 13:529-538). The SFL (SIINFEKL; SEQ ID NO: 29362) epitope is expressed by the B16-OVA melanoma cell line, and the AH1-A5 (SPSYAYHQF (SEQ ID NO: 29363); Slansky et al., 2000, Immunity) epitope induces T cells targeting a related epitope (AH1/SPSYVYHQF (SEQ ID NO: 29391); Huang et al., 1996, Proc Natl Acad Sci USA 93:9730-9735) that is expressed by the CT26 colon carcinoma cell line. In one example, for in vivo studies, VEE-UbAAY srRNA was generated by in vitro transcription using T7 polymerase (TriLink Biotechnologies) and encapsulated in a lipid nanoparticle (MC3).
[0612] A strong antigen-specific T-cell response targeting SFL, relative to control, was observed two weeks after immunization of B16-OVA tumor bearing mice with MC3 formulated VEE-UbAAY srRNA. In one example, a median of 3835 spot forming cells (SFC) per 10.sup.6 splenocytes was measured after stimulation with the SFL peptide in ELISpot assays (
TABLE-US-00020 TABLE 12 Results of ELISpot and MHCI-pentamer staining assays 14 days post VEE srRNA immunization in B16-0VA tumor bearing C57BL/6J mice. Pentamer Pentamer SFC/1e6 positive (% SFC/1e6 positive (% Group Mouse splenocytes of CD8) Group Mouse splenocytes of CD8) Control 1 47 0.22 Vax 1 6774 4.92 2 80 0.32 2 2323 1.34 3 0 0.27 3 2997 1.52 4 0 0.29 4 4492 1.86 5 0 0.27 5 4970 3.7 6 0 0.25 6 4.13 7 0 0.23 7 3835 1.66 8 87 0.25 8 3119 1.64 aCTLA4 1 0 0.24 Vax + 1 6232 2.16 2 0 0.26 aCTLA4 2 4242 0.82 3 0 0.39 3 5347 1.57 4 0 0.28 4 6568 2.33 5 0 0.28 5 6269 1.55 6 0 0.28 6 4056 1.74 7 0 0.31 7 4163 1.14 8 6 0.26 8 3667 1.01 * Note that results from mouse #6 in the Vax group were excluded from analysis due to high variability between triplicate wells.
[0613] In another implementation, to mirror a clinical approach, a heterologous prime/boost in the B16-OVA and CT26 mouse tumor models was performed, where tumor bearing mice were immunized first with adenoviral vector expressing the same antigen cassette (Ad5-UbAAY), followed by a boost immunization with the VEE-UbAAY srRNA vaccine 14 days after the Ad5-UbAAY prime. In one example, an antigen-specific immune response was induced by the Ad5-UbAAY vaccine resulting in 7330 (median) SFCs per 10.sup.6 splenocytes measured in the ELISpot assay (
TABLE-US-00021 TABLE 13 Immune monitoring of B16-OVA mice following heterologous prime/boost with Ad5 vaccine prime and srRNA boost. Pentamer Pentamer SFC/1e6 positive SFC/1e6 positive Group Mouse splenocytes (% of CD8) Group Mouse splenocytes (% of CD8) Day 14 Control 1 0 0.10 Vax 1 8514 1.87 2 0 0.09 2 7779 1.91 3 0 0.11 3 6177 3.17 4 46 0.18 4 7945 3.41 5 0 0.11 5 8821 4.51 6 16 0.11 6 6881 2.48 7 0 0.24 7 5365 2.57 8 37 0.10 8 6705 3.98 aCTLA4 1 0 0.08 Vax + 1 9416 2.35 2 29 0.10 aCTLA4 2 7918 3.33 3 0 0.09 3 10153 4.50 4 29 0.09 4 7212 2.98 5 0 0.10 5 11203 4.38 6 49 0.10 6 9784 2.27 7 0 0.10 8 7267 2.87 8 31 0.14 Day 28 Control 2 0 0.17 Vax 1 5033 2.61 4 0 0.15 2 3958 3.08 6 20 0.17 4 3960 3.58 aCTLA4 1 7 0.23 Vax + 4 3460 2.44 2 0 0.18 aCTLA4 5 5670 3.46 3 0 0.14
[0614] In another implementation, similar results were observed after an Ad5-UbAAY prime and VEE-UbAAY srRNA boost in the CT26 mouse model. In one example, an AH1 antigen-specific response was observed after the Ad5-UbAAY prime (day 14) with a mean of 5187 SFCs per 10.sup.6 splenocytes measured in the ELISpot assay (
TABLE-US-00022 TABLE 14 Immune monitoring after heterologous prime/boost in CT26 tumor mouse model Day 12 Day 21 SFC/1e6 SFC/1e6 Group Mouse splenocytes Group Mouse splenocytes Control 1 1799 Control 9 167 2 1442 10 115 3 1235 11 347 aPD1 1 737 aPD1 8 511 2 5230 11 758 3 332 Vax 9 3133 Vax 1 6287 10 2036 2 4086 11 6227 Vax + 1 5363 Vax + 8 3844 aPD1 2 6500 aPD1 9 2071 11 4888
XVII. ChAdV/srRNA Combination Tumor Model Evaluation
[0615] Various dosing protocols using ChAdV68 and self-replicating RNA (srRNA) were evaluated in murine CT26 tumor models.
XVII.A ChAdV/srRNA Combination Tumor Model Evaluation
Methods and Materials
Tumor Injection
[0616] Balb/c mice were injected with the CT26 tumor cell line. 7 days after tumor cell injection, mice were randomized to the different study arms (28-40 mice per group) and treatment initiated. Balb/c mice were injected in the lower left abdominal flank with 10.sup.6 CT26 cells/animal. Tumors were allowed to grow for 7 days prior to immunization. The study arms are described in detail in Table 15.
TABLE-US-00023 TABLE 15 ChAdV/srRNA Combination Tumor Model Evaluation Study Arms Group N Treatment Dose Volume Schedule Route 1 40 chAd68 control 1e11 vp 2× 50 uL day 0 IM srRNA control 10 ug 50 uL day 14, 28, 42 IM Anti-PD1 250 ug 100 uL 2×/week (start day 0) IP 2 40 chAd68 control 1e11 vp 2× 50 uL day 0 IM srRNA control 10 ug 50 uL day 14, 28, 42 IM Anti-IgG 250 ug 100 uL 2×/week (start day 0) IP 3 28 chAd68 vaccine 1e11 vp 2× 50 uL day 0 IM srRNA vaccine 10 ug 50 uL day 14, 28, 42 IM Anti-PD1 250 ug 100 uL 2×/week (start day 0) IP 4 28 chAd68 vaccine 1e11 vp 2× 50 uL day 0 IM srRNA vaccine 10 ug 50 uL day 14, 28, 42 IM Anti-IgG 250 ug 100 uL 2×/week (start day 0) IP 5 28 srRNA vaccine 10 ug 50 uL day 0, 28, 42 IM chAd68 vaccine 1e11 vp 2× 50 uL day 14 IM Anti-PD1 250 ug 100 uL 2×/week (start day 0) IP 6 28 srRNA vaccine 10 ug 50 uL day 0, 28, 42 IM chAd68 vaccine 1e11 vp 2× 50 uL day 14 IM Anti-IgG 250 ug 100 uL 2×/week (start day 0) IP 7 40 srRNA vaccine 10 ug 50 uL day 0, 14, 28, 42 IM Anti-PD1 250 ug 100 uL 2×/week (start day 0) IP 8 40 srRNA vaccine 10 ug 50 uL day 0, 14, 28, 42 IM Anti-IgG 250 ug 100 uL 2×/week (start day 0) IP
Immunizations
[0617] For srRNA vaccine, mice were injected with 10 ug of VEE-MAG25mer srRNA in 100 uL volume, bilateral intramuscular injection (50 uL per leg). For C68 vaccine, mice were injected with 1×10.sup.11 viral particles (VP) of ChAdV68.5WTnt.MAG25mer in 100 uL volume, bilateral intramuscular injection (50 uL per leg). Animals were injected with anti-PD-1 (clone RMP1-14, BioXcell) or anti-IgG (clone MPC-11, BioXcell), 250 ug dose, 2 times per week, via intraperitoneal injection.
Splenocyte Dissociation
[0618] Spleen and lymph nodes for each mouse were pooled in 3 mL of complete RPMI (RPMI, 10% FBS, penicillin/streptomycin). Mechanical dissociation was performed using the gentleMACS Dissociator (Miltenyi Biotec), following manufacturer's protocol. Dissociated cells were filtered through a 40 micron filter and red blood cells were lysed with ACK lysis buffer (150 mM NH.sub.4Cl, 10 mM KHCO.sub.3, 0.1 mM Na.sub.2EDTA). Cells were filtered again through a 30 micron filter and then resuspended in complete RPMI. Cells were counted on the Attune N×T flow cytometer (Thermo Fisher) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis.
Ex Vivo Enzyme-Linked Immunospot (ELISpot) Analysis
[0619] ELISpot analysis was performed according to ELISpot harmonization guidelines {DOI: 10.1038/nprot.2015.068} with the mouse IFNg ELISpotPLUS kit (MABTECH). 5×10.sup.4 splenocytes were incubated with 10 uM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was terminated by running plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISpot analysis, wells with saturation >50% were recorded as “too numerous to count”. Samples with deviation of replicate wells >10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count+2 x (spot count x % confluence/[100%−% confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.
XVI.B ChAdV/srRNA Combination Evaluation in a CT26 Tumor Model
[0620] The immunogenicity and efficacy of the ChAdV68.5WTnt.MAG25mer/VEE-MAG25mer srRNA heterologous prime/boost or VEE-MAG25mer srRNA homologous prime/boost vaccines were evaluated in the CT26 mouse tumor model. Balb/c mice were injected with the CT26 tumor cell line. 7 days after tumor cell injection, mice were randomized to the different study arms and treatment initiated. The study arms are described in detail in Table 15 and more generally in Table 16.
TABLE-US-00024 TABLE 16 Prime/Boost Study Arms Group Prime Boost 1 Control Control 2 Control + anti-PD-1 Control + anti-PD-1 3 ChAdV68.5WTnt.MAG25mer VEE-MAG25mer srRNA 4 ChAdV68.5WTnt.MAG25mer + anti-PD-1 VEE-MAG25mer srRNA + anti-PD-1 5 VEE-MAG25mer srRNA ChAdV68.5WTnt.MAG25mer 6 VEE-MAG25mer srRNA + anti-PD-1 ChAdV68.5WTnt.MAG25mer + anti-PD-1 7 VEE-MAG25mer srRNA VEE-MAG25mer srRNA 8 VEE-MAG25mer srRNA + anti-PD-1 VEE-MAG25mer srRNA + anti-PD-1
[0621] Spleens were harvested 14 days after the prime vaccination for immune monitoring. Tumor and body weight measurements were taken twice a week and survival was monitored. Strong immune responses relative to control were observed in all active vaccine groups.
[0622] Median cellular immune responses of 10,630, 12,976, 3319, or 3745 spot forming cells (SFCs) per 10.sup.6 splenocytes were observed in ELISpot assays in mice immunized with ChAdV68.5WTnt.MAG25mer (ChAdV/group 3), ChAdV68.5WTnt.MAG25mer+anti-PD-1 (ChAdV+PD-1/group 4), VEE-MAG25mer srRNA (srRNA/median for groups 5 & 7 combined), or VEE-MAG25mer srRNA+anti-PD-1 (srRNA+PD-1/median for groups 6 & 8 combined), respectively, 14 days after the first immunization (
TABLE-US-00025 TABLE 17 Cellular immune responses in a CT26 tumor model Median SFC/ Treatment 10.sup.6 Splenocytes Control 296 PD1 285 ChAdV68.5WTnt.MAG25mer 10630 (ChAdV) ChAdV68.5WTnt.MAG25mer + 12976 PD1 (ChAdV + PD-1) VEE-MAG25mer srRNA 3319 (srRNA) VEE-MAG25mer srRNA + 3745 PD-1 (srRNA + PD1)
[0623] Consistent with the ELISpot data, 5.6, 7.8, 1.8 or 1.9% of CD8 T cells (median) exhibited antigen-specific responses in intracellular cytokine staining (ICS) analyses for mice immunized with ChAdV68.5WTnt.MAG25mer (ChAdV/group 3), ChAdV68.5WTnt.MAG25mer+anti-PD-1 (ChAdV+PD-1/group 4), VEE-MAG25mer srRNA (srRNA/median for groups 5 & 7 combined), or VEE-MAG25mer srRNA+anti-PD-1 (srRNA+PD-1/median for groups 6 & 8 combined), respectively, 14 days after the first immunization (
TABLE-US-00026 TABLE 18 CD8 T-Cell responses in a CT26 tumor model Median % CD8 IFN- Treatment gamma Positive Control 0.21 PD1 0.1 ChAdV68.5WTnt.MAG25mer 5.6 (ChAdV) ChAdV68.5WTnt.MAG25mer + 7.8 PD1 (ChAdV + PD-1) VEE-MAG25mer srRNA 1.8 (srRNA) VEE-MAG25mer srRNA + 1.9 PD-1 (srRNA + PD1)
[0624] Tumor growth was measured in the CT26 colon tumor model for all groups, and tumor growth up to 21 days after treatment initiation (28 days after injection of CT-26 tumor cells) is presented. Mice were sacrificed 21 days after treatment initiation based on large tumor sizes (>2500 mm.sup.3); therefore, only the first 21 days are presented to avoid analytical bias. Mean tumor volumes at 21 days were 1129, 848, 2142, 1418, 2198 and 1606 mm.sup.3 for ChAdV68.5WTnt.MAG25mer prime/VEE-MAG25mer srRNA boost (group 3), ChAdV68.5WTnt.MAG25mer prime/VEE-MAG25mer srRNA boost+anti-PD-1 (group 4), VEE-MAG25mer srRNA prime/ChAdV68.5WTnt.MAG25mer boost (group 5), VEE-MAG25mer srRNA prime/ChAdV68.5WTnt.MAG25mer boost+anti-PD-1 (group 6), VEE-MAG25mer srRNA prime/VEE-MAG25mer srRNA boost (group 7) and VEE-MAG25mer srRNA prime/VEE-MAG25mer srRNA boost+anti-PD-1 (group 8), respectively (
TABLE-US-00027 TABLE 19 Tumor size at day 21 measured in the CT26 model Treatment Tumor Size (mm.sup.3) SEM Control 2361 235 PD1 2067 137 chAdV/srRNA 1129 181 chAdV/srRNA + 848 182 PD1 srRNA/chAdV 2142 233 srRNA/chAdV + 1418 220 PD1 srRNA 2198 134 srRNA + PDl 1606 210
[0625] Survival was monitored for 35 days after treatment initiation in the CT-26 tumor model (42 days after injection of CT-26 tumor cells). Improved survival was observed after vaccination of mice with 4 of the combinations tested. After vaccination, 64%, 46%, 41% and 36% of mice survived with ChAdV68.5WTnt.MAG25mer prime/VEE-MAG25mer srRNA boost in combination with anti-PD-1 (group 4; P<0.0001 relative to control group 1), VEE-MAG25mer srRNA prime/VEE-MAG25mer srRNA boost in combination with anti-PD-1 (group 8; P=0.0006 relative to control group 1), ChAdV68.5WTnt.MAG25mer prime/VEE-MAG25mer srRNA boost (group 3; P=0.0003 relative to control group 1) and VEE-MAG25mer srRNA prime/ChAdV68.5WTnt.MAG25mer boost in combination with anti-PD-1 (group 6; P=0.0016 relative to control group 1), respectively (
TABLE-US-00028 TABLE 20 Survival in the CT26 model chAdV/ srRNA/ chAdV/ srRNA + srRNA/ chAdV + srRNA + Timepoint Control PD1 srRNA PD1 chAdV PD1 srRNA PD1 0 100 100 100 100.00 100.00 100 100 100 21 96 100 100 100 100 95 100 100 24 54 64 91 100 68 82 68 71 28 21 32 68 86 45 68 21 64 31 7 14 41 64 14 36 11 46 35 7 14 41 64 14 36 11 46
[0626] In conclusion, ChAdV68.5WTnt.MAG25mer and VEE-MAG25mer srRNA elicited strong T-cell responses to mouse tumor antigens encoded by the vaccines, relative to control. Administration of a ChAdV68.5WTnt.MAG25mer prime and VEE-MAG25mer srRNA boost with or without co-administration of anti-PD-1, VEE-MAG25mer srRNA prime and ChAdV68.5WTnt.MAG25mer boost in combination with anti-PD-1 or administration of VEE-MAG25mer srRNA as a homologous prime boost immunization in combination with anti-PD-1 to tumor bearing mice resulted in improved survival.
XVIII. Non-Human Primate Studies
[0627] Various dosing protocols using ChAdV68 and self-replicating RNA (srRNA) were evaluated in non-human primates (NHP).
Materials and Methods
[0628] A priming vaccine was injected intramuscularly (IM) in each NHP to initiate the study (vaccine prime). One or more boosting vaccines (vaccine boost) were also injected intramuscularly in each NHP. Bilateral injections per dose were administered according to groups outlined in tables and summarized below.
Immunizations
[0629] Mamu-A*01 Indian rhesus macaques were immunized bilaterally with 1×10.sup.12 viral particles (5×10.sup.11 viral particles per injection) of ChAdV68.5WTnt.MAG25mer, 30 ug of VEE-MAG25MER srRNA, 100 ug of VEE-MAG25mer srRNA or 300 ug of VEE-MAG25mer srRNA formulated in LNP-1 or LNP-2. Vaccine boosts of 30 ug, 100 ug or 300 ug VEE-MAG25mer srRNA were administered intramuscularly at the indicated time after prime vaccination.
Immune Monitoring
[0630] PBMCs were isolated at indicated times after prime vaccination using Lymphocyte Separation Medium (LSM, MP Biomedicals) and LeucoSep separation tubes (Greiner Bio-One) and resuspended in RPMI containing 10% FBS and penicillin/streptomycin. Cells were counted on the Attune N×T flow cytometer (Thermo Fisher) using propidium iodide staining to exclude dead and apoptotic cells. Cell were then adjusted to the appropriate concentration of live cells for subsequent analysis. For each monkey in the studies, T cell responses were measured using ELISpot or flow cytometry methods. T cell responses to 6 different rhesus macaque Mamu-A*01 class I epitopes encoded in the vaccines were monitored from PBMCs by measuring induction of cytokines, such as IFN-gamma, using ex vivo enzyme-linked immunospot (ELISpot) analysis. ELISpot analysis was performed according to ELISpot harmonization guidelines {DOI: 10.1038/nprot.2015.068} with the monkey IFNg ELISpotPLUS kit (MABTECH). 200,000 PBMCs were incubated with 10 uM of the indicated peptides for 16 hours in 96-well IFNg antibody coated plates. Spots were developed using alkaline phosphatase. The reaction was timed for 10 minutes and was terminated by running plate under tap water. Spots were counted using an AID vSpot Reader Spectrum. For ELISpot analysis, wells with saturation >50% were recorded as “too numerous to count”. Samples with deviation of replicate wells >10% were excluded from analysis. Spot counts were then corrected for well confluency using the formula: spot count+2 x (spot count x % confluence/[100%−% confluence]). Negative background was corrected by subtraction of spot counts in the negative peptide stimulation wells from the antigen stimulated wells. Finally, wells labeled too numerous to count were set to the highest observed corrected value, rounded up to the nearest hundred.
[0631] Specific CD4 and CD8 T cell responses to 6 different rhesus macaque Mamu-A*01 class I epitopes encoded in the vaccines were monitored from PBMCs by measuring induction of intracellular cytokines, such as IFN-gamma, using flow cytometry. The results from both methods indicate that cytokines were induced in an antigen-specific manner to epitopes.
[0632] Immunogenicity in Rhesus Macaques
[0633] This study was designed to (a) evaluate the immunogenicity and preliminary safety of VEE-MAG25mer srRNA 30 μg and 100 μg doses as a homologous prime/boost or heterologous prime/boost in combination with ChAdV68.5WTnt.MAG25mer; (b) compare the immune responses of VEE-MAG25mer srRNA in lipid nanoparticles using LNP1 versus LNP2; (c) evaluate the kinetics of T-cell responses to VEE-MAG25mer srRNA and ChAdV68.5WTnt.MAG25mer immunizations.
[0634] The study arm was conducted in Mamu-A*01 Indian rhesus macaques to demonstrate immunogenicity. Select antigens used in this study are only recognized in Rhesus macaques, specifically those with a Mamu-A*01 MHC class I haplotype. Mamu-A*01 Indian rhesus macaques were randomized to the different study arms (6 macaques per group) and administered an IM injection bilaterally with either ChAdV68.5WTnt.MAG25mer or VEE-MAG25mer srRNA vector encoding model antigens that includes multiple Mamu-A*01 restricted epitopes. The study arms were as described below.
TABLE-US-00029 TABLE 21 Non-GLP immunogenicity study in Indian Rhesus Macaques Group Prime Boost 1 Boost 2 1 VEE-MAG25mer VEE-MAG25mer VEE-MAG25mer srRNA-LNP1 srRNA-LNP1 srRNA-LNP1 (30 μg) (30 μg) (30 μg) 2 VEE-MAG25mer VEE-MAG25mer VEE-MAG25mer srRNA-LNP1 srRNA-LNP1 srRNA-LNP1 (100 μg) (100 μg) (100 μg) 3 VEE-MAG25mer VEE-MAG25mer VEE-MAG25mer srRNA-LNP2 srRNA-LNP2 srRNA-LNP2 (100 μg) (100 μg) (100 μg) 4 ChAdV68.5WTnt. VEE-MAG25mer VEE-MAG25mer MAG25mer srRNA-LNP1 srRNA-LNP1 (100 μg) (100 μg)
[0635] PBMCs were collected prior to immunization and on weeks 1, 2, 3, 4, 5, 6, 8, 9, and 10 after the initial immunization for immune monitoring.
[0636] Results
[0637] Antigen-specific cellular immune responses in peripheral blood mononuclear cells (PBMCs) were measured to six different Mamu-A*01 restricted epitopes prior to immunization and 1, 2, 3, 4, 5, 6, 8, 9, and 10 weeks after the initial immunization. Animals received a boost immunization with VEE-MAG25mer srRNA on weeks 4 and 8 with either 30 μg or 100 μg doses, and either formulated with LNP1 or LNP2, as described in Table 21. Combined immune responses to all six epitopes were plotted for each immune monitoring timepoint (
[0638] Combined antigen-specific immune responses were observed at all measurements with 170, 14, 15, 11, 7, 8, 14, 17, 12 SFCs per 10.sup.6 PBMCs (six epitopes combined) 1, 2, 3, 4, 5, 6, 8, 9, or 10 weeks after an initial VEE-MAG25mer srRNA-LNP1 (30 μg) prime immunization, respectively (
[0639] Combined antigen-specific immune responses were observed at all measurements with 1218, 1784, 1866, 973, 1813, 747, 797, 1249, and 547 SFCs per 10.sup.6 PBMCs (six epitopes combined) 1, 2, 3, 4, 5, 6, 8, 9, or 10 weeks after an initial ChAdV68.5WTnt.MAG25mer prime immunization, respectively (
TABLE-US-00030 TABLE 22 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for VEE-MAG25mer srRNA-LNP1 (30 μg) (Group 1) Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 1 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 2 39.7 ± 22.7 35.4 ± 25.1 3.2 ± 3.6 33 ± 28.1 30.9 ± 20.3 28.3 ± 17.5 3 2 ± 2.4 0.2 ± 1.8 1.8 ± 2.4 3.7 ± 1.9 1.7 ± 2.8 4.9 ± 2.3 4 1 ± 1.8 0.3 ± 1.2 5.5 ± 3.6 2.3 ± 2.2 5.7 ± 2.7 0.8 ± 0.8 5 0.5 ± 0.9 1.4 ± 3.8 3.1 ± 1.6 2.3 ± 2.7 1.9 ± 2 1.4 ± 1.2 6 1.9 ± 1.8 −0.3 ± 3 1.7 ± 1.2 1.4 ± 1.4 0.8 ± 1.1 1.1 ± 1 8 −0.4 ± 0.8 −0.9 ± 2.9 0.5 ± 1.3 3 ± 1.1 2.2 ± 2.1 3.7 ± 2 9 1 ± 1.7 1.2 ± 4.2 7.2 ± 3.9 0.5 ± 0.7 1.6 ± 3 3 ± 1 10 3.8 ± 1.8 11 ± 5 −1.1 ± 1.1 1.9 ± 0.9 1.3 ± 1.6 0.2 ± 0.5
TABLE-US-00031 TABLE 23 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for VEE-MAG25mer srRNA-LNP1 (100 μg) (Group 2) Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 1 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 2 7.9 ± 17.2 23.2 ± 17.4 11.4 ± 4.9 41.7 ± 16.5 15 ± 13.5 8.9 ± 6.2 3 −3.1 ± 4.6 −7.2 ± 6.5 2.3 ± 2.3 −0.3 ± 2.7 2.7 ± 5.1 2.2 ± 1.4 4 1.9 ± 3.8 −6.2 ± 7.6 10.5 ± 4.1 1.2 ± 2.9 5.6 ± 4.9 1.1 ± 0.8 5 −2.6 ± 7 −8 ± 5.9 1.5 ± 1.7 6.4 ± 2.3 0.7 ± 4.3 3.3 ± 1.3 6 6.3 ± 6.3 4.4 ± 8.3 6.6 ± 4.4 5.2 ± 5.2 3.9 ± 5 10.8 ± 6.9 8 −3.6 ± 7.2 −6.8 ± 7.3 −0.8 ± 1.2 3.4 ± 4.2 6.4 ± 7.5 5.7 ± 2.7 9 8.1 ± 2.4 20.6 ± 23.4 18.9 ± 5.7 8.1 ± 8.9 9 ± 11.2 40 ± 17.6 10 3.1 ± 8 −3.9 ± 8.5 3.3 ± 1.8 0.6 ± 2.9 7.4 ± 6.4 6.1 ± 2.5
TABLE-US-00032 TABLE 24 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for VEE-MAG25mer srRNA-LNP2 (100 μg) (Group 3) Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 1 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 0 ± 0 2 −5.9 ± 3.8 −0.3 ± 0.5 −0.5 ± 1.5 −5.7 ± 6.1 −1 ± 1.3 −3.2 ± 5.5 3 0.7 ± 5.2 3.4 ± 2.4 4.2 ± 4.6 18.3 ± 15.5 11.9 ± 5.1 −0.4 ± 8.2 4 −3.8 ± 5.5 2.3 ± 1.8 11.3 ± 6.1 −3.1 ± 5.6 8.5 ± 4 −1.5 ± 6.1 5 −3.7 ± 5.7 −0.1 ± 0.7 −0.2 ± 1.6 3.4 ± 8.5 3 ± 3.1 −4.6 ± 5 6 12.3 ± 15 7.8 ± 4.9 24.7 ± 19.8 23.2 ± 22.5 18.7 ± 15.8 0.5 ± 6.2 8 5.9 ± 12.3 −0.1 ± 0.7 −0.5 ± 1.3 8.8 ± 14.4 8.7 ± 8 −1.3 ± 4 9 16.1 ± 13.4 16.5 ± 4 22.9 ± 4.2 13 ± 13.2 16.4 ± 7.8 19.6 ± 9.2 10 29.9 ± 21.8 22 ± 19.5 0.5 ± 2.6 22.2 ± 22.6 35.3 ± 15.8 19.4 ± 17.3
TABLE-US-00033 TABLE 25 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for ChAdV68.5WTnt.MAG25mer prime Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 1 178 ± 68.7 206.5 ± 94.8 221.2 ± 120 15.4 ± 16.7 33.3 ± 25.9 563.5 ± 174.4 2 311.2 ± 165.5 278.8 ± 100.9 344.6 ± 110.8 46.3 ± 13.5 181.6 ± 76.8 621.4 ± 220.9 3 277.3 ± 101.1 359.6 ± 90.5 468.2 ± 106.6 41.7 ± 11.1 169.8 ± 57.8 549.4 ± 115.7 4 140 ± 46.5 169.6 ± 46.8 239.4 ± 37 26.5 ± 11.4 75 ± 31.6 322.2 ± 50.7 5 155.6 ± 62.1 406.7 ± 96.4 542.7 ± 143.3 35.1 ± 16.6 134.2 ± 53.7 538.5 ± 91.9 6 78.9 ± 42.5 95.5 ± 29.4 220.9 ± 75.3 −1.4 ± 5.3 43.4 ± 19.6 308.1 ± 42.6 8 88.4 ± 30.4 162.1 ± 30.3 253.4 ± 78.6 21.4 ± 11.2 53.7 ± 22.3 217.8 ± 45.2 9 158.5 ± 69 322.3 ± 87.2 338.2 ± 137.1 5.6 ± 12.4 109.2 ± 17.9 314.8 ± 43.4 10 97.3 ± 32.5 133.2 ± 27 154.9 ± 59.2 10 ± 6 26 ± 16.7 125.5 ± 27.7
[0640] Non-GLP RNA Dose Ranging Study (Higher Doses) in Indian Rhesus Macaques
[0641] This study was designed to (a) evaluate the immunogenicity of VEE-MAG25mer srRNA at a dose of 300 μg as a homologous prime/boost or heterologous prime/boost in combination with ChAdV68.5WTnt.MAG25mer; (b) compare the immune responses of VEE-MAG25mer srRNA in lipid nanoparticles using LNP1 versus LNP2 at the 300 μg dose; and (c) evaluate the kinetics of T-cell responses to VEE-MAG25mer srRNA and ChAdV68.5WTnt.MAG25mer immunizations.
[0642] The study arm was conducted in Mamu-A*01 Indian rhesus macaques to demonstrate immunogenicity. Vaccine immunogenicity in nonhuman primate species, such as Rhesus, is the best predictor of vaccine potency in humans. Furthermore, select antigens used in this study are only recognized in Rhesus macaques, specifically those with a Mamu-A*01 MHC class I haplotype. Mamu-A*01 Indian rhesus macaques were randomized to the different study arms (6 macaques per group) and administered an IM injection bilaterally with either ChAdV68.5-WTnt.MAG25mer or VEE-MAG25mer srRNA encoding model antigens that includes multiple Mamu-A*01 restricted antigens. The study arms were as described below.
[0643] PBMCs were collected prior to immunization and 4, 5, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 weeks after the initial immunization for immune monitoring for group 1 (heterologous prime/boost). PBMCs were collected prior to immunization and 4, 5, 7, 8, 10, 11, 12, 13, 14, or 15 weeks after the initial immunization for immune monitoring for groups 2 and 3 (homologous prime/boost).
TABLE-US-00034 TABLE 26 Non-GLP immunogenicity study in Indian Rhesus Macaques Group Prime Boost 1 Boost 2 Boost 3 1 ChAdV68.5WTnt. VEE-MAG25mer VEE-MAG25mer VEE-MAG25mer MAG25mer srRNA-LNP2 srRNA-LNP2 srRNA-LNP2 (300 μg) (300 μg) (300 μg) 2 VEE-MAG25mer VEE-MAG25mer VEE-MAG25mer srRNA-LNP2 srRNA-LNP2 srRNA-LNP2 (300 μg) (300 μg) (300 μg) 3 VEE-MAG25mer VEE-MAG25mer VEE-MAG25mer srRNA-LNP1 srRNA-LNP1 srRNA-LNP1 (300 μg) (300 μg) (300 μg)
[0644] Results
[0645] Mamu-A*01 Indian rhesus macaques were immunized with ChAdV68.5-WTnt.MAG25mer. Antigen-specific cellular immune responses in peripheral blood mononuclear cells (PBMCs) were measured to six different Mamu-A*01 restricted epitopes prior to immunization and 4, 5, 6, 7, 8, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23 or 24 weeks after the initial immunization (
[0646] Mamu-A*01 Indian rhesus macaques were also immunized with VEE-MAG25mer srRNA using two different LNP formulations (LNP1 and LNP2). Antigen-specific cellular immune responses in peripheral blood mononuclear cells (PBMCs) were measured to six different Mamu-A*01 restricted epitopes prior to immunization and 4, 5, 6, 7, 8, 10, 11, 12, 13, 14, or 15 weeks after the initial immunization (
TABLE-US-00035 TABLE 27 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for priming vaccination with ChAdV68.5WTnt.MAG25mer (Group 1) Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 4 173 ± 41.6 373.5 ± 87.3 461.4 ± 74.2 38.4 ± 26.1 94.5 ± 26 609.2 ± 121.9 5 412.7 ± 138.4 987.8 ± 283.3 1064.4 ± 266.9 85.6 ± 31.2 367.2 ± 135.2 1306.8 ± 332.8 6 116.2 ± 41.2 231.1 ± 46.3 268.3 ± 90.7 86.1 ± 42 174.3 ± 61 223.9 ± 38.1 7 287.4 ± 148.7 588.9 ± 173.9 693.2 ± 224.8 92.1 ± 33.5 172.9 ± 55.6 694.6 ± 194.8 8 325.4 ± 126.6 735.8 ± 212 948.9 ± 274.5 211.3 ± 62.7 179.1 ± 50 817.3 ± 185.2 10 312 ± 129.7 543.2 ± 188.4 618.6 ± 221.7 −5.7 ± 4.1 136.5 ± 51.3 309.9 ± 85.6 11 248.5 ± 81.1 348.7 ± 129.8 581.1 ± 205.5 −3.1 ± 4.4 119 ± 51.2 413.7 ± 144.8 12 261.9 ± 68.2 329.9 ± 83 486.5 ± 118.6 −1.2 ± 5.1 132.8 ± 31.8 350.9 ± 69.3 13 389.3 ± 167.7 1615.8 ± 418.3 1244.3 ± 403.6 1.3 ± 8.1 522.5 ± 155 1303.3 ± 385.6 14 406.3 ± 121.6 1616 ± 491.7 1142.3 ± 247.2 6.6 ± 11.1 322.7 ± 94.1 1048.6 ± 215.6 15 446.8 ± 138.7 1700.8 ± 469.1 1306.3 ± 294.4 43 ± 24.5 421.2 ± 87.9 1001.5 ± 236.4 16 686.8 ± 268.8 1979.5 ± 541.7 1616.8 ± 411.8 2.4 ± 7.8 381.9 ± 116.4 1152.8 ± 352.7 17 375.8 ± 109.3 1378.6 ± 561.2 773.1 ± 210.3 −1.4 ± 4.3 177.6 ± 93.7 691.7 ± 245 18 255.9 ± 499.7 1538.4 ± 498.1 498.7 ± 152.3 −5.3 ± 3.3 26.2 ± 13.4 413.9 ± 164.8 19 133 ± 62.6 955.9 ± 456.8 491.1 ± 121.8 −5.7 ± 4.1 50.3 ± 25.4 371.2 ± 123.7 20 163.7 ± 55.8 641.7 ± 313.5 357.9 ± 91.1 2.6 ± 7.5 41.4 ± 24.2 257.8 ± 68.9 21 319.9 ± 160.5 2017.1 ± 419.9 1204.8 ± 335.2 −3.7 ± 5.1 268.1 ± 109.6 924.1 ± 301 22 244.7 ± 105.6 1370.9 ± 563.5 780.3 ± 390 −3.6 ± 5.1 118.2 ± 68.1 473.3 ± 249.3 23 176.7 ± 81.8 1263.7 ± 527.3 838.6 ± 367.9 −5.7 ± 4.1 73.6 ± 49 480.9 ± 163.9 24 236.5 ± 92 1324.7 ± 589.3 879.7 ± 321 −0.4 ± 5.7 104 ± 53.1 498 ± 135.8
TABLE-US-00036 TABLE 28 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for priming vaccination with VEE-MAG25mer srRNA-LNP2 (300 μg) (Group 2) Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 4 46 ± 27.1 18.4 ± 6.8 58.3 ± 45.8 29.9 ± 20.8 4.9 ± 2.3 10.7 ± 4 5 85.4 ± 54 5.2 ± 5.8 52.4 ± 51.2 34.5 ± 35 11.8 ± 12.2 14.4 ± 7.9 7 18.6 ± 32.5 1.9 ± 1.7 59.4 ± 55.7 9.3 ± 10.7 3.3 ± 3 10.7 ± 6.1 8 36.6 ± 39.4 6.3 ± 3.9 48.7 ± 39.9 13.5 ± 8.8 3.8 ± 3.6 17.2 ± 9.7 10 69.1 ± 59.1 4.4 ± 1.9 39.3 ± 38 14.7 ± 10.8 4.4 ± 5.3 8.5 ± 5.3 11 43 ± 38.8 22.6 ± 21.1 30.2 ± 26.2 3.3 ± 2.2 5.8 ± 3.5 40.3 ± 25.5 13 120.4 ± 78.3 68.2 ± 43.9 54.2 ± 36.8 21.8 ± 7.4 17.7 ± 6.1 47.4 ± 27.3 14 76 ± 44.8 28 ± 19.5 65.9 ± 64.3 −0.3 ± 1.3 2.5 ± 2 31.1 ± 26.5 15 58.9 ± 41.4 19.5 ± 15.1 55.4 ± 51 2.5 ± 2 5.5 ± 3.6 20.1 ± 15.7
TABLE-US-00037 TABLE 29 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each epitope ± SEM for priming vaccination with VEE-MAG25mer srRNA-LNP1 (300 μg) (Group 3) Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 4 19.5 ± 8.7 13.3 ± 13.1 16.5 ± 15.3 10.5 ± 7.3 35.9 ± 24.8 92.9 ± 91.6 5 87.9 ± 43.9 12.7 ± 11.7 37.2 ± 31.9 21.1 ± 23.8 13.2 ± 13.7 12.6 ± 13.7 7 21.1 ± 13.3 48.8 ± 48.4 51.7 ± 39.5 9.1 ± 10.5 58.6 ± 55.8 159.4 ± 159 8 47.7 ± 21.7 66.4 ± 52.2 59.8 ± 57.4 49.4 ± 28 79.4 ± 63 133.8 ± 132.1 10 49 ± 30.2 42.2 ± 41.1 139.3 ± 139.3 51.6 ± 51.2 78.2 ± 75.8 131.7 ± 131.6 11 42 ± 26.8 20.9 ± 21.4 177.1 ± 162 −6.3 ± 4.3 104.3 ± 104.1 231.5 ± 230.1 12 40.2 ± 19 20.3 ± 11.9 42.2 ± 46.7 3.7 ± 6.7 57 ± 44.7 70 ± 69.2 13 81.2 ± 48.9 38.2 ± 37.6 259.4 ± 222.2 −4 ± 4.1 164.1 ± 159.3 347.3 ± 343.5 14 34.5 ± 31.8 5.3 ± 11.6 138.6 ± 137.3 −4.7 ± 5.2 52.3 ± 52.9 142.6 ± 142.6 15 49 ± 24 6.7 ± 9.8 167.1 ± 163.8 −6.4 ± 4.2 47.8 ± 42.3 116.6 ± 114.5
[0647] srRNA Dose Ranging Study
[0648] In one implementation of the present invention, an srRNA dose ranging study can be conducted in mamu A01 Indian rhesus macaques to identify which srRNA dose to progress to NHP immunogenicity studies. In one example, Mamu A01 Indian rhesus macaques can be administered with an srRNA vector encoding model antigens that includes multiple mamu A01 restricted epitopes by IM injection. In another example, an anti-CTLA-4 monoclonal antibody can be administered SC proximal to the site of IM vaccine injection to target the vaccine draining lymph node in one group of animals. PBMCs can be collected every 2 weeks after the initial vaccination for immune monitoring. The study arms are described in below (Table 30).
TABLE-US-00038 TABLE 30 Non-GLP RNA dose ranging study in Indian Rhesus Macaques Group Prime Boost 1 Boost 2 1 srRNA-LNP (Low Dose) srRNA-LNP (Low Dose) srRNA-LNP (Low Dose) 2 srRNA-LNP (Mid Dose) srRNA-LNP (Mid Dose) srRNA-LNP (Mid Dose) 3 SrRNA-LNP (High Dose) srRNA-LNP (High Dose) srRNA-LNP (High Dose) 4 srRNA-LNP (High Dose) + srRNA-LNP (High Dose) + srRNA-LNP (High Dose) + anti-CTLA-4 anti-CTLA-4 anti-CTLA-4 * Dose range of srRNA to be determined with the high dose ≤300 μg.
[0649] Immunogenicity Study in Indian Rhesus Macaques
[0650] Vaccine studies were conducted in mamu A01 Indian rhesus macaques (NHPs) to demonstrate immunogenicity using the antigen vectors.
[0651] The time course of CD8+ anti-epitope responses in the immunized NHPs are presented for chAd-MAG immunization alone (
TABLE-US-00039 TABLE 31A CD8+ anti-epitope responses in Rhesus Macaques dosed with chAd-MAG (Group 4). Mean SFC/1e6 splenocytes +/− the standard error is shown Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 4 173 ± 41.6 373.5 ± 87.3 461.4 ± 74.2 38.4 ± 26.1 94.5 ± 26 609.2 ± 121.9 5 412.7 ± 138.4 987.8 ± 283.3 1064.4 ± 266.9 85.6 ± 31.2 367.2 ± 135.2 1306.8 ± 332.8 6 116.2 ± 41.2 231.1 ± 46.3 268.3 ± 90.7 86.1 ± 42 174.3 ± 61 223.9 ± 38.1 7 287.4 ± 148.7 588.9 ± 173.9 693.2 ± 224.8 92.1 ± 33.5 172.9 ± 55.6 694.6 ± 194.8 8 325.4 ± 126.6 735.8 ± 212 948.9 ± 274.5 211.3 ± 62.7 179.1 ± 50 817.3 ± 185.2 10 312 ± 129.7 543.2 ± 188.4 618.6 ± 221.7 −5.7 ± 4.1 136.5 ± 51.3 309.9 ± 85.6 11 248.5 ± 81.1 348.7 ± 129.8 581.1 ± 205.5 −3.1 ± 4.4 119 ± 51.2 413.7 ± 144.8 12 261.9 ± 68.2 329.9 ± 83 486.5 ± 118.6 −1.2 ± 5.1 132.8 ± 31.8 350.9 ± 69.3 13 389.3 ± 167.7 1615.8 ± 418.3 1244.3 ± 403.6 1.3 ± 8.1 522.5 ± 155 1303.3 ± 385.6 14 406.3 ± 121.6 1616 ± 491.7 1142.3 ± 247.2 6.6 ± 11.1 322.7 ± 94.1 1048.6 ± 215.6 15 446.8 ± 138.7 1700.8 ± 469.1 1306.3 ± 294.4 43 ± 24.5 421.2 ± 87.9 1001.5 ± 236.4 16 686.8 ± 268.8 1979.5 ± 541.7 1616.8 ± 411.8 2.4 ± 7.8 381.9 ± 116.4 1152.8 ± 352.7 17 375.8 ± 109.3 1378.6 ± 561.2 773.1 ± 210.3 −1.4 ± 4.3 177.6 ± 93.7 691.7 ± 245 18 255.9 ± 99.7 1538.4 ± 498.1 498.7 ± 152.3 −5.3 ± 3.3 26.2 ± 13.4 413.9 ± 164.8 19 133 ± 62.6 955.9 ± 456.8 491.1 ± 121.8 −5.7 ± 4.1 50.3 ± 25.4 371.2 ± 123.7 20 163.7 ± 55.8 641.7 ± 313.5 357.9 ± 91.1 2.6 ± 7.5 41.4 ± 24.2 257.8 ± 68.9 21 319.9 ± 160.5 2017.1 ± 419.9 1204.8 ± 335.2 −3.7 ± 5.1 268.1 ± 109.6 924.1 ± 301 22 244.7 ± 105.6 1370.9 ± 563.5 780.3 ± 390 −3.6 ± 5.1 118.2 ± 68.1 473.3 ± 249.3 23 176.7 ± 81.8 1263.7 ± 527.3 838.6 ± 367.9 −5.7 ± 4.1 73.6 ± 49 480.9 ± 163.9 24 236.5 ± 92 1324.7 ± 589.3 879.7 ± 321 −0.4 ± 5.7 104 ± 53.1 498 ± 135.8 25 136.4 ± 52.6 1207.1 ± 501.6 924 ± 358.5 6.2 ± 10.5 74.1 ± 34.4 484.6 ± 116.7 26 278.2 ± 114.4 1645 ± 661.7 1170.2 ± 469.9 −2.9 ± 5.7 80.6 ± 55.8 784.4 ± 214.1 27 159 ± 56.8 961.7 ± 547.1 783.6 ± 366.4 −5 ± 4.3 63.6 ± 27.5 402.9 ± 123.4 28 189.6 ± 75.7 1073.1 ± 508.8 668.3 ± 312.5 −5.7 ± 4.1 80.3 ± 38.3 386.4 ± 122 29 155.3 ± 69.1 1102.9 ± 606.1 632.9 ± 235 34.5 ± 24.2 80 ± 35.5 422.5 ± 122.9 30 160.2 ± 59.9 859 ± 440.9 455 ± 209.1 −3 ± 5.3 60.5 ± 28.4 302.7 ± 123.2 31 122.2 ± 49.7 771.1 ± 392.7 582.2 ± 233.5 −5.7 ± 4.1 55.1 ± 27.3 295.2 ± 68.3 32 119.3 ± 28.3 619.4 ± 189.7 566 ± 222.1 −3.7 ± 5.1 21.9 ± 4.5 320.5 ± 76.4 33 380.5 ± 122 1636.1 ± 391.4 1056.2 ± 205.7 −5.7 ± 4.1 154.5 ± 38.5 988.4 ± 287.7 34 1410.8 ± 505.4 972.4 ± 301.5 319.6 ± 89.6 −4.8 ± 4.2 141.1 ± 49.8 1375.5 ± 296.7 37 130.8 ± 29.2 500 ± 156.9 424.9 ± 148.9 −3.5 ± 4.7 77.7 ± 24.6 207.1 ± 42.4 38 167.7 ± 54.8 1390.8 ± 504.7 830.4 ± 329.1 −5.5 ± 4.1 111.8 ± 43.2 516 ± 121.7
TABLE-US-00040 TABLE 31B CD8+ anti-epitope responses in Rhesus Macaques dosed with chAd-MAG plus anti-CTLA4 antibody (Ipilimumab) delivered IV. (Group 5). Mean SFC/1e6 splenocytes +/− the standard error is shown Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 4 1848.1 ± 432.2 1295.7 ± 479.7 1709.8 ± 416.9 513.7 ± 219.8 838.5 ± 221.1 2514.6 ± 246.5 5 1844.1 ± 410.2 2367.5 ± 334.4 1983.1 ± 370.7 732.1 ± 249.4 1429.7 ± 275.3 2517.7 ± 286.5 6 822.4 ± 216.7 1131.2 ± 194.7 796.8 ± 185.8 226.8 ± 70 802.2 ± 101.4 913.5 ± 222.7 7 1147.2 ± 332.9 1066 ± 311.2 1149.8 ± 467.3 267.4 ± 162.6 621.5 ± 283.2 1552.2 ± 395.1 8 1192.7 ± 188.8 1461.5 ± 237.7 1566.9 ± 310.5 522.5 ± 118.6 662.3 ± 142.4 1706 ± 216.7 10 1249 ± 220.3 1170.6 ± 227.7 1297.3 ± 264.7 −0.3 ± 4.4 551.8 ± 90.5 1425.3 ± 142.6 11 934.2 ± 221.7 808 ± 191.3 1003.1 ± 293.4 1.9 ± 4.3 364.2 ± 76.6 1270.8 ± 191.6 12 1106.2 ± 216.6 896.7 ± 190.7 1020.1 ± 243.3 1.3 ± 3.9 436.6 ± 90 1222 ± 155.4 13 2023.8 ± 556.3 3696.7 ± 1.7 2248.5 ± 436.4 −4.5 ± 3.5 2614 ± 406.1 3700 ± 0 14 1278.7 ± 240 2639.5 ± 387 1654.6 ± 381.1 −6 ± 2.1 988.8 ± 197.9 2288.3 ± 298.7 15 1458.9 ± 281.8 2932.5 ± 488.7 1893.4 ± 499 74.6 ± 15.6 1657.8 ± 508.9 2709.1 ± 428.7 16 1556.8 ± 243 2143.8 ± 295.2 2082.8 ± 234.2 −5.8 ± 2.5 1014.6 ± 161.4 2063.7 ± 86.7 17 1527 ± 495.1 2213 ± 677.1 1767.7 ± 391.8 15.1 ± 5.9 633.8 ± 133.9 2890.8 ± 433.9 18 1068.2 ± 279.9 1940.9 ± 204.1 1114.1 ± 216.1 −5.8 ± 2.5 396.6 ± 77.6 1659.4 ± 171.7 19 760.7 ± 362.2 1099.5 ± 438.4 802.7 ± 192.5 −2.4 ± 3.3 262.2 ± 62.2 1118.6 ± 224.2 20 696.3 ± 138.2 954.9 ± 198 765.1 ± 248.4 −1.4 ± 4.4 279.6 ± 89.3 1139 ± 204.5 21 1201.4 ± 327.9 3096 ± 1.9 1901 ± 412.1 −5.8 ± 2.5 1676.3 ± 311.5 2809.3 ± 195.8 22 1442.5 ± 508.3 2944.7 ± 438.6 1528.4 ± 349.6 2.8 ± 5.1 940.7 ± 160.5 2306.3 ± 218.6 23 1400.4 ± 502.2 2757.1 ± 452.9 1604.2 ± 450.1 −5.1 ± 2.3 708.1 ± 162.6 2100.4 ± 362.9 24 1351 ± 585.1 2264.5 ± 496 1080.6 ± 253.8 0.3 ± 6.5 444.2 ± 126.4 1823.7 ± 306.5 25 1211.5 ± 505.2 2160.4 ± 581.8 970.8 ± 235.9 2.5 ± 3.8 450.4 ± 126.9 1626.2 ± 261.3 26 1443 ± 492.5 2485 ± 588 1252.5 ± 326.4 −0.2 ± 6 360.2 ± 92.3 2081.9 ± 331.1 27 896.2 ± 413.3 1686 ± 559.5 751 ± 192.1 −3.7 ± 2.5 247.4 ± 82.8 1364.1 ± 232 28 1147.8 ± 456.9 1912.1 ± 417.1 930.3 ± 211.4 −5.8 ± 2.5 423.9 ± 79.6 1649.3 ± 315 29 1038.5 ± 431.9 1915.2 ± 626.1 786.8 ± 205.9 23.5 ± 8.3 462.8 ± 64 1441.5 ± 249.7 30 730.5 ± 259.3 1078.6 ± 211.5 699.1 ± 156.2 −4.4 ± 2.7 234.4 ± 43.9 1160.6 ± 112.6 31 750.4 ± 328.3 1431 ± 549.9 650.6 ± 141.1 −5.2 ± 3 243.4 ± 56.4 868.9 ± 142.8 32 581.4 ± 227.7 1326.6 ± 505.2 573.3 ± 138 −3.2 ± 4.2 160.8 ± 49.2 936.4 ± 110.4 33 2198.4 ± 403.8 3093.4 ± 123.3 2391.8 ± 378.4 7.1 ± 8.5 1598.1 ± 343.1 2827.5 ± 289.5 34 2654.3 ± 337 2709.9 ± 204.3 1297.5 ± 291.4 0.4 ± 4.2 1091.8 ± 242.9 1924 ± 245.7 37 846.8 ± 301.7 1706.9 ± 196 973.6 ± 149.3 50.5 ± 45.2 777.3 ± 140.2 1478.8 ± 94.3
TABLE-US-00041 TABLE 31C CD8+ anti-epitope responses in Rhesus Macaques dosed with chAd-MAG plus anti-CTLA4 antibody (Ipilimumab) delivered SC (Group 6). Mean SFC/1e6 splenocytes +/− the standard error is shown Antigen Wk Env CL9 Env TL9 Gag CM9 Gag LW9 Pol SV9 Tat TL8 4 598.3 ± 157.4 923.7 ± 306.8 1075.6 ± 171.8 180.5 ± 74.1 752.3 ± 245.8 1955.3 ± 444.4 5 842.2 ± 188.5 1703.7 ± 514.2 1595.8 ± 348.4 352.7 ± 92.3 1598.9 ± 416.8 2163.7 ± 522.1 6 396.4 ± 45.3 728.3 ± 232.7 503.8 ± 151.9 282 ± 69 463.1 ± 135.7 555.2 ± 191.5 7 584.2 ± 177 838.3 ± 254.9 1013.9 ± 349.4 173.6 ± 64.3 507.4 ± 165.7 1222.8 ± 368 8 642.9 ± 134 1128.6 ± 240.6 1259.1 ± 163.8 366.1 ± 72.8 726.7 ± 220.9 1695.6 ± 359.4 10 660.4 ± 211.4 746.9 ± 222.7 944.8 ± 210.2 −1.2 ± 1.9 523.4 ± 230.7 787.3 ± 308.3 11 571.2 ± 162 609.4 ± 194.3 937.9 ± 186.5 −8.9 ± 2.3 511.6 ± 229.6 1033.3 ± 315.7 12 485.3 ± 123.7 489.4 ± 142.7 919.3 ± 214.1 −8.9 ± 2.3 341.6 ± 139.4 1394.7 ± 432.1 13 986.9 ± 154.5 2811.9 ± 411.3 1687.7 ± 344.3 −4.1 ± 5.1 1368.5 ± 294.2 2751 ± 501.9 14 945.9 ± 251.4 2027.7 ± 492.8 1386.7 ± 326.7 −5.7 ± 2.8 708.9 ± 277.1 1588.2 ± 440.1 15 1075.2 ± 322.4 2386 ± 580.7 1606.3 ± 368.1 −5.4 ± 3.2 763.3 ± 248.8 1896.5 ± 507.8 16 1171.8 ± 341.6 2255.1 ± 439.6 1672.2 ± 342.3 −7.8 ± 2.4 1031.6 ± 228.8 1896.4 ± 419.9 17 1118.2 ± 415.4 2156.3 ± 476 1345.3 ± 377.7 −1.1 ± 6.7 573.7 ± 118.8 1614.4 ± 382.3 18 861.3 ± 313.8 2668.2 ± 366.8 1157.2 ± 259.6 −8.9 ± 2.3 481.2 ± 164 1725.8 ± 511.4 19 719.2 ± 294.2 1447.2 ± 285 968 ± 294.5 −2.2 ± 4.6 395.6 ± 106.1 1199.6 ± 289.2 20 651.6 ± 184 1189.8 ± 242.8 947.4 ± 249.8 −8.9 ± 2.3 355 ± 106.3 1234.7 ± 361.7 21 810.3 ± 301.9 2576.2 ± 283.7 1334 ± 363.1 −8.9 ± 2.3 892.2 ± 305 1904.4 ± 448.1 22 775 ± 196.4 2949 ± 409.7 1421.8 ± 309.7 38 ± 27.8 577 ± 144.2 2330.6 ± 572.3 23 584.9 ± 240.2 1977.9 ± 361.4 1209.8 ± 405.1 −7.3 ± 3.2 273.7 ± 93.3 1430.6 ± 363.9 24 485.4 ± 194.4 1819.8 ± 325.5 837.2 ± 261.4 −3.4 ± 4.1 234.4 ± 71.1 943.9 ± 243.3 25 452.3 ± 175 2072 ± 405.7 957.1 ± 293.1 −8.9 ± 2.3 163 ± 43.2 1341.2 ± 394.7 26 517.9 ± 179.1 2616 ± 567.5 1126.6 ± 289 −8.3 ± 2.3 199.9 ± 89.2 1615.7 ± 385.6 27 592.8 ± 171.7 1838.3 ± 372.4 749.3 ± 170.4 −7.3 ± 2.5 325.5 ± 98.7 1110.7 ± 308.8 28 793 ± 228.5 1795.4 ± 332.3 1068.7 ± 210.3 2.5 ± 4.1 553.1 ± 144.3 1480.8 ± 357.1 29 661.8 ± 199.9 2140.6 ± 599.3 1202.7 ± 292.2 −8.7 ± 2.8 558.9 ± 279.2 1424.2 ± 408.6 30 529.1 ± 163.3 1528.2 ± 249.8 840.5 ± 218.3 −8.9 ± 2.3 357.7 ± 149.4 1029.3 ± 335 31 464.8 ± 152.9 1332.2 ± 322.7 726.3 ± 194.3 −8.9 ± 2.3 354.3 ± 158.6 884.4 ± 282 32 612.9 ± 175.3 1584.2 ± 390.2 1058.3 ± 219.8 −8.7 ± 2.8 364.6 ± 149.8 1388.8 ± 467.3 33 1600.2 ± 416.7 2597.4 ± 367.9 2086.4 ± 414.8 −6.3 ± 3.3 893.8 ± 266 2490.6 ± 416.4 34 2814.6 ± 376.2 2713.6 ± 380.8 1888.8 ± 499.4 −7.5 ± 3.1 1288.9 ± 438.9 2428.1 ± 458.9 37 1245.9 ± 471.7 1877.7 ± 291.2 1606.6 ± 441.9 14.2 ± 13 1227.5 ± 348.1 1260.7 ± 342
[0652] Memory Phenotyping in Indian Rhesus Macaques
[0653] Rhesus macaque were immunized with ChAdV68.5WTnt.MAG25mer NEE-MAG25mer srRNA heterologous prime/boost regimen with or without anti-CTLA4, and boosted again with ChAdV68.5WTnt.MAG25mer. Groups were assessed 11 months after the final ChAdV68 administration (study month 18). by ELISpot was performed as described.
[0654] To assess memory, CD8+ T-cells recognizing 4 different rhesus macaque Mamu-A*01 class I epitopes encoded in the vaccines were monitored using dual-color Mamu-A*01 tetramer labeling, with each antigen being represented by a unique double positive combination, and allowed the identification of all 4 antigen-specific populations within a single sample. Memory cell phenotyping was performed by co-staining with the cell surface markers CD45RA and CCR7.
TABLE-US-00042 TABLE 43 Mean spot forming cells (SFC) per 10.sup.6 PBMCs for each animal at both pre-prime and memory assessment time points (18 months). Pre-prime baseline 18 months Tat Gag Env Env Gag Pol Tat Gag Env Env Gag Pol Animal TL8 CM9 TL9 CL9 LW9 SV9 TL8 CM9 TL9 CL9 LW9 SV9 1 1.7 0.0 0.0 5.0 0.0 13.7 683.0 499.2 1100.3 217.5 47.7 205.3 2 0.0 0.0 0.0 0.2 0.1 0.0 773.4 ND 1500.0 509.3 134.5 242.5 3 0.0 0.0 6.7 6.8 10.2 3.3 746.3 167.5 494.1 402.8 140.6 376.0 4 0.0 0.0 0.0 0.0 0.0 0.0 47.6 1023.9 85.1 44.2 44.2 47.6 5 15.3 6.7 18.6 15.6 5.2 12.1 842.4 467.7 1500.0 805.9 527.8 201.8 6 3.1 0.0 0.0 15.5 6.9 5.3 224.3 720.3 849.0 296.9 32.4 121.9 ND = not determined due to technical exclusion
TABLE-US-00043 TABLE 44 Percent Mamu-A*01 tetramer positive out of live CD8+ cells Animal Tat TL8 Gag CM9 Env TL9 Env CL9 1 0.42 0.11 0.19 0.013 2 0.36 0.048 0.033 0.00834 3 0.97 0.051 0.35 0.048 4 0.46 0.083 0.17 0.028 5 0.77 0.45 0.14 0.2 6 0.71 0.16 0.17 0.04
XIX. Identification of MHC/Peptide Target-Reactive T Cells and TCRs
[0655] Target reactive T cells and TCRs are identified for one or more of the antigen/HLA peptides pairs described in Table A, AACR GENIE Results, Table 1.2, and/or Additional MS Validated Neoantigens (see SEQ ID NO: 57-29,357 and SEQ ID NO: 29,512-29,519 and below)
[0656] T cells can be isolated from blood, lymph nodes, or tumors of patients. T cells can be enriched for antigen-specific T cells, e.g., by sorting antigen-MHC tetramer binding cells or by sorting activated cells stimulated in an in vitro co-culture of T cells and antigen-pulsed antigen presenting cells. Various reagents are known in the art for antigen-specific T cell identification including antigen-loaded tetramers and other MHC-based reagents.
[0657] Antigen-relevant alpha-beta (or gamma-delta) TCR dimers can be identified by single cell sequencing of TCRs of antigen-specific T cells. Alternatively, bulk TCR sequencing of antigen-specific T cells can be performed and alpha-beta pairs with a high probability of matching can be determined using a TCR pairing method known in the art.
[0658] Alternatively or in addition, antigen-specific T cells can be obtained through in vitro priming of naïve T cells from healthy donors. T cells obtained from PBMCs, lymph nodes, or cord blood can be repeatedly stimulated by antigen-pulsed antigen presenting cells to prime differentiation of antigen-experienced T cells. TCRs can then be identified similarly as described above for antigen-specific T cells from patients.
XX. Identification of Shared Neoantigens
[0659] We identified shared neoantigens using a series of steps. We obtained a list of common driver mutations classified as “confirmed somatic” from the COSMIC database. For each mutation, we generated candidate neoepitopes (8 to 11-mer peptides), used a TPM of 100, and ran our EDGE prediction model (a deep learning model trained on HLA presented peptides sequenced by MS/MS, as described in international patent application publications WO/2017/106638, WO/2018/195357, and WO/2018/208856, each herein incorporated by reference, in their entirety, for all purposes) across all modeled HLA alleles. Note that each peptide contained at least one mutant amino acid and was not a self-peptide. We then recorded any peptide with an HLA allele that has an EDGE score >0.001. The results are shown in Table A. A total of 10261 shared neoantigen sequences were thus identified and are described in SEQ ID NO: 10,755-21,015. The corresponding HLA allele(s) for each sequence are shown.
[0660] The initial list provided in Table A was further analyzed for level of neoantigen/HLA prevalence in the patient population. “Antigen/HLA prevalence” is calculated as the frequency of antigen (A) in a given population multiplied by the frequency of an HLA allele (B) in the given population. Antigen/HLA prevalence can also refer to mutation/HLA prevalence or neoantigen/HLA prevalence. As part of this analysis, for each mutation, its (A) frequency was obtained across common tumor types in TCGA and recorded at its highest frequency amongst tumor types. (B) For each HLA allele in EDGE, the HLA allele frequency TCGA (a predominantly Caucasian population) was recorded. HLA allele frequencies are described in more detail in Shukla, S. A. et al. (Nat. Biotechnol. 33, 1152-1158 2015), herein incorporated by reference for all purposes. The neoantigen/HLA prevalence was calculated as (A) multiplied by (B). Any neoepitope/HLA pair in Table A that is >0.10% prevalence using this methodology is identified with a “Most Common 1” (2387/10261).
[0661] Additionally, we characterized the prevalence of cancer driver mutations across a large cohort of patient samples representative of the advanced cancer patient population relevant for potential clinical studies. EDGE prediction was performed using the publicly-released AACR Genie v4.1 dataset, which has over 40,000 patients sequenced on NGS cancer gene panels ranging from 50 to 500 genes, from major academic cancer centers including Dana-Farber, Johns Hopkins, M D Anderson, MSKCC, and Vanderbilt. We selected base substitution and indel mutations in lung, microsatellite stable colon, and pancreatic cancers, and required coverage across multiple gene panels. We analyzed each neoantigen peptide paired with each of greater than 90 Class I HLA alleles covered in our EDGE antigen presentation prediction model and recorded the epitopes and corresponding HLA alleles with an EDGE probability of HLA presentation score of >0.001. We then determined the neoantigen/HLA prevalence of those peptide with an EDGE score >0.001, calculated as A*B, where A is the highest frequency of the mutation amongst the three tumor types and B is the HLA allele frequency. We used HLA allele frequencies representative of the population in the USA by examining HLA alleles from the TCGA population and tabulating the frequency for each HLA allele (Shukla, S. A. et al.). Peptides and corresponding HLA alleles that demonstrated a neoantigen/HLA prevalence >0.01% from the analysis are described in SEQ ID NO:21,016-29,357 and referred to as AACR GENIE Results.
[0662] In addition, we analyzed the EDGE prediction run on the available AACR GENIE database of tumor mutations for specific cancer subsets across the following modeled HLA alleles: A0101; A0201; A0205; A0206; A0301; A1101; A2301; A2402; A2501; A2601; A2902; A3001; A3002; A3101; A3201; A3301; A3303; A6801; A6802; B0702; B0801; B1302; B1401; B1402; B1501; B1503; B1510; B1801; B2705; B3501; B3502; B3503; B3508; B3701; B3801; B3901; B3906; B4001; B4002; B4402; B4403; B4901; B5001; B5101; B5501; B5701; B5801; C0102; C0202; C0302; C0303; C0304; C0401; C0501; C0602; C0701; C0702; C0704; C0801; C0802; C1203; C1402; C1502; C1601; C1701
We then recorded any peptide with an HLA allele that has an EDGE score >0.1. The results are shown in
The total Antigen/HLA prevalence of all shared neoantigens combined is indicated (see percentage next to given cancer). Also indicated are the number of distinct HLAs predicted to present the given neoantigen (see number above bar for each specific mutation).As determined from analysis of
XXI. A. Validation of Shared Neoantigen Presentation in Human Tumors
[0669] Mass spectrometry (MS) validation of candidate shared neoantigens was performed using targeted mass spectrometry methods. Nearly 500 frozen resected lung, colorectal and pancreatic tumor samples were homogenized and used for both RNASeq transcriptome sequencing and immunoprecipitation of the HLA/peptide complexes. A peptide target list was generated for each sample by analysis of the transcriptome, whereby recurrent cancer driver mutations, as defined in the AACR Genie v4.1 dataset, were identified and RNA expression levels assessed. The EDGE model of antigen presentation was then applied to the mutation sequence and expression data to prioritize peptides for the targeting list. The peptides from the HLA molecules were eluted and collected using size exclusion to isolate the presented peptides prior to mass spectrometry. Synthetic heavy labeled peptide with the same amino acid sequence was co-loaded with each sample for targeted mass spectrometry. Both coelution of the heavy labeled peptide with the experimental peptide and analysis of the fragmentation pattern we were used to validate a candidate epitope. Mass spectrometry analysis methods are described in more detail in Gillete et al. (Nat Methods. 2013 January;10(1):28-34), herein incorporated by reference in its entirety for all purposes. Shared neoantigen epitopes from driver mutations validated in this manner with sufficient prevalence for further consideration are summarized in Table 32A below, along with sample tumor type and associated HLA alleles.
TABLE-US-00044 TABLE 32A MS-validated neoantigen neoepitopes in human tumors Peptide Patient Tumor Presenting Gene Elution Targeted ID Type HLA* Mutation Time (min.) Peptide A0002082 CRC HLA-A* CTNNB1_S45P 17.2 TTAPPLSGK 03:01 (SEQ ID NO: 29393) A0001877 Lung HLA-A* KRAS_G12C 46.7 KLVVVGACGV 02:01 (SEQ ID NO: 29395) A0002129 Lung HLA-A* KRAS_G12C 46.5 KLVVVGACGV 02:01 (SEQ ID NO: 29395) A0001947 CRC HLA-A* KRAS_G12D 12 VVGADGVGK 11:01 (pep. #1) (SEQ ID NO: 29396) A0001947 CRC HLA-A* KRAS_G12D 23.4 WVGADGVGK 11:01 (pep. #2) (SEQ ID NO: 29397) A0001474 Gastric HLA-A* KRAS_G12V 30.4 WVGAVGVGK 11:01 (SEQ ID NO: 29398) A0001730 Pancreatic HLA-A* KRAS_G12V 18.4 VVGAVGVGK 11:01 (pep. #1) (SEQ ID NO: 29399) A0001730 Pancreatic HLA-A* KRAS_G12V 31.6 WVGAVGVGK 11:01 (pep. #2) (SEQ ID NO: 29398) A0001896 Lung HLA-C* KRAS_G12V 23.6 AVGVGKSAL 01:02 (SEQ ID NO: 29400) A0001966 CRC HLA-A* KRAS_G12V 27.8 WVGAVGVGK 03:01 (SEQ ID NO: 29398) A0001973 Ovarian HLA-A* TP53_K132N 97.7 TYSPALNNMF 24:02 (SEQ ID NO: 29401) A0001983 Ovarian HLA-A* CTNNB1_S37Y 50.9 YLDSGIHYGA 02:01 A0000799 CRC HLA-B* CHD4_K73fs 43.3 TVRAATIL 08:01 *When the same peptide was predicted to be presented by multiple HLA alleles for a patient and detected by MS/MS, it was inferred to be presented by the highest scoring HLA allele by EDGE or both alleles if the scores were sufficiently close
[0670] We further evaluated the MS data with respect to mutations for which peptides were not detected in order to assess the value of narrowly targeting patients with specific HLAs for treatment, e.g., requiring patients to have at least one validated or predicted HLA allele that presents a neoantigen contained in a vaccine cassette.
[0671] For example, in the case of KRAS, we counted the number of patient samples in which KRAS epitope peptides for particular HLA alleles were detected or not detected. (When the same peptide was predicted to be presented by multiple HLA alleles for a patient and detected by MS/MS, it was inferred to be presented by the highest scoring HLA allele by EDGE or both alleles if the scores were sufficiently close). Results are presented in Table 33. Based on these results, several common HLA alleles are not expected to present a given KRAS neoantigen and these KRAS neoantigen/HLA pair can be excluded for purposes of selection criteria for a vaccine cassette design and patient selection in this instance. For example, Table 34 directed to a specific vaccine cassette (see Section XXII below) does not include predicted neoantigen/HLA pair G12D/A*02:01 on the basis that the peptide was not detected in 17 samples tested, and likewise did not include G12V/A*02:01 on the basis that the peptide was not detected in 9 samples tested. In contrast, neoantigen/HLA pair G12D/A*11:01 was considered validated on the basis that the peptide was detected in 1/5 samples tested, and likewise G12V/A*11:01 was considered validated on the basis that the peptide was detected in 2/6 samples tested.
[0672] These results highlight the importance of identifying the relevant neoantigen/HLA pairs for proper HLA type selection in patient selection for treatment with a shared neoantigen vaccine, such as that described in Table 34. Specifically, several common KRAS neoantigen/HLA pairs were excluded for purposes of selection criteria in this case as the MS data suggested a shared neoantigen vaccine would unlikely provide a benefit to a patient with that predicted KRAS neoantigen/HLA pair (e.g., G12D/A*02:01 or G12V/A*02:01).
TABLE-US-00045 TABLE 33 Presentation of KRAS Neoantigens HLA Peptide Number of tested confirmation patient samples Genemutation HLA by MS/MS with MS/MS result KRAS_G12A HLA-A*02:01 N 2 KRAS_G12A HLA-A*02:06 N 1 KRAS_G12A HLA-A*03:01 N 3 KRAS_G12A HLA-B*27:05 N 1 KRAS_G12A HLA-B*35:01 N 1 KRAS_G12A HLA-B*41:02 N 1 KRAS_G12A HLA-B*48:01 N 1 KRAS_G12A HLA-C*08:03 N 1 KRAS_G12C HLA-A*02:01 Y 2 KRAS_G12C HLA-A*02:01 N 2 KRAS_G12C HLA-A*03:01 N 8 KRAS_G12C HLA-A*03:02 N 1 KRAS_G12C HLA-A*68:01 N 1 KRAS_G12C HLA-B*27:05 N 1 KRAS_G12D HLA-A*02:01 N 17 KRAS_G12D HLA-A*02:05 N 2 KRAS_G12D HLA-A*03:01 N 4 KRAS_G12D HLA-A*11:01 Y 1 KRAS_G12D HLA-A*11:01 N 4 KRAS_G12D HLA-A*26:01 N 2 KRAS_G12D HLA-A*31:01 N 4 KRAS_G12D HLA-A*68:01 N 3 KRAS_G12D HLA-B*07:02 N 4 KRAS_G12D HLA-B*08:01 N 1 KRAS_G12D HLA-B*13:02 N 1 KRAS_G12D HLA-B*15:01 N 5 KRAS_G12D HLA-B*27:05 N 2 KRAS_G12D HLA-B*35:01 N 2 KRAS_G12D HLA-B*37:01 N 1 KRAS_G12D HLA-B*38:01 N 2 KRAS_G12D HLA-B*40:01 N 3 KRAS_G12D HLA-B*40:02 N 3 KRAS_G12D HLA-B*44:02 N 1 KRAS_G12D HLA-B*44:03 N 4 KRAS_G12D HLA-B*48:01 N 1 KRAS_G12D HLA-B*50:01 N 1 KRAS_G12D HLA-B*57:01 N 1 KRAS_G12D HLA-C*01:02 N 1 KRAS_G12D HLA-C*02:02 N 1 KRAS_G12D HLA-C*03:03 N 3 KRAS_G12D HLA-C*03:04 N 2 KRAS_G12D HLA-C*04:01 N 8 KRAS_G12D HLA-C*05:01 N 2 KRAS_G12D HLA-C*07:04 N 1 KRAS_G12D HLA-C*08:02 N 2 KRAS_G12D HLA-C*08:03 N 1 KRAS_G12D HLA-C*16:01 N 1 KRAS_G12D HLA-C*17:01 N 1 KRAS_G12R HLA-B*41:02 N 1 KRAS_G12R HLA-C*07:04 N 1 KRAS_G12V HLA-A*02:01 N 9 KRAS_G12V HLA-A*02:05 N 1 KRAS_G12V HLA-A*02:06 N 1 KRAS_G12V HLA-A*03:01 Y 1 KRAS_G12V HLA-A*03:01 N 4 KRAS_G12V HLA-A*11:01 Y 2 KRAS_G12V HLA-A*11:01 N 4 KRAS_G12V HLA-A*25:01 N 3 KRAS_G12V HLA-A*26:01 N 2 KRAS_G12V HLA-A*30:01 N 2 KRAS_G12V HLA-A*31:01 N 2 KRAS_G12V HLA-A*32:01 N 1 KRAS_G12V HLA-A*68:02 N 1 KRAS_G12V HLA-B*07:02 N 6 KRAS_G12V HLA-B*08:01 N 1 KRAS_G12V HLA-B*13:02 N 2 KRAS_G12V HLA-B*14:02 N 1 KRAS_G12V HLA-B*15:01 N 2 KRAS_G12V HLA-B*27:05 N 2 KRAS_G12V HLA-B*39:01 N 1 KRAS_G12V HLA-B*40:01 N 1 KRAS_G12V HLA-B*40:02 N 1 KRAS_G12V HLA-B*41:02 N 1 KRAS_G12V HLA-B*44:05 N 1 KRAS_G12V HLA-B*50:01 N 1 KRAS_G12V HLA-B*51:01 N 1 KRAS_G12V HLA-C*01:02 Y 1 KRAS_G12V HLA-C*01:02 N 1 KRAS_G12V HLA-C*03:03 N 1 KRAS_G12V HLA-C*03:04 N 2 KRAS_G12V HLA-C*08:02 N 2 KRAS_G12V HLA-C*14:02 N 1 KRAS_G12V HLA-C*17:01 N 2 KRAS_G13D HLA-A*02:01 N 2 KRAS_G13D HLA-B*07:02 N 1 KRAS_G13D HLA-B*08:01 N 1 KRAS_G13D HLA-B*35:01 N 1 KRAS_G13D HLA-B*35:03 N 1 KRAS_G13D HLA-B*35:08 N 1 KRAS_G13D HLA-B*38:01 N 1 KRAS_G13D HLA-C*04:01 N 3 KRAS_Q61H HLA-A*01:01 N 1 KRAS_Q61H HLA-A*02:01 N 2 KRAS_Q61H HLA-A*23:01 N 2 KRAS_Q61H HLA-A*29:01 N 1 KRAS_Q61H HLA-A*30:02 N 1 KRAS_Q61H HLA-A*33:01 N 1 KRAS_Q61H HLA-A*68:01 N 1 KRAS_Q61H HLA-B*07:02 N 1 KRAS_Q61H HLA-B*08:01 N 1 KRAS_Q61H HLA-B*18:01 N 1 KRAS_Q61H HLA-B*35:01 N 1 KRAS_Q61H HLA-B*38:01 N 1 KRAS_Q61H HLA-B*40:01 N 1 KRAS_Q61H HLA-B*44:02 N 1 KRAS_Q61H HLA-C*03:04 N 1 KRAS_Q61H HLA-C*05:01 N 2 KRAS_Q61H HLA-C*08:02 N 1
XXL B. Validation of Shared Neoantigen Presentation Using and In Vitro System
[0673] Mass spectrometry (MS) validation for HLA-presentation for candidate shared neoantigens was also performed using targeted mass spectrometry methods and an in vitro single-HLA expression system. Briefly, cell lines were engineered to express a single specific HLA alleles and inducibly express a candidate shared neoantigen.
[0674] Single HLA Allele expressing K562 cell lines were created by traditional transfection methods using reagent kits and the instructions provided. Details are provided below for the methods used but other similar methods could be used.
[0675] To create virus particles for transduction of the HLA genes into K562 cells the plasmids were transfection into Phoenix-ampho cells. Phoenix-ampho cells were introduced into 6 well plates at a density of 5×10.sup.5 cells per well and incubated at 37C overnight prior to transfection. 10 ug of purified DNA was mixed with 10 uL Plus Reagent and brought to 100 uL with pre-warmed Opti-MEM media. Lipofectamine reagent was prepared by mixing 8 uL of Lipofectamine with 92 uL of the pre-warmed Opti-MEM. Both mixtures were incubated at room temperature for 15 prior to mixing the 100 uL of Lipofectamine reagent with the 100 uL of DNA solution and allowing the combined solution to incubate at room temperature for another 15 min. The Phoenix-ampho cells were washed gently by aspirating the media and adding 6 mL of pre-warmed Opti-MEM media to wash the cells. The media was removed from the plated cells. 800 uL of the pre-warmed Opti-MEM was added to the DNA/Lipofectamine mixture to make 1 mL and that solution was added to the plated cells. After the plate was incubated for 3 hrs at 37C, 3 mL of complete media was added and the cells were incubated overnight at 37 C. The complete media was exchanged after the incubation and the cells incubated for another 2 days. Virus particles were collected after the supernatant was passed through a 45 um filter into a new 6 well plate. 20 uL of Plus reagent and 8 uL of Lipofectamine was added to each well with a 15 min room temperature incubation after each addition.
[0676] K562 cells were suspended complete media at a concentration of 5×10.sup.6 per mL. 100 uL of K562 cells were added to each well of the 6 well plate containing the virus particles. The plate was centrifuged at 700×g for 20 min and the cells were incubated for 6 hrs at 37 C. Cells and virus were collected and transferred to T25 flasks with the addition of 7 mL of complete media. The cells were incubated for 3 days prior to a media change which included selection with Puromyocin antibiotic. Live cells were collected and passaged to create stocks of K562 cells expressing a single HLA allele. Overall 25 of these cell lines were created, each with a different HLA expressed, to provide a reagent pool for future experiments.
[0677] A shared neoantigen cassette was created to express 20 shared neoantigens with the mutation centered in a 25mer amino acid chain and was created with no linkers between the entries. This cassette was subcloned into a lentiviral Tet-One Inducible Expression vector system (Clonetech) and lenitvirus was produced in 293T cells by contransfecting the shared neoantigen expression vector with ViraPower (Thermo) packaging plasmids according to manufacturer's specifications. Single HLA Allele expressing K562 cell lines were then transduced with this virus as described above and single cell clones were characterized for shared neoantigen expression. Briefly, expression of the shared neoantigen cassette was placed under control of a doxycycline (DOX)-controlled TRE3G promoter, where administration of DOX leads to expression of the neoantigens via stabilization of the Tet-On 3G transactivator protein that is constitutively expressed on the same plasmid. The TREG3 promoter—Tet-On 3G transactivator system allows titration of DOX to control the level of expression. As shown in
[0678] Cells containing both the single HLA allele and the shared neoantigen cassette were grown to ˜2.5×10.sup.8 cells and pelleted into 15 mL vials. Additionally, cells were plated in limited dilution to prepare single clones of the HLA/Cassette pairing. These single clones were tested to achieve a variety of expression levels of the cassette. Use of cell lines with differing expression levels of the cassette allows for analysis of the system at close to endogenous expression levels. Single clones were also grown to ˜2.5×10.sup.8 cells and pelleted into 15 mL vials. All pellets were washed 2× with cold PBS and frozen to allow for processing for mass spectrometry detection of HLA peptides. Expression levels of the HLA and the cassette was performed using SmartSeq or Tagman assays with appropriate probes.
[0679] For isolation of HLA peptides, each cell pellet was lysed with lysis buffer and centrifuged at 20,000×g for 1 hr to clarify the lysate and the HLA peptide complexes were enriched as previously described (see Section VIIIB. Isolation and Detection of HLA Peptides). Heavy peptides—peptides synthesized with amino acids containing isotopically heavy amino acids—were added to the peptides prior to analysis by MS to aid in confirmation of the identity of the peptides detected.
[0680] As shown in
[0681] The in vitro system described above was used to validate HLA-specific presentation of predicted neoantigens. Results demonstrating validated HLA-specific presentation of predicted neoantigens are shown in Table 32B.
TABLE-US-00046 TABLE 32B MS-validated neoantigen neoepitopes in a single-HLA K562 in vitro system Gene HLAType Size Sequence CTNNB1S45P A*ll:01 9-mer TTAPPLSGK CTNNB1T41A A*ll:01 9-mer ATAPSLSGK KRASG12D A*ll:01 10-mer VVVGADGVGK KRASG12V A*03:01 9-mer VVGAVGVGK KRASG12V A*03:01 10-mer VVVGAVGVGK KRASG12V A*ll:01 9-mer VVGAVGVGK KRASG12V A*ll:01 10-mer VVVGAVGVGK KRASQ61R A*01:01 10-mer ILDTAGREEY TP53R213L A*02:01 9-mer YLDDRNTFL
XXII. A. Selection of Shared Neoantigens for Vaccine Cassette
[0682] A vaccine cassette (“GO-005”) containing 20 shared neoantigens was constructed. Table 34 describes features of the neoantigens selected for the cassette. Shared neoantigens directly detected on the surface of tumor cells by mass spectrometry, as described above in Table 32A, were included in the cassette and the HLA of the epitope was added to the eligible HLA list for the mutations. Neoantigens not independently verified as being presented in our assays were considered validated and added to the cassette if there was compelling literature evidence of tumor presentation (e.g., tumor-infiltrating lymphocytes (TIL) recognizing the neoantigen). KRAS G12D presented by HLA-C*08:02 was considered validated and added based on literature evidence of adoptive cell therapy targeting this neoantigen causing tumor regression in a patient with CRC (Tran et al. N Engl J Med. 2016 Dec. 8; 375(23): 2255-2262). Neoantigens with validated HLA alleles occupied 6 out of 20 slots.
[0683] Additional, rarer neoantigens predicted to be presented by tumor cells, but not yet validated by MS, were used to complement the initial set. Mutations with high EDGE scores were prioritized for inclusion as predicted neoantigens given the strong dependence we observed between EDGE score and probability of detection of candidate shared neoantigen peptides by targeted mass spectrometry (MS) validation experiments (see Section XXI above). Results showing the correlation between EDGE score and the probability of detection of candidate shared neoantigen peptides by targeted MS are shown in
TABLE-US-00047 TABLE 34 Selected Shared Neoantigens in Vaccine Cassette GO-005 Neoantigen/ Neoantigen/ Neoantigen/ HLA HLA HLA Validated Predicted Mean Predicted Prevalence in Prevalence Prevalence Slot Mutation HLA HLA EDGE Score Lung in CRC in Pancreas 1 KRAS_G13D A1101 C0802 0.306 0.07% 0.39% 0.06% 2 KRAS_Q61K A0101 — N/A - validated only 0.05% 0.37% 0.00% NRAS_Q61K 3 TP53_R249M — B3512, 0.524 0.04% 0.00% 0.00% B3503, B3501 4 CTNNB1_S45P A0301, A6801, 0.894 0.13% 0.00% 0.00% A1101 A0302, 5 CTNNB1_S45F A1101 A0301, 0.478 0.08% 0.27% 0.00% A6801 6 ERBB2_Y772_A775dup.sup.a — B1801 0.758 0.11% 0.00% 0.00% 7 KRAS_G12D A1101, — N/A - validated only 0.79% 2.28% 5.45% NRAS_G12D A0301, C0802 8 KRAS_Q61R A0101 — N/A - validated only 0.06% 0.33% 0.47% NRAS_Q61R 9 CTNNB1_T41A A1101 A0301, 0.545 0.00% 0.27% 0.00% A0302, B1510, C0303, C0304 10 TP53_K132N A2402 A2301 0.659 0.04% 0.00% 0.00% 11 KRAS_G12A A0301, — N/A - validated only 0.58% 0.49% 0.00% A1101 12 KRAS_Q61L — A0101 0.792 0.22% 0.08% 0.00% NRAS_Q61L 13 TP53_R213L A0201 A0207, 0.558 0.09% 0.18% 0.00% C0802 14 BRAF_G466V — B1501, 0.604 0.03% 0.05% 0.00% B1503 15 KRAS_G12V A0301, A0302 0.759 2.56% 3.43% 9.89% A1101, C0102 16 KRAS_Q61H A0101 — N/A - validated only 0.42% 0.28% 0.91% NRAS_Q61H 17 CTNNB1_S37F A0101 A2301, 0.554 0.29% 0.00% 0.00% A2402 B1510, B3906 C0501, C1402 C1403 18 TP53_S127Y — A1101, 0.522 0.04% 0.00% 0.00% A0301 19 TP53K132E — A2402, 0.445 0.00% 0.05% 0.00% C1403, A2301 20 KRAS_G12C A0201, — N/A - validated only 5.00% 1.46% 0.63% NRAS_G12C A0301, A1101 .sup.aERBB2_Y772_A775dup is also commonly annotated as A775_G776insYVMA, M774_A775insAYVM, and E770delinsEAYVM. Also, ERBB2 may be referred to as HER2
[0684] Additionally, we determined the total population of patients with at least one HLA allele identified (i.e., either validated or predicted) to present at least one shared neoantigen contained in the shared neoantigen vaccine GO-005 and compared it to the population of patients with the mutations agnostic of whether the patient had the identified allele. Given the GO-005 vaccine cassette from Table 34, to estimate the GO-005 targeted patient population, we collected patient mutation data from AACR Genie. As such patients do not have matching HLA alleles, we sampled HLA alleles from the TCGA population and paired it to the AACR Genie dataset. Then given a tumor type, any patient from AACR Genie with matching both mutation and HLA is labeled positive, and any patient that doesn't meet the criteria is labeled negative. The percent positives give the overall addressable patient population, per tumor type, in Table 35.
[0685] It can be readily appreciated from Table 35 that only a subset of patients who carry a particular mutation also carry the HLA allele likely to present that mutation as a neoantigen. Patients with the mutation, but without the appropriate HLA allele are less likely to benefit from therapy. As an example, whereas an estimated ˜60% of pancreatic cancer patients carry appropriate mutations/neoantigens, more than 2 out of 3 of these patients do not carry the corresponding HLA allele(s). Therefore, a vaccination strategy that considers the relevant mutation and HLA allele pairs as proposed will target just those patients who may benefit. Thus, consideration of epitope presentation by validated or high-scoring predicted HLA is an important step in determining the potential efficacy of a shared neoantigen vaccine.
TABLE-US-00048 TABLE 35 Neoantigen/HLA Prevalence in Target Populations MSS CRC Pancreas Lung GO-005 Targeted Patient 9.0% 17.4% 10.6% Population (cumulative neoantigen/HLA prevalence) HLA agnostic patient population 35.1% 60.8% 32.0% (mutation frequency only)
XXI. B. Shared Neoantigens Vaccine Cassette Sequence Selection
[0686] Shared neoantigen sequences for inclusion in a shared neoantigen vaccine were chosen.
[0687] For KRAS_G13D, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list KRAS_G13D and C0802.
[0688] For KRAS_Q61K or NRAS_Q61K, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list (1) KRAS_Q61K and A0101; or (2) NRAS Q61K, and A0101.
[0689] For TP53_R249M, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list TP53_R249M and at least one of B3512, B3503, and B3501.
[0690] For CTNNB1_S45P, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list CTNNB1_S45P and at least one of A0301, A6801, A0302, and A1101. For example, see relevant sequences shown in Table 32A and Table 32B.
[0691] For CTNNB1_S45F, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list CTNNB1_S45F and at least one of A0301, A1101, and A6801.
[0692] For ERBB2_Y772_A775dup, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list ERBB2_Y772_A775dup and B1801.
[0693] For KRAS_G12D or NRAS_G12D, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list (1) KRAS_G12D and at least one of A1101 and C0802; or (2) NRAS_G12D and at least one of A1101 and C0802. For example, see relevant sequences shown in Table 32A or Table 32B.
[0694] For KRAS_Q61R or NRAS_Q61R, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list (1) KRAS_Q61R and A0101; or (2) NRAS_Q61R and A0101. For example, see relevant sequence shown in Table 32B.
[0695] For CTNNB1_T41A, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list CTNNB1_T41A and at least one of A0301, A0302, A1101, B1510, C0303, and C0304. For example, see relevant sequence shown in Table 32B.
[0696] For TP53_K132N, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list TP53_K132N and at least one of A2402 and A2301. For example, see relevant sequence shown in Table 32A.
[0697] For KRAS_G12A, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list KRAS_G12A.
[0698] For KRAS_Q61L or NRAS_Q61L, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list (1) KRAS_Q61L and A0101; or (2) NRAS_Q61L and A0101.
[0699] For TP53_R213L, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list TP53_R213L and at least one of A0207, C0802, and A0201. For example, see relevant sequence shown in Table 32B.
[0700] For BRAF_G466V, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list BRAF_G466V and at least one of B1501 and B1503.
[0701] For KRAS_G12V, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A, Additional MS Validated Neoantigens, or AACR GENIE Results, where each relevant sequence considered for inclusion was selected by identifying all rows that list KRAS_G12V and at least one of A0301, A1101, C0102, and A0302. For example, see relevant sequences shown in Table 32A and Table 32B.
[0702] For KRAS_Q61H or NRAS_Q61H, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered was selected by identifying all rows that list (1) KRAS_Q61H and A0101; or (2) NRAS_Q61H and A0101.
[0703] For CTNNB1_S37F, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered was selected by identifying all rows that list CTNNB1_S37F and at least one of A2301, A2402, B1510, B3906, C0501, C1402, and C1403.
[0704] For TP53_S127Y, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered was selected by identifying all rows that list TP53_S127Y and at least one of A1101 and A0301.
[0705] For TP53_K132E, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A or AACR GENIE Results, where each relevant sequence considered was selected by identifying all rows that list TP53_K132E and at least one of A2402, C1403, and A2301.
[0706] For KRAS_G12C or NRAS_G12C, the shared neoantigen-encoding sequence for inclusion in the vaccine was selected by reference to Table A 32, or AACR GENIE Results, where each relevant sequence considered was selected by identifying all rows that list (1) KRAS_G12C and A0201; or (2) NRAS_G12C and A0201. For example, see relevant sequences shown in Table 32A.
XXIII. Evaluation of T Cell Recognition of Shared Neoantigens
[0707] We evaluated whether neoantigens induce an immune response in patients. We obtained dissociated tumor cells from a patient with lung adenocarcinoma. Tumor cells were sequenced to determine the patient's HLA and identify mutations. The patient expressed HLA-A*1101 and we identified the KRAS G12V mutation in the tumor. Simultaneously, we sorted and expanded CD45+ cells from the tumor which represent tumor infiltrating lymphocytes (TIL). Expanded TILs were stained with mutated peptide HLA-A*11:01 tetramers to assess immunogenicity of this mutation in the patient.
[0708] Additionally, we evaluated the presence of T cell precursors in the naïve T cell repertoire of healthy donors capable of recognizing a shared neoantigen. Peripheral blood mononuclear cells (PBMCs) were enriched for naïve CD8+ T cells and stained with MHC multimers presenting several of the shared neoantigen candidates present in the vaccine cassette GO-005. As shown in
TABLE-US-00049 TABLE 36 Assessment of Neoantigen Reactive Naïve T cells Precursors Number of healthy donors Number of Mutation/ with precursors neo antigen-specific neoantigen Peptide HLA-restriction (% among donors tested) clonotypes per donor KRAS G12V 1 HLA-A*0301 1 (100%) 46 KRAS G12V 2 HLA-A*0301 2 (100%) Donor 1: 25, Donor 2: No sequence data KRAS G12V 1 HLA-A*1101 2 (100%) No sequence data KRAS G12V 2 HLA-A*1101 2 (100%) Donor 1: 100, Donor 2: No sequence data KRAS G12C 3 HLA-A*0201 1 (100%) No sequence data CTNNB1 S45P 4 HLA-A*0301 1 (100%) 987
XXIV. Selection of Shared Neoantigens and Patient Populations
[0709] One or more of the antigens provided in Table 34, Table A, Table 1.2, Additional MS Validated Neoantigens, or the AACR GENIE Results described herein (SEQ ID NOs: 57-29,364) are used to formulate a vaccine composition as described herein. The vaccine is administered to a patient, e.g., to treat cancer. In certain instances the patient is selected, e.g., using a companion diagnostic or a commonly use cancer gene panel NGS assay such as FoundationOne, FoundationOne CDx, Guardant 360, Guardant OMNI, or MSK IMPACT. Exemplary patient selection criteria are described below. An exemplary shared neoantigen vaccine composition GO-005 targets the mutations described in Table 34.
Patient Selection
[0710] Patient selection for shared neoantigen vaccination is performed by consideration of tumor gene expression, somatic mutation status, and patient HLA type. Specifically, a patient is considered eligible for the vaccine therapy if:
[0711] (a) the patient carries an HLA allele predicted or known to present an epitope included in a vaccine and the patient tumor expresses a gene with the epitope sequence, or
[0712] (b) the patient carries an HLA allele predicted or known to present an epitope included in a vaccine, and the patient tumor carries the mutation giving rise to the epitope sequence, or
[0713] (c) Same as (b), but also requiring that the patient tumor expresses the gene with the mutation above a certain threshold (e.g., 1 TPM or 10 TPM), or
[0714] (d) Same as (b), but also requiring that the patient tumor expresses the mutation above a certain threshold (e.g., at least 1 mutated read observed at the level of RNA)
[0715] (e) Same as (b), but also requiring both additional criteria in (c) and (d)
[0716] (f) Any of the above, but also optionally requiring that loss of the presenting HLA allele is not detected in the tumor
[0717] Gene expression is measured at the RNA or protein level by any of the established methods including RNASeq, microarray, PCR, Nanostring, ISH, Mass spectrometry, or IHC. Thresholds for positivity of gene expression is established by several methods, including: (1) predicted probability of presentation of the epitope by the HLA allele at various gene expression levels, (2) correlation of gene expression and HLA epitope presentation as measured by mass spectrometry, and/or (3) clinical benefits of vaccination attained for patients expressing the genes at various levels. Patient selection is further extended to require positivity for greater than 1 epitope, for examples, at least 2, 3, 4 or 5 epitopes included in the vaccine.
[0718] Somatic mutational status is assessed by any of the established methods, including exome sequencing (NGS DNASeq), targeted exome sequencing (panel of genes), transcriptome sequencing (RNASeq), Sanger sequencing, PCR-based genotyping assays (e.g., Tagman or droplet digital PCR), Mass-spectrometry based methods (e.g., by Sequenom), or any other method known to those skilled in the art.
[0719] Additional new shared neoantigens are identified using any of the methods described, e.g., by mass spectrometry. These newly identified shared neoantigens are incorporated into the vaccine cassettes described herein.
[0720] Previously validated neoantigens are additionally validated as being presented by additional HLA alleles and informs neoantigen selection for the vaccine cassette and/or expands the potential treatable population.
[0721] Inclusions of a new neoantigen enables the broadening of addressable tumor type (eg, EGFR mutated NSCLC) or inclusion of patients with a new tumor type.
XXV. Identification of Shared Antigens
[0722] We identified shared antigen gene-based targets using three computational steps: First, we identified genes with low or no expression in most normal tissues using data available through the Genotype-Tissue Expression (GTEx) Project [1]. We obtained aggregated gene expression data from the Genotype-Tissue Expression (GTEx) Project (version V7p2). This dataset comprised greater than 11,000 post-mortem samples from greater than 700 individuals and greater than 50 different tissue types. Expression was measured using RNA-Seq and computationally processed according to the GTEx standard pipeline (https://www.gtexportal.org/home/documentationPage). Gene expression was calculated using the sum of isoform expressions that were calculated using RSEM v1.2.22 [2].
[0723] Next, we identified which of those genes are aberrantly expressed in cancer samples using data from The Cancer Genome Atlas (TCGA) Research Network: http://cancergenome.nih.gov/. We examined greater than 11,000 samples available from TCGA (Data Release 6.0).
[0724] Finally, in these genes, we identified which peptides are likely to be presented as cell surface antigens by MHC Class I proteins using a deep learning model trained on HLA presented peptides sequenced by MS/MS, as described in international patent application no. PCT/US2016/067159, herein incorporated by reference, in its entirety, for all purposes.
[0725] To identify the common tumor antigens (CTAs; shared antigens), we sought to define criteria to exclude genes that were expressed in normal tissue that were strict enough to ensure tumor specificity, but would account for potential artifacts such as read misalignment. Genes were eligible for inclusion as CTAs if they met the following criteria: The median GTEx expression in each organ that was a part of the brain, heart, or lung was less than 0.1 transcripts per million (TPM) with no one sample exceeding 5 TPM. The median GTEx expression in other essential organs was less than 2 TPM with no one sample exceeding 10 TPM. Expression was ignored for organs classified as non-essential (testis, thyroid, and minor salivary gland). Genes were considered expressed in tumor samples if they had expression in TCGA of greater than 10 TPM in at least 30 samples. Based on literature review, we also added the genes MAGEB4 and MAGEB6.
[0726] We also added the gene CTAG1A/CTAG1B (NY-ESO-1). As it's expression is not accurately quantified using the computational methodology in TCGA Data Release 6.0, we relied on the RSEM calculations available in the TCGA legacy archive (https.//portal.gdc.cancer.gov/legacy-archive) which accounts for multiply mapped reads.
[0727] We then examined the distribution of the expression of the remaining genes across TCGA samples. When we examined the known CTAs, e.g. the MAGE family of genes, we observed that the expression of these genes in log space was generally characterized by a bimodal distribution. This distribution included a left mode around a lower expression value and a right mode (or thick tail) at a higher expression level. This expression pattern is consistent with a biological model in which some minimal expression can be detected at baseline in many samples and higher expression of the gene is observed in a subset of tumors experiencing epigenetic dysregulation. We reviewed the distribution of expression of each gene across TCGA samples and discarded those where we observed only a unimodal distribution with no significant right-hand tail. A small number of genes were eliminated by hand curation, for example, if they were likely to be expressed in a tissue not available in GTEx. This resulted in a set of 59 genes. See Table 46. In Table 46 an X is used to indicate cancers in which the gene is expressed at greater than 10 TPM in at least 1% of cases.
TABLE-US-00050 TABLE 46 Analysis of Expression Levels in Cancer Subtypes Cervival Squamous Cell Brain Carcinoma and Acute Bladder Lower Breast Endocervical Colon Myeloid Adrenocortical Urothelial Grade Invasive Adeno- Cholanglo- Adeno- Esophegal Gene Leukemia Carcinoma Carcinoma Glioma Carcinoma carcinoma carcinoma carcinoma Carcinoma ACTL8 X X X X X X ADAM2 X ADAM7 AMELX X BPIFA2 X CRYGC CT83 X X X X X X X CTAG1A/ X X X X X X X CTAG 1B CTCFL X X DCAF12L1 X DCAF4L2 X X X X DEFB126 X X X DMRT1 X X DPPA2 X X FMR1NB X FTHL17 X X X X GAG El X GAGE12J X X GAGE2A X X X GLYATL3 X X GPRC6A X GSG1L2 IFNK X X X IL22RA2 X X X X INSL4 X X INSL6 X X X X KCNU1 LIN28A X X LUZP4 MAGEA1 X X X X X X X MAGEA10 X X X X MAGEAll X X X X MAGEA3 X X X X X X X MAGEA4 X X X X X MAGEA6 X X X X X X X MAGEA9 X X MAGEB1 X MAGEB2 X X X X X X MAGEB4 X MAGEB6 X MAGECI X X X X MAGEC2 X X X X X MORC1 X PAG El X X X PAGE5 X X X X X PASD1 X X PRDM7 PROKRI R3HDML X SLC7A13 SMCIB X X X X X SMR3A SSXI X X X X STRA8 X X X X TFDP3 X XAGE3 X XAGE5 ZFP42 X X X X X ZNF560 X X X X Head Lymphoid and Kidney Kidney Neoplasm Neck Renal Renal Lung Diffuse Squamous Clear Papillary Liver Lung Squamous Large Gliobatoma Cell Kidney Cell Cell Hepatocellular Adeno- Cell B-cell Gene Multiforme Carcinoma Chromophobe Carcinoma Carcinoma Carcinoma carcinoma Carcinoma Lymphoma ACTL8 X X X X X ADAM2 X ADAM7 X AMELX BPIFA2 X X X X X CRYGC CT83 X X X X X CTAG1A/ X X X X X X CTAG 1B CTCFL X X X DCAF12L1 X X DCAF4L2 X X X X DEFB126 X DMRT1 X X DPPA2 X X X X FMR1NB X FTHL17 X X X X GAG El X X GAGE12J X GAGE2A X X X X X X GLYATL3 X GPRC6A X X GSG1L2 X IFNK X X IL22RA2 X X X X INSL4 X X INSL6 X X KCNU1 X X LIN28A LUZP4 MAGEA1 X X X X X X MAGEA10 X X X MAGEAll X X X X MAGEA3 X X X X X X MAGEA4 X X X X X MAGEA6 X X X X X X MAGEA9 X X X MAGEB1 X X X X X MAGEB2 X X X X X X X MAGEB4 MAGEB6 MAGECI X X X X X X MAGEC2 X X X X X X X X MORC1 PAG El X X X X X PAGE5 X X X X X X X PASD1 X X PRDM7 PROKRI R3HDML SLC7A13 X X X SMCIB X X X X X X SMR3A X X SSXI X X X X STRA8 X X X X X TFDP3 X XAGE3 X XAGE5 X X ZFP42 X X X ZNF560 X X X Ovarian Pheochromo- Serous Pancreatic cytoma Prostate Rectum Skin Stomach Cystadeno- Adeno- and Adeno- Adeno- Cutaneous Adeno- Gene Mesothelioma carcinoma carcinoma Paraganglioma carcinoma carcinoma Sarcoma Melanoma carcinoma ACTL8 X X X X X X X X ADAM2 X ADAM7 X AMELX X X BPIFA2 X X X CRYGC X CT83 X X X X X CTAG1A/ X X X X X X X X CTAG 1B CTCFL X X X DCAF12L1 X X X DCAF4L2 X DEFB126 X DMRT1 X DPPA2 X FMR1NB FTHL17 GAG El X X X X GAGE12J X X X GAGE2A X X X X X GLYATL3 X X GPRC6A GSG1L2 IFNK IL22RA2 INSL4 X INSL6 X X KCNU1 X LIN28A X LUZP4 X MAGEA1 X X X X X X X X MAGEA10 X X X X X MAGEAll X X X X X MAGEA3 X X X X X X X X X MAGEA4 X X X X X MAGEA6 X X X X X X X X MAGEA9 MAGEB1 X X X MAGEB2 X X X X X X MAGEB4 MAGEB6 MAGECI X X X X X MAGEC2 X X X X X X X MORC1 X PAG El X X X X X X PAGE5 X X X X X PASD1 X X X X PRDM7 X PROKRI X R3HDML X SLC7A13 SMCIB X X X SMR3A SSXI X X X X STRA8 X X TFDP3 XAGE3 X X X XAGE5 X X ZFP42 X X X X ZNF560 X X X X X X Uterine Uterine Corpus Thyroid Carcino- Endometrial Uveal Total Gene Thymoma Carcinoma sarcoma Carcinoma Melanoma Indicarions ACTL8 X X X 22 ADAM2 3 ADAM7 2 AMELX X 4 BPIFA2 X 10 CRYGC X 2 CT83 X X 19 CTAG1A/ X X X 24 CTAG 1B CTCFL X X 10 DCAF12L1 X X 8 DCAF4L2 X 10 DEFB126 X 6 DMRT1 X X 7 DPPA2 X 8 FMR1NB X 3 FTHL17 8 GAG El X 8 GAGE12J 6 GAGE2A X X 16 GLYATL3 X X 7 GPRC6A 3 GSG1L2 1 IFNK 5 IL22RA2 8 INSL4 X X 7 INSL6 X X 10 KCNU1 3 LIN28A X X 5 LUZP4 X 2 MAGEA1 X X X 24 MAGEA10 X X 14 MAGEAll X X 15 MAGEA3 X X 24 MAGEA4 X X X 18 MAGEA6 X X 23 MAGEA9 X 6 MAGEB1 X 10 MAGEB2 X X 21 MAGEB4 1 MAGEB6 1 MAGECI X X 17 MAGEC2 X X 22 MORC1 X 2 PAG El X X 16 PAGE5 X X 19 PASD1 X X 10 PRDM7 1 PROKRI X 2 R3HDML 2 SLC7A13 3 SMCIB X 15 SMR3A X X 4 SSXI X X X 15 STRA8 X 12 TFDP3 X 3 XAGE3 X X 7 XAGE5 X 5 ZFP42 X X 14 ZNF560 X X X X 17
[0728] To identify peptides that are likely to be presented as cell surface antigens by MHC Class I proteins, we used a sliding window to parse each of these proteins into its constituent 8-11 amino acid sequences. We processed these peptides and their flanking sequences with the HLA peptide presentation deep learning model to calculate the probability of presentation of each peptide at the 99.9.sup.th percentile expression level observed for this gene in TCGA. We considered a peptide likely to be presented (i.e., a candidate target) if its quantile normalized probability of presentation calculated by our model was greater than 0.001.
[0729] To prioritize genes that are likely to be relevant to a given indication, we selected genes where the gene is expressed at a level of at least 10 TPM in at least 0.98% of cancer cases.
[0730] The results are shown in Table 1.2. A total of 10698 shared antigen sequences were identified. The corresponding HLA allele(s) for each sequence are shown.
XXVI. Heterologous Prime/Boost Stimulates CD8+ T-Cell Responses in Human Subjects
[0731] An open-label, multi-center, multi-dose Phase 1/2 study was performed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of a heterologous prime/boost vaccination strategy. Two vaccine programs, GRANITE and SLATE, were assessed.
[0732] A personalized neoantigen cancer vaccine (“GRANITE”) was administered in combination with immune checkpoint blockade in patients with advanced cancer. The GRANITE heterologous prime/boost vaccine regimen included (1) a ChAdV that is used as a prime vaccination [GRT-C901] and (2) a SAM formulated in a LNP that is used for boost vaccinations [GRT-R902] following GRT-C901. The ChAdV vector is based on a modified ChAdV68 sequence having the sequence of SEQ ID NO:1 with an E1 (nt 577 to 3403) deletion and an E3 (nt 27,125-31,825) deletion. The SAM vector is based on an RNA alphavirus backbone having the nucleic acid sequence set forth in SEQ ID NO:6. Both GRT-C901 and GRT-R902 expressed the same 20 personalized neoantigens as well as two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). Tumors were used for whole-exome and transcriptome sequencing to detect somatic mutations, and blood was used for HLA typing and detection/subtraction of germline exome variants to generate the personalized neoantigen cassette using the EDGE algorithm for 10 subjects (Patients 1-10, referred to herein as patients G1-G10). The neoantigens included in each subject's cassette is shown in Table 47A and the full-length cassette is shown in Table 47B. The determined HLAs of GRANITE subjects are shown in Table 48.
TABLE-US-00051 TABLE 47A GRANITE Subject-Specific Neoantigens Ag Patient G1 Patient G2 Patient G3 Patient G4 1 QLQAEQKGLTEVIQ YPLAAHTYTPITGS ERYHFLEERLARLG KRYRVRSYEAVAV SLKMENEEFKK VSTIRQYPVSA LTEVYQWYLDL AAAASAYNYAEQ 2 GLFEGDEYATLMM RYYDRVTGVSSFH KQGKDLTVLDHTL EDPYLEDSEASLVP QCKEGAQKEGLM VTWVSQASADQR PTALTSPELSSW LAYQPIPFSQS 3 APFPAWSAFGKEE VKELRRLEDQLASL MASMGTLAFHEYG ERAQGELFPDRASS HDEALKNTWNLH QQELAALALKQ RPFLIIKDQDRK SWGNAAAAAGD 4 LAEQVQKADEFIQ SSLDAVLSQDLILA NWVQQQAYGMLA DVKKLITDEFVKH ANATNKLTVIAE DGPAVEVGDSL GIPVTICTYPFVF KYLDYARVPNSN 5 EEQKLPEADVAVL RRMNRVGNESLNP CSPPSPSALIQEMEE HLLQSKSGTQPHTA RTFLRQQASILS AVAKAAETIIDT RLWEKEQEVA TRLSLQQPRAE 6 VSQKQIADRAAHN LYSLSVLYKGEAR VKGGYQESSLLRV KIPASQHTQNWSTT ESPGNNVVDISV VVLLKAAYDVSS LVTLNDLEPKAA WTKDSKRRDKR 7 LNTAQDELVTFSDE IMEIQLNGGTVAKK PNYADTLISQESFE PKPFRPILGLHLNL LAQLYHHVCLC VAWAQARLEKQ KKGFLSAPQSL GILYYVYMGLL 8 HNMKLSISYLREYA GFAAEFKLVDQSRP HSSFVAVTEEGTKA AILSFGELIFCGMPA KANDWLQFIIH PHEPKFVYQAK AAATGIGFTVT EMLDFFNDCG 9 GPKVDIDVPDVNFE DQAVGAYLPLTTA AVKLLIERATNQG ANMCRCLVTLKVL APEGKLKGPKF RYSTLLAGNLRI WMLRVKWLYHLA MADKPGNTVNFR 10 NFDVAGYIVGANT KRQELESENKKLN FFGMHVQEYGSDW SLQHQLPQPGAQH ETYLLEKSRAIR NDLNELRKAVAD PPPNTRRVYISY FATRGYPMEDMK 11 DTCVCSTVAEFSHQ DVTRQADCKMKL DTRIAKRMAMLIY TEPGDYNINILFTDT CSHAGGRPGNW ADFVKYYYSGKRE TDFLCMAPISFF HIPGSPFKAH 12 QGDGCSGHKNQNQ LRNDAKNLYAANS VRASSDGEGTMSL YKCLSCTKTFPNVP IDTLQEVRLRFL IGAVLAHKGYFR PASVDGSPVSPS RAARHAATHGP 13 PMNTIAEAVIEMVN DMFDCVFPTRTALF SKELVEKSEAVRK PLKIFAQDGEGQHI RGQIQITINGF GSALVPTGNLQ MSSSGKLWKPRQ DIQMKNRMDGT 14 GKISRHEMLQVLH MSNLRQVGLKKPM MDARRVPPKDLRV VYCDFSTGETCIQA LMVGVQVTEEQL ERSSVLDRYPPA KKNLKKFRYVKL QPENIPAKNWY 15 TDAYLLYTPSQIVL QLMPLKTFPAAIW VKKNRQNGMHTL NSLATVTMEDLIQP TAILSSASRAG GVIQSELNYSVI YLLDIKVKEQSLE WFPEFSEARAI 16 GIGWLITFCSKGED SEVSKAIINIFFFYG LFIYQSLDAIDGRQ KVHLAKSSGSALM CLTSQTRLRLS PPQKIIMDQR ARRTNSSSPLG VWGTGNPRRQFI 17 GQLSQDRDFIMTLN LQMTDIVQACHDSI YLSLLRMYLSPPCI SFVIPFIHLPEIINLY TSLHRSWWMEN KAALDISIKSD HCLGPIKLELL NLSEQNDVF 18 SEEAEVDVREREIQ LEAFLTQKAKVGK SLSLAEKSILHEECI SYQPAVTAPEPDSS RDREPKRARDL LKDDDFERISEL KSPVVETVPA PRLAVDFALPK 19 QGRVKDLESLFHQ KLPGLNTATILLMG PPDPLEPPSLPAQRP VFYIEACESGSMVN SEVELAAALSDK TEDALLQQLAD GPPTPAAAHS HLPDNINVYAT 20 CLAFKNDATEILHS SNLKVLNHSPMSG GDGGLVCPYMEFL RDSVKSCRVHVPG HVVKPVPAHPS ASVNFDYKSPSP KNENNELPKLQW KTLTCGKGRRDF Ag Patient G5 Patient G6 Patient G7 Patient G8 1 RIEVMALPKPGGTH EQTEAAAREEILTN QIGALILATDISCQN GSRKERQVYSKAL SLALVTVPSMG GGSLSHHHGVG EYLSLFRSHL NRLFGVEASGRR 2 VDPEDQSQVTLAS FQYNYEYLGNSGQ HMSSMEHTEEGLQ PYHRSQSSSSVLNN YGFAFRYCPSGK LVITPLTDRCYM ERLADAMAESPS KSMDSINYPSD 3 STLYGRVLAPLPER MDKDGYFWFVAR REKVDNVWTEESS NANFDLRTSQSVR AGGAASGGGGN SDDVILSSGYRIG NQFLQELETGQR AMLAYNMRDQHL 4 LRKRHRKHTQQRV AVRTPYTMGYGEP LRDVDAKALVRSH EVLLLSMRDMNIT AALSLSTLASPK MYYNDAYGALDY FLLVYGDVISNI KLTSVDAPLFNA 5 SARIPEQLDVTAHG MTEYKLVVVGAV IIAKLLADELISLKD AQPHVNGGPLYSK VYAPEDVYRFR GVGKSALTIQLIQ IDPVQRYVPL NSISIAPPPPPM 6 GTGGSGPGLSRTRA IEMWISILELNELEY VAASEKSTGKIFLY AKMKWTNLLYKA LSTGALPPLAP AAVELHQAKD DGRGDNQPLHI GGVKIRDDERLLQ 7 VEEDESAMPKKDS LLLAAHRFLATELS MFEVCFESKGTGPI EQSAERCVSTLLNL RTLLARFNEQIE QFSPSLISEKI PDQLVILDMKH IQTKVNYVVQE 8 GASAPGKSMEASM ELKHMVMSFRVSA QDVCENFWMVWS SYQHKFQDDDQTH DVSAPKVEADVS LQVLLGFAGRNK DAMAHGCFLNAKR VKGSLKAGFFGT 9 MNCREVTFVPGLC SGSKKKGPPDADSP IIGVTLFSSTKEDFQ EHKVLLTGTPLQKT KIFDEILVNAAD LYLPYKTLVST QYAAALQAGM VEELFSLLHFL 10 PTMASVPALQLTLP STLATIQALASGCS EALRSQAALGRVL PGHDKMLSPNFDV THHPRRCPIPK LPITSLDATGN LDCGASCAADPG HHTAMLTRGEQH 11 KLGTRLVPAERRK NKQWDQHFRSMK DSQFLAPDVTSTPV PPAVISQMLLLDSP KLKTSRDKLRKS HQYEQKITELRQK NTVVSGALDRL HKEPIRLRYKL 12 SSDQTNDSEGASRP LLSSRSPLAEHRPD TSSTSTPSSTPGMT LSDQENAPPILPRRP APFEMPSSVSE AYQDVSMVLLP WILTELTTAAT SEGLGPSPHL 13 IEDLLPASYFSTILL FIQRDYSSGTRCLF ASLLTSGLELYCKK PKVRERHFSESTYI GVQTDQRVLR QTKFPAELENR GLSMTVEADPA DNALSRLTLGN 14 SKPDLTAALRDIW KPKEDKLRLAQEV CAMLRRLEKRILID PPACSSSSSSLFLAV AQYETIAAKNIS SDMVIYCKSVHF LPSREARQAMI VARRLGRGSV 15 EIAVLELAKSCPHV HYNYMCNSSCMGS MTEYKLVVVGAGR GIALVMRVDGAVS INLHEVYENTS MNRRPILTIITL VGKSALTIQLIQ SCFRQLFLAQQR 16 MPAQRLLLLLTLLL EKKKPHIKKPLNVF ELYQRMLKGPPPP LHKSLKLYQVIFKG PGLGIFGSTST MLYMKEMRAKV AARARSQRRPRH EIGKGNLGGIA 17 LSTMERSELAKKT KQQPQDNFKNNVQ SDNSGCDAPGNSY APRLGSYSGTTILH GTTPDIILDDLL KSQLPVQLDLGG PSLSVPSSAESE LLNSTSNNLYL 18 MSGREGGKRKPLK KVTQTELMRESFT EHRKDLGLTTVWK APAPPARTSRGQVS QPKKQAKEMDEE QKQEATESLKCQ DQLSYLLSPALA ERANEAGGQVG 19 LRQITVNDLPVGHS MAAADGALLEAA NCPTKKYMPAVTL MTEYKLVVVGAD VDEALRLVQAF ALEQPAELPASVR TPTVNQHETSTS GVGKSALTIQLIQ 20 SLHEICSKIMAEWK DEMVNTICDVLQK ELYQRMLKGPPPPP KDLAKRLLVGKSD NAKALACSSLQ PEQFPLVQGVAI PEPAASAAQGT SVDAEKSMLSKL Ag Patient G9 Patient G10 1 KVAKPKKAAKSAT TSGSQGQSTQSSGY KAVKPKAAKPKV SSSYGYPPSSL 2 ECTDGSSFVDEVEK ISHLIEPLANAAQA VMKCGCTRCVS EASQLGHKVSQ 3 SVLSPPPEKAGATA PQTLLDQKVKVVN ATLLPHEVAPL VARNAKDVAVSY 4 RCRQGATRLPLPLL YCKFKNTEDITFSS LRDYLLLRVEG VYVGLKDKLSG 5 EAHVAKGKSVFLH VDSYEDEWGRLHE QMKKFVEWLQNA SLWDSAGVLREG 6 ALKEKYDSAAAMG AGAQRVGLPGPPA LNSRGKLVQVNS PPGPPGKPGQDG 7 AKLLGLLAELRSLN ADTERFYTRESTQF EAYGYQIQHIQ LQQNPVTEYMK 8 FEHLKWNDMMEE KESRPPRKFPSDIIF VYQTLFLLQHLWS EAISSMFPDK 9 LLLNLAENPAMTSE LQFSQIYPVVCVLS LLRAQVPSSLG SFFIGDSGIPL 10 RQLFLSENRRKEIL EALLHPFFAGLTLE QRIIVELVEFI ERSFHTSRNPS 11 ISLLKLTQGETLCK VDQSPKPLIIGPVED LYEQHHVVQDM YDPGYFNNES 12 EEHLSIEDFTQASG STPCWIELHLNGLL MTPAAFSALPR QWLDKVLTQMG 13 ELDSLITAITTNR QSLESSSLEGSHMG AHPSKCVTIQRT VYFSAHWCPPC 14 EESREYTEDGQVT GEVLSRRCVNLLN KETRYSYNTEWR TALRPDMWPKSE 15 TNITTETSKILLR HLCIVDDWICEEVI KNMQIANHTLKY TGTDALLRRML 16 PPARKKFVIPLDVD GGFGLALGTHANC EVPPGVAKPLF LDSPPMFAGAGL 17 TLVQNLVNNGYV LRGNHESRQITQFY WDETVRAAPYDW GFYDECQTKYG R 18 NLHGDGIALWYTL NEQACEDMDILKL DRLVPGPVFGSK ESYGTVVRISPQ 19 YMCNSSCMGGMN PRSAPSLRPKDYDV QRPILTIITLEDS DATLKSLNNQI 20 LSTSRPPQHLGGLK QTNHCYIAILNISQ KPTYDPVSEDQ GEVDPTQVHKS
TABLE-US-00052 TABLE 47B GRANITE Subject-Specific Neoantigen Cassettes Patient Cassette Sequence G1 LAEQVQKADEFIQANATNKL TVIAEQGDGCSGHKNQNQID TLQEVRLRFLGQLSQDRDFI MTLNTSLHRSWWMENDTCVC STVAEFSHQCSHAGGRPGNW PMNTIAEAVIEMVNRGQIQI TINGFVSQKQIADRAAHNES PGNNVVDISVSEEAEVDVRE REIQRDREPKRARDLQLQAE QKGLTEVIQSLKMENEEFKK QGRVKDLESLFHQSEVELAA ALSDKGKISRHEMLQVLHLM VGVQVTEEQLGLFEGDEYAT LMMQCKEGAQKEGLMCLAFK NDATEILHSHVVKPVPAHPS GIGWLITFCSKGEDCLTSQT RLRLSHNMKLSISYLREYAK ANDWLQFIIHLNTAQDELVT FSDELAQLYHHVCLCAPFPA WSAFGKEEHDEALKNTWNLH TDAYLLYTPSQIVLTAILSS ASRAGGPKVDIDVPDVNFEA PEGKLKGPKFNFDVAGYIVG ANTETYLLEKSRAIREEQKL PEADVAVLRTFLRQQASILS G2 LEAFLTQKAKVGKLKDDDFE RISELYPLAAHTYTPITGSV STIRQYPVSAIMEIQLNGGT VAKKVAWAQARLEKQKLPGL NTATILLMGTEDALLQQLAD GFAAEFKLVDQSRPPHEPKF VYQAKMSNLRQVGLKKPMER SSVLDRYPPAQLMPLKTFPA AIWGVIQSELNYSVILYSLS VLYKGEARVVLLKAAYDVSS DMFDCVFPTRTALFGSALVP TGNLQSNLKVLNHSPMSGAS VNFDYKSPSPDQAVGAYLPL TTARYSTLLAGNLRIRYYDR VTGVSSFHVTWVSQASADQR DVTRQADCKMKLADFVKYYY SGKRESEVSKAIINIFFFYG PPQKIIMDQRLRNDAKNLYA ANSIGAVLAHKGYFRKRQEL ESENKKLNNDLNELRKAVAD LQMTDIVQACHDSIKAALDI SIKSDSSLDAVLSQDLILAD GPAVEVGDSLVKELRRLEDQ LASLQQELAALALKQRRMNR VGNESLNPAVAKAAETIIDT G3 SKELVEKSEAVRKMSSSGKL WKPRQMASMGTLAFHEYGRP FLIIKDQDRKDTRIAKRMAM LIYTDFLCMAPISFFYLSLL RMYLSPPCIHCLGPIKLELL AVKLLIERATNQGWMLRVKW LYHLAVRASSDGEGTMSLPA SVDGSPVSPSCSPPSPSALI QEMEERLWEKEQEVAERYHF LEERLARLGLTEVYQWYLDL FFGMHVQEYGSDWPPPNTRR VYISYLFIYQSLDAIDGRQA RRTNSSSPLGNWVQQQAYGM LAGIPVTICTYPFVFMDARR VPPKDLRVKKNLKKFRYVKL VKKNRQNGMHTLYLLDIKVK EQSLEPNYADTLISQESFEK KGFLSAPQSLGDGGLVCPYM EFLKNENNELPKLQWSLSLA EKSILHEECIKSPVVETVPA PPDPLEPPSLPAQRPGPPTP AAAHSVKGGYQESSLLRVLV TLNDLEPKAAKQGKDLTVLD HTLPTALTSPELSSWHSSFV AVTEEGTKAAAATGIGFTVT G4 SYQPAVTAPEPDSSPRLAVD FALPKEDPYLEDSEASLVPL AYQPIPFSQSPLKIFAQDGE GQHIDIQMKNRMDGTTEPGD YNINILFTDTHIPGSPFKAH NSLATVTMEDLIQPWFPEFS EARAIKRYRVRSYEAVAVAA AASAYNYAEQANMCRCLVTL KVLMADKPGNTVNFRHLLQS KSGTQPHTATRLSLQQPRAE SLQHQLPQPGAQHFATRGYP MEDMKDVKKLITDEFVKHKY LDYARVPNSNSFVIPFIHLP EIINLYNLSEQNDVFRDSVK SCRVHVPGKTLTCGKGRRDF YKCLSCTKTFPNVPRAARHA ATHGPERAQGELFPDRASSS WGNAAAAAGDKIPASQHTQN WSTTWTKDSKRRDKRKVHLA KSSGSALMVWGTGNPRRQFI VYCDFSTGETCIQAQPENIP AKNWYAILSFGELIFCGMPA EMLDFFNDCGPKPFRPILGL HLNLGILYYVYMGLLVFYIE ACESGSMVNHLPDNINVYAT G5 STLYGRVLAPLPERAGGAAS GGGGNSKPDLTAALRDIWAQ YETIAAKNISGTGGSGPGLS RTRALSTGALPPLAPIEDLL PASYFSTILLGVQTDQRVLR RIEVMALPKPGGTHSLALVT VPSMGVEEDESAMPKKDSRT LLARFNEQIEPTMASVPALQ LTLPTHHPRRCPIPKLRKRH RKHTQQRVAALSLSTLASPK VDPEDQSQVTLASYGFAFRY CPSGKMNCREVTFVPGLCKI FDEILVNAADSLHEICSKIM AEWKNAKALACSSLQMSGRE GGKRKPLKQPKKQAKEMDEE EIAVLELAKSCPHVINLHEV YENTSGASAPGKSMEASMDV SAPKVEADVSSSDQTNDSEG ASRPAPFEMPSSVSESARIP EQLDVTAHGVYAPEDVYRFR KLGTRLVPAERRKKLKTSRD KLRKSLRQITVNDLPVGHSV DEALRLVQAFLSTMERSELA KKTGTTPDIILDDLLMPAQR LLLLLTLLLPGLGIFGSTST G6 LLSSRSPLAEHRPDAYQDVS MVLLPMAAADGALLEAAALE QPAELPASVRHYNYMCNSSC MGSMNRRPILTIITLFQYNY EYLGNSGQLVITPLTDRCYM FIQRDYSSGTRCLFQTKFPA ELENRAVRTPYTMGYGEPMY YNDAYGALDYLLLAAHRFLA TELSQFSPSLISEKIEQTEA AAREEILTNGGSLSHHHGVG STLATIQALASGCSLPITSL DATGNKQQPQDNFKNNVQKS QLPVQLDLGGMDKDGYFWFV ARSDDVILSSGYRIGDEMVN TICDVLQKPEQFPLVQGVAI MTEYKLVVVGAVGVGKSALT IQLIQIEMWISILELNELEY AAVELHQAKDNKQWDQHFRS MKHQYEQKITELRQKKPKED KLRLAQEVSDMVIYCKSVHF ELKHMVMSFRVSALQVLLGF AGRNKKVTQTELMRESFTQK QEATESLKCQEKKKPHIKKP LNVFMLYMKEMRAKVSGSKK KGPPDADSPLYLPYKTLVST G7 EALRSQAALGRVLLDCGASC AADPGTSSTSTPSSTPGMTW ILTELTTAATQDVCENFWMV WSDAMAHGCFLNAKRMTEYK LVVVGAGRVGKSALTIQLIQ QIGALILATDISCQNEYLSL FRSHLELYQRMLKGPPPPPP EPAASAAQGTIIAKLLADEL ISLKDIDPVQRYVPLASLLT SGLELYCKKGLSMTVEADPA NCPTKKYMPAVTLTPTVNQH ETSTSREKVDNVWTEESSNQ FLQELETGQRDSQFLAPDVT STPVNTVVSGALDRLHMSSM EHTEEGLQERLADAMAESPS SDNSGCDAPGNSYPSLSVPS SAESEVAASEKSTGKIFLYD GRGDNQPLHIELYQRMLKGP PPPAARARSQRRPRHIIGVT LFSSTKEDFQQYAAALQAGM CAMLRRLEKRILIDLPSREA RQAMIMFEVCFESKGTGPIP DQLVILDMKHLRDVDAKALV RSHFLLVYGDVISNIEHRKD LGLTTVWKDQLSYLLSPALA G8 APRLGSYSGTTILHLLNSTS NNLYLPPACSSSSSSLFLAW ARRLGRGSVSYQHKFQDDDQ THVKGSLKAGFFGTPPAVIS QMLLLDSPHKEPIRLRYKLP KVRERHFSESTYIDNALSRL TLGNEHKVLLTGTPLQKTVE ELFSLLHFLPYHRSQSSSSV LNNKSMDSINYPSDLSDQEN APPILPRRPSEGLGPSPHLE VLLLSMRDMNITKLTSVDAP LFNAPGHDKMLSPNFDVHHT AMLTRGEQHLHKSLKLYQVI FKGEIGKGNLGGIAAQPHVN GGPLYSKNSISIAPPPPPMA PAPPARTSRGQVSERANEAG GQVGAKMKWTNLLYKAGGVK IRDDERLLQNANFDLRTSQS VRAMLAYNMRDQHLMTEYKL VVVGADGVGKSALTIQLIQG IALVMRVDGAVSSCFRQLFL AQQRGSRKERQVYSKALNRL FGVEASGRRKDLAKRLLVGK SDSVDAEKSMLSKLEQSAER CVSTLLNLIQTKVNYVVQE G9 TNITTETSKILLRKNMQIAN HTLKYSVLSPPPEKAGATAA TLLPHEVAPLRCRQGATRLP LPLLLRDYLLLRVEGELDSL ITAITTNRAHPSKCVTIQRT YMCNSSCMGGMNQRPILTII TLEDSECTDGSSFVDEVEKV MKCGCTRCVSLLLNLAENPA MTSELLRAQVPSSLGTLVQN LVNNGYVWDETVRAAPYDWR KVAKPKKAAKSATKAVKPKA AKPKVEAHVAKGKSVFLHQM KKFVEWLQNAAKLLGLLAEL RSLNEAYGYQIQHIQFEHLK WNDMMEEVYQTLFLLQHLWS NLHGDGIALWYTLDRLVPGP VFGSKISLLKLTQGETLCKL YEQHHVVQDMLSTSRPPQHL GGLKKPTYDPVSEDQEESRE YTEDGQVTKETRYSYNTEWR PPARKKFVIPLDVDEVPPGV AKPLFEEHLSIEDFTQASGM TPAAFSALPRRQLFLSENRR KEILQRIIVELVEFIALKEK YDSAAAMGLNSRGKLVQVNS G10 QSLESSSLEGSHMGVYFSAH WCPPCGGFGLALGTHANCLD SPPMFAGAGLKESRPPRKFP SDIIFEAISSMFPDKVDQSP KPLIIGPVEDYDPGYFNNES TSGSQGQSTQSSGYSSSYGY PPSSLSTPCWIELHLNGLLQ WLDKVLTQMGLRGNHESRQI TQFYGFYDECQTKYGYCKFK NTEDITFSSVYVGLKDKLSG GEVLSRRCVNLLNTALRPDM WPKSEEALLHPFFAGLTLEE RSFHTSRNPSQTNHCYIAIL NISQGEVDPTQVHKSAGAQR VGLPGPPAPPGPPGKPGQDG VDSYEDEWGRLHESLWDSAG VLREGHLCIVDDWICEEVIT GTDALLRRMLLQFSQIYPVV CVLSSFFIGDSGIPLADTER FYTRESTQFLQQNPVTEYMK ISHLIEPLANAAQAEASQLG HKVSQPQTLLDQKVKVVNVA RNAKDVAVSYNEQACEDMDI LKLESYGTVVRISPQPRSAP SLRPKDYDVDATLKSLNNQI
TABLE-US-00053 TABLE 48A GRANITE Subject HLAs Patient HLA-A HLA-A HLA-B HLA-B HLA-C HLA-C G1 A*02:01 A*32:01 B*18:01 B*44:05 C*02:02 C*07:04 G2 A*30:04 A*02:01 B*08:01 B*57:01 C*07:01 C*06:02 G3 A*02:01 A*11:01 B*27:02 B*35:01 C*04:01 C*02:02 G4 A*25:01 A*03:01 B*15:17 B*18:01 C*07:01 C*07:01 G5 A*01:01 A*03:01 B*07:02 B*08:01 C*07:01 C*07:02 G6 A*01:01 A*31:01 B*37:01 B*40:01 C*03:04 C*06:02 G7 A*01:01 A*02:01 B*08:01 B*40:01 C*03:04 C*07:01 G8 A*03:01 A*33:01 B*42:01 B*53:01 C*04:01 C*17:01 G9 A*02:01 A*03:01 B*35:12 B*45:01 C*04:01 C*06:02 G10 A*01:01 A*02:01 B*08:01 B*15:01 C*04:01 C*07:01
[0733] A shared neoantigen cancer vaccine (“SLATE”) was administered in combination with immune checkpoint blockade in patients with advanced cancer. The SLATE heterologous prime/boost vaccine regimen included (1) a ChAdV that is used as a prime vaccination [GRT-C903] and (2) a SAM formulated in a LNP that is used for boost vaccinations [GRT-R904] following GRT-C903. Both GRT-C903 and GRT-R904 expressed the same 20 shared neoantigens derived from a specific list of oncogenic mutations (see Table 34) as well as two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). For subject inclusion, tumors were used for whole-exome and transcriptome sequencing to detect somatic mutations, and blood was used for HLA typing. Enrolled SLATE subjects were determined to have HLA A02:01 and KRAS mutation G12C predicted to be presented by HLA A02:01 (Patients S1, S2, and S3), HLA A01:01 and KRAS mutation Q61H predicted to be presented by HLA A01:01 (Patients S4 and S7), or HLA A03:01 or A11:01 and KRAS mutation G12V predicted to be presented by HLA A03:01 or A11:01 (A03:01 for Patient S9; A11:01 for Patients S11 and S15).
[0734] Both treatment studies (ie, the GRANITE and SLATE vaccine regimens) administered the vaccine via IM injection bilaterally (eg, in each deltoid muscle) in combination with immune checkpoint blockade, specifically SC ipilimumab and IV nivolumab. The studies followed two sequential phases.
[0735] GRT-C901 and GRT-C903 are replication-defective, E1 and E3 deleted adenoviral vectors based on chimpanzee adenovirus 68. The vector contained an expression cassette encoding 20 neoantigens as well as two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). GRT-C901 and GRT-C903 were formulated in solution at 5×10.sup.11 vp/mL and 1.0 mL was injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles. The GRT-C901 and GRT-C903 vectors differ only by the encoded neoantigens within the cassette.
[0736] GRT-R902 and GRT-R904 are SAM vectors derived from an alphavirus. The GRT-R902 and GRT-R904 vectors encoded the viral proteins and the 5′ and 3′ RNA sequences required for RNA amplification but encoded no structural proteins. The SAM vectors were formulated in LNPs that included 4 lipids: an ionizable amino lipid, a phosphatidylcholine, cholesterol, and a PEG-based coat lipid to encapsulate the SAM and form LNPs. The GRT-R902 vector contained the same neoantigen expression cassette as used in GRT-C901 for each patient, respectively. The GRT-R904 vector contained the same neoantigen expression cassette as used in GRT-C903. GRT-R902 and GRT-R904 were formulated in solution at 1 mg/mL and was injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles (deltoid muscle preferred, gluteus [dorso or ventro] or rectus femoris on each side may be used). The boost vaccination sites were as close to the prime vaccination site as possible. The injection volume was based on the dose to be administered. The dose level amount refers explicitly to the amount of the SAM vector, i.e., it does not refer to other components, such as the LNP. The ratio of LNP:SAM was approximately 24:1. Accordingly, the dose of LNP was 720 μg, 2400 μg, and 7200 μg for each respective GRT-R902/GRT-R904 dose level (see below).
[0737] Ipilimumab is a human monoclonal IgG1 antibody (see SEQ ID NO: 29520 and 29521) that binds to the cytotoxic T-lymphocyte associated antigen 4 (CTLA-4). Ipilimumab was formulated in solution at 5 mg/mL and was injected SC proximally (within ˜2 cm) to each of the bilateral vaccination sites. Ipilimumab was administered at a dose of 30 mg of antibody in four 1.5 mL (7.5 mg) injections proximal to the vaccine draining LN at each of the bilateral vaccination sites (ie, 1.5 mL below the vaccination site and 1.5 mL above the vaccination site on each bilateral side in each deltoid, ventrogluteal, dorsogluteal, or rectus femoris [deltoid preferred, but dependent on clinical site and patient preference])
[0738] Nivolumab is a human monoclonal IgG4 antibody (see SEQ ID NO: 29522 and 29523) that blocks the interaction of PD-1 and its ligands, PD-L1 and PD-L2. Nivolumab was formulated in solution at 10 mg/mL and was administered as an IV infusion (480 mg) through a 0.2-micron to 1.2-micron pore size, low-protein binding in-line filter at the protocol-specified doses. It was not administered as an IV push or bolus injection. Nivolumab infusion was promptly followed by a flush of diluent to clear the line. Nivolumab was administered following each vaccination (i.e., each of GRT-C901, GRT-R902, GRT-C903, or GRT-R904) with or without ipilimumab on the same day. The dose and route of nivolumab was based on the Food and Drug Administration approved dose and route.
[0739] As shown in Table 49, subjects included those with advanced or metastatic NSCLC, MSS-CRC, gastroesophageal adenocarcinoma (GEA), ovarian adenocarcinoma, ampullary adenocarcinoma. As further shown in Table 49 and shown in
[0740] As shown in Tables 50A-C, adverse events were recorded for GRANITE but no dose limiting toxicities were observed. Fever was the only severe adverse event observed. Grade 3 hyperthyroidism and Grade 3 asymptomatic CK elevation were observed in one patient each. The data overall demonstrate the general safety and tolerability of administering a heterologous prime/boost of 1×10.sup.12 vp (GRT-C901) and 30 μg, 100 μg, 100 μg+SC ipilimumab, and 300 μg+SC ipilimumab GRT-R902.
[0741] As shown in Tables 50A and D-E, adverse events were also recorded for SLATE. Two dose limiting toxicities were observed out of 19 subjects after administering GRT-C903 in combination with nivolumab and ipilimumab (1 each of CPI-induced autoimmune hepatitis and myositis). Severe adverse events observed were mostly attributable to checkpoint immunotherapy treatment. Grade 3 fever, reversible Grade 3 ALT together Grade 4 AST elevation (attributable to nivolumab), Grade 3 neutropenia together with thrombocytopenia, and Grade 3 rhabdomyolysis were observed in one patient each. Transient fever and injection site reactions were as expected, as well as customary CPI-induced immune-related adverse events. The data overall demonstrate the general safety and tolerability of a heterologous prime/boost of 1×10.sup.2 vp of GRT-C903 and 30 μg, 30 μg+SC ipilimumab, 100 μg+SC ipilimumab, and 300 μg+SC ipilimumab GRT-R904.
[0742] Immune responses following vaccinations for GRANITE subjects was assessed. Blood draws were performed for subjects and PBMCs were collected. T-cell responses were assessed by IFN-gamma ELISpot. Peripheral blood mononuclear cells (PBMCs) were plated at 2×10.sup.5 cells/well (ex vivo) or 10.sup.5 cells/well (post-IVS) and stimulated overnight in the presence of minimal epitope peptides (8-11mers) or controls in ELISpot plates coated with anti-human Interferon-gamma antibody. Following 20 h incubation in a humidified, 5% CO.sub.2, 37° C. incubator, cells were removed and ELISpot plates developed according to standard protocols. Data are reported as spot-forming cells (SFC) per 10.sup.6 splenocytes.
[0743] Shown in
[0744] The CD8 T cell pools responsive to vaccination for GRANITE subjects were further assessed and characterized. PBMCs were collected and expanded for 2 weeks in the presence of peptide pools (In Vitro Stimulation (IVS) culture), and T-cell responses were assessed by IFN-gamma ELISpot for each possible vaccine-encoded peptide (40 total to cover different distinct epitopes for each of the neoantigens, i.e., two or more distinct epitopes from the same neoantigen that may both elicit and immune response to that neoantigen) and reported as spot-forming cells (SFC) per 10.sup.6 splenocytes. As shown in
[0745] The TCRs of the expanded CD8 T cells were further assessed by TCR β sequencing. The general sequencing workflow is shown in
[0746] Shown in
[0747] Disease progression and vaccine efficacy was further examined through radiological assessment of CT scans. As shown in
[0748] The clinical status of patients was also monitored. GRANITE subject G2 (who had received prior therapies of FOLFOXIRI for 2 months, followed by surgery, then FOLFOXIRI for another 2 months), was on the study for 365+ days then discontinued study treatment per patient request, during which no evidence of disease at any timepoint on study (post-surgery) was observed while CD8 T-cell expansion with 12 neoantigen-specific CD8 T-cell clones was observed. GRANITE subject G3 (who had received prior therapies of chemoradiation+durvalumab for 9 months but demonstrating progressive disease, followed by carboplatin+gemcitabine for 4 months leading to stable disease), was on the study for 180+ days symptomatically improving since study entry without any complaint compared to prior lines of treatment and treated beyond radiologic progression, during which tumor control was observed until T cell decline. GRANITE subject G8 (who had received prior therapies of FOLFOX/bev for 15 months but demonstrating progressive disease, followed by FOLFIRI/bev for 6 months), was on the study for 112+ days and clinically feeling well, during which stable disease was observed at week 16 (one liver lesion stable, all other lesions shrinking) as well as CD8 T-cell expansion with priming dose and a further expansion with the boosting dose. SLATE subject S2 (who had received prior therapies of Pembrolizumab for 4 months but demonstrating progressive disease, followed by Anti-TIGIT for 10 months leading to stable disease, then Carboplatin/pemetrexed/SBRT for 2 months), was on the study for 168 days then declined further treatment due to fatigue, during which stable disease with a 20% reduction from baseline was observed as well as an expansion of pre-existing CD8 T-cell against KRAS G12C. SLATE subject S3 (who had received prior therapies of Pembrolizumab+Carboplatin/pemetrexed for 8 months but demonstrating progressive disease), was on the study for 196+ and clinically doing well, during which stable disease with a 15% reduction from baseline was observed at weeks 24 and 32 as well as CD8 T cells against KRAS G12C following in vitro stimulation.
[0749] For GRANITE, the data overall demonstrate good tolerability at dose level 3 (100 μg+SC IPI) with evaluation of dose level 4 still in progress. Strong, consistent induction of killer CD8+ T cells, specific to multiple neoantigens, demonstrated which have been shown to accumulate in tumors of each of two patients studied. Dose level 1 (30 μg) efficacy data suggest induction of disease control that is also potentially more durable in an adjuvant-like context. Dose level 2 (100 μg) data suggest that development of T cell response may take multiple weeks (and thus, presumably, any consequent benefit), indicating patients about to progress and die within a few weeks may not benefit from this form of immunotherapy. Dose level 3 (100 μg+SC IPI) data demonstrated no observed disease progression as well as a clear clinical benefit ongoing in a metastatic colorectal cancer patient (MSS genotype).
[0750] For SLATE, the data overall demonstrate good tolerability at dose level 4 (300 μg+SC IPI). Induction of CD8+ T cells to KRAS neoantigens was observed, although inconsistent. Strong, consistent induction of CD8+ T cells to TP53 neoantigens was observed. Evidence of clinical benefit and minor but sustained tumor shrinkage in multiple NSCLC patients with KRAS G12C mutations who had progressed on prior CPI therapy was observed.
TABLE-US-00054 TABLE 49 Subjects Enrolled in Heterologous Prime/Boost Studies GRANITE SLATE (n = 10) (n = 19) Age (mean, raμge) 59 (38-76) 58 33-83) Gender (Female/Male) 4/6 12/7 # of doses ChAdV 11 19 SAM 44 39 Nivolumab (IV) 61 58 Ipilimumab (SC) 14 47 Tumor Types NSCLC 1 6 Microsatellite stable (MSS)-CRC 5 6 Gastroesophageal adenocarcinoma (GEA) 4 0 Pancreatic ductal adenocarcinoma N/A 5 Ovarian adenocarcinoma N/A 1 Ampullary adenocarcinoma N/A 1 Prior anti-PD(L)1 therapy 1 6
TABLE-US-00055 TABLE 50A Heterologous Prime/Boost Adverse Events Summary GRANITE (n = 10) SLATE (n = 19) Grade 1/2 Grade 3/4 Grade 1/2 Grade 3/4 Treatment-related adverse events Fever 9 0 14 1 Skin rash 3 0 0 0 Diarrhea 2 0 4 0 Fatigue 4 0 9 0 CK Elevation 0 .sup. 1.sup.a 0 0 Injection-site 7 0 1 0 reactions Myalgia 2 0 2 0 Pruritus 1 0 4 0 Anorexia 2 0 1 0 Chills 1 0 3 0 Congestion 1 0 0 0 Hot flashes 1 0 0 0 Hyperthyroidism 0 1 0 0 Hypotension 1 0 0 0 Infusion-related 1 0 0 0 reaction Vomiting 1 0 3 0 Nausea 0 0 4 0 ALT increased 0 0 0 .sup. 1.sup.e AST increased 0 0 0 .sup. 1.sup.e Neutropenia 0 0 0 1 Thrombocytopenia 0 0 0 1 Rash 0 0 2 0 Arthralgia 0 0 1 0 Dizziness 0 0 1 0 Dry skin 0 0 1 0 Gait disturbance 0 0 1 0 Generalized 0 0 1 0 weakness Headache 0 0 1 0 Insomnia 0 0 1 0 Myositis 0 0 1 0 Night Sweats 0 0 1 0 Rhabdomyolysis 0 0 0 1 Serious Adverse Events (SAEs) Fever .sup. 2.sup.b 0 0 .sup. 2.sup.b Cervical Fracture 0 0 0 .sup. 1.sup.c Heart Failure 0 .sup. 1.sup.c 0 0 Abdominal pain .sup. 1.sup.c 0 .sup. 1.sup.c 0 Bradycardia .sup. 1.sup.c 0 0 0 Hyperthyroidism 0 1 0 0 Respiratory Failure 0 .sup. 1.sup.d 0 0 Acute kidney failure 0 0 .sup. 1.sup.c Anemia 0 0 .sup. 1.sup.c ALT elevation 0 0 0 .sup. 1.sup.e AST elevation 0 0 0 .sup. 1.sup.e Hypotension 0 0 .sup. 1.sup.c Rhabdomyolysis 0 0 0 1 Myositis 0 0 1 0 Nausea 0 0 .sup. 2.sup.c 0 Neutropenia 0 0 0 1 Right Frontal Brain 0 0 .sup. 1.sup.c 0 Metastasis Small bowel 0 0 .sup. 1.sup.c 0 obstruction Vomiting 0 0 .sup. 1.sup.c 0 .sup.aSelf-limiting, asymptomatic increase in creatine kinase .sup.bBoth SAEs of fever occurring in the same patient .sup.cNot treatment-related .sup.dGrade 5 respiratory failure resulted from checkpoint inhibitor-induced acute thyrotoxicosis, with associated aspiration pneumonia, respiratory failure leading to patient death and is not related to vaccine treatment .sup.eattributed to nivolumab
TABLE-US-00056 TABLE 50B GRANITE Treatment-related adverse events (TRAEs) n = 10 (all patients treated with concurrent nivolumab) SAM ChAdV (1 × 10.sup.12 vp) 100 ug + 300 ug + No SC IPI With SC IPI 30 ug 100 ug.sup.a SC IPI SC IPI Safety (n = 5) (n = 5) (n = 3) (n = 2) (n = 2) (n = 2) Treatment-related adverse events Fever 4 3 1 — 1 — Injection-site reactions 1 4 1 1 — — Fatigue 1 1 1 1 — Skin rash 1 — 1 1 — Anorexia — 1 — — 1 — Chills — — — — 1 — CK Elevation — — 1 — — — Congestion — 1 — — — Diarrhea — — 1 — 1 — Hot flashes — 1 — — — Hyperthyroidism — — — — 1 — Hypotension — — 1 — — — Infusion-related reaction — — — 1 — — Myalgia — 1 — 1 — — Pruritus — — 1 — — — Vomiting — — — 1 — .sup.aOne patient did not receive SAM boosts
TABLE-US-00057 TABLE 50C GRANITE serious adverse events (TRAEs) n = 10 (all patients treated with concurrent nivolumab) SAM ChAdV (1 × 10.sup.12 vp) 300 ug + No SC IPI With SC IPI 30 ug 100 ug.sup.a 100 ug + SC IPI SC IPI Safety (n = 5) (n = 5) (n = 3) (n = 2) (n = 2) (n = 2) SAEs Abdominal paine 1.sup.e — — — — Fever 1.sup.b — 1.sup.b — — — Bradycardia — — 1.sup.c,2 — — — Heart Failure — — 1.sup.c,2 — — — Hyperthyroidism — — — — 1.sup.d — Respiratory Failure — — — — 1.sup.d,e — .sup.aOne patient did not receive SAM boosts .sup.bOccurring in the same patient .sup.cOccurring in the same patient .sup.dOccurring in the same patient .sup.eNot treatment-related
TABLE-US-00058 TABLE 50D SLATE Treatment-related adverse events (TRAEs) n = 19 (all patients treated with concurrent nivolumab) SAM ChAdV (1 × 10.sup.12 vp) 30 ug + 100 ug + 300 ug + No SC IPI With SC IPI 30 ug SC IPI SC IPI SC IPI Safety (n = 2) (n = 17) (n = 2) (n = 4) (n = 6) (n = 6.sup.a) Treatment-related adverse events Fever — 7 — 1 2 5 Fatigue — 6 — — 1 2 Diarrhea — 2 — — 1 1 Nausea — 2 — — 1 1 Pruritus 1 1 — 1 1 — Chills — 2 — — — 1 Vomiting — 2 — — — 1 LALT increased — 1 — — — 1 AST increased — 1 — — — 1 Myalgia — 2 — — — — Neutropenia — 1 — — — 1 Rash — — 1 — 1 — Anorexia — — — 1 — — Arthralgia — 1 — — — — Dizziness — — 1 — — — Dry skin — — 1 — — — Gait disturbance — — 1 — — — Generalized weakness — — 1 — — — Headache — 1 — — — — Injection site reaction — 1 — — — — Insomnia — 1 — — — — Myositis — 1 — — — — Night Sweats — 1 — — — — Rhabdomyolysis — 1 — — — — Thrombocytopenia — — — — — 1 .sup.a1 patient discontinued after ChAdV due to autoimmune myositis
TABLE-US-00059 TABLE 50E SLATE serious adverse events (SAEs) Safetyn = 19 (all patients treated with concurrent nivolumab) SAM ChAdV (1 × 10.sup.12 vp) 30 ug + 100 ug + 300 ug + No SC IPI With SC IPI 30 ug SC IPI SC IPI SC IPI (n = 2) (n = 17) (n = 2) (n = 4) (n = 6) (n = 6.sup.f) SAEs Abdominal pain — — — — § 1.sup.a Acute kidney failure — 1.sup.a,b — — — — Anemia — — — 1.sup.a,f — — ALT elevation — 1.sup.c — — — — AST elevation| — 1.sup.c — — — — Cervical fracture — — 1.sup.a — — — Fever — 1.sup.c — — — 1.sup.c,g Hypotension — — — 1.sup.a,f — — Myositis — 1.sup.c — — — — Nausea — — — 1.sup.a,b 1.sup.a,d — Neutropenia — — — — — 1.sup.c,g Right Frontal Brain Metastasis — 1.sup.a — — — — Rhabdomyolysis — 1.sup.c — — — — Small bowel obstruction — — — 1.sup.a,b — — Vomiting — — — — 1.sup.a,d — .sup.aNot treatment-related .sup.bOccurring in the same patient .sup.cOccurring in the same patient .sup.dOccurring in the same patient .sup.eOccurring in the same patient .sup.fOccurring in the same patient .sup.gOne patient not treated with nivolumab or ipilimumab in combination with SAM
TABLE-US-00060 TABLE 51A GRANITE Patient G1 Peptides in Restimulation Assay Peptide sequence (amino acids) Peptide pools TVAEFSHQC CD8 Pool Mini 1 VLTAILSSA CD8 Pool Mini 1 FIMTLNTSL CD8 Pool Mini 1 VDIDVPDVNF CD8 Pool Mini 1 FEAPEGKL CD8 Pool Mini 1 FEAPEGKLK CD8 Pool Mini 1 LSISYLREY CD8 Pool Mini 1 IEMVNRGQIQI CD8 Pool Mini 1 IDVPDVNF CD8 Pool Mini 1 IEMVNRGQI CD8 Pool Mini 1 EHDEALKNTW CD8 Pool Mini 1 EEHDEALKNTW CD8 Pool Mini 1 NQIDTLQEV CD8 Pool Mini 2 SLFHQSEVEL CD8 Pool Mini 2 YIVGANTETYL CD8 Pool Mini 2 IVGANTETY CD8 Pool Mini 2 YIVGANTETY CD8 Pool Mini 2 GEDCLTSQTRL CD8 Pool Mini 2 NESPGNNVV CD8 Pool Mini 2 TEILHSHVV CD8 Pool Mini 2 AEVDVREREI CD8 Pool Mini 2 SDELAQLY CD8 Pool Mini 2 NESPGNNVVDI CD8 Pool Mini 2 DELVTFSDEL CD8 Pool Mini 2 DEFIQANA CD8 Pool Mini 2 DELAQLYHH CD8 Pool Mini 2 DEFIQANAT CD8 Pool Mini 2 KLPEADVAVL CD8 Pool Mini 3 PEADVAVL CD8 Pool Mini 3 ADVAVLRTF CD8 Pool Mini 3 PEADVAVLRTF CD8 Pool Mini 3 DVAVLRTF CD8 Pool Mini 3 EADVAVLRTF CD8 Pool Mini 3 DEYATLMM CD8 Pool Mini 3 GLTEVIQSL CD8 Pool Mini 4 QVLHLMVGV CD8 Pool Mini 4 VLHLMVGV CD8 Pool Mini 4 HEMLQVLHL CD8 Pool Mini 4 TEVIQSLKM CD8 Pool Mini 4 AEQKGLTEVI CD8 Pool Mini 4
TABLE-US-00061 TABLE 51B GRANITE Patient G2 Peptides in Restimulation Assay Peptide sequence (amino acids) Peptide pools ALFGSALVPTG CD8 Pool Mini 1 ALFGSALVPT CD8 Pool Mini 1 GVSSFHVTW CD8 Pool Mini 1 SRPPHEPKF CD8 Pool Mini 1 TGVSSFHVTW CD8 Pool Mini 1 VSSFHVTW CD8 Pool Mini 1 QSRPPHEPKF CD8 Pool Mini 1 SRPPHEPKFV CD8 Pool Mini 1 VTGVSSFHVTW CD8 Pool Mini 1 VFPTRTAL CD8 Pool Mini 1 QLASLQQEL CD8 Pool Mini 2 SLNPAVAKA CD8 Pool Mini 2 SLQQELAAL CD8 Pool Mini 2 VLYKGEARV CD8 Pool Mini 2 KLNNDLNEL CD8 Pool Mini 2 RLEDQLASL CD8 Pool Mini 2 VLYKGEARVV CD8 Pool Mini 2 YAANSIGAV CD8 Pool Mini 2 RVGNESLNPAV CD8 Pool Mini 2 NLYAANSIGA CD8 Pool Mini 2 KPMERSSVL CD8 Pool Mini 2 SGASVNFDY CD8 Pool Mini 2 YKGEARVV CD8 Pool Mini 2 LYKGEARVV CD8 Pool Mini 2 HDSIKAAL CD8 Pool Mini 2 RVVLLKAAY CD8 Pool Mini 2 GSVSTIRQY CD8 Pool Mini 3 KTFPAAIW CD8 Pool Mini 3 ILADGPAVEV CD8 Pool Mini 4 LILADGPAV CD8 Pool Mini 4 LLMGTEDAL CD8 Pool Mini 4 KLADFVKYY CD8 Pool Mini 4 KLADFVKYYY CD8 Pool Mini 4 FYGPPQKI CD8 Pool Mini 4 STLLAGNLRI CD8 Pool Mini 4 TQKAKVGKL CD8 Pool Mini 4 LPLTTARYSTL CD8 Pool Mini 4 KAIINIFFF CD8 Pool Mini 4 GTVAKKVAW CD8 Pool Mini 4 TVAKKVAW CD8 Pool Mini 4
TABLE-US-00062 TABLE 51C GRANITE Patient G3 Peptides in Restimulation Assay Peptide sequence (amino acids) Peptide pools LVEKSEAVRK CD8 Pool Mini 1 ASMGTLAFHEY CD8 Pool Mini 1 ASMGTLAFH CD8 Pool Mini 1 MGTLAFHEY CD8 Pool Mini 1 GTLAFHEY CD8 Pool Mini 1 ATNQGWMLR CD8 Pool Mini 1 GTMSLPASV CD8 Pool Mini 1 RVPPKDLRVK CD8 Pool Mini 1 DTLISQESFEK CD8 Pool Mini 1 ISQESFEKK CD8 Pool Mini 1 TLISQESFEK CD8 Pool Mini 1 ISQESFEK CD8 Pool Mini 1 FLKNENNEL CD8 Pool Mini 1 SPVVETVPA CD8 Pool Mini 1 LEPPSLPAQR CD8 Pool Mini 1 MAMLIYTDF CD8 Pool Mini 2 AMLIYTDFL CD8 Pool Mini 2 SPSALIQEM CD8 Pool Mini 2 SDWPPPNTR CD8 Pool Mini 2 DAIDGRQAR CD8 Pool Mini 2 MLAGIPVTI CD8 Pool Mini 2 GMLAGIPVTI CD8 Pool Mini 2 GMLAGIPVT CD8 Pool Mini 2 TLYLLDIKV CD8 Pool Mini 2 SFVAVTEEGTK CD8 Pool Mini 2 FVAVTEEGTK CD8 Pool Mini 2 YLSPPCIHC CD8 Pool Mini 3 ARLGLTEVY CD8 Pool Mini 3 FLEERLARL CD8 Pool Mini 3 RLARLGLTEV CD8 Pool Mini 3 LARLGLTEVY CD8 Pool Mini 3 LARLGLTEV CD8 Pool Mini 3 SLLRVLVTL CD8 Pool Mini 3 VLVTLNDLEPK CD8 Pool Mini 3 VLDHTLPTA CD8 Pool Mini 4 TVLDHTLPTA CD8 Pool Mini 4 LPTALTSPEL CD8 Pool Mini 4 TVLDHTLPT CD8 Pool Mini 4 TVLDHTLPTAL CD8 Pool Mini 4 VLDHTLPTAL CD8 Pool Mini 4
TABLE-US-00063 TABLE 51D GRANITE Patient G4 Peptides in Restimulation Assay Peptide sequence (amino acids) Peptide pools YEAVAVAA CD8 Pool Mini 1 AVAAAASAY CD8 Pool Mini 1 YEAVAVAAA CD8 Pool Mini 1 AVAVAAAASAY CD8 Pool Mini 1 AVAAAASAYNY CD8 Pool Mini 1 RVRSYEAVAV CD8 Pool Mini 1 SYEAVAVAA CD8 Pool Mini 1 VAAAASAY CD8 Pool Mini 1 KTFPNVPRAAR CD8 Pool Mini 1 VAVAAAASAY CD8 Pool Mini 1 SYEAVAVA CD8 Pool Mini 1 RVHVPGKTL CD8 Pool Mini 1 SEASLVPLAY CD8 Pool Mini 2 EASLVPLAY CD8 Pool Mini 2 SEASLVPLA CD8 Pool Mini 2 ASLVPLAY CD8 Pool Mini 2 SEASLVPL CD8 Pool Mini 2 IQAQPENIPAK CD8 Pool Mini 2 DSEASLVPLAY CD8 Pool Mini 2 ELFPDRASSSW CD8 Pool Mini 3 HTQNWSTTW CD8 Pool Mini 3 GELIFCGM CD8 Pool Mini 3 GQHIDIQMK CD8 Pool Mini 3 DEFVKHKY CD8 Pool Mini 4 TDEFVKHKY CD8 Pool Mini 4 GTQPHTATR CD8 Pool Mini 4 ITDEFVKHK CD8 Pool Mini 4 GTQPHTATRL CD8 Pool Mini 4 HLNLGILYY CD8 Pool Mini 4 VTLKVLMADK CD8 Pool Mini 4 TDTHIPGSPF CD8 Pool Mini 4 HLNLGILY CD8 Pool Mini 4 QLPQPGAQH CD8 Pool Mini 4 KLITDEFVKHK CD8 Pool Mini 4 LPEIINLY CD8 Pool Mini 4 VTMEDLIQPW CD8 Pool Mini 4 TLKVLMADK CD8 Pool Mini 4 MVWGTGNPR CD8 Pool Mini 4 DSSPRLAVDF CD8 Pool Mini 4 ESGSMVNHL CD8 Pool Mini 4
TABLE-US-00064 TABLE 51E GRANITE Patient G7 Peptides in Restimulation Assay Peptide sequence (amino acids) Peptide pools SSSSVLNNK CD8 Pool Mini 1 SQSSSSVLNNK CD8 Pool Mini 1 HVNGGPLYSK CD8 Pool Mini 1 QSSSSVLNNK CD8 Pool Mini 1 QTHVKGSLK CD8 Pool Mini 1 ENAPPILPR CD8 Pool Mini 1 VIFKGEIGK CD8 Pool Mini 1 GSYSGTTILH CD8 Pool Mini 1 VVVGADGVGK CD8 Pool Mini 1 VNGGPLYSK CD8 Pool Mini 1 SMRDMNITK CD8 Pool Mini 2 TLLNLIQTK CD8 Pool Mini 2 STLLNLIQTK CD8 Pool Mini 2 YIDNALSRL CD8 Pool Mini 2 TSRGQVSER CD8 Pool Mini 2 SMRDMNITKL CD8 Pool Mini 2 VGKSDSVDAEK CD8 Pool Mini 2 TYIDNALSR CD8 Pool Mini 2 KSDSVDAEK CD8 Pool Mini 2 NLIQTKVNYV CD8 Pool Mini 2 LLNLIQTK CD8 Pool Mini 2 DSVDAEKSMLS CD8 Pool Mini 2 DLRTSQSVR CD8 Pool Mini 3 VLLTGTPLQK CD8 Pool Mini 3 KVLLTGTPLQK CD8 Pool Mini 3 LLTGTPLQK CD8 Pool Mini 3 NFDLRTSQSVR CD8 Pool Mini 3 QVYSKALNR CD8 Pool Mini 4 LLYKAGGVK CD8 Pool Mini 4 NFDVHHTAM CD8 Pool Mini 4 DSPHKEPIRLR CD8 Pool Mini 4 SLFLAVVAR CD8 Pool Mini 4 AVSSCFRQL CD8 Pool Mini 4 SSSSSLFL CD8 Pool Mini 4 SSSSSSLFL CD8 Pool Mini 4 DGAVSSCFR CD8 Pool Mini 4 SSSSLFLAV CD8 Pool Mini 4 LFLAVVAR CD8 Pool Mini 4 QVYSKALNRL CD8 Pool Mini 4 DVHHTAMLTR CD8 Pool Mini 4
TABLE-US-00065 TABLE 51F GRANITE Patient G8 Peptides in Restimulation Assay Peptide sequence (amino acids) Peptide pools SATKAVKPK CD8 Pool Mini 4 FVDEVEKVM CD8 Pool Mini 2 KSATKAVKPK CD8 Pool Mini 4 ATAATLLPH CD8 Pool Mini 1 TRLPLPLLL CD8 Pool Mini 3 SVFLHQMKK CD8 Pool Mini 2 GLNSRGKLVQV CD8 Pool Mini 2 SLNEAYGYQI CD8 Pool Mini 3 LLAELRSLNEA CD8 Pool Mini 3 MMEEVYQTL CD8 Pool Mini 1 ATKAVKPK CD8 Pool Mini 4 KSATKAVKP CD8 Pool Mini 4 NPAMTSELL CD8 Pool Mini 4 ILQRIIVEL CD8 Pool Mini 1 KLTQGETLCK CD8 Pool Mini 4 FTQASGMTPA CD8 Pool Mini 1 SLITAITTNR CD8 Pool Mini 2 PAMTSELL CD8 Pool Mini 4 REYTEDGQVTK CD8 Pool Mini 1 ETSKILLRK CD8 Pool Mini 2 FVIPLDVDEV CD8 Pool Mini 3 YVWDETVRA CD8 Pool Mini 2 GLLAELRSL CD8 Pool Mini 3 LITAITTNR CD8 Pool Mini 2 NPAMTSEL CD8 Pool Mini 4 YVWDETVRAA CD8 Pool Mini 2 ATRLPLPLLL CD8 Pool Mini 3 ITAITTNR CD8 Pool Mini 2 AMTSELLRA CD8 Pool Mini 4 ALWYTLDRL CD8 Pool Mini 3 NQRPILTII CD8 Pool Mini 1 RPPQHLGGLK CD8 Pool Mini 3 KSATKAVK CD8 Pool Mini 4 DVDEVPPGV CD8 Pool Mini 3 GMNQRPILT CD8 Pool Mini 1 GGMNQRPIL CD8 Pool Mini 1 TTETSKILLRK CD8 Pool Mini 2 TQASGMTPA CD8 Pool Mini 1 YTEDGQVTK CD8 Pool Mini 1 TSRPPQHLGGL CD8 Pool Mini 3
TABLE-US-00066 TABLE 52A GRANITE Patient G1 ELISpot Time- Dose point administered Vehicle CD8 Pool Day 0 ChAdV Prime 5 5 0 20 0 35 Day 14 5 0 0 15 35 15 Day 28 SAM Boost 1 10 10 0 105 160 135 Day 35 0 0 6.9 409.7 229.2 284.7 Day 42 6.9 0 0 298.6 284.7 361.1 Day 56 SAM Boost 2 13.9 0 0 256.9 284.7 381.9 Day 84 SAM Boost 3 0 0 0 812.5 770.8 680.6 Day 91 Day 112 SAM Boost 4 18.9 0 0 2232.5 2081.2 1873.1 Day 120 Day 140 SAM Boost 5 9.5 0 813.6 1059.5 (no Nivolumab) Day 148 Day 168 SAM Boost 6 9.5 9.5 9.5 1267.6 1381.1 1277.1 (no Nivolumab)
TABLE-US-00067 TABLE 52B GRANITE Patient G2 ELISpot Timepoint Dose administered Vehicle CD8 Pool Day 0 ChAdV Prime 0 0 0 15 5 0 Day 14 0 0 0 355 445 430 Day 28 SAM Boost 1 0 0 0 1065 1120 905 Day 35 0 0 0 2579.5 2706 2512.1 Day 42 8.4 0 0 1424.6 1584.8 1500.5 Day 56 0 0 0 1837.7 1896.7 1711.3 Day 84 0 0 0 2689.1 2630.1 2672.3 Day 91 SAM Boost 2 0 0 0 1079 1062.2 1062.2 Day 112 Day 120 SAM Boost 3 0 0 0 1331.9 1087.5 1180.2 Day 140 Day 148 SAM Boost 4 0 0 0 1083.1 1039.5 | 1003.1 Day 168 Day 183 SAM Boost 5 0 0 0 1112.2 1461.1 1221.2
TABLE-US-00068 TABLE 52C GRANITE Patient G3 ELISpot Timepoint Dose administered Vehicle CD8 Pool Day 0 ChAdV Prime 25 20 55 80 Day 14 20 50 Day 28 SAM Boost 1 0 0 5 165 205 125 Day 35 0 5.5 170.2 153.8 Day 42 Day 56 SAM Boost 2 0 11 153.8 137.3 Day 84 SAM Boost 3 5.5 11 71.4 137.3 197.7
TABLE-US-00069 TABLE 52D GRANITE Patient G4 ELISpot Timepoint Dose administered Vehicle CD8 Pool Day 0 ChAdV Prime 0 5 0 25 5 15 Day 14 0 0 0 40 55 35 Day 28 SAM Boost 1 15 0 0 230 220 220
TABLE-US-00070 TABLE 53A IL-2 and Granzyme B Production by Peptide Stimulated T Cells Sample IL-2 Granzyme B Patient G1— 0.97 0.46 2.37 8.77 11.54 13.23 Day 0 Patient G1— 42.96 31.58 30.67 28.82 55.32 55.15 Day 35 Patient G2— 0.00 7.24 0.90 0.00 14.19 0.00 Day 0 Patient G2— 42.30 46.17 35.35 20.94 21.99 12.38 Day 35 Replicate values for each cytokine and each timepoint are shown. Data are background subtracted based on vehicle control. Cytokine levels in supernatants (pg/ml)
TABLE-US-00071 TABLE 53B IFN-gamma Production by Peptide Stimulated T Cells Sample Vehicle Mini 1 Mini 2 Mini 3 Mini 4 Pat G1 - Day 0 5 5 0 0 20 10 5 10 5 10 Pat Gl - Day 84 0 0 0 930.6 930.6 319.4 333.3 208.3 208.3 534.7 590.3 Pat G2 - Day 0 0 0 0 5 0 0 0 5 5 0 5 Pat G2 - Day 84 0 0 0 767.1 767.1 1180.2 1374.1 143.3 160.2 1593.2 1483.7 Replicate values for each stimulation condition and each timepoint are shown as Interferon-gamma spot forming units per million peripheral blood mononuclear cells as measured by ELISpot assay. Values from different assay batches are normalized to batch 1 based on bridging samples stimulated with CMV-EBV-Flu peptide pools.
TABLE-US-00072 TABLE 54 Expansion of de novo and pre-existing T cells subsets Patient Stimulus Day 0 Day 112 CD8 Pool 1350 1780 10000 10000 G1 Mini 1 910 970 7280 6600 Mini 2 650 660 4980 4350 Mini 3 170 180 4060 Patient Stimulus Day 0 Day 14 CD8 Pool 2830 3220 2780 10000 10000 10000 Mini 1 320 570 5530 5790 G2 Mini 2 2960 2240 8130 7590 Mini 3 370 340 2400 3680 Mini 4 210 290 8730 7490 Replicate values for each stimulation condition and each timepoint are shown as Interferon-gamma spot forming units per million peripheral blood mononuclear cells as measured by post-IVS ELISpot assay. Pool 4 for patient 1 not tested due to insufficient PBMC numbers. IFNgamma spot forming units per million PBMCs
TABLE-US-00073 TABLE 55A SLATE KRAS Peptide Pools in Restimulation Assay KRAS G12C KRAS Q61H KRAS G12V Peptides Peptides Peptides KLVWGAC DILDTAGH KLVVVGAV LVVVGACG ILDTAGHE LVVVGAVG VVVGACGV LDTAGHEE VVVGAVGV VVGACGVG DTAGHEEY VVGAVGVG VGACGVGK TAGHEEYS VGAVGVGK GACGVGKS AGHEEYSA GAVGVGKS ACGVGKSA GHEEYSAM AVGVGKSA CGVGKSAL HEEYSAMR VGVGKSAL YKLVVVGAC LDILDTAGH YKLVVVGAV KLVVVGACG DILDTAGHE KLVVVGAVG LVVVGACGV ILDTAGHEE LVVVGAVGV VVVGACGVG LDTAGHEEY VVVGAVGVG VVGACGVGK DTAGHEEYS VVGAVGVGK VGACGVGKS TAGHEEYSA VGAVGVGKS GACGVGKSA AGHEEYSAM GAVGVGKSA ACGVGKSAL GHEEYSAMR AVGVGKSAL CGVGKSALT HEEYSAMRD VGVGKSALT EYKLVVVGAC LLDILDTAGH EYKLVVVGAV YKLVVVGACG LDILDTAGHE YKLVVVGAVG KLVVVGACGV DILDTAGHEE KLVVVGAVGV LVVVGACGVG ILDTAGHEEY LVVVGAVGVG VVVGACGVGK LDTAGHEEYS VVVGAVGVGK VVGACGVGKS DTAGHEEYSA VVGAVGVGKS VGACGVGKSA TAGHEEYSAM VGAVGVGKSA GACGVGKSAL AGHEEYSAMR GAVGVGKSAL ACGVGKSALT GHEEYSAMRD AVGVGKSALT CGVGKSALTI HEEYSAMRDQ VGVGKSALTI TEYKLVVVGAC CLLDILDTAGH TEYKLVVVGAV EYKLVVVGACG LLDILDTAGHE EYKLVVVGAVG YKLVVVGACGV LDILDTAGHEE YKLVVVGAVGV KLVVVGACGVG DILDTAGHEEY KLVVVGAVGVG LVVVGACGVGK ILDTAGHEEYS LVVVGAVGVGK VVVGACGVGKS LDTAGHEEYSA VVVGAVGVGKS VVGACGVGKSA DTAGHEEYSAM VVGAVGVGKSA VGACGVGKSAL TAGHEEYSAMR VGAVGVGKSAL GACGVGKSALT AGHEEYSAMRD GAVGVGKSALT ACGVGKSALTI GHEEYSAMRDQ AVGVGKSALTI CGVGKSALTIQ HEEYSAMRDQY VGVGKSALTIQ
TABLE-US-00074 TABLE 55B SLATE TP53 Peptide Pools in Restimulation Assay TP53 R213L TP53 S217Y TP53 R249M Peptides Peptides Peptides LDDRNTFL KSVTCTYY CMGGMNRM DDRNTFLH SVTCTYYP MGGMNRMP DRNTFLHS VTCTYYPA GGMNRMPI RNTFLHSV TCTYYPAL GMNRMPIL NTFLHSVV CTYYPALN MNRMPILT TFLHSVVV TYYPALNK NRMPILTI FLHSVVVP YYPALNKM RMPILTII LHSVVVPY YPALNKMF MPILTIIT YLDDRNTFL AKSVTCTYY SCMGGMNRM LDDRNTFLH KSVTCTYYP CMGGMNRMP DDRNTFLHS SVTCTYYPA MGGMNRMPI DRNTFLHSV VTCTYYPAL GGMNRMPIL RNTFLHSVV TCTYYPALN GMNRMPILT NTFLHSVVV CTYYPALNK MNRMPILTI TFLHSVVVP TYYPALNKM NRMPILTII FLHSVVVPY YYPALNKMF RMPILTIIT LHSVVVPYE YPALNKMFC MPILTIITL EYLDDRNTFL TAKSVTCTYY SSCMGGMNRM YLDDRNTFLH AKSVTCTYYP SCMGGMNRMP LDDRNTFLHS KSVTCTYYPA CMGGMNRMPI DDRNTFLHSV SVTCTYYPAL MGGMNRMPIL DRNTFLHSVV VTCTYYPALN GGMNRMPILT RNTFLHSVVV TCTYYPALNK GMNRMPILTI NTFLHSVVVP CTYYPALNKM MNRMPILTII TFLHSVVVPY TYYPALNKMF NRMPILTIIT FLHSVVVPYE YYPALNKMFC RMPILTIITL LHSVVVPYEP YPALNKMFCQ MPILTIITLE VEYLDDRNTFL GTAKSVTCTYY NSSCMGGMNRM EYLDDRNTFLH TAKSVTCTYYP SSCMGGMNRMP YLDDRNTFLHS AKSVTCTYYPA SCMGGMNRMPI LDDRNTFLHSV KSVTCTYYPAL CMGGMNRMPIL DDRNTFLHSVV SVTCTYYPALN MGGMNRMPILT DRNTFLHSVVV VTCTYYPALNK GGMNRMPILTI RNTFLHSVVVP TCTYYPALNKM GMNRMPILTII NTFLHSVVVPY CTYYPALNKMF MNRMPILTIIT TFLHSVVVPYE TYYPALNKMFC NRMPILTIITL FLHSVVVPYEP YYPALNKMFCQ RMPILTIITLE LHSVVVPYEPP YPALNKMFCQL MPILTIITLED
TABLE-US-00075 TABLE 56A SLATE Patient S1 ELISpot Timepoint Dose administered Vehicle CD8 Pool Day 0 ChAdV Prime 5 5 Day 14 0 10 Day 28 SAM Boost 1 0 10 35 40 Day 35 0 0 Day 42 15 0 50 55 Day 56 EOT 15 25 30 25
TABLE-US-00076 TABLE 56B SLATE Patient S2 ELISpot Timepoint Dose administered Vehicle CD8 Pool Day 0 ChAdV Prime 10 30 15 195 285 Day 14 30 60 10 390 285 Day 28 SAM Boost 1 10 0 10 485 455 Day 35 5 0 5 480 500 Day 42 60 80 70 565 855 Day 56 SAM Boost 2 10 15 20 420 450
XXVI. Clinical Assessment of a Neoantigen Vaccine
[0751] An open-label, multi-center, multi-dose Phase 1/2 study is performed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of a heterologous prime/boost vaccination strategy. Two vaccine programs, GRANITE and SLATE, are assessed.
[0752] A personalized neoantigen cancer vaccine (“GRANITE”) is administered in combination with immune checkpoint blockade in patients with advanced cancer strategies. The GRANITE heterologous prime/boost vaccine regimen involves (1) a ChAdV that is used as a prime vaccination [GRT-C901] and (2) a SAM formulated in a LNP that is used for boost vaccinations [GRT-R902] following GRT-C901. Both GRT-C901 and GRT-R902 express the same 20 personalized neoantigens as well as two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). Tumors are used for whole-exome and transcriptome sequencing to detect somatic mutations, and blood is used for HLA typing and detection/subtraction of germline exome variants to generate the personalized neoantigen cassette using the EDGE algorithm.
[0753] A shared neoantigen cancer vaccine (“SLATE”) is administered in combination with immune checkpoint blockade in patients with advanced cancer. The SLATE heterologous prime/boost vaccine regimen involves (1) a ChAdV that is used as a prime vaccination [GRT-C903] and (2) a SAM formulated in a LNP that is used for boost vaccinations [GRT-R904]following GRT-C903. Both GRT-C903 and GRT-R904 express the same 20 shared neoantigens derived from a specific list of oncogenic mutations (see Table 34) as well as two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). For subject inclusion, tumors are used for whole-exome and transcriptome sequencing to detect somatic mutations, and blood is used for HLA typing.
[0754] GRT-C901 and GRT-C903 are replication-defective, E1 and E3 deleted adenoviral vectors based on chimpanzee adenovirus 68. The vectors contain an expression cassette encoding 20 neoantigens as well as two universal CD4 T-cell epitopes (PADRE and Tetanus Toxoid). GRT-C901 and GRT-C903 are formulated in solution at 5×10.sup.11 vp/mL and 1.0 mL is injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles (deltoid muscle preferred, gluteus [dorso or ventro] or rectus femoris on each side may be used). The GRT-C901 and GRT-C903 vectors differ only by the encoded neoantigens.
[0755] GRT-R902 and GRT-R904 are SAM vectors derived from an alphavirus. The GRT-R902 and GRT-R904 vectors encode the viral proteins and the 5′ and 3′ RNA sequences required for RNA amplification but encoded no structural proteins. The SAM vectors are formulated in LNPs composed of 4 lipids: an ionizable amino lipid, a phosphatidylcholine, cholesterol, and a PEG-based coat lipid to encapsulate the SAM and form LNPs. The GRT-R902 vector contains the same neoantigen expression cassette as used in GRT-C901 for each patient, respectively. The GRT-R904 vector contains the same neoantigen expression cassette as used in GRT-C903. GRT-R902 and GRT-R904 are formulated in solution at 1 mg/mL and was injected IM at each of 2 bilateral vaccine injection sites in opposing deltoid muscles (deltoid muscle preferred, gluteus [dorso or ventro] or rectus femoris on each side may be used). The boost vaccination sites is as close to the prime vaccination site as possible. The injection volume is based on the dose to be administered. The dose level amount refers explicitly to the amount of the SAM vector, i.e., it does not refer to other components, such as the LNP. The ratio of LNP:SAM is approximately 24:1. Accordingly, the dose of LNP is 720 μg, 2400 μg, and 7200 μg for each respective GRT-R902/GRT-R904 dose level (see below).
[0756] Ipilimumab is a human monoclonal IgG1 antibody that binds to the cytotoxic T-lymphocyte associated antigen 4 (CTLA-4). Ipilimumab is formulated in solution at 5 mg/mL and is injected SC proximally (within ˜2 cm) to each of the bilateral vaccination sites. The SC route of ipilimumab is distinct from the approved IV route of administration. Ipilimumab is administered at a does of 30 mg in one of two methods listed below: 1. Four 1.5 mL (7.5 mg) injections proximal to the vaccine draining LN at each of the bilateral vaccination sites (ie, 1.5 mL below the vaccination site and 1.5 mL above the vaccination site on each bilateral side in each deltoid, ventrogluteal, dorsogluteal, or rectus femoris [deltoid preferred, but dependent on clinical site and patient preference]). 2. Six 1 mL (5 mg) injections proximal to the vaccine draining LN at each of the bilateral vaccination sites (ie, 1 mL below the vaccination site, 1 mL to the side of the vaccination site, and 1 mL above the vaccination site on each bilateral side in each deltoid, ventrogluteal, dorsogluteal, or rectus femoris [deltoid preferred, but dependent on clinical site and patient preference]).
[0757] Nivolumab is a human monoclonal IgG4 antibody that blocks the interaction of PD-1 and its ligands, PD-L1 and PD-L2. Nivolumab is formulated in solution at 10 mg/mL and is administered as an IV infusion through a 0.2-micron to 1.2-micron pore size, low-protein binding in-line filter at the protocol-specified doses. It is not administered as an IV push or bolus injection. When the dose is fixed (eg, 240 mg flat dose), nivolumab injection may be infused undiluted or diluted so as not to exceed a total infusion volume of 160 mL. Nivolumab infusion is promptly followed by a flush of diluent to clear the line. Nivolumab is administered following each vaccination (i.e., each of GRT-C901, GRT-R902, GRT-C903, or GRT-R904) with or without ipilimumab on the same day. The dose and route of nivolumab is based on the Food and Drug Administration approved dose and route. Doses of nivolumab may be interrupted, delayed, or discontinued depending on how well the participant tolerates the treatment. Dosing visits are not skipped, only delayed. Vaccination does not occur in the absence of nivolumab unless the Investigator and Sponsor believe treatment with GRT-R902/GRT-R904 in the absence of nivolumab is in the best interest of the patient.
[0758] As illustrated in
[0759] As illustrated in
[0760] GRANITE Protocol Stages
[0761] For GRANITE, the personalized nature of the vaccine requires a specialized manufacturing process and thus, the patient's participation in the study is conducted in 2 stages: [0762] 1) Vaccine Production Stage [0763] a. Neoantigen prediction: NGS of a patient's tumor and blood followed by prediction of a patient's neoantigens using the EDGE machine learning model. [0764] b. Vaccine manufacturing: generating a patient-specific heterologous prime/boost vaccine that incorporates the identified neoantigens. [0765] 2) Study Treatment Stage: delivering the vaccine regimen to the patient consisting of the heterologous prime/boost vaccine in combination with immune checkpoint blockade.
[0766] Neoantigen prediction and vaccine manufacturing occur while the patient is receiving routine therapy for metastatic disease. The Study Treatment Stage will begin when the vaccine is ready and the patient meets eligibility criteria for the Study Treatment Stage.
[0767] The neoantigen vaccine strategy is outlined in the following steps: [0768] Obtain formalin-fixed paraffin-embedded (FFPE) tumor specimen and blood from patient [0769] Sequence the tumor and normal DNA and tumor RNA to identify non-synonymous exome mutations [0770] Perform transcriptome analysis to determine expression level of mutated proteins/peptides [0771] Determine the patient's HLA type from normal DNA [0772] Predict which of the mutant peptides are likely to be presented by the patient's class I HLA alleles using the EDGE model [0773] Assemble a prioritized list of candidate neoantigens based on predicted HLA presentation (including removal of epitopes identical to self-proteins to prevent potential autoimmune reactions) [0774] Insert the top 20 patient-specific predicted neoantigens into an expression cassette [0775] Generate two plasmids encoding the identical neoantigen expression cassette; one plasmid for GRT-C901 and one plasmid for GRT-R902 [0776] Utilize plasmids to generate the ChAdV68 and SAM vectors [0777] Formulate the SAM in LNP [0778] Confirm the potency, identity, and sterility of ChAdV and SAM-LNP [0779] Immunize the patient with the patient-specific, selected neoantigen vaccine, in combination with checkpoint blockade
[0780] GRANITE Vaccine Production Stage
[0781] The first step in manufacturing GRT-C901 and GRT-R902 is to determine the presence of neoantigens in a patient's tumor. Patients have available and sufficient tumor tissue and blood for genomic sequencing and HLA typing. For inclusion in the study, each patient has an available FFPE tumor specimen (FFPE block/slides/scrolls sufficient to yield approximately 40 microns tissue thickness and preferably from the most recent available biopsy) and blood. When equally recent FFPE tumor specimens are available from both primary tumor and distant metastases, the primary tumor specimen is preferred. The tumor is used for whole-exome and transcriptome sequencing to detect somatic mutations, and the blood for HLA typing and detection/subtraction of germline exome variants.
[0782] GRANITE Study Treatment Stage
[0783] When a patient's vaccine is ready for administration, patients receive study treatment according to the study Phase/cohort in which they are enrolled, as described above. Patients who experience disease progression on or after, or intolerance to, routine therapy while vaccine is being manufactured receive study treatment as their next line of therapy. For patients who have SD or better response to their routine therapy while the vaccine is being manufactured, study treatment is either administered concurrent with their routine therapy or these patients interrupt or stop routine therapy and receive only study treatment if deemed clinically appropriate (eg, in the setting of cumulative toxicity, patient preference/refusal to continue routine therapy).
[0784] The study uses a sequential approach in Phase 1 to assess the safety of the intended GRANITE vaccine regimen consisting of a heterologous prime/boost vaccine in combination with nivolumab and ipilimumab. Patients receive a prime vaccination with GRT-C901 followed by boost vaccinations with escalating doses of GRT-R902. All patients receive IV nivolumab. As part of the dose escalation of GRT-R902, SC ipilimumab is combined with the GRT-C901 prime vaccination and GRT-R902 boost vaccinations for patients treated in Dose Levels 3 and 4. Given the immunogenicity data observed in NHPs (data not shown), the addition of SC ipilimumab is expected to boost T-cell responses providing the best opportunity for a patient to generate the most robust T-cell response.
[0785] Phase 2 consists of tumor-specific expansion cohorts that each comprise two treatment settings for each tumor type; an “A” arm that enrolls patients who have SD or better response to routine therapy and a “B” arm that enrolls patients who experience disease progression on, or after, routine therapy (ie, post-progression). Patients in Phase 2 receive SC ipilimumab at the dose determined to be well tolerated in Phase 1. Patients receive IV nivolumab at 480 mg Q4W throughout Phase 1 and 2. In one GRANITE phase 2 arm, MSS-CRC cohorts, including following FOLFOX/FOLFIRI treatment, are assessed using the RP2D determined. In another GRANITE phase 2 arm, Gastro-esophageal cancer (GEA) cohorts, including following 2.sup.nd line chemotherapy, are assessed using the RP2D determined.
[0786] If patients progress prior to vaccine availability, the patient can begin treatment with nivolumab until the vaccine is available (ie, nivolumab bridging). Once the vaccine is available, the vaccine is administered upon the next treatment with nivolumab to align vaccine administration with nivolumab administration.
[0787] SLATE Protocol Stages
[0788] For SLATE, as shared tumor neoantigens are presented via specific HLA proteins on the surface of the tumor cells for recognition by CD8 T cells, the patient's HLA Class I alleles are identified to confirm the patient's tumor-specific neoantigen can be presented. Therefore, patient's participation in the study is conducted in 2 stages:
[0789] 1) HLA Screening Stage
[0790] 2) Study Treatment Stage
[0791] Given that ˜33% of patients with a relevant mutation are expected to have the matching HLA allele, patients are HLA typed prior to being eligible for study treatment. Patients eligible for the HLA Screening Stage are briefly described below; these patients include those with advanced or metastatic: [0792] MSS-CRC who are currently receiving systemic chemotherapy OR who have experienced disease progression following systemic chemotherapy, but have not initiated a new line of therapy [0793] NSCLC who are currently receiving an anti-PD-(L)1 antibody in combination with platinum-based chemotherapy OR who have experienced disease progression following treatment with an anti-PD-(L)1 antibody in combination with platinum-based chemotherapy, but have not initiated a new line of therapy [0794] PDA who are currently receiving first-line systemic chemotherapy for metastatic disease OR who have experienced disease progression on 1 L systemic cytotoxic chemotherapy, but have not initiated a new line of therapy [0795] Other solid tumor histology where the patient's tumor has the specified mutation and has experienced disease progression on available therapies known to confer clinical benefit
[0796] Patients with a matching specified mutation and HLA allele are eligible for study treatment.
[0797] SLATE HLA Screening Stage
[0798] The HLA Screening Stage of the study identifies patients who may be eligible for study treatment. A blood sample is submitted to the Sponsor to perform HLA typing to determine whether a patient possesses an HLA allele that matches the specified oncogenic mutation in that patient's tumor. Patients who do not possess the appropriate HLA alleles for the tumor-specific mutation are not be eligible to participate in the Study Treatment Stage.
[0799] Patients are assessed in the HLA Screening Stage if their tumors are known to have at least one mutation included in the expression cassette of GRT-C903/GRT-R904 based on a suitable molecular profiling assay performed according to institutional standards in a Clinical Laboratory Improvement Amendments (CLIA)-certified laboratory by a validated assay (eg, institutional or commercially available gene panel) (see Table 34). The mutation is clearly identified in the report and subclonal mutations are not considered eligible. HLA typing is performed by a centralized third-party CLIA-certified laboratory designated by the Sponsor. The Sponsor confirms the mutation result based on the mutation test report provided by the site and determines whether the patient's HLA Class I proteins are adequate for antigen presentation of the patient's tumor shared neoantigen(s).
[0800] SLATE Study Treatment Stage
[0801] Patients that meet eligibility criteria are administered the vaccine prime and boosts in combination with ipilimumab and nivolumab to augment T-cell responses. Patients receive study treatment according to the study Phase/cohort in which they are enrolled once their eligibility for the Study Treatment Stage has been confirmed.
[0802] Study treatment are administered either as maintenance therapy or as a new line of therapy as briefly described below: [0803] MSS-CRC 1L/2L maintenance: patients who have not experienced PD with at least 16 weeks of routine 1L or 2L chemotherapy [0804] MSS-CRC 3L: patients who have experienced PD on 2L chemotherapy [0805] NSCLC 2L: patients who have experienced PD following 1L treatment with anti-PD-(L)1 in combination with platinum-based chemotherapy (or PD following 1L treatment with anti-PD-(L)1 alone if patient refused platinum-based chemotherapy) [0806] PDA 1L maintenance: patients who have not experienced PD with at least 16 weeks of routine 1L chemotherapy [0807] PDA 2L: patients who have experienced PD on 1L chemotherapy [0808] Mutation positive solid tumor: patients who have experienced PD with all available therapies known to confer benefit
[0809] Some patients may be eligible to receive the shared neoantigen vaccine in the maintenance setting. For patients with MSS-CRC who have received >16 weeks of 1L or 2L chemotherapy or with PDA who have received >16 weeks of 1L chemotherapy, but have not experienced disease progression, study treatment may be administered concurrent with their routine therapy or these patients may interrupt or stop routine therapy and receive only study treatment if deemed clinically appropriate by the Investigator (eg, in the setting of cumulative toxicity, patient preference/refusal to continue routine therapy).
[0810] Phase 1 utilizes adaptive statistical methods to guide dose selection with the goal of determining the highest vaccine dose with a dose-limiting toxicity rate below 30%. This target toxicity rate takes into account the known safety profile of nivolumab and ipilimumab while optimizing the number of patients needed to establish a preliminary toxicity profile of the vaccine in combination with nivolumab and ipilimumab compared to other statistical approaches (eg, a 3+3 design). The dosing decisions in Phase 1 is based on a safety review of the treatment by the Study Committee (eg, to determine whether a DLT has occurred). An established adaptive method termed the modified toxicity probability interval (mTPI) incorporates the currently available safety information and indicates what dose subsequent patients should receive (ie, dose escalation, de-escalation, continue at the same dose, or close that dose level).
[0811] Phase 1 enrolls a maximum sample size of 24 patients. The full sample size may not be reached if either of the following criteria are met: [0812] There are no DLTs observed in >5 patients at the highest available dose level [0813] At least 8 subjects have been treated at the highest available dose level and the mTPI-2 model continues to recommend dose escalation
[0814] If either of these criteria are met, then the study may proceed to the next Phase (ie, from Phase 1 to Phase 2) prior to reaching the maximum sample size provided that higher dose levels are not available (eg, after ≥5 patients have been treated at Dose Level 4 in Phase 1 with no DLTs, the study can proceed to Phase 2).
[0815] A dose is excluded from further consideration due to unacceptable toxicity (DU) if at least 3 patients have been evaluated at that dose and the posterior probability that the true DLT rate is >30% exceeds 95%. Patients who are receiving study treatment concurrent with chemotherapy may be considered separately if there is evidence that toxicity may be due to the concurrent treatment with chemotherapy.
[0816] For all new dose levels, there is >24 hours between the first and second patients receiving GRT-C903 or the first dose of GRT-R904 to allow for observation of any severe acute toxicities as an initial assessment of the safety of this therapeutic approach and to inform subsequent treatment of patients.
[0817]
[0818] The mTPI-2 model determines whether doses of GRT-R904 can be increased from 30 to 100 to 300 μg in subsequent patients. Patients beginning study treatment at Dose Level 1 receive their first dose (Dose 1) of 30 μg of GRT-R904 in combination with IV nivolumab followed by the DLT observation period of 28 days per patient. Dose escalation decisions are made based on the mTPI-2 model once at least two patients have completed the DLT observation period at any dose level. For example, in the absence of any observed DLTs in the first two patients treated at Dose Level 1, dose escalation is permitted as indicated by the mTPI-2 model.
[0819] If the mTPI-2 model dictates dose escalation, then subsequent patients are treated at Dose Level 2 (ie, 30 μg of GRT-R904 in combination with 30 mg of SC ipilimumab). Once at least two patients have completed the DLT observation period, the mTPI model determines the subsequent dose of GRT-R904 to treat additional patients in combination with 30 mg of SC ipilimumab. For example, if no DLTs are observed in at least two patients in Dose Level 2, the mTPI model dictates dose escalation resulting in subsequent patients being administered GRT-R904 at the next dose level of 100 μg in combination with 30 mg of SC ipilimumab (ie, Dose Level 3) followed by the DLT observation period of 28 days. Similarly, if no DLTs are observed in at least two patients receiving 100 μg, subsequent patients receive GRT-R904 at the next dose level of 300 μg in combination with 30 mg of SC ipilimumab (ie, Dose Level 4) followed by a DLT observation period of 28 days. If DLTs are observed at the initial 30 μg dose and the mTPI model indicates de-escalation, a lower dose (Dose Level −1) of 10 μg of GRT-R904 may be evaluated in these patients.
[0820] If a DLT is observed at a particular dose level and the mTPI-2 model dictates dose de-escalation, then subsequent patients are treated at the next lower dose level below the dose level at which the DLT was observed. For example, if a DLT was observed within the 28-day DLT observation period in Dose Level 4 (ie, 300 μg dose of GRT-R904 in combination with 30 mg of SC ipilimumab) and the mTPI-2 model dictates dose de-escalation, subsequent patients start Dose 1 at Dose Level 3 (ie, 100 μg of GRT-R904 in combination with 30 mg of SC ipilimumab).
[0821] Each patient could receive a total of 9 vaccine doses including one dose of GRT-C903 (Dose 1) and 8 doses of GRT-R904 (Doses 2 to 7, 10, and 13). For doses 8, 9, 11, 12, 14, and onward patients only receive nivolumab.
[0822] The RP2D for GRT-R904 is declared once the criteria for moving from Phase 1 to Phase 2 have been met as described above (no DLTs in at least 5 patients, observed DLT rate <30% in at least 8 patients treated at the highest dose and mTPI-2 continues to recommend escalation, or maximum number of patients have been treated).
[0823] Once the study has moved to Phase 2, patients treated at Dose Levels 1 and 2 may receive the RP2D for GRT-R904 in combination with SC ipilimumab to minimize patient exposure to potentially sub-therapeutic doses and increase the amount of safety data obtained with the RP2D dose.
[0824] Following evaluation of the safety and tolerability of the vaccine regimen in Phase 1, Phase 2 enrolls tumor-specific cohorts in Phase 2 to assess early signs of clinical activity. Patients are treated in Phase 2 as in Phase 1. The vaccine regimen includes patients receiving GRT-C903/GRT-R904 IM bilaterally in combination with IV nivolumab with SC ipilimumab based on the tolerability in Phase 1. The dose of GRT-C903/GRT-R904 and SC ipilimumab is the RP2D based on data from Phase 1. Each expansion cohort enrolls approximately 20 patients. In one SLATE Phase 2 arm, patients with TP53 mutations, including ovarian cancer cohorts and others, are assessed using dose level 4 (300 μg+SC IPI). In another SLATE Phase 2 arm, NSCLC cohorts, including patients following immunotherapy and/or chemotherapy, are assessed using dose level 4 (300 μg+SC IPI) with either the original SLATE cassette or a new SLATE cassette design (such as one that features repeated epitopes, including KRAS epitopes). A representative preclinical cassette featuring multiple iterations of epitopes and corresponding preclinical data is shown in
XXVII. Clinical Assessment of a Neoantigen Vaccine
[0825] Appendix A is a document 35 pages in length (including title slip sheet) describing embodiments of the invention. Appendix A is hereby incorporated by reference, in its entirety, for all purposes.
[0826] It should be noted that the language used in Appendix A has been principally selected for readability and instructional purposes, and it may not have been selected to delineate or circumscribe the inventive subject matter. Accordingly, the disclosure of Appendix A is intended to be illustrative, but not limiting, of the scope of the invention.
[0827] In Appendix A, clinical evaluation results are presented for the open-label, multi-center, multi-dose Phase 1/2 studies that were performed to assess the dose, safety and tolerability, immunogenicity, and early clinical activity of a heterologous prime/boost vaccination strategy for the two vaccine programs, GRANITE and SLATE, described herein. The results demonstrated clear signals of efficacy.
[0828] Also presented in Appendix A are further studies that are performed to continue to assess clinical efficacy and safety.
[0829] While the invention has been particularly shown and described with reference to a preferred embodiment and various alternate embodiments, it will be understood by persons skilled in the relevant art that various changes in form and details can be made therein without departing from the spirit and scope of the invention.
Sequences
[0830] Table A
[0831] Refer to Sequence Listing, SEQ ID NOS. 10,755-21,015. For clarity, each peptide that was predicted to associate with a given HLA allele peptide with an HLA allele with an EDGE score >0.001 is assigned a unique SEQ ID. NO. Each of the above sequence identifiers is associated with the amino acid sequence of the peptide, HLA subtype, the gene name corresponding to the peptide, the mutation associated with the peptide, and whether the prevalence of the peptide:HLA pair was greater than 0.1% (noted as “1”) or less than 0.1% (noted as “0”).
[0832] Table A is disclosed in its entirety in U.S. Provisional Application No. 62/675,559, filed December May 23, 2018, which is hereby incorporated by reference in its entirety.
[0833] AACR GENIE Results
[0834] Refer to Sequence Listing, SEQ ID NOS. 21,016-29,357. For clarity, each peptide that was predicted to associate with a given HLA allele peptide with an HLA allele with an EDGE score >0.001 and prevalence >0.1% is assigned a unique SEQ ID. NO. Each of the above sequence identifiers is associated with the gene name and mutations corresponding to the peptide, HLA subtype, and amino acid sequence of the peptide.
TABLE-US-00077 Additional MS Validated Neoantigens (SEQ ID NOs 29513-29519) Restricted SEQ HLA Peptide ID Class 1 amino acid NO: Gene Mutation subtype sequence 29513 CTNNB1 S37Y point HLA-A* YLDSGIHYGA mutation 02:01 29514 CHD4 CHD4_K73fs HLA-B* TVRAATIL 08:01 29515 CTNNB1 CTNNB1S45P A*11:01 TTAPPLSGK 29516 CTNNB1 CTNNB1T41A A*11:01 ATAPSLSGK 29517 KRAS KRASG12V A*03:01 VVGAVGVGK 29518 KRAS KRASQ61R A*01:01 ILDTAGREEY 29519 TP53 TP53R213L A*02:01 YLDDRNTFL
[0835] Table 1.2
[0836] Refer to Sequence Listing, SEQ ID NOS. 57-10,754. Predicted shared antigens associated with gene expressed at a level of at least 10 TPM in at least 0.98% of cancer cases. Each of the above sequence identifiers is associated with the gene name, amino acid sequence of the peptide, Ensembl ID, and corresponding HLA allele(s).
Certain Sequences
[0837] Vectors, cassettes, and antibodies referred to herein are described below and referred to by SEQ ID NO.
TABLE-US-00078 Tremelimumab VL (SEQ ID NO: 16) Tremelimumab VH (SEQ ID NO: 17) Tremelimumab VH CDR1 (SEQ ID NO: 18) Tremelimumab VH CDR2 (SEQ ID NO: 19) Tremelimumab VH CDR3 (SEQ ID NO: 20) Tremelimumab VL CDR1 (SEQ ID NO: 21) Tremelimumab VL CDR2 (SEQ ID NO: 22) Tremelimumab VL CDR3 (SEQ ID NO: 23) Durvalumab (MEDI4736) VL (SEQ ID NO: 24) MEDI4736 VH (SEQ ID NO: 25) MEDI4736 VH CDR1 (SEQ ID NO: 26) MEDI4736 VH CDR2 (SEQ ID NO: 27) MEDI4736 VH CDR3 (SEQ ID NO: 28) MEDI4736 VL CDR1 (SEQ ID NO: 29) MEDI4736 VL CDR2 (SEQ ID NO: 30) MEDI4736 VL CDR3 (SEQ ID NO: 31) UbA76-25merPDTT nucleotide (SEQ ID NO: 32) UbA76-25merPDTT polypeptide (SEQ ID NO: 33) MAG-25merPDTT nucleotide (SEQ ID NO: 34) MAG-25merPDTT polypeptide (SEQ ID NO: 35) Ub7625merPDTT NoSFL nucleotide (SEQ ID NO: 36) Ub7625merPDTT NoSFL polypeptide (SEQ ID NO: 37) ChAdV68.5WTnt.MAG25mer (SEQ ID NO: 2); AC_000011.1 with E1 (nt 577 to 3403) and E3 (nt 27,125-31,825) sequences deleted; corresponding ATCC VR-594 nucleotides substituted at five positions; model neoantigen cassette under the control of the CMV promoter/enhancer inserted in place of deleted E1; SV40 polyA 3′ of cassette Venezuelan equine encephalitis virus [VEE] (SEQ ID NO: 3) GenBank: L01442.2 VEE-MAG25mer (SEQ ID NO: 4); contains MAG-25merPDTT nucleotide (bases 30- 1755) Venezuelan equine encephalitis virus strain TC-83 [TC-83](SEQ ID NO: 5) GenBank: L01443.1 VEE Delivery Vector (SEQ ID NO: 6); VEE genome with nucleotides 7544-11175 deleted [alphavirus structural proteins removed] TC-83 Delivery Vector(SEQ ID NO: 7); TC-83 genome with nucleotides 7544- 11175 deleted [alphavirus structural proteins removed] VEE Production Vector (SEQ ID NO: 8); VEE genome with nucleotides 7544- 11175 deleted, plus 5′ T7-promoter, plus 3′ restriction sites TC-83 Production Vector(SEQ ID NO: 9); TC-83 genome with nucleotides 7544- 11175 deleted, plus 5′ T7-promoter, plus 3′ restriction sites VEE-UbAAY (SEQ ID NO: 14); VEE delivery vector with MHC class 1 mouse tumor epitopes SIINFEKL (SEQ ID NO: 29362) and AH1-A5 inserted VEE-Luciferase (SEQ ID NO: 15); VEE delivery vector with luciferase gene inserted at 7545 ubiquitin (SEQ ID NO: 38)>UbG76 0-228 Ubiquitin A76 (SEQ ID NO: 39)>UbA76 0-228 HLA-A2 (MHC class 1) signal peptide (SEQ ID NO: 40)>MHC SignalPep 0-78 HLA-A2 (MHC class 1) Trans Membrane domain (SEQ ID NO: 41)>HLA A2 TM Domain 0-201 IgK Leader Seq (SEQ ID NO: 42)>IgK Leader Seq 0-60 Human DC-Lamp (SEQ ID NO: 43)>HumanDCLAMP 0-3178 Mouse LAMPI (SEQ ID NO: 44)>MouseLampl 0-1858 Human Lampl cDNA (SEQ ID NO: 45)>Human Lampl 0-2339 Tetanus toxoid nulceic acid sequence (SEQ ID NO: 46) Tetanus toxoid amino acid sequence (SEQ ID NO: 47) PADRE nulceotide sequence (SEQ ID NO: 48) PADRE amino acid sequence (SEQ ID NO: 49) WPRE (SEQ ID NO: 50)>WPRE 0-593 IRES (SEQ ID NO: 51)>eGFP IRES SEAP Insert 1746-2335 GFP (SEQ ID NO: 52) SEAP (SEQ ID NO: 53) Firefly Luciferase (SEQ ID NO: 54) FMDV 2A (SEQ ID NO: 55) Ipilimumab Heavy Chain (SEQ ID NO: 29520) QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYTMHWVRQAPGKGLEWVTFISYDGNNKYYADSVKGRFTISRDN SKNTLYLQMNSLRAEDTAIYYCARTGWLGPFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK Ipilimumab Light Chain (SEQ ID NO: 29521) EIVLTQSPGTLSLSPGERATLSCRASQSVGSSYLAWYQQKPGQAPRLLIYGAFSRATGIPDRFSGSGSGTDFTL TISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC Nivolumab Heavy Chain (SEQ ID NO: 29522) QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYYADSVKGRFTISRDN SKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPE PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPC PAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK Nivolumab Light Chain (SEQ ID NO: 29523) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGSGTDFTLT ISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW KVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
REFERENCES
[0838] 1. Desrichard, A., Snyder, A. & Chan, T. A. Cancer Neoantigens and Applications for Immunotherapy. Clin. Cancer Res. Off J. Am. Assoc. Cancer Res. (2015). doi: 10.1158/1078-0432.CCR-14-3175 [0839] 2. Schumacher, T. N. & Schreiber, R. D. Neoantigens in cancer immunotherapy. Science 348, 69-74 (2015). [0840] 3. Gubin, M. M., Artyomov, M. N., Mardis, E. R. & Schreiber, R. D. Tumor neoantigens: building a framework for personalized cancer immunotherapy. J Clin. Invest. 125, 3413-3421 (2015). [0841] 4. Rizvi, N. A. et al. Cancer immunology. Mutational landscape determines sensitivity to PD-1 blockade in non-small cell lung cancer. Science 348, 124-128 (2015). [0842] 5. Snyder, A. et al. Genetic basis for clinical response to CTLA-4 blockade in melanoma. N. Engl. J Med. 371, 2189-2199 (2014). [0843] 6. Carreno, B. M. et al. Cancer immunotherapy. A dendritic cell vaccine increases the breadth and diversity of melanoma neoantigen-specific T cells. Science 348, 803-808 (2015). [0844] 7. Tran, E. et al. Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer. Science 344, 641-645 (2014). [0845] 8. Hacohen, N. & Wu, C. J.-Y. United States Patent Application: 20110293637-COMPOSITIONS AND METHODS OF IDENTIFYING TUMOR SPECIFIC NEOANTIGENS. (A1). at <http://appft1.uspto.gov/netacgi/nph-Parser?Sect1=PTO1&Sect2=HITOFF&d=PG01&p=1&u=/netahtml/PTO/srchnum.html&r=1& f=G&1=50&s1=20110293637.PGNR.> [0846] 9. Lundegaard, C., Hoof, I., Lund, O. & Nielsen, M. State of the art and challenges in sequence based T-cell epitope prediction. Immunome Res. 6 Suppl 2, S3 (2010). [0847] 10. Yadav, M. et al. Predicting immunogenic tumour mutations by combining mass spectrometry and exome sequencing. Nature 515, 572-576 (2014). [0848] 11. Bassani-Stemberg, M., Pletscher-Frankild, S., Jensen, L. J. & Mann, M. Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation. Mol. Cell. Proteomics MCP 14, 658-673 (2015). [0849] 12. Van Allen, E. M. et al. Genomic correlates of response to CTLA-4 blockade in metastatic melanoma. Science 350, 207-211 (2015). [0850] 13. Yoshida, K. & Ogawa, S. Splicing factor mutations and cancer. Wiley Interdiscip. Rev. RNA 5, 445-459 (2014). [0851] 14. Cancer Genome Atlas Research Network. Comprehensive molecular profiling of lung adenocarcinoma. Nature 511, 543-550 (2014). [0852] 15. Rajasagi, M. et al. Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia. Blood 124, 453-462 (2014). [0853] 16. Downing, S. R. et al. U.S. Patent Application: 0120208706-OPTIMIZATION OF MULTIGENE ANALYSIS OF TUMOR SAMPLES. (A1). at <http://appft1.uspto.gov/netacgi/nph-Parser?Sect1=PTO1&Sect2=HITOFF&d=PG01&p=1&u=/netahtml/PTO/srchnum.html&r=1& f=G&1=50&s1=20120208706.PGNR.> [0854] 17. Target Capture for NextGen Sequencing-IDT. at <http://www.idtdna.com/pages/products/nextgen/target-capture> [0855] 18. Shukla, S. A. et al. Comprehensive analysis of cancer-associated somatic mutations in class I HLA genes. Nat. Biotechnol. 33, 1152-1158 (2015). [0856] 19. Cieslik, M. et al. The use of exome capture RNA-seq for highly degraded RNA with application to clinical cancer sequencing. Genome Res. 25, 1372-1381 (2015). [0857] 20. Bodini, M. et al. The hidden genomic landscape of acute myeloid leukemia: subclonal structure revealed by undetected mutations. Blood 125, 600-605 (2015). [0858] 21. Saunders, C. T. et al. Strelka: accurate somatic small-variant calling from sequenced tumor-normal sample pairs. Bioinforma. Oxf. Engl. 28, 1811-1817 (2012). [0859] 22. Cibulskis, K. et al. Sensitive detection of somatic point mutations in impure and heterogeneous cancer samples. Nat. Biotechnol. 31, 213-219 (2013). [0860] 23. Wilkerson, M. D. et al. Integrated RNA and DNA sequencing improves mutation detection in low purity tumors. Nucleic Acids Res. 42, e107 (2014). [0861] 24. Mose, L. E., Wilkerson, M. D., Hayes, D. N., Perou, C. M. & Parker, J. S. ABRA: improved coding indel detection via assembly-based realignment. Bioinforma. Oxf. Engl. 30, 2813-2815 (2014). [0862] 25. Ye, K., Schulz, M. H., Long, Q., Apweiler, R. & Ning, Z. Pindel: a pattern growth approach to detect break points of large deletions and medium sized insertions from paired-end short reads. Bioinforma. Oxf. Engl. 25, 2865-2871 (2009). [0863] 26. Lam, H. Y. K. et al. Nucleotide-resolution analysis of structural variants using BreakSeq and a breakpoint library. Nat. Biotechnol. 28, 47-55 (2010). [0864] 27. Frampton, G. M. et al. Development and validation of a clinical cancer genomic profiling test based on massively parallel DNA sequencing. Nat. Biotechnol. 31, 1023-1031 (2013). [0865] 28. Boegel, S. et al. HLA typing from RNA-Seq sequence reads. Genome Med. 4, 102 (2012). [0866] 29. Liu, C. et al. ATHLATES: accurate typing of human leukocyte antigen through exome sequencing. Nucleic Acids Res. 41, e142 (2013). [0867] 30. Mayor, N. P. et al. HLA Typing for the Next Generation. PloS One 10, e0127153 (2015). [0868] 31. Roy, C. K., Olson, S., Graveley, B. R., Zamore, P. D. & Moore, M. J. Assessing long-distance RNA sequence connectivity via RNA-templated DNA-DNA ligation. eLife 4, (2015). [0869] 32. Song, L. & Florea, L. CLASS: constrained transcript assembly of RNA-seq reads. BMC Bioinformatics 14 Suppl 5, S14 (2013). [0870] 33. Maretty, L., Sibbesen, J. A. & Krogh, A. Bayesian transcriptome assembly. Genome Biol. 15, 501 (2014). [0871] 34. Pertea, M. et al. StringTie enables improved reconstruction of a transcriptome from RNA-seq reads. Nat. Biotechnol. 33, 290-295 (2015). [0872] 35. Roberts, A., Pimentel, H., Trapnell, C. & Pachter, L. Identification of novel transcripts in annotated genomes using RNA-Seq. Bioinforma. Oxf. Engl. (2011). doi:10.1093/bioinformatics/btr355 [0873] 36. Vitting-Seerup, K., Porse, B. T., Sandelin, A. & Waage, J. spliceR: an R package for classification of alternative splicing and prediction of coding potential from RNA-seq data. BMC Bioinformatics 15, 81 (2014). [0874] 37. Rivas, M. A. et al. Human genomics. Effect of predicted protein-truncating genetic variants on the human transcriptome. Science 348, 666-669 (2015). [0875] 38. Skelly, D. A., Johansson, M., Madeoy, J., Wakefield, J. & Akey, J. M. A powerful and flexible statistical framework for testing hypotheses of allele-specific gene expression from RNA-seq data. Genome Res. 21, 1728-1737 (2011). [0876] 39. Anders, S., Pyl, P. T. & Huber, W. HTSeq—a Python framework to work with high-throughput sequencing data. Bioinforma. Oxf. Engl. 31, 166-169 (2015). [0877] 40. Furney, S. J. et al. SF3B1 mutations are associated with alternative splicing in uveal melanoma. Cancer Discov. (2013). doi:10.1158/2159-8290.CD-13-0330 [0878] 41. Zhou, Q. et al. A chemical genetics approach for the functional assessment of novel cancer genes. Cancer Res. (2015). doi:10.1158/0008-5472.CAN-14-2930 [0879] 42. Maguire, S. L. et al. SF3B1 mutations constitute a novel therapeutic target in breast cancer. J. Pathol. 235, 571-580 (2015). [0880] 43. Carithers, L. J. et al. A Novel Approach to High-Quality Postmortem Tissue Procurement: The GTEx Project. Biopreservation Biobanking 13, 311-319 (2015). [0881] 44. Xu, G. et al. RNA CoMPASS: a dual approach for pathogen and host transcriptome analysis of RNA-seq datasets. PloS One 9, e89445 (2014). [0882] 45. Andreatta, M. & Nielsen, M. Gapped sequence alignment using artificial neural networks: application to the MHC class I system. Bioinforma. Oxf. Engl. (2015). doi:10.1093/bioinformatics/btv639 [0883] 46. Jorgensen, K. W., Rasmussen, M., Buus, S. & Nielsen, M. NetMHCstab-predicting stability of peptide-MHC-I complexes; impacts for cytotoxic T lymphocyte epitope discovery. Immunology 141, 18-26 (2014). [0884] 47. Larsen, M. V. et al. An integrative approach to CTL epitope prediction: a combined algorithm integrating MHC class I binding, TAP transport efficiency, and proteasomal cleavage predictions. Eur. J. Immunol. 35, 2295-2303 (2005). [0885] 48. Nielsen, M., Lundegaard, C., Lund, O. & Keşmir, C. The role of the proteasome in generating cytotoxic T-cell epitopes: insights obtained from improved predictions of proteasomal cleavage. Immunogenetics 57, 33-41 (2005). [0886] 49. Boisvert, F.-M. et al. A Quantitative Spatial Proteomics Analysis of Proteome Turnover in Human Cells. Mol. Cell. Proteomics 11, M111.011429-M11.011429 (2012). [0887] 50. Duan, F. et al. Genomic and bioinformatic profiling of mutational neoepitopes reveals new rules to predict anticancer immunogenicity. J Exp. Med. 211, 2231-2248 (2014). [0888] 51. Janeway's Immunobiology: 9780815345312: Medicine & Health Science Books @ Amazon.com. at <http://www.amazon.com/Janeways-Immunobiology-Kenneth-Murphy/dp/0815345313> [0889] 52. Calis, J. J. A. et al. Properties of MHC Class I Presented Peptides That Enhance Immunogenicity. PLoS Comput. Biol. 9, e1003266 (2013). [0890] 53. Zhang, J. et al. Intratumor heterogeneity in localized lung adenocarcinomas delineated by multiregion sequencing. Science 346, 256-259 (2014) [0891] 54. Walter, M. J. et al. Clonal architecture of secondary acute myeloid leukemia. N. Engl. J. Med. 366, 1090-1098 (2012). [0892] 55. Hunt D F, Henderson R A, Shabanowitz J, Sakaguchi K, Michel H, Sevilir N, Cox A L, Appella E, Engelhard V H. Characterization of peptides bound to the class I MHC molecule HLA-A2.1 by mass spectrometry. Science 1992. 255: 1261-1263. [0893] 56. Zarling A L, Polefrone J M, Evans A M, Mikesh L M, Shabanowitz J, Lewis S T, Engelhard V H, Hunt D F. Identification of class I MHC-associated phosphopeptides as targets for cancer immunotherapy. Proc Natl Acad Sci USA. 2006 Oct. 3;103(40):14889-94. [0894] 57. Bassani-Sternberg M, Pletscher-Frankild S, Jensen L J, Mann M. Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation. Mol Cell Proteomics. 2015 March;14(3):658-73. doi: 10.1074/mcp.M114.042812. [0895] 58. Abelin J G, Trantham P D, Penny S A, Patterson A M, Ward S T, Hildebrand W H, Cobbold M, Bai D L, Shabanowitz J, Hunt D F. Complementary IMAC enrichment methods for HLA-associated phosphopeptide identification by mass spectrometry. Nat Protoc. 2015 September;10(9):1308-18. doi: 10.1038/nprot.2015.086. Epub 2015 Aug. 6 [0896] 59. Barnstable C J, Bodmer W F, Brown G, Galfre G, Milstein C, Williams A F, Ziegler A. Production of monoclonal antibodies to group A erythrocytes, HLA and other human cell surface antigens-new tools for genetic analysis. Cell. 1978 May; 14(1):9-20. [0897] 60. Goldman J M, Hibbin J, Kearney L, Orchard K, Th'ng KH. HLA-DR monoclonal antibodies inhibit the proliferation of normal and chronic granulocytic leukaemia myeloid progenitor cells. Br J Haematol. 1982 November; 52(3):411-20. [0898] 61. Eng J K, Jahan T A, Hoopmann M R. Comet: an open-source MS/MS sequence database search tool. Proteomics. 2013 January;13(1):22-4. doi: 10.1002/pmic.201200439. Epub 2012 Dec. 4. [0899] 62. Eng J K, Hoopmann M R, Jahan T A, Egertson J D, Noble W S, MacCoss MJ. A deeper look into Comet-implementation and features. J Am Soc Mass Spectrom. 2015 November;26(11):1865-74. doi: 10.1007/s13361-015-1179-x. Epub 2015 Jun. 27. [0900] 63. Lukas Käll, Jesse Canterbury, Jason Weston, William Stafford Noble and Michael J. MacCoss. Semi-supervised learning for peptide identification from shotgun proteomics datasets. Nature Methods 4:923-925, November 2007 [0901] 64. Lukas Käll, John D. Storey, Michael J. MacCoss and William Stafford Noble. Assigning confidence measures to peptides identified by tandem mass spectrometry. Journal of Proteome Research, 7(1):29-34, January 2008 [0902] 65. Lukas Käll, John D. Storey and William Stafford Noble. Nonparametric estimation of posterior error probabilities associated with peptides identified by tandem mass spectrometry. Bioinformatics, 24(16):i42-i48, August 2008 [0903] 66. Kinney R M, BJ Johnson, V L Brown, D W Trent. Nucleotide Sequence of the 26 S mRNA of the Virulent Trinidad Donkey Strain of Venezuelan Equine Encephalitis Virus and Deduced Sequence of the Encoded Structural Proteins. Virology 152 (2), 400-413. 1986 Jul. 30. [0904] 67. Jill E Slansky, Frederique M Rattis, Lisa F Boyd, Tarek Fahmy, Elizabeth M Jaffee, Jonathan P Schneck, David H Margulies, Drew M Pardoll. Enhanced Antigen-Specific Antitumor Immunity with Altered Peptide Ligands that Stabilize the MHC-Peptide-TCR Complex. Immunity, Volume 13, Issue 4, 1 Oct. 2000, Pages 529-538. [0905] 68. A Y Huang, P H Gulden, A S Woods, M C Thomas, C D Tong, W Wang, V H Engelhard, G Pastemack, R Cotter, D Hunt, D M Pardoll, and E M Jaffee. The immunodominant major histocompatibility complex class I-restricted antigen of a murine colon tumor derives from an endogenous retroviral gene product. Proc Natl Acad Sci USA.; 93(18): 9730-9735, 1996 Sep. 3. [0906] 69. JOHNSON, BARBARA J. B., RICHARD M. KINNEY, CRYSTLE L. KOST AND DENNIS W. TRENT. Molecular Determinants of Alphavirus Neurovirulence: Nucleotide and Deduced Protein Sequence Changes during Attenuation of Venezuelan Equine Encephalitis Virus. J Gen Virol 67:1951-1960, 1986. [0907] 70. Aarnoudse, C. A., Kruse, M., Konopitzky, R., Brouwenstijn, N., and Schrier, P.I. (2002). TCR reconstitution in Jurkat reporter cells facilitates the identification of novel tumor antigens by cDNA expression cloning. Int J Cancer 99, 7-13. [0908] 71. Alexander, J., Sidney, J., Southwood, S., Ruppert, J., Oseroff, C., Maewal, A., Snoke, K., Serra, H.M., Kubo, R. T., and Sette, A. (1994). Development of high potency universal DR-restricted helper epitopes by modification of high affinity DR-blocking peptides. Immunity 1, 751-761. [0909] 72. Banu, N., Chia, A., Ho, Z. Z., Garcia, A. T., Paravasivam, K., Grotenbreg, G.M., Bertoletti, A., and Gehring, A. J. (2014). Building and optimizing a virus-specific T cell receptor library for targeted immunotherapy in viral infections. Scientific Reports 4, 4166. [0910] 73. Comet, S., Miconnet, I., Menez, J., Lemonnier, F., and Kosmatopoulos, K. (2006). Optimal organization of a polypeptide-based candidate cancer vaccine composed of cryptic tumor peptides with enhanced immunogenicity. Vaccine 24, 2102-2109. [0911] 74. Depla, E., van der Aa, A., Livingston, B. D., Crimi, C., Allosery, K., de Brabandere, V., Krakover, J., Murthy, S., Huang, M., Power, S., et al. (2008). Rational design of a multiepitope vaccine encoding T-lymphocyte epitopes for treatment of chronic hepatitis B virus infections. Journal of Virology 82, 435-450. [0912] 75. Ishioka, G. Y., Fikes, J., Hermanson, G., Livingston, B., Crimi, C., Qin, M., del Guercio, M.F., Oseroff, C., Dahlberg, C., Alexander, J., et al. (1999). Utilization of MHC class I transgenic mice for development of minigene DNA vaccines encoding multiple HLA-restricted CTL epitopes. J Immunol 162, 3915-3925. [0913] 76. Janetzki, S., Price, L., Schroeder, H., Britten, C. M., Welters, M. J. P., and Hoos, A. (2015). Guidelines for the automated evaluation of Elispot assays. Nat Protoc 10, 1098-1115. [0914] 77. Lyons, G. E., Moore, T., Brasic, N., Li, M., Roszkowski, J. J., and Nishimura, M.I. (2006). Influence of human CD8 on antigen recognition by T-cell receptor-transduced cells. Cancer Res 66, 11455-11461. [0915] 78. Nagai, K., Ochi, T., Fujiwara, H., An, J., Shirakata, T., Mineno, J., Kuzushima, K., Shiku, H., Melenhorst, J. J., Gostick, E., et al. (2012). Aurora kinase A-specific T-cell receptor gene transfer redirects T lymphocytes to display effective antileukemia reactivity. Blood 119, 368-376. [0916] 79. Panina-Bordignon, P., Tan, A., Termijtelen, A., Demotz, S., Corradin, G., and Lanzavecchia, A. (1989). Universally immunogenic T cell epitopes: promiscuous binding to human MHC class II and promiscuous recognition by T cells. Eur J Immunol 19, 2237-2242. [0917] 80. Vitiello, A., Marchesini, D., Furze, J., Sherman, L. A., and Chesnut, R.W. (1991). Analysis of the HLA-restricted influenza-specific cytotoxic T lymphocyte response in transgenic mice carrying a chimeric human-mouse class I major histocompatibility complex. J Exp Med 173, 1007-1015. [0918] 81. Yachi, P. P., Ampudia, J., Zal, T., and Gascoigne, N. R. J. (2006). Altered peptide ligands induce delayed CD8-T cell receptor interaction—a role for CD8 in distinguishing antigen quality. Immunity 25, 203-211. [0919] 82. Pushko P, Parker M, Ludwig G V, Davis N L, Johnston R E, Smith J F. Replicon-helper systems from attenuated Venezuelan equine encephalitis virus: expression of heterologous genes in vitro and immunization against heterologous pathogens in vivo. Virology. 1997 Dec. 22;239(2):389-401. [0920] 83. Strauss, J H and E G Strauss. The alphaviruses: gene expression, replication, and evolution. Microbiol Rev. 1994 September; 58(3): 491-562. [0921] 84. Rheme C, Ehrengruber M U, Grandgirard D. Alphaviral cytotoxicity and its implication in vector development. Exp Physiol. 2005 January;90(1):45-52. Epub 2004 Nov. 12. [0922] 85. Riley, Michael K. II, and Wilfred Vermerris. Recent Advances in Nanomaterials for Gene Delivery-A Review. Nanomaterials 2017, 7(5), 94. [0923] 86. Frolov I, Hardy R, Rice C M. Cis-acting RNA elements at the 5′ end of Sindbis virus genome RNA regulate minus- and plus-strand RNA synthesis. RNA. 2001 November; 7(11):1638-51. [0924] 87. Jose J, Snyder J E, Kuhn R J. A structural and functional perspective of alphavirus replication and assembly. Future Microbiol. 2009 September;4(7):837-56. [0925] 88. Bo Li and C. olin N. Dewey. RSEM: accurate transcript quantification from RNA-Seq data with or without a referenfe genome. BMC Bioinformatics, 12:323, August 2011 [0926] 89. Hillary Pearson, Tariq Daouda, Diana Paola Granados, Chantal Durette, Eric Bonneil, Mathieu Courcelles, Anja Rodenbrock, Jean-Philippe Laverdure, Caroline Côté, Sylvie Mader, Sebastien Lemieux, Pierre Thibault, and Claude Perreault. MHC class I-associated peptides derive from selective regions of the human genome. The Journal of Clinical Investigation, 2016, [0927] 90. Juliane Liepe, Fabio Marino, John Sidney, Anita Jeko, Daniel E. Bunting, Alessandro Sette, Peter M. Kloetzel, Michael P. H. Stumpf, Albert J. R. Heck, Michele Mishto. A large fraction of HLA class I ligands are proteasome-generated spliced peptides. Science, 21, October 2016. [0928] 91. Mommen G P., Marino, F., Meiring H D., Poelen, M C., van Gaans-van den Brink, J A., Mohammed S., Heck A J., and van Els C A. Sampling From the Proteome to the Human Leukocyte Antigen-DR (HLA-DR) Ligandome Proceeds Via High Specificity. Mol Cell Proteomics 15(4): 1412-1423, April 2016. [0929] 92. Sebastian Kreiter, Mathias Vormehr, Niels van de Roemer, Mustafa Diken, Martin Löwer, Jan Diekmann, Sebastian Boegel, Barbara Schrors, Fulvia Vascotto, John C. Castle, Arbel D. Tadmor, Stephen P. Schoenberger, Christoph Huber, Ozlem Tureci, and Ugur Sahin. Mutant MHC class II epitopes drive therapeutic immune responses to caner. Nature 520, 692-696, April 2015. [0930] 93. Tran E., Turcotte S., Gros A., Robbins P. F., Lu Y. C., Dudley M.E., Wunderlich J. R., Somerville R. P., Hogan K., Hinrichs C. S., Parkhurst M. R., Yang J. C., Rosenberg S. A. Cancer immunotherapy based on mutation-specific CD4+ T cells in a patient with epithelial cancer. Science 344(6184) 641-645, May 2014. [0931] 94. Andreatta M., Karosiene E., Rasmussen M., Stryhn A., Buus S., Nielsen M. Accurate pan-specific prediction of peptide-MHC class II binding affinity with improved binding core identification. Immunogenetics 67(11-12) 641-650, November 2015. [0932] 95. Nielsen, M., Lund, O. NN-align. An artificial neural network-based alignment algorithm for MHC class II peptide binding prediction. BMC Bioinformatics 10:296, September 2009. [0933] 96. Nielsen, M., Lundegaard, C., Lund, O. Prediction of MHC class II binding affinity using SMM-align, a novel stabilization matrix alignment method. BMC Bioinformatics 8:238, July 2007. [0934] 97. Zhang, J., et al. PEAKS DB: de novo sequencing assisted database search for sensitive and accurate peptide identification. Molecular & Cellular Proteomics. 11(4):1-8. 1/2/2012. [0935] 98. Jensen, Kamilla Kjaergaard, et al. “Improved Methods for Prediting Peptide Binding Affinity to MHC Class II Molecules.” Immunology, 2018, doi:10.1111/imm.12889. [0936] 99. Carter, S. L., Cibulskis, K., Helman, E., McKenna, A., Shen, H., Zack, T., Laird, P. W., Onofrio, R. C., Winckler, W., Weir, B. A., et al. (2012). Absolute quantification of somatic DNA alterations in human cancer. Nat. Biotechnol. 30, 413-421 [0937] 100. McGranahan, N., Rosenthal, R., Hiley, C. T., Rowan, A. J., Watkins, T. B. K., Wilson, G. A., Birkbak, N. J., Veeriah, S., Van Loo, P., Herrero, J., et al. (2017). Allele-Specific HLA Loss and Immune Escape in Lung Cancer Evolution. Cell 171, 1259-1271.e11. [0938] 101. Shukla, S. A., Rooney, M. S., Rajasagi, M., Tiao, G., Dixon, P. M., Lawrence, M. S., Stevens, J., Lane, W. J., Dellagatta, J. L., Steelman, S., et al. (2015). Comprehensive analysis of cancer-associated somatic mutations in class I HLA genes. Nat. Biotechnol. 33, 1152-1158. [0939] 102. Van Loo, P., Nordgard, S. H., Lingjorde, O. C., Russnes, H. G., Rye, I. H., Sun, W., Weigman, V. J., Marynen, P., Zetterberg, A., Naume, B., et al. (2010). Allele-specific copy number analysis of tumors. Proc. Natl. Acad. Sci. U.S.A 107, 16910-16915. [0940] 103. Van Loo, P., Nordgard, S. H., Lingjorde, O. C., Russnes, H. G., Rye, I. H., Sun, W., Weigman, V. J., Marynen, P., Zetterberg, A., Naume, B., et al. (2010). Allele-specific copy number analysis of tumors. Proc. Natl. Acad. Sci. U.S.A 107, 16910-16915.