REDUCING CADMIUM ACCUMULATION IN FIELD GROWN TOBACCO PLANTS

20190387702 ยท 2019-12-26

    Inventors

    Cpc classification

    International classification

    Abstract

    There is described herein a mutant plant or part thereof having at least partially reduced expression or activity of at least two heavy metal ATPases (HMAs), said two HMAs comprising, consisting or consisting essentially of: (i) polypeptides having at least 65% sequence identity to SEQ ID NO:1 and SEQ ID NO:2; (ii) polynucleotides encoding the polypeptides set forth in (i); or (iii) polynucleotides having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4 encoding HMAs; wherein the expression or activity of one of the HMAs set forth in (i) or (ii) or (iii) is partially reduced or lost and the expression or activity of one of the HMAs set forth in (i) or (ii) or (iii) is lost as compared to a control plant; and wherein the mutant plant or part thereof exhibits at least a 27% reduction, as compared to the control plant, in the accumulation of cadmium in leaf when the mutant plant is grown in the field in the presence of naturally or non-naturally occurring cadmium.

    Claims

    1. A mutant plant or part thereof having at least partially reduced expression or activity of at least two heavy metal ATPases (HMAs), said two HMAs comprising: (i) polypeptides having at least 65% sequence identity to SEQ ID NO:1 and SEQ ID NO:2; (ii) polynucleotides encoding the polypeptides set forth in (i); or (iii) polynucleotides having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4 encoding HMAs; wherein the mutant plant or part thereof exhibits at least a 27% reduction, as compared to the control plant, in the accumulation of cadmium in leaf when the mutant plant is field grown in the presence of naturally or non-naturally occurring cadmium.

    2. The mutant plant or part thereof according to claim 1, wherein the expression or activity of one of the HMAs set forth in (i) or (ii) or (iii) is partially reduced or lost and the expression or activity of one of the HMAs set forth in (i) or (ii) or (iii) is lost as compared to a control plant.

    3. The mutant plant or part thereof according to claim 1, wherein the phenotype of the mutant plant or part thereof at harvest time is the same as the control plant at the same harvest time, wherein the mutant plant or part thereof does not show a biomass reduction at harvest time as compared to the control plant at the same harvest time.

    4. The mutant plant or part thereof according to claim 1, comprising at least one genetic alteration in a regulatory region or in the coding sequence of each of the polynucleotide sequences set forth in (ii) or (iii), suitably, wherein the mutation is a missense mutation or a nonsense mutation.

    5. The mutant plant or part thereof according to claim 1, comprising one or more of the following groups of mutations: at least one mutation at a position corresponding to an amino acid position in the A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in an P/N-domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid positions 251 to 296 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4, suitably, at least one mutation at a position corresponding to amino acid position 251 or 293 or 296 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in the A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid position 293 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid positions 223 to 265 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4, suitably, wherein the plant comprises at least one mutation at a position corresponding to amino acid position 293 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 or 234 or 235 or 265 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in a P/N-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a P/N-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 4, suitably, at least one mutation at a position corresponding to amino acid positions 402 to 464 of the P/N-domain of the third loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 comprising at least one mutation at a position corresponding to amino acid position 402 or 464 of the P/N-domain of the third loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in a P/N-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 4, suitably, at least one mutation at a position corresponding to amino acid position 438 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation corresponding to amino acid position 265 in the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the third cytoplasmic loop of the P/N domain of a HMA polypeptide encoded by a non-mutated sequence set forth SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid positions 464 of the third cytoplasmic loop of the P/N domain of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the second cytoplasmic loop of the A domain of a HMA polypeptide encoded by a non-mutated sequence set forth SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A domain of the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the third cytoplasmic loop of the P/N domain of a non-mutated sequence set forth SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N domain of the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the second cytoplasmic loop of the A domain loop of a non-mutated sequence set forth SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A domain loop of the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the second cytoplasmic loop of the third cytoplasmic loop of the P/N domain of a non-mutated sequence set forth SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in a third cytoplasmic loop of the P/N domain second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 4; suitably, at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N domain of the non-mutated sequence set forth in SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4; at least one mutation at a position corresponding to an amino acid position in the A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in an P/N-domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid positions 251 to 296 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3, suitably, at least one mutation at a position corresponding to amino acid position 251 or 293 or 296 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in the A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in the A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid position 293 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid positions 223 to 265 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3, suitably, wherein the plant comprises at least one mutation at a position corresponding to amino acid position 293 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 or 234 or 235 or 265 of the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in a P/N-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a P/N-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 3, suitably, at least one mutation at a position corresponding to amino acid positions 402 to 464 of the P/N-domain of the third loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid position 402 or 464 of the P/N-domain of the third loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in a P/N-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a A-domain loop of a HMA polypeptide encoded by a non-mutated sequence set forth in SEQ ID NO: 3, suitably, at least one mutation at a position corresponding to amino acid position 438 of the P/N-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation corresponding to amino acid position 265 in the A-domain loop of the HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in the third cytoplasmic loop of the P/N domain of a HMA polypeptide encoded by a non-mutated sequence set forth SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid positions 464 of the third cytoplasmic loop of the P/N domain of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in the second cytoplasmic loop of the A domain of a HMA polypeptide encoded by a non-mutated sequence set forth SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 3 suitably, at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A domain of the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in the third cytoplasmic loop of the P/N domain of a non-mutated sequence set forth SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N domain of the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; at least one mutation at a position corresponding to an amino acid position in the second cytoplasmic loop of the A domain loop of a non-mutated sequence set forth SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A domain loop of the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3; and at least one mutation at a position corresponding to an amino acid position in the second cytoplasmic loop of the third cytoplasmic loop of the P/N domain of a non-mutated sequence set forth SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in a third cytoplasmic loop of the P/N domain second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth SEQ ID NO: 3; suitably, at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N domain of the non-mutated sequence set forth in SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265, 223, 234 or 235 of the second cytoplasmic loop of the A domain loop of a HMA polypeptide encoded by the non-mutated sequence set forth in SEQ ID NO: 3.

    6. The mutant plant or part thereof according to claim 1, comprising one or more of the following groups of mutations: a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and Q561*, and wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are E296K and Q561*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and L223F, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and D234N, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and G235E, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are H438Y and W265*, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and W265**, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and L223F, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and D234N, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and G235E, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are E296K and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are E296K and L223F; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are E296K and D234N, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are E296K and G235E; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are T402I and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are T402I and L223F; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are T402I and D234N; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are T402I and G235E; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are G251D and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are G251D and L223F; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are G251D and D234N; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are G251D and G235E; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and Q561*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and L223F, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and D234N, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and G235E, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and Q561*, and wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are E296K and Q561*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and L223F, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and D234N, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and G235E, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are H438Y and W265*, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and W265**, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and L223F, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and D234N, wherein * denotes a stop codon; a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and G235E, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are E296K and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are E296K and L223F; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are E296K and D234N, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are E296K and G235E; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are T402I and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are T402I and L223F; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are T402I and D234N; a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are T402I and G235E; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are G251D and W265*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are G251D and L223F; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are G251D and D234N; a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are G251D and G235E; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and Q561*, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and L223F, wherein * denotes a stop codon; a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and D234N, wherein * denotes a stop codon; and a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and G235E, wherein * denotes a stop codon.

    7. A method for reducing the level of cadmium in the leaf of a field grown plant comprising the steps of: (a) reducing the expression or activity of two heavy metal ATPases (HMAs), said two HMAs comprising, consisting or consisting essentially of: (i) polypeptides having at least 65% sequence identity to SEQ ID NO:1 and SEQ ID NO:2; (ii) polynucleotides encoding the polypeptides set forth in (i); or (iii) polynucleotides having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4 encoding HMAs suitably, wherein the expression or activity of the HMAs is reduced by mutagenesis or genome editing; (b) growing the plant in the field; (c) optionally, measuring the cadmium content in the plant obtained in step (b); and (d) identifying a plant in which the cadmium content therein is reduced in comparison to a control plant in which the expression or activity of the HMAs has not been reduced, suitably, wherein the plant or part thereof exhibits at least a 27% reduction, as compared to the control plant, in the accumulation of cadmium in leaf when the plant is field grown in the presence of naturally or non-naturally occurring cadmium; suitably, wherein the phenotype of the mutant plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the mutant plant or part thereof does not show a biomass reduction at harvest time as compared to the control plant at the same harvest time.

    8. A method for identifying one or more genetic alterations in a field grown plant that correlates with reduced levels of cadmium in leaf as compared to a field grown control plant that does not comprise the one or more genetic alterations, said method comprising the steps of: (a) identifying a plant with reduced levels of cadmium in the leaves when grown in the field as compared to a control plant grown in the field, optionally wherein the phenotype of the plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the plant or part thereof does not show a biomass (for example, leaf weight) reduction at harvest time as compared to the control plant at the same harvest time; (b) providing a nucleic acid sample from the plant identified in step (a); and (c) identifying in the nucleic acid sample from step (b) one or more genetic alterations in the polynucleotide sequences encoding HMAs having at least 65% sequence identity to the non-mutated sequences set forth in SEQ ID NO:1 and SEQ ID NO:2 or the polynucleotide sequence having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4.

    9. Plant material from the mutant plant or part thereof of claim 1, suitably wherein the plant material is cured or dried plant material, suitably, wherein the phenotype of the mutant plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the mutant plant or part thereof does not show a biomass reduction at harvest time as compared to the control plant at the same harvest time.

    10. A method for producing plant material with reduced accumulation of cadmium in leaf when grown in the field as compared to a field grown control plant, said method comprising the steps of: (a) providing a mutant plant or part thereof according to claim 1 ; (b) growing the plant in the field; and (c) harvesting plant material from the plant, suitably, wherein the phenotype of the mutant plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the mutant plant or part thereof does not show a biomass reduction at harvest time as compared to the control plant at the same harvest time.

    11. A mutant plant or part thereof or plant material derived or derivable therefrom that is obtained or obtainable by the method according to claim 8, suitably wherein the phenotype of the mutant plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the mutant plant or part thereof does not show a biomass reduction at harvest time as compared to the control plant at the same harvest time.

    12. A plant product comprising at least a part of the mutant plant or part thereof of claim 1.

    13. A tobacco product or smoking article or consumable product comprising the mutant plant or part thereof of claim 1.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0039] FIG. 1: Gene expression levels for HMA4.1 and HMA4.2 in TN90 and K326 in 8 tissues. The gene expression ratio between roots and leaves is similar for both HMA4.1 and HMA4.2. Plants used in this experiment are mature field grown plants. Bars and errors represent mean and upper confidence intervals of three replicate plants.

    [0040] FIG. 2: Gene expression levels of HMA4.1 and HMA4.2 in TN90 and K326 HMA4 RNAi lines and their respective WT controls. Entire roots are harvested from agar grown plants, ground and extracted. Bars and errors represent mean and standard deviation (SD) of 4 replicate plants. *, **, and *** indicate levels of significance at P<0.05, P<0.01 and P<0.001, respectively, compared to the WT control plants.

    [0041] FIG. 3: (a) HMA4 RNAi K326 and TN90 tobacco plants and their respective background WT plants are grown for five weeks under low N fertilization regime in the greenhouse. (b, c) Cd/Zn levels in dry weight, (d) height, (e) leaf weight, (f) leaf thickness and (g) water content (comparison between fresh and dry weight) are determined. Bars and errors represent meanSD of five plants. *, **, and *** indicate levels of significance at P<0.05, P<0.01 and P<0.001, respectively, compared to the untreated control plants. The dotted lines indicate LOQ=0.05 ppm for Cd measurement.

    [0042] FIG. 4: (a) Phenotype, (b) leaf fresh weight and (c) leaf Cd and (d) leaf Zn levels in dry weight of mutant plants containing decreasing numbers of functional HMA4 alleles after five (left) and eleven (right) weeks growth in the greenhouse. The genotype is indicated beneath the panels: A and a are the wild-type and mutant alleles for HMA4.1, B and b are wild-type and mutant alleles for HMA4.2. Bars and errors represent meanSD of eight plants. *, **, and *** indicate levels of significance at P<0.05, P<0.01 and P<0.001, respectively, compared to the WT control plants. The dotted line indicates LOQ=0.05 ppm for Cd measurement.

    [0043] FIG. 5: Analysis of (a) leaf Cd and (b) Zn and (c) leaf fresh weight in the different double mutant plants and their respective HMA4 WT null-segregant controls grown for five and eleven weeks on soil in the greenhouse. Black bars indicate the null-segregant controls, grey bars the respective HMA4 homozygous double mutants. *, **, and *** indicate levels of significance at P<0.05, P<0.01 and P<0.001, respectively, compared to the WT control plants. The dotted lines indicates LOQ=0.05 ppm for Cd measurement.

    [0044] FIG. 6: (a) Leaf Cd and (b) leaf fresh weight data of the HMA4 mutants grown in the field in a region where a moderate Cd content is present. The genotype is indicated: A and a are the wild-type and mutant alleles for HMA4.1, B and b are wild-type and mutant alleles for HMA4.2. Leaf pooled samples were collected at lower stalk position in six (for some genotypes 3) replicated plots. Bars and error represent mean and standard deviation from 3-6 replicate plots measurements. *, **, and *** indicate levels of significance at P<0.05, P<0.01 and P<0.001, respectively, compared to the WT control plants. The dotted lines indicates LOQ=0.05 ppm for Cd measurement.

    [0045] FIG. 7: (a) Leaf Cd and (b) leaf dry weight data of the HMA4 mutants grown in the field in a region where a moderate Cd content is present. Black bars indicate the null-segregant controls, grey bars the respective HMA4 homozygous double mutants. Leaf pooled samples were collected at lower stalk position in six (for Q293*/W265* and Q293*/D234N four) replicated plots. Bars and error represent mean and standard deviation.

    [0046] FIG. 8: (a, b) Leaf Cd and (c, d) cured leaf weight data of the HMA4 mutants grown in the field in two regions where a high Cd content is present. (a) and (c) correspond to Cd and cured leaf weight data from field 3 and b and d to Cd and cured leaf weight data from field 4. Black bars indicate the null-segregant controls, grey bars the respective HMA4 homozygous double mutants. Leaf pooled samples were collected at lower stalk position in five replicated plots. Bars and error represent mean and standard deviation.

    [0047] FIG. 9: Scheme of the N. tabacum HMA4 proteins. Three functional domains carry out catalytic functions: the phosphorylation (P), nucleotide binding (N) and actuator (A) domains which are located in the second and third cytoplasmic loop of the protein. The missense mutations that were found to have an impact on protein function and reduced Cd in combination with a nonsense mutation are highlighted with underscore characters. All other missense mutations analysed in this study had no impact on Cd reduction when combined with a nonsense mutation. Nonsense mutations are highlighted in black. (This model only serves for illustration purposes and does not reflect domain folding.)

    DEFINITIONS

    [0048] The technical terms and expressions used within the scope of this application are generally to be given the meaning commonly applied to them in the pertinent art of plant and molecular biology. All of the following term definitions apply to the complete content of this application. The word comprising does not exclude other elements or steps, and the indefinite article a or an does not exclude a plurality. A single step may fulfil the functions of several features recited in the claims. The terms about, essentially and approximately in the context of a given numerate value or range refers to a value or range that is within 20%, within 10%, or within 5%, 4%, 3%, 2% or 1% of the given value or range.

    [0049] The term isolated refers to any entity that is taken from its natural milieu, but the term does not connote any degree of purification.

    [0050] An expression vector is a nucleic acid vehicle that comprises a combination of nucleic acid components for enabling the expression of nucleic acid. Suitable expression vectors include episomes capable of extra-chromosomal replication such as circular, double-stranded nucleic acid plasmids; linearized double-stranded nucleic acid plasmids; and other functionally equivalent expression vectors of any origin. An expression vector comprises at least a promoter positioned upstream and operably-linked to a nucleic acid, nucleic acid constructs or nucleic acid conjugate, as defined below.

    [0051] The term construct refers to a double-stranded, recombinant nucleic acid fragment comprising one or more polynucleotides. The construct comprises a template strand base-paired with a complementary sense or coding strand. A given construct can be inserted into a vector in two possible orientations, either in the same (or sense) orientation or in the reverse (or anti-sense) orientation with respect to the orientation of a promoter positioned within a vectorsuch as an expression vector.

    [0052] A vector refers to a nucleic acid vehicle that comprises a combination of nucleic acid components for enabling the transport of nucleic acid, nucleic acid constructs and nucleic acid conjugates and the like. Suitable vectors include episomes capable of extra-chromosomal replication such as circular, double-stranded nucleic acid plasmids; linearized double-stranded nucleic acid plasmids; and other vectors of any origin.

    [0053] A promoter refers to a nucleic acid element/sequence, typically positioned upstream and operably-linked to a double-stranded DNA fragment. Promoters can be derived entirely from regions proximate to a native gene of interest, or can be composed of different elements derived from different native promoters or synthetic DNA segments.

    [0054] The terms homology, identity or similarity refer to the degree of sequence similarity between two polypeptides or between two nucleic acid molecules compared by sequence alignment. The degree of homology between two discrete nucleic acid sequences being compared is a function of the number of identical, or matching, nucleotides at comparable positions. The percent identity may be determined by visual inspection and mathematical calculation. Alternatively, the percent identity of two nucleic acid sequences may be determined by comparing sequence information using a computer program such asClustalW, BLAST, FASTA or Smith-Waterman. The percentage identity for two sequences may take different values depending on: (i) the method used to align the sequences, for example, ClustalW, BLAST, FASTA, Smith-Waterman (implemented in different programs), or structural alignment from 3D comparison; and (ii) the parameters used by the alignment method, for example, local vs global alignment, the pair-score matrix used (for example, BLOSUM62, PAM250, Gonnet etc.), and gap-penalty, for example, functional form and constants. Having made the alignment, there are different ways of calculating percentage identity between the two sequences. For example, one may divide the number of identities by: (i) the length of shortest sequence; (ii) the length of alignment; (iii) the mean length of sequence; (iv) the number of non-gap positions; or (iv) the number of equivalenced positions excluding overhangs. Furthermore, it will be appreciated that percentage identity is also strongly length dependent. Therefore, the shorter a pair of sequences is, the higher the sequence identity one may expect to occur by chance. The popular multiple alignment program ClustalW (Nucleic Acids Research (1994) 22, 4673-4680; Nucleic Acids Research (1997), 24, 4876-4882) is a suitable way for generating multiple alignments of polypeptides or polynucleotides. Suitable parameters for ClustalW maybe as follows: For polynucleotide alignments: Gap Open Penalty=15.0, Gap Extension Penalty=6.66, and Matrix=Identity. For polypeptide alignments: Gap Open Penalty=10. o, Gap Extension Penalty=0.2, and Matrix=Gonnet. For DNA and Protein alignments: ENDGAP=1, and GAPDIST=4. Those skilled in the art will be aware that it may be necessary to vary these and other parameters for optimal sequence alignment. Suitably, calculation of percentage identities is then calculated from such an alignment as (N/T), where N is the number of positions at which the sequences share an identical residue, and T is the total number of positions compared including gaps but excluding overhangs.

    [0055] A variant means a substantially similar sequence. A variant can have a similar function or substantially similar function as a wild-type sequence. For the variants described herein, a similar function is at least about 50%, 60%, 70%, 80% or 90% of wild-type enzyme function. For the variants described herein, a substantially similar function is at least about 90%, 95%, 96%, 97%, 98% or 99% of wild-type enzyme function. The variants can have one or more favourable mutations that result in the enzyme having a reduced level of activity as compared to the wild-type polypeptide. The variants can have one or more favourable mutations that result in their activity being knocked out (ie. a 100% inhibition, and thus a non-functional polypeptide). Exemplary variants having one or more favourable mutations are described herein.

    [0056] The term plant refers to any plant or part of a plant at any stage of its life cycle or development, and its progenies. In one embodiment, the plant is a tobacco plant, which refers to a plant belonging to the genus Nicotiana. Preferred species of tobacco plant are described herein. Suitably, the plant is a mutant plant in which the expression of one or more genes or the activity of one or more proteins is modulated as compared to a control plant. Suitably, the alteration that renders the plant a mutant plant results in the modulation of the expression of one or more genes or the modulation of the activity of one or more polypeptides. In certain embodiments, the alteration is a genetic alternation or a genetic modification.

    [0057] Plant parts include plant cells, plant protoplasts, plant cell tissue cultures from which a whole plant can be regenerated, plant calli, plant clumps and plant cells that are intact in plants or parts of plants such as embryos, pollen, anthers, ovules, seeds, leaves, flowers, stems, branches, fruit, roots, root tips and the like. Progeny, variants and mutants of regenerated plants are also included within the scope of the disclosure, provided that they comprise the introduced polynucleotides described herein. Leaves of plants are particularly suitable for use in the present disclosure.

    [0058] A plant cell refers to a structural and physiological unit of a plant. The plant cell may be in the form of a protoplast without a cell wall, an isolated single cell or a cultured cell, or as a part of higher organized unit such as but not limited to, plant tissue, a plant organ, or a whole plant.

    [0059] The term plant material refers to any solid, liquid or gaseous composition, or a combination thereof, obtainable from a plant, including biomass, leaves, stems, roots, flowers or flower parts, fruits, pollen, egg cells, zygotes, seeds, cuttings, secretions, extracts, cell or tissue cultures, or any other parts or products of a plant. In one embodiment, the plant material comprises or consists of biomass, stem, seed or leaves. In another embodiment, the plant material comprises or consists of leaves.

    [0060] The term variety refers to a population of plants that share constant characteristics which separate them from other plants of the same species. While possessing one or more distinctive traits, a variety is further characterized by a very small overall variation between individuals within that variety. A variety is often sold commercially.

    [0061] The term line or breeding line as used herein denotes a group of plants that are used during plant breeding. A line is distinguishable from a variety as it displays little variation between individuals for one or more traits of interest, although there may be some variation between individuals for other traits.

    [0062] The term non-naturally occurring as used herein describes an entity (for example, a polynucleotide, a genetic mutation, a polypeptide, a plant, and a plant cell and plant material) that is not formed by nature or that does not exist in nature. Such non-naturally occurring entities or artificial entities may be made, synthesized, initiated, modified, intervened, or manipulated by methods described herein or that are known in the art. Such non-naturally occurring entities or artificial entities may be made, synthesized, initiated, modified, intervened, or manipulated by man. Thus, by way of example, a non-naturally occurring plant, a non-naturally occurring plant cell or non-naturally occurring plant material may be made using genetic manipulation technologiessuch as antisense RNA, interfering RNA, meganuclease and the like. By way of further example, a non-naturally occurring plant, a non-naturally occurring plant cell or non-naturally occurring plant material may be made by introgression of or by transferring one or more genetic mutations (for example one or more polymorphisms) from a first plant or plant cell into a second plant or plant cell (which may itself be naturally occurring), such that the resulting plant, plant cell or plant material or the progeny thereof comprises a genetic constitution (for example, a genome, a chromosome or a segment thereof) that is not formed by nature or that does not exist in nature. The resulting plant, plant cell or plant material is thus artificial or non-naturally occurring. Accordingly, an artificial or non-naturally occurring plant or plant cell may be made by modifying a genetic sequence in a first naturally occurring plant or plant cell, even if the resulting genetic sequence occurs naturally in a second plant or plant cell that comprises a different genetic background from the first plant or plant cell.

    [0063] The term modulating may refer to reducing, inhibiting, eliminating increasing or otherwise affecting the expression or activity of a polypeptide. The term may also refer to reducing, inhibiting, eliminating, increasing or otherwise affecting the activity of a gene encoding a polypeptide which can include, but is not limited to, modulating transcriptional activity.

    [0064] The term reduce or reduced as used herein, refers to a reduction of from about 10% to about 99%, or a reduction of at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or at least 100% or more of a quantity or an activity, such as but not limited to polypeptide activity, transcriptional activity and protein expression. The term inhibit or inhibited or eliminate or eliminated as used herein, refers to a reduction of from about 98% to about 100%, or a reduction of at least 98%, at least 99%, but particularly of 100%, of a quantity or an activity, such as but not limited to polypeptide activity, transcriptional activity and expression.

    [0065] Transformation of a cell may be stable or transient. The term transient transformation or transiently transformed or variations thereof refers to the introduction of one or more exogenous polynucleotides into a cell in the absence of integration of the exogenous polynucleotide into the host cell's genome. In contrast, the term stable transformation or stably transformed refers to the introduction and integration of one or more exogenous polynucleotides into the genome of a cell. The term stable transformant refers to a cell which has stably integrated one or more exogenous polynucleotides into the genomic or organellar DNA. It is to be understood that an organism or its cell transformed with the nucleic acids, constructs and/or vectors of the present disclosure can be transiently as well as stably transformed. In certain embodiments, stable transformation is preferred.

    [0066] The term increase or increased as used herein, refers to an increase of from about 5% to about 99%, or an increase of at least 5%, at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 98%, at least 99%, or at least 100% or more of a quantity or an activity, such as but not limited to polypeptide activity, transcriptional activity and protein expression.

    [0067] The term substantially as used herein and when used in the context of an amount means that the amount is at least about 10%, at least about 9%, at least about 8%, at least about 7%, at least about 6%, at least about 5%, at least about 4%, at least about 3%, at least about 2%, at least about 1%, or at least about 0.1% of the amount that it is being compared to.

    [0068] The term control in the context of a control plant or control plant cell and the like means a plant or plant cell in which the expression or activity of the gene or protein of interest has not been modulated and so it can provide a comparison or reference with a plant or plant cell in which the expression or activity of the enzyme has been modified. Thus, in the context of the present invention, the control will not include the at least one genetic alteration which reduces the expression or activity of the HMA4(s) described herein. The control plant or pant cell may comprise an empty vector. The control plant or plant cell may correspond to a wild-type plant or wild-type plant cell and the like. In all such cases, the subject plant and the control plant are grown and harvested under the same conditions and using the same protocols for comparative purposes. Thus, by way of example, the subject plant and the control plant can be grown in and harvested from soil with about the same levels of heavy metal(s) contentsuch as Cdso that comparisons between the two can be made. This can entail the subject plant and the control plant being grown in the same part of a field, for example, so that they are exposed to the approximately the same soil Cd levels. Changes in levels, ratios, activity, or distribution of the genes or polypeptides described herein, or changes in plant phenotype, particularly reduced accumulation of Cd and/or zinc can be measured using the methods described herein by comparing a subject plant to the control plant, suitably, where the subject plant and the control plant have been cultured and/or harvested using the same protocols. The control plant can provide a reference point for measuring changes in phenotype of the subject plant. The measurement of changes in phenotype can be measured at any time in a plant, including during plant development, senescence, or after curing. Measurement of changes in phenotype can be measured in plants grown under any conditions, including from plants grown in growth chamber, greenhouse, or in a field. Changes in phenotype can be measured by measuring Cd content and/or zinc content before and/or during and/or after curing or drying using methods that are well known in the art.

    [0069] The term field as used herein, assumes its normal meaning in the art as an area of open land, especially one that can be or is planted with crops. The field is part of the natural environment, rather than an artificial environmentsuch as a laboratory or a greenhouse. Thus, unlike an artificial environment, which will commonly be a man made building or structure, the field is part of the open outside environment.

    [0070] As discussed herein, the expression or activity of HMA(s) can be partially reduced in the mutant plant. As used, herein, them term partially reduced means that the expression or activity of HMA(s) in the mutant plant is between about 1% and 99% lower than the level of expression or activity of HMA(s) in the control plant. Suitably, the expression or activity of HMA(s) in the mutant plant is between at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80% or 90% lower than the level of expression or activity of HMA(s) in the control plant. By way of example, a nonsense mutation that truncates a large part of the HMA protein is expected not to show any enzyme activity thereby resuting in the complete loss of activity (that is, zero activity). By way of further example, for a missense mutation, enzyme activity can be the same as the control plant, partially reduced or may not be detectable (for example, completely lost or zero).

    DETAILED DESCRIPTION

    [0071] Isolated HMA4 polypeptide variants (mutants) are described herein comprising a polypeptide sequence having at least 65% sequence identity to SEQ ID NO:1 or SEQ ID NO:2 and at least one amino acid mutation as compared to the wild-type sequences set forth in SEQ ID NO:1 or SEQ ID NO:2. SEQ ID NO:1 and SEQ ID NO:2 are non-mutated sequences. SEQ ID NO: 1 and SEQ ID NO:2 correspond to the amino acid sequence of Nicotiana tabacum heavy metal ATPase (NtHMA4.1) GenBank Accession No: CCQ77798 and the amino acid sequence of Nicotiana tabacum heavy metal ATPase (NtHMA4.2) GenBank Accession No: CCW03243.1, respectively. Suitably, the isolated polypeptide comprises, consists or consists essentially of a sequence having at least 65%, 66%, 67%, 68%, 69%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9% or 100% sequence identity thereto and at least one amino acid mutation. Certain plantssuch as N. tabacumcontain two homeologs of HMA4 which are referred to herein as HMA4.1 and HMA4.2.

    [0072] In a plant, plant cell or plant material and the like, the function or activity of the mutant polypeptides is modulated, reduced, partially inactivated, inhibited, eliminated, knocked out or lost. In one embodiment, the function or activity of one mutant polypeptide can be inhibited, eliminated, knocked out or lost such that the polypeptide activity is not detectable. In one embodiment, the function or activity of two mutant polypeptides (for example, polypeptides encoded by homeologs of the same gene) can be inhibited, eliminated, knocked out or lost such that the polypeptide activity is not detectable.

    [0073] In another embodiment, the function or activity of one mutant polypeptide (for example, one homeolog of a gene) is lost, inhibited or eliminated such that polypeptide activity is not detectable and the function or activity of another mutant polypeptide (for example, a second homeolog of the gene) is reduced or partially reduced such that the HMA polypeptide activity is lower as compared to a control HMA polypeptide but is still detectable. An exemplary mutation combination of this type is the double homozygous mutant G251D/Q561*, wherein the G251D mutation partially reduces the activity of NtHMA4.1 (SEQ ID NO:1) and the Q561* mutation knocks out, inhibits or eliminates the activity of NtHMA4.2 (SEQ ID NO:2). Either the activity of SEQ ID NO:1 or SEQ ID NO:2 is partially reduced and either the activity of SEQ ID NO:1 or SEQ ID NO:2 is lost, inhibited or eliminated provided that the activity of one of the HMA4 polypeptides is partially reduced and the activity of one of the HMAs is lost. Either the activity of SEQ ID NO:1 or SEQ ID NO:2 can be partially reduced and either the activity of SEQ ID NO:1 or SEQ ID NO:2 can be lost, inhibited or eliminated provided that the activity of one of the HMA4 polypeptides is partially reduced and the activity of one of the HMAs is lost.

    [0074] Suitably, at least one of the HMAs is fully knocked out and at least one of the HMAs comprises a nonsense or a missense mutation located either in the A-domain, in the DKTGT motif of the P-domain or in the HP locus of the N-domain.

    [0075] In a plant, plant cell or plant material and the like, the activity of NtHMA4.1 (SEQ ID NO:1) and NtHMA4.2 (SEQ ID NO:2) can be lost, inhibited or eliminated as compared to a control plant. An exemplary mutation combination of this type is the double homozygous mutant Q293*/Q561*, wherein the Q293* mutation knocks out, inhibits or eliminates the activity of NtHMA4.1 (SEQ ID NO:1) and the Q561* mutation knocks out, inhibits or eliminates the activity of NtHMA4.2 (SEQ ID NO:2). Other exemplary mutants are described in Tables 4 and 5. Combinations or mixtures of the variant (mutant) HMA4.1 and HMA4.2 polypeptides and polynucleotides as described herein are contemplated.

    [0076] For all combinations, the same combination in the other homeolog is contemplated, respectively. For example, the combination HMA4.1 E296K/HMA4.2 Q561* and the combination HMA4.1 Q561*/HMA4.2 E296K is contemplated.

    [0077] Suitably, the HMA4 polypeptide variants cause the plant in which they are contained to exhibit at least about a 27%, 33%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% or 95% or more Cd reduction when compared to the control.

    [0078] Other HMAs with at least 60% identity to SEQ ID NO: 1 or SEQ ID NO:2 that comprise at least one amino acid mutation at the position(s) that upon sequence alignment correspond to the positions disclosed herein are also contemplated for use in the present disclosure. Examples of these sequences include HMA sequences from the Solanaceae familysuch as tomato, potato and eggplant.

    [0079] Fragments of the variant polypeptides are also contemplated with the proviso they that they carry one or more of the amino acid mutation(s). Fragments of variant polypeptides may range from at least about 25 amino acids, about 50 amino acids, about 75 amino acids, about 100 amino acids about 150 amino acids, about 200 amino acids, about 250 amino acids, about 300 amino acids, about 400 amino acids, about 500 amino acids, about 600 amino acids, or up to the full-length polypeptide.

    [0080] The variants can be produced by introducing any type of alterations (for example, insertions, deletions, or substitutions of amino acids; changes in glycosylation states; changes that affect refolding or isomerizations, three-dimensional structures, or self-association states), provided that the mutant polypeptide causes the plant in which it is expressed to exhibit at least a reduction in the accumulation of Cd in as described herein.

    [0081] Polypeptides variants include mutants produced by introducing any type of alterations (for example, insertions, deletions, or substitutions of amino acids; changes in glycosylation states; changes that affect refolding or isomerizations, three-dimensional structures, or self-association states), which can be deliberately engineered or isolated naturally. Deliberate amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity and the amphipathic nature of the residues as long as the secondary binding activity of the substance is retained. For example, negatively charged amino acids include aspartic acid and glutamic acid; positively charged amino acids include lysine and arginine; and amino acids with uncharged polar head groups having similar hydrophilicity values include leucine, isoleucine, valine, glycine, alanine, asparagine, glutamine, serine, threonine, phenylalanine, and tyrosine. Conservative substitutions may be made, for example according to the Table below. Amino acids in the same block in the second column and suitably in the same line in the third column may be substituted for each other:

    TABLE-US-00001 ALIPHATIC Non-polar Gly Ala Pro Ile Leu Val Polar - uncharged Cys Ser Thr Met Asn Gly Polar - charged Asp Glu Lys Arg AROMATIC His Phe TrpTyr

    [0082] One suitable type of mutation is a missense mutation which is a point mutation in which a single nucleotide change results in a codon that codes for a different amino acid. Missense mutations can be particularly effective for partially inactivating (eg. reducing) a HMA4 polypeptidesuch as HMA4.1 or HMA4.2.

    [0083] Another suitable type of mutation is a nonsense mutation which is a point mutation in which a single nucleotide change results in a premature stop codon or a nonsense codon in the transcribed mRNA and a truncated, incomplete and non-functional HMA4 polypeptidesuch as HMA4.1 or HMA4.2. Nonsense mutations can be particularly effective for inhibiting or eliminating or knocking out the activity of a HMA4 polypeptidesuch as HMA4.1 or HMA4.2. As described herein, the expression or activity of one of HMA4.1 or HMA4.2 is at least partially reduced and the expression or activity of the other HMA4.1 or HMA4.2 is lost, eliminated or reduced as compared to a control plant in certain embodiments. In one embodiment, the expression or activity of one of HMA4.1 or HMA4.2 is partially reduced through the use of a missense point mutation and the expression or activity of the other HMA4.1 or HMA4.2 is lost, eliminated or reduced through the use of a nonsense point mutation.

    [0084] Suitably, the mutations described herein are heterozygous or homozygous mutations. Suitably, the mutations described herein are homozygous mutations.

    [0085] The mutation(s) can be positioned in, for example, a regulatory region of HMA4.1 or HMA4.2 or in the coding sequence of HMA4.1 or HMA4.2. In certain embodiments, the mutation(s) are positioned in the coding sequence of HMA4.1 or HMA4.2.

    [0086] The HMA4 polypeptide comprises various domains which are described in Table 7. For the combinations of mutants described herein, the same combination can be included in the other homeolog, respectively.

    [0087] The expression or activity of at least two heavy metal ATPases (HMAs) is partially reduced such that a mutant plant or part thereof containing the HMAs exhibits at least a 27% reduction, as compared to the control plant, in the accumulation of cadmium in leaf when the mutant plant is field grown in the presence of naturally or non-naturally occurring cadmium. The expression or activity of one of the HMAs can be partially reduced or lost and the expression or activity of the other HMA can be lost as compared to a control plant.

    [0088] Suitably, the HMA4 polypeptide variant can comprise at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0089] Suitably, the HMA4 polypeptide variant can comprise at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0090] More suitably, variant comprises at least one mutation at a position corresponding to amino acid positions 251 to 296 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0091] More suitably, variant comprises at least one mutation at a position corresponding to amino acid positions 251 to 296 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0092] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 251 or 293 or 296 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0093] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 251 or 293 or 296 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0094] Suitably, the plant comprises at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0095] Suitably, the plant comprises at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0096] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 293 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid positions 223 to 265 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0097] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 293 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid positions 223 to 265 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0098] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 293 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 or 234 or 235 or 265 of the N-domain of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0099] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 293 of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 or 234 or 235 or 265 of the N-domain of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0100] Suitably, the variant comprises at least one mutation at a position corresponding to an amino acid position in the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0101] Suitably, the variant comprises at least one mutation at a position corresponding to an amino acid position in the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to an amino acid position in the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0102] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 402 to 464 of the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0103] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 402 to 464 of the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0104] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 402 or 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0105] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 402 or 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0106] Suitably, the variant comprises at least one mutation at a position corresponding to an amino acid position in the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0107] Suitably, the variant comprises at least one mutation at a position corresponding to an amino acid position in the P/N-domain loop of the HMA polypeptide encoded by SEQ ID NO:4 and at least one mutation at a position corresponding to an amino acid position in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0108] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the P/N-domain loop encoded by SEQ ID NO: 3 and at least one mutation at amino acid position 265 in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0109] More suitably, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the P/N-domain loop encoded by SEQ ID NO: 4 and at least one mutation at amino acid position 265 in the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0110] Suitably, the variant comprises one or more of the mutations selected from the group consisting of: (i) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and Q561*, wherein * denotes a stop codon; (ii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and W265*, wherein * denotes a stop codon; (iii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are E296K and Q561*, wherein * denotes a stop codon; (iv) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon; (v) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; (vi) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and Q561*, wherein * denotes a stop codon; (vii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and L223F, wherein * denotes a stop codon; (viii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and D234N, wherein * denotes a stop codon; (ix) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are Q293* and G235E, wherein * denotes a stop codon; or (x) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of a non-mutated sequence set forth in SEQ ID NO:2, suitably, wherein the mutations are H438Y and W265*, wherein * denotes a stop codon.

    [0111] Suitably, the variant comprises one or more of the mutations selected from the group consisting of: (i) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and Q561*, wherein * denotes a stop codon; (ii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and W265*, wherein * denotes a stop codon; (iii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are E296K and Q561*, wherein * denotes a stop codon; (iv) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon; (v) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; (vi) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and Q561*, wherein * denotes a stop codon; (vii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and L223F, wherein * denotes a stop codon; (viii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and D234N, wherein * denotes a stop codon; (ix) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are Q293* and G235E, wherein * denotes a stop codon; or (x) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of a non-mutated sequence set forth in SEQ ID NO:1, suitably, wherein the mutations are H438Y and W265*, wherein * denotes a stop codon.

    [0112] It is contemplated that any one of the nonsense mutations can be combined with any one of the missense mutations described herein.

    [0113] A summary of the data obtained using plants containing the above-mentioned variants when grown outside in the field is set forth in Table 4, 5 and 6. Plants comprising the double mutant Q293*/Q561* or Q293*/W265* or Q464*/Q561* or Q293*/G235E or E296K/Q561* or T402I/Q561* exhibit around 80-96% Cd reduction. Plants comprising the double mutant G251D/Q561* exhibit around 33-70% Cd reduction. Plants comprising the double mutant Q293*/L223F or Q293*/D234N exhibit around 27-37% Cd reduction. At an early stage and under certain conditions delayed plant development is observed for the double mutants Q293*/Q561* or Q293*/W265* or Q464*/Q561* or Q293*/G235E or E296K/Q561* or T402I/Q561*. However, at harvest time, no clear phenotypic differences can be observed between each of the mutants and the control. G251D/Q561* shows normal growth and development. Although Q293*/Q561* or Q293*/W265* or Q464*/Q561* or E296K/Q561* or Q293*/G235E might show necrotic lesions on their leaves at an early stage, depending on environmental conditions, the presence of necrotic lesions is not observed under most conditions at harvest time in the field. The other mutation combinations tested (G382R/Q561*, V351M/Q561*, A188V/Q561*, Q293*/A369V, Q293*/A374V, T1891/Q561*, Q293*/S27L, Q293*/A188V, G128E/Q561*) do not lead to significant or greater than 20% Cd reduction. Suitably, in certain embodiments, the double mutant is not G382R/Q561* or V351M/Q561* or A188V/Q561* or Q293*/A369V or Q293*/A374V or T1891/Q561* or Q293*/S27L or Q293*/A188V or G128E/Q561*.

    [0114] Data for some of these double mutants when grown in the greenhouse is shown in Table 8. As can be seen from a comparison of Table 4 (field trial) and Table 8 (greenhouse), the level of Cd reduction for the various mutation combinations generally correspond to each other.

    [0115] Further double mutants have been tested in the greenhouse. The results of these data are presented in Table 9. In view of the general agreement on the level of Cd reduction for the double mutants presented in Tables 4 and 8 for the field data and greenhouse data, it is predicted that the greenhouse data presented in Table 9 will also generally correspond to the results that will be obtained the field. The mutation combination H438Y/W265* was tested under greenhouse conditions only where it led to around 58% Cd reduction; phenotypic changes were not observed (Table 9).

    [0116] In certain embodiments, the double mutants Q293*/Q561* or Q293*/W265* or E296K/Q561* or T402I/Q561* or Q464*/Q561* or Q293*/G235E are preferred because they exhibit about 80% or more Cd reduction in the field. In one embodiment of this preferred combination, the mutant plant or part thereof comprises one or more of the mutations selected from the group consisting of: (i) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and Q561*, wherein * denotes a stop codon; (ii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and W265*, wherein * denotes a stop codon; (iii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are E296K and Q561*, wherein * denotes a stop codon; (iv) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon; (v) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and Q561*, wherein * denotes a stop codon; (vi) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and G235E, wherein * denotes a stop codon.

    [0117] In one embodiment of this preferred combination, the mutant plant or part thereof comprises one or more of the mutations selected from the group consisting of: (i) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and Q561*, wherein * denotes a stop codon; (ii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and W265*, wherein * denotes a stop codon; (iii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are E296K and Q561*, wherein * denotes a stop codon; (iv) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon; (v) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and Q561*, wherein * denotes a stop codon; (vi) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and G235E, wherein * denotes a stop codon.

    [0118] In certain embodiments, the double mutants G251D/Q561* or H438Y/W265* or Q293*/L223F or Q293*/D234N are preferred (for example, for introduction into plantssuch as tobacco, for example, Burley tobacco) because they exhibit 27-70% Cd reduction and are likely not to interfere with growth. In one embodiment of this preferred combination, the mutant plant or part thereof comprises one or more of the mutations selected from the group consisting of: (i) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; (ii) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and W265*, wherein * denotes a stop codon; (iii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and L223F, wherein * denotes a stop codon; (iv) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are Q293* and D234N, wherein * denotes a stop codon.

    [0119] In one embodiment of this preferred combination, the mutant plant or part thereof comprises one or more of the mutations selected from the group consisting of: (i) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are G251D and Q561*, wherein * denotes a stop codon; (ii) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and W265*, wherein * denotes a stop codon; (iii) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and L223F, wherein * denotes a stop codon; (iv) a nonsense mutation at a position corresponding to amino acid position 293 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are Q293* and D234N, wherein * denotes a stop codon.

    [0120] In certain embodiments, the double mutant T402I/Q561* is preferred since it exhibits around 90% Cd reduction and acceptable morphology even at early growing stage. Thus, according to this embodiment, the mutant plant or part thereof comprises a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are T402I and Q561*, wherein * denotes a stop codon.

    [0121] Combinations of the mutations described herein are also contemplated. In particular, different combinations of each of the single mutations in the double mutants are contemplated. Examples of such combinations are shown in Tables 11 and 12 and described below.

    [0122] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0123] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0124] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0125] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0126] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0127] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0128] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0129] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 464 of the P-domain of the third loop of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0130] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0131] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0132] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0133] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0134] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0135] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0136] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0137] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 296 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0138] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0139] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0140] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0141] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0142] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0143] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0144] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0145] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 402 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0146] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0147] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 265 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0148] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0149] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0150] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0151] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0152] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0153] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 251 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0154] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 561 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0155] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 561 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0156] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0157] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 223 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0158] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0159] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 234 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0160] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 3 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 4.

    [0161] In one embodiment, the variant comprises at least one mutation at a position corresponding to amino acid position 438 of the third cytoplasmic loop of the P/N-domain of the HMA polypeptide encoded by SEQ ID NO: 4 and at least one mutation at a position corresponding to amino acid position 235 of the second cytoplasmic loop of the A-domain of the HMA polypeptide encoded by SEQ ID NO: 3.

    [0162] Suitably, the variant comprises one or more of the mutations selected from the group consisting of: (i) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and W265**, wherein * denotes a stop codon; (ii) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and L223F, wherein * denotes a stop codon; (iii) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and D234N, wherein * denotes a stop codon; (iv) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are Q464* and G235E, wherein * denotes a stop codon; (v) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are E296K and W265*, wherein * denotes a stop codon; (vi) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are E296K and L223F; (vii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are E296K and D234N, wherein * denotes a stop codon; (viii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are E296K and G235E; (ix) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are T402I and W265*, wherein * denotes a stop codon; (x) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are T402I and L223F; (xi) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are T402I and D234N; (xii) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are T402I and G235E; (xiii) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:2, suitably, wherein the mutations are G251 D and W265*, wherein * denotes a stop codon; (xiv) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are G251 D and L223F; (xv) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are G251D and D234N; (xvi) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are G251 D and G235E; (xvii) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and Q561*, wherein * denotes a stop codon; (xviii) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and L223F, wherein * denotes a stop codon; (xix) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and D234N, wherein * denotes a stop codon; or (xx) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:1 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:2, suitably, wherein the mutations are H438Y and G235E, wherein * denotes a stop codon.

    [0163] Suitably, the variant comprises one or more of the mutations selected from the group consisting of: (i) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and W265**, wherein * denotes a stop codon; (ii) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and L223F, wherein * denotes a stop codon; (iii) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and D234N, wherein * denotes a stop codon; (iv) a nonsense mutation at a position corresponding to amino acid position 464 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are Q464* and G235E, wherein * denotes a stop codon; (v) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are E296K and W265*, wherein * denotes a stop codon; (vi) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are E296K and L223F; (vii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are E296K and D234N, wherein * denotes a stop codon; (viii) a missense mutation at a position corresponding to amino acid position 296 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are E296K and G235E; (ix) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are T402I and W265*, wherein * denotes a stop codon; (x) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are T402I and L223F; (xi) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are T402I and D234N; (xii) a missense mutation at a position corresponding to amino acid position 402 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are T402I and G235E; (xiii) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 265 of SEQ ID NO:1, suitably, wherein the mutations are G251D and W265*, wherein * denotes a stop codon; (xiv) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are G251 D and L223F; (xv) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are G251D and D234N; (xvi) a missense mutation at a position corresponding to amino acid position 251 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are G251D and G235E; (xvii) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a nonsense mutation at a position corresponding to amino acid position 561 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and Q561*, wherein * denotes a stop codon; (xviii) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 223 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and L223F, wherein * denotes a stop codon; (xix) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 234 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and D234N, wherein * denotes a stop codon; or (xx) a missense mutation at a position corresponding to amino acid position 438 of SEQ ID NO:2 and a missense mutation at a position corresponding to amino acid position 235 of SEQ ID NO:1, suitably, wherein the mutations are H438Y and G235E, wherein * denotes a stop codon.

    [0164] A polynucleotide as described herein will generally contain phosphodiester bonds, although in some cases, polynucleotide analogues are included that may have alternate backbones, comprising, for example, phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages; and peptide polynucleotide backbones and linkages. Other analogue polynucleotides include those with positive backbones; non-ionic backbones, and non-ribose backbones. Modifications of the ribose-phosphate backbone may be done for a variety of reasons, for example, to increase the stability and half-life of such molecules in physiological environments or as probes on a biochip. Mixtures of naturally occurring polynucleotides and analogues can be made; alternatively, mixtures of different polynucleotide analogues, and mixtures of naturally occurring polynucleotides and analogues may be made.

    [0165] Isolated HMA4 polynucleotide variants (mutants) are described herein comprising a polynucleotide sequence having at least 65% sequence identity to SEQ ID NO:3 or SEQ ID NO:4 and at least one nucleotide mutation as compared to the wild-type sequences set forth in SEQ ID NO:3 or SEQ ID NO:4. SEQ ID NO:3 and SEQ ID NO:4 are non-mutated sequences. SEQ ID NO: 3 and SEQ ID NO:4 correspond to the polynucleotide sequence of Nicotiana tabacum heavy metal ATPase (NtHMA4.1) GenBank Accession No: HF675181.1 and Nicotiana tabacum heavy metal ATPase (NtHMA4.2) GenBank Accession No: HF937054.1, respectively. Suitably, the isolated polynucleotide comprises, consists or consists essentially of a sequence having at least 65%, 66%, 67%, 68%, 69%, 70%, 75%, 76%, 77%, 78%, 79%, 80%, 85%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96 %, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, 99.9% or 100% sequence identity thereto and at least one nucleotide mutation.

    [0166] Suitably, the plant comprises at least one mutation in each of SEQ ID NO:3 and SEQ NO:4 and/or a gene fragment that interferes with the translation of an RNA transcript encoding the HMAs set forth in (ii), suitably, where in the mutation is a missense mutation or a nonsense mutation.

    [0167] A variety of polynucleotide analogues are known, including, for example, phosphoramidate, phosphorothioate, phosphorodithioate, O-methylphophoroamidite linkages and peptide polynucleotide backbones and linkages. Other analogue polynucleotides include those with positive backbones, non-ionic backbones and non-ribose backbones. Polynucleotides containing one or more carbocyclic sugars are also included.

    [0168] The basic parameters affecting the choice of hybridization conditions for polynucleotides and guidance for devising suitable conditions are described by Sambrook et al., 1989. Using knowledge of the genetic code in combination with the amino acid sequences described herein, sets of degenerate oligonucleotides can be prepared. Such oligonucleotides are useful as primers, for example, in polymerase chain reactions (PCR), whereby DNA fragments are isolated and amplified. In certain embodiments, degenerate primers can be used as probes for genetic libraries. Such libraries would include but are not limited to cDNA libraries, genomic libraries, and even electronic express sequence tag or DNA libraries. Homologous sequences identified by this method would then be used as probes to identify homologues of the sequences identified herein.

    [0169] Also of potential use are polynucleotides and oligonucleotides (for example, primers or probes) that hybridize under reduced stringency conditions, typically moderately stringent conditions, and commonly highly stringent conditions to the polynucleotide(s) as described herein. The basic parameters affecting the choice of hybridization conditions and guidance for devising suitable conditions can be readily determined by those having ordinary skill in the art based on, for example, the length or base composition of the polynucleotide. One way of achieving moderately stringent conditions involves the use of a prewashing solution containing 5 Standard Sodium Citrate, 0.5% Sodium Dodecyl Sulphate, 1.0 mM Ethylenediaminetetraacetic acid (pH 8.0), hybridization buffer of about 50% formamide, 6 Standard Sodium Citrate, and a hybridization temperature of about 55 C. (or other similar hybridization solutions, such as one containing about 50% formamide, with a hybridization temperature of about 42 C.), and washing conditions of about 60 C., in 0.5 Standard Sodium Citrate, 0.1% Sodium Dodecyl Sulphate. Generally, highly stringent conditions are defined as hybridization conditions as above, but with washing at approximately 68 C., 0.2 Standard Sodium Citrate, 0.1% Sodium Dodecyl Sulphate. SSPE (1SSPE is 0.15 M sodium chloride, 10 mM sodium phosphate, and 1.25 mM Ethylenediaminetetraacetic acid, pH 7.4) can be substituted for Standard Sodium Citrate (1 Standard Sodium Citrate is 0.15 M sodium chloride and 15 mM sodium citrate) in the hybridization and wash buffers; washes are performed for 15 minutes after hybridization is complete. It should be understood that the wash temperature and wash salt concentration can be adjusted as necessary to achieve a desired degree of stringency by applying the basic principles that govern hybridization reactions and duplex stability, as known to those skilled in the art and described further below (see, for example, Sambrook, et al., 1989). When hybridizing a polynucleotide to a target polynucleotide of unknown sequence, the hybrid length is assumed to be that of the hybridizing polynucleotide. When polynucleotides of known sequence are hybridized, the hybrid length can be determined by aligning the sequences of the polynucleotides and identifying the region or regions of optimal sequence complementarity. The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be 5 to 10 C. less than the melting temperature of the hybrid, where melting temperature is determined according to the following equations. For hybrids less than 18 base pairs in length, melting temperature ( C.)=2(number of A+T bases)+4(number of G+C bases). For hybrids above 18 base pairs in length, melting temperature ( C.)=81.5+16.6(log 10 [Na+])+0.41(% G+C)-(600/N), where N is the number of bases in the hybrid, and [Na+] is the concentration of sodium ions in the hybridization buffer ([Na+] for 1 Standard Sodium Citrate=0.165M). Typically, each such hybridizing polynucleotide has a length that is at least 25% (commonly at least 50%, 60%, or 70%, and most commonly at least 80%) of the length of a polynucleotide to which it hybridizes, and has at least 60% sequence identity (for example, at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100%) with a polynucleotide to which it hybridizes.

    [0170] Isolated polynucleotides are also contemplated. An isolated polynucleotide is free of sequences (optimally protein encoding sequences) that naturally flank the polynucleotide (for example, sequences located at the 5 and 3 ends of the polynucleotide) in the genomic DNA of the organism from which the polynucleotide is derived. For example, in various embodiments, the isolated polynucleotide can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0.1 kb of nucleotide sequence that naturally flank the polynucleotide in genomic DNA of the cell from which the polynucleotide is derived.

    [0171] Recombinant constructs can be used to transform plants or plant cells. A recombinant polynucleotide construct can comprise a polynucleotide encoding one or more variant polypeptides as described herein, operably linked to a regulatory region suitable for expressing the variant polypeptide. Thus, a polynucleotide can comprise a coding sequence that encodes the variant polypeptide. The plant or plant cell can comprise a genome that has been altered by the stable integration of recombinant DNA. Recombinant DNA includes DNA which has been genetically engineered and constructed outside of a cell and includes DNA containing naturally occurring DNA or cDNA or synthetic DNA. The plant can include a plant regenerated from an originally-transformed plant cell and progeny plants from later generations or crosses of a transformed plant. Suitably, the modification alters the expression or activity of the HMA polynucleotide or the HMA polypeptide described herein as compared to a control plant. In certain embodiments, the use of non-GMO approaches to reduce Cd accumulation through the use of gene inactivation is used. Thus, for example, the use of mutants featuring one or more nucleotide polymorphisms obtained thought the use of one or more exogenously added chemicalssuch as mutagenic, teratogenic, or carcinogenic organic compounds, for example ethyl methanesulfonate (EMS), that produce random mutations in genetic material is used. A DNA library of treated plants can then be screened for mutations in the two HMA4 genes.

    [0172] Vectors containing recombinant polynucleotide constructs such as those described herein are also provided. Suitable vector backbones include, for example, those routinely used in the art such as plasmids, viruses, artificial chromosomes, bacterial artificial chromosomes, yeast artificial chromosomes, or bacteriophage artificial chromosomes. Suitable expression vectors include, without limitation, plasmids and viral vectors derived from, for example, bacteriophage, baculoviruses, and retroviruses. Numerous vectors and expression systems are commercially available. The vectors can include, for example, origins of replication, scaffold attachment regions or markers. A marker gene can confer a selectable phenotype on a plant cell. For example, a marker can confer biocide resistance, such as resistance to an antibiotic (for example, kanamycin, G418, bleomycin, or hygromycin), or an herbicide (for example, glyphosate, chlorsulfuron or phosphinothricin). In addition, an expression vector can include a tag sequence designed to facilitate manipulation or detection (for example, purification or localization) of the expressed polypeptide. Tag sequences, such as luciferase, beta-glucuronidase, green fluorescent protein, glutathione S-transferase, polyhistidine, c-myc or hemagglutinin sequences typically are expressed as a fusion with the encoded polypeptide. Such tags can be inserted anywhere within the HMA variant polypeptide, including at either the carboxyl or amino terminus.

    [0173] A plant or plant cell can be transformed by having the recombinant polynucleotide integrated into its genome to become stably transformed. The plant or plant cell described herein can be stably transformed. Stably transformed cells typically retain the introduced polynucleotide with each cell division. A plant or plant cell can be transiently transformed such that the recombinant polynucleotide is not integrated into its genome. Transiently transformed cells typically lose all or some portion of the introduced recombinant polynucleotide with each cell division such that the introduced recombinant polynucleotide cannot be detected in daughter cells after a sufficient number of cell divisions. The use of genome editing is also contemplated.

    [0174] A number of methods are available in the art for transforming a plant cell which are all encompassed herein, including biolistics, gene gun techniques, Agrobacterium-mediated transformation, viral vector-mediated transformation and electroporation. The Agrobacterium system for integration of foreign DNA into plant chromosomes has been extensively studied, modified, and exploited for plant genetic engineering. Naked recombinant DNA molecules comprising DNA sequences corresponding to the subject purified protein operably linked, in the sense or antisense orientation, to regulatory sequences are joined to appropriate T-DNA sequences by conventional methods. These are introduced into protoplasts by polyethylene glycol techniques or by electroporation techniques, both of which are standard. Alternatively, such vectors comprising recombinant DNA molecules encoding the subject purified protein are introduced into live Agrobacterium cells, which then transfer the DNA into the plant cells. Transformation by naked DNA without accompanying T-DNA vector sequences can be accomplished via fusion of protoplasts with DNA-containing liposomes or via electroporation. Naked DNA unaccompanied by T-DNA vector sequences can also be used to transform cells via inert, high velocity microprojectiles.

    [0175] The choice of regulatory regions to be included in a recombinant construct depends upon several factors, including, but not limited to, efficiency, selectability, inducibility, desired expression level, and cell- or tissue-preferential expression. It is a routine matter for one of skill in the art to modulate the expression of a HMA variant coding sequence by appropriately selecting and positioning regulatory regions relative to the coding sequence. Transcription of a polynucleotide can be modulated in a similar manner. Some suitable regulatory regions initiate transcription only, or predominantly, in certain cell types. Methods for identifying and characterizing regulatory regions in plant genomic DNA are known in the art. Examples of promoters include tissue-specific promoters recognized by tissue-specific factors present in different tissues or cell types (for example, root-specific promoters, shoot-specific promoters, xylem-specific promoters), or present during different developmental stages, or present in response to different environmental conditions. Examples of promoters include constitutive promoters that can be activated in most cell types without requiring specific inducers. Examples of promoters for controlling RNAi polypeptide production include the cauliflower mosaic virus 35S (CaMV/35S), SSU, OCS, lib4, usp, STLS1, B33, nos or ubiquitin- or phaseolin-promoters. Persons skilled in the art are capable of generating multiple variations of recombinant promoters. In addition to plant promoters, other suitable promoters may be derived from bacterial origin for example, the octopine synthase promoter, the nopaline synthase promoter and other promoters derived from Ti plasmids), or may be derived from viral promoters (for example, 35S and 19S RNA promoters of cauliflower mosaic virus (CaMV), constitutive promoters of tobacco mosaic virus, cauliflower mosaic virus (CaMV) 19S and 35S promoters, or figwort mosaic virus 35S promoter).

    [0176] It is to be understood that reducing or inhibiting the expression or activity of the HMAs described herein may be achieved by various means. For example, inserting one or more mutations into at least one of the genes encoding the HMAs, including deletions, insertions, site specific mutations, zinc-finger nucleases is contemplated.

    [0177] In one aspect, there is provided a mutant plant or part thereof having at least partially reduced expression or activity of at least two heavy metal ATPases (HMAs), said two HMAs comprising, consisting or consisting essentially of: (i) polypeptides having at least 65% sequence identity to SEQ ID NO:1 and SEQ ID NO:2; (ii) polynucleotides encoding the polypeptides set forth in (i); or (iii) polynucleotides having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4 encoding HMAs; wherein the mutant plant or part thereof exhibits at least a 27% reduction, as compared to the control plant, in the accumulation of cadmium in leaf when the mutant plant is grown in the field in the presence of naturally or non-naturally occurring cadmium.

    [0178] The expression or activity of the HMAs can be modulated through the use of one of more mutations that cause a reduction in the expression or function of said gene or protein encoded thereby. Aside from the one or more mutations described herein, the mutant plant or plant cell can have one or more further mutations in one or more other genes or polypeptides. In certain embodiments, the mutants can have one or more further mutations in one or more other genes or polypeptides.

    [0179] In another aspect, there is provided a method for reducing the level of cadmium in the leaf of a field grown plant comprising the steps of: (a) reducing the expression or activity of two heavy metal ATPases (HMAs), said two HMAs comprising, consisting or consisting essentially of: (i) polypeptides having at least 65% sequence identity to SEQ ID NO:1 and SEQ ID NO:2; (ii) polynucleotides encoding the polypeptides set forth in (i); or (iii) polynucleotides having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4 encoding HMAs; (b) growing the plant in the field; (c) optionally, measuring the cadmium content in the plant obtained in step (b); and (d) identifying a plant in which the cadmium content therein is reduced in comparison to a control plant in which the expression or activity of the HMAs has not been reduced, suitably, wherein the plant or part thereof exhibits at least a 27% reduction, as compared to the control plant, in the accumulation of cadmium in leaf when the plant is field grown in the presence of naturally or non-naturally occurring cadmium; suitably, wherein the phenotype of the mutant plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the mutant plant or part thereof does not show a biomass (for example, leaf weight) reduction at harvest time as compared to the control plant at the same harvest time. In certain embodiments, the expression or activity of the two HMAs is reduced via the mutagenesis approach described herein or through the use of the mutants that are described herein.

    [0180] The harvest time of a plant will be immediately apparent to a person skilled in the art. In other words, the skilled person will know when a plant is ready for harvesting. By way of example, the person skilled in the art knows when to harvest a tobacco plant because the leaves of the tobacco plant begin to ripen. For certain varieties of tobacco this means that the leaves begin to yellow, which is intended and desired for proper curing. There are also varieties of tobacco that cure from green to brown or from green to yellow to brown. Plants can be harvested as a whole or in part once the part of the plant is ready to harvest. For example, for tobacco plants, the harvest time can be defined for each stalk position. The leaves on the bottom of the tobacco stalk will start to change colour (eg. yellow) first and can be harvested, and the upper leaves will then yellow later on for harvesting. There is also provided a method for identifying one or more genetic alterations in a field grown plant that correlates with reduced levels of cadmium in leaf as compared to a field grown control plant that does not comprise the one or more genetic alterations, said method comprising the steps of: (a) identifying a plant with reduced levels of cadmium in the leaves when grown in the field as compared to a control plant grown in the field, optionally wherein the phenotype of the plant or part thereof at harvest time is the same as the control plant at the same harvest time, suitably, wherein the plant or part thereof does not show a biomass (for example, leaf weight) reduction at harvest time as compared to the control plant at the same harvest time; (b) providing a nucleic acid sample from the plant identified in step (a); and (c) identifying in the nucleic acid sample from step (b) one or more genetic alterations in the polynucleotide sequences encoding HMAs having at least 65% sequence identity to the non-mutated sequences set forth in SEQ ID NO:1 and SEQ ID NO:2 or the polynucleotide sequence having at least 65% sequence identity to SEQ ID NO:3 and SEQ ID NO:4.

    [0181] In some embodiments, one or more favourable mutations are identified through screening a mutant plant population. In some embodiments, one or more favourable mutations that are identified through a screening approach can be introduced into a different plant or plant cell and the introduced mutation can be identified or selected using methods known to those of skill in the artsuch as Southern blot analysis, DNA sequencing, PCR analysis, or phenotypic analysis. Mutations that impact gene expression or that interfere with the function of the encoded HMA protein can be determined using methods that are well known in the art.

    [0182] Any plant of interest, including a plant cell or plant material can be modified by various methods known to induce mutagenesis, including site-directed mutagenesis, oligonucleotide-directed mutagenesis, chemically-induced mutagenesis, irradiation-induced mutagenesis, mutagenesis utilizing modified bases, mutagenesis utilizing gapped duplex DNA, double-strand break mutagenesis, mutagenesis utilizing repair-deficient host strains, mutagenesis by total gene synthesis, DNA shuffling and other equivalent methods.

    [0183] Mutant polypeptide variants can be used to create mutant plants or plant cells comprising one or more mutant polypeptide variants. The HMA activity of the mutant polypeptide variant may be higher, lower or about the same as the unmutated polypeptide. Suitably, the HMA activity of the mutant polypeptide variants is partially inactivated (for example, reduced) or lost (for example, inhibited or eliminated) as described herein.

    [0184] Mutations in the nucleotide sequences and polypeptides described herein can include man-made mutations or synthetic mutations or genetically engineered mutations. Mutations in the nucleotide sequences and polypeptides described herein can be mutations that are obtained or obtainable via a process which includes an in vitro or an in vivo manipulation step. Mutations in the nucleotide sequences and polypeptides described herein can be mutations that are obtained or obtainable via a process which includes intervention by man. By way of example, the process may include mutagenesis using exogenously added chemicalssuch as mutagenic, teratogenic, or carcinogenic organic compounds, for example ethyl methanesulfonate (EMS), that produce random mutations in genetic material. By way of further example, the process may include one or more genetic engineering stepssuch as one or more of the genetic engineering steps that are described herein or combinations thereof. By way of further example, the process may include one or more plant crossing steps.

    [0185] The activity of one or more HMA polypeptides in a plant is reduced or inhibited according to the present disclosure if the HMA polypeptide activity is statistically lower than the activity of the same HMA polypeptide(s) in a plant that has not been modified to reduce or inhibit the activity of that HMA polypeptide and which has been cultured and harvested using the same protocols. The activity of a HMA polypeptide in a plant is considered to be eliminated when it is not detectable by the assay methods described herein. In order to analyse the Cd transport activity of a mutant HMA protein, a yeast-based assay can be used. In this assay, the full-length sequence can be cloned into a yeast expression vector and expressed in a Cd-sensitive ycf1 yeast mutant. Cells in the log phase are diluted to different OD.sub.600 and spotted onto medium containing Cd. The Cd tolerance of the strain reflects the transport activity of the HMA mutant protein. As an alternative, the activity can be deduced when combining a mutated HMA sequence with a second HMA nonsense mutation which completely abolishes HMA transport activity. A nonsense mutation that truncates a large part of the protein is expected not to show any transport activity. For a missense mutation, enzyme activity can be either partially reduced or completely lost. When Cd values in a double mutant combining nonsense and missense mutations are similar to the control, it can be deduced that the missense mutation has no significant influence on protein activity. When the Cd values and/or the phenotype are between a double nonsense mutation and the control, partial activity of the missense mutation can be assumed. When Cd values and phenotype are similar to the double HMA nonsense mutant, it can be concluded that the missense mutation completely abolishes transport activity.

    [0186] Methods that introduce a mutation randomly in a gene sequence can include chemical mutagenesis, EMS mutagenesis and radiation mutagenesis. Methods that introduce one or more targeted mutations into a cell include but are not limited to genome editing technology, particularly zinc finger nuclease-mediated mutagenesis (reviewed in Petolino, 2015), targeting induced local lesions in genomes (TILLING) (reviewed in Chen et al., 2014), meganuclease-mediated mutagenesis (see, for example, Arnould et al., 2011), TALENs (reviewed in Wright et al., 2014) and the CRISPR/Cas system (reviewed in Bortesi and Fischer, 2015). Methods of genome/gene editing in plants is reviewed in, for example, in Puchta and Fauser (2013), Qiwei and Caixia, (2015) and Chen and Gao (2014). Combinations of the various methods described above are also contemplated. In other words, the activity or expression of one HMA may be modulated using one particular technique and a second HMA may be modulated using a different technique.

    [0187] Some non-limiting examples of mutations are deletions, insertions, nonsense and missense mutations of at least one nucleotide, single nucleotide polymorphisms and a simple sequence repeat. After mutation, screening can be performed to identify mutations that create premature stop codons or otherwise non-functional genes. Screening of mutants can be carried out by sequencing, or by the use of one or more probes or primers specific to the gene or protein. Specific mutations in polynucleotides can also be created that can result in modulated gene expression, modulated stability of mRNA, or modulated stability of protein. Such plants are referred to herein as non-naturally occurring or mutant plants. The mutant or non-naturally occurring plants may include at least a portion of foreign or synthetic or man-made nucleic acid (for example, DNA or RNA) that was not present in the plant before it was manipulated. The foreign nucleic acid may be a single nucleotide, two or more nucleotides, two or more contiguous nucleotides or two or more non-contiguous nucleotidessuch as at least 10, 20, 30, 40, 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400 or 1500 or more contiguous or non-contiguous nucleotides.

    [0188] In one embodiment, seeds from plants are mutagenised and then grown into first generation mutant plants, which are then screened for mutations in their loci. The first generation plants can be allowed to self-pollinate and seeds from the first generation plant can be grown into second generation plants, which can be screened for mutations in their loci. Though the mutagenized plant material (including seeds) can be screened for mutations, an advantage of screening the second generation plants is that all somatic mutations correspond to germline mutations. One of skill in the art would understand that a variety of plant materials, including but not limited to, seeds, pollen, plant tissue or plant cells, may be mutagenised in order to create the mutant plants. However, the type of plant material mutagenised may affect when the plant nucleic acid is screened for mutations. For example, when pollen is subjected to mutagenesis prior to pollination of a non-mutagenized plant the seeds resulting from that pollination are grown into first generation plants. Every cell of the first generation plants will contain mutations created in the pollen; thus these first generation plants may then be screened for mutations instead of waiting until the second generation.

    [0189] Mutagens that create primarily point mutations and short deletions, insertions, transversions, and or transitions, including chemical mutagens or radiation, may be used to create the mutations. Mutagens include, but are not limited to, ethyl methanesulfonate, methylmethane sulfonate, N-ethyl-N-nitrosurea, triethylmelamine, N-methyl-N-nitrosourea, procarbazine, chlorambucil, cyclophosphamide, diethyl sulfate, acrylamide monomer, melphalan, nitrogen mustard, vincristine, dimethylnitrosamine, N-methyl-N-nitro-Nitrosoguanidine, nitrosoguanidine, 2-aminopurine, 7,12 dimethyl-benz(a)anthracene, ethylene oxide, hexamethylphosphoramide, bisulfan, diepoxyalkanes (diepoxyoctane, diepoxybutane, and the like), 2-methoxy-6-chloro-9[3-(ethyl-2-chloro-ethyl)aminopropylamino]acridine dihydrochloride and formaldehyde.

    [0190] Spontaneous mutations in the locus that may not have been directly caused by the mutagen are also contemplated provided that they result in the desired phenotype. Suitable mutagenic agents can also include, for example, ionising radiationsuch as X-rays, gamma rays, fast neutron irradiation and UV radiation. Any method of plant nucleic acid preparation known to those of skill in the art may be used to prepare the plant nucleic acid for mutation screening.

    [0191] Prepared nucleic acid from individual plants, plant cells, or plant material can optionally be pooled in order to expedite screening for mutations in the population of plants originating from the mutagenized plant tissue, cells or material. One or more subsequent generations of plants, plant cells or plant material can be screened. The size of the optionally pooled group is dependent upon the sensitivity of the screening method used.

    [0192] After the nucleic acid samples are optionally pooled, they can be subjected to polynucleotide-specific amplification techniques, such as Polymerase Chain Reaction. Any one or more primers or probes specific to the gene or the sequences immediately adjacent to the gene may be utilized to amplify the sequences within the optionally pooled nucleic acid sample. Examples of oligonucleotide primers are described herein. Suitably, the one or more primers or probes are designed to amplify the regions of the locus where useful mutations are most likely to arise. Most suitably, the primer is designed to detect mutations within regions of the polynucleotide. Additionally, it is suitable for the primer(s) and probe(s) to avoid known polymorphic sites in order to ease screening for point mutations. To facilitate detection of amplification products, the one or more primers or probes may be labelled using any conventional labelling method. Primer(s) or probe(s) can be designed based upon the sequences described herein using methods that are well understood in the art.

    [0193] To facilitate detection of amplification products, the primer(s) or probe(s) may be labelled using any conventional labelling method. These can be designed based upon the sequences described herein using methods that are well understood in the art. Polymorphisms may be identified by means known in the art and some have been described in the literature.

    [0194] In a further aspect there is provided a method of preparing a mutant plant. The method involves providing at least one cell of a plant comprising a gene encoding a functional HMA polypeptide as described herein (or any combination thereof as described herein). Next, the at least one cell of the plant is treated under conditions effective to modulate the activity of the HMA polypeptide(s) described herein. The at least one mutant plant cell is then propagated into a mutant plant, where the mutant plant has a modulated level of HMA polypeptide(s) as compared to that of a control plant. In one embodiment of this method of making a mutant plant, the treating step involves subjecting the at least one cell to a chemical mutagenising agent as described above and under conditions effective to yield at least one mutant plant cell. In another embodiment of this method, the treating step involves subjecting the at least one cell to a radiation source under conditions effective to yield at least one mutant plant cell. The term mutant plant includes mutant plants in which the genotype is modified as compared to a control plant.

    [0195] In certain embodiments, the mutant plant, mutant plant cell or mutant plant material may comprise one or more mutations that have occurred naturally in another plant, plant cell or plant material and confer a desired trait. This mutation can be incorporated (for example, introgressed) into another plant, plant cell or plant material (for example, a plant, plant cell or plant material with a different genetic background to the plant from which the mutation was derived) to create a mutation that is non-naturally occurring in that plant and to confer the trait thereto. Thus by way of example, a mutation that occurred naturally in a first plant may be introduced into a second plantsuch as a second plant with a different genetic background to the first plant. The skilled person is therefore able to search for and identify a plant carrying naturally in its genome one or more mutant alleles of the genes described herein which confer a desired trait. The mutant allele(s) that occurs naturally can be transferred to the second plant by various methods including breeding, backcrossing and introgression to produce a lines, varieties or hybrids that have one or more mutations in the genes described herein. Plants showing a desired trait may be screened out of a pool of mutant plants. Suitably, the selection is carried out utilising the knowledge of the nucleotide sequences as described herein. Consequently, it is possible to screen for a genetic trait as compared to a control. Such a screening approach may involve the application of conventional nucleic acid amplification and/or hybridization techniques as discussed herein.

    [0196] In another aspect there is provided a method for preparing a mutant plant which has reduced levels of Cd as compared to a control plant comprising the steps of: (a) providing a sample from a first plant; (b) determining if said sample comprises a simultaneous mutations in each of the HMA4 polypeptides described herein that result in reduced levels of Cd in plants grown in the field; and (c) transferring both mutations into a second plant. The mutation(s) can be transferred into the second plant using various methods that are known in the artsuch as by genetic engineering, genetic manipulation, introgression, plant breeding, backcrossing and the like. In one embodiment, the second plant has a different genetic background to the first plant.

    [0197] In another aspect there is provided a method for preparing a mutant plant which has reduced levels of Cd as compared to a control plant comprising the steps of: (a) providing a sample from a first plant; (b) determining if said sample comprises a double mutations in the HMA4 polypeptides described herein that result in reduced levels of Cd in plants grown in the field; and (c) introgressing both mutations from the first plant into a second plant. In one embodiment, the step of introgressing comprises plant breeding, optionally including backcrossing and the like. In one embodiment, the second plant has a different genetic background to the first plant. In one embodiment, the first plant is not a cultivar or an elite cultivar. In one embodiment, the second plant is a cultivar or an elite cultivar.

    [0198] A further aspect relates to a mutant plant (including a cultivar or elite cultivar mutant plant) obtained or obtainable by the methods described herein. In certain embodiments, the mutant plant may have one or more mutations localised only to a specific region of the plantsuch as within the sequence of the one or more polynucleotide(s) described herein. According to this embodiment, the remaining genomic sequence of the mutant plant will be the same or substantially the same as the plant prior to the mutagenesis.

    [0199] The present disclosure is likely reproducible in other plants and applicable for breeding with variant lines.

    [0200] Plants of interest include, but are not limited to, monocotyledonous and dicotyledonous plants and plant cell systems, including species from one of the following families: Acanthaceae, Alliaceae, Alstroemeriaceae, Amaryllidaceae, Apocynaceae, Arecaceae, Asteraceae, Berberidaceae, Bixaceae, Brassicaceae, Bromeliaceae, Cannabaceae, Caryophyllaceae, Cephalotaxaceae, Chenopodiaceae, Colchicaceae, Cucurbitaceae, Dioscoreaceae, Ephedraceae, Erythroxylaceae, Euphorbiaceae, Fabaceae, Lamiaceae, Linaceae, Lycopodiaceae, Malvaceae, Melanthiaceae, Musaceae, Myrtaceae, Nyssaceae, Papaveraceae, Pinaceae, Plantaginaceae, Poaceae, Rosaceae, Rubiaceae, Salicaceae, Sapindaceae, Solanaceae, Taxaceae, Theaceae, or Vitaceae.

    [0201] Suitable species may include members of the genera Abelmoschus, Abies, Acer, Agrostis, Allium, Alstroemeria, Ananas, Andrographis, Andropogon, Artemisia, Arundo, Atropa, Berberis, Beta, Bixa, Brassica, Calendula, Camellia, Camptotheca, Cannabis, Capsicum, Carthamus, Catharanthus, Cephalotaxus, Chrysanthemum, Cinchona, Citrullus, Coffea, Colchicum, Coleus, Cucumis, Cucurbita, Cynodon, Datura, Dianthus, Digitalis, Dioscorea, Elaeis, Ephedra, Erianthus, Erythroxylum, Eucalyptus, Festuca, Fragaria, Galanthus, Glycine, Gossypium, Helianthus, Hevea, Hordeum, Hyoscyamus, Jatropha, Lactuca, Linum, Lolium, Lupinus, Lycopersicon, Lycopodium, Manihot, Medicago, Mentha, Miscanthus, Musa, Nicotiana, Oryza, Panicum, Papaver, Parthenium, Pennisetum, Petunia, Phalaris, Phleum, Pinus, Poa, Poinsettia, Populus, Rauwolfia, Ricinus, Rosa, Saccharum, Salix, Sanguinaria, Scopolia, Secale, Solanum, Sorghum, Spartina, Spinacea, Tanacetum, Taxus, Theobroma, Triticosecale, Triticum, Uniola, Veratrum, Vinca, Vitis, and Zea.

    [0202] Suitable species may include Panicum spp., Sorghum spp., Miscanthus spp., Saccharum spp., Erianthus spp., Populus spp., Andropogon gerardii (big bluestem), Pennisetum purpureum (elephant grass), Phalaris arundinacea (reed canarygrass), Cynodon dactylon (bermudagrass), Festuca arundinacea (tall fescue), Spartina pectinata (prairie cord-grass), Medicago sativa (alfalfa), Arundo donax (giant reed), Secale cereale (rye), Salix spp. (willow), Eucalyptus spp. (eucalyptus), Triticosecale (tritic wheat times rye), bamboo, Helianthus annuus (sunflower), Carthamus tinctorius (safflower), Jatropha curcas (jatropha), Ricinus communis (castor), Elaeis guineensis (palm), Linum usitatissimum (flax), Brassica juncea, Beta vulgaris (sugarbeet), Manihot esculenta (cassaya), Lycopersicon esculentum (tomato), Lactuca sativa (lettuce), Musyclise alca (banana), Solanum tuberosum (potato), Brassica oleracea (broccoli, cauliflower, Brussels sprouts), Camellia sinensis (tea), Fragaria ananassa (strawberry), Theobroma cacao (cocoa), Coffe cliseca (coffee), Vitis vinifera (grape), Ananas comosus (pineapple), Capsicum annum (hot & sweet pepper), Allium cepa (onion), Cucumis melo (melon), Cucumis sativus (cucumber), Cucurbita maxima (squash), Cucurbita moschata (squash), Spinacea oleracea (spinach), Citrullus lanatus (watermelon), Abelmoschus esculentus (okra), Solanum melongena (eggplant), Rosa spp. (rose), Dianthus caryophyllus (carnation), Petunia spp. (petunia), Poinsettia pulcherrima (poinsettia), Lupinus albus (lupin), Uniola paniculata (oats), bentgrass (Agrostis spp.), Populus tremuloides (aspen), Pinus spp. (pine), Abies spp. (fir), Acer spp. (maple), Hordeum vulgare (barley), Poa pratensis (bluegrass), Lolium spp. (ryegrass) and Phleum pratense (timothy), Panicum virgatum (switchgrass), Sorghu58yclise58or (sorghum, sudangrass), Miscanthus giganteus (miscanthus), Saccharum sp. (energycane), Populus balsamifera (poplar), Zea mays (corn), Glycine max (soybean), Brassica napus (canola), Triticum aestivum (wheat), Gossypium hirsutum (cotton), Oryza sativa (rice), Helianthus annuus (sunflower), Medicago sativa (alfalfa), Beta vulgaris (sugarbeet), or Pennisetum glaucum (pearl millet).

    [0203] Various embodiments are directed to mutant plants or plant cells modified to modulate gene expression levels thereby producing a plant or plant cellsuch as a tobacco plant or tobacco plant cellin which the expression level of a HMA polypeptide is modulated within tissues of interest as compared to a control. The disclosed compositions and methods can be applied to any species of the genus Nicotiana, including N. rustica and N. tabacum (for example, LA B21, LN KY171, TI 1406, Basma, Galpao, Perique, Beinhart 1000-1, and Petico). Other species include N. acaulis, N. acuminata, N. africana, N. alata, N. ameghinoi, N. amplexicaulis, N. arentsii, N. attenuata, N. azambujae, N. benavidesii, N. benthamiana, N. bigelovii, N. bonariensis, N. cavicola, N. clevelandii, N. cordifolia, N. corymbosa, N. debneyi, N. excelsior, N. forgetiana, N. fragrans, N. glauca, N. glutinosa, N. goodspeedii, N. gossei, N. hybrid, N. ingulba, N. kawakamii, N. knightiana, N. langsdorffii, N. linearis, N. longiflora, N. maritima, N. megalosiphon, N. miersii, N. noctiflora, N. nudicaulis, N. obtusifolia, N. occidentalis, N. occidentalis subsp. hesperis, N. otophora, N. paniculata, N. pauciflora, N. petunioides, N. plumbaginifolia, N. quadrivalvis, N. raimondii, N. repanda, N. rosulata, N. rosulata subsp. ingulba, N. rotundifolia, N. setchellii, N. simulans, N. solanifolia, N. spegazzinii, N. stocktonii, N. suaveolens, N. sylvestris, N. thyrsiflora, N. tomentosa, N. tomentosiformis, N. trigonophylla, N. umbratica, N. undulata, N. velutina, N. wigandioides, and N. x sanderae.

    [0204] The use of tobacco cultivars and elite tobacco cultivars is also contemplated herein. The mutant plant may therefore be a tobacco variety or elite tobacco cultivar that comprises one or more transgenes, or one or more genetic mutations or a combination thereof. The genetic mutation(s) (for example, one or more polymorphisms) can be mutations that do not exist naturally in the individual tobacco variety or tobacco cultivar (for example, elite tobacco cultivar) or can be genetic mutation(s) that do occur naturally provided that the mutation does not occur naturally in the individual tobacco variety or tobacco cultivar (for example, elite tobacco cultivar).

    [0205] Particularly useful Nicotiana tabacum varieties include Burley type, dark type, flue-cured type, and Oriental type tobaccos. Non-limiting examples of varieties or cultivars are: BD 64, CC 101, CC 200, CC 27, CC 301, CC 400, CC 500, CC 600, CC 700, CC 800, CC 900, Coker 176, Coker 319, Coker 371 Gold, Coker 48, CD 263, DF911, DT 538 LC Galpao tobacco, GL 26H, GL 350, GL 600, GL 737, GL 939, GL 973, HB 04P, HB 04P LC, HB3307PLC, Hybrid 403LC, Hybrid 404LC, Hybrid 501 LC, K 149, K 326, K 346, K 358, K394, K 399, K 730, KDH 959, KT 200, KT204LC, KY10, KY14, KY 160, KY 17, KY 171, KY 907, KY907LC, KY14xL8 LC, Little Crittenden, McNair 373, McNair 944, msKY 14xL8, Narrow Leaf Madole, Narrow Leaf Madole LC, NBH 98, N-126, N-777LC, N-7371LC, NC 100, NC 102, NC 2000, NC 291, NC 297, NC 299, NC 3, NC 4, NC 5, NC 6, NC7, NC 606, NC 71, NC 72, NC 810, NC BH 129, NC 2002, Neal Smith Madole, OXFORD 207, PD 7302 LC, PD 7309 LC, PD 7312 LC, Periqe tobacco, PVH03, PVH09, PVH19, PVH50, PVH51, R 610, R 630, R 7-11, R 7-12, RG 17, RG 81, RG H51, RGH 4, RGH 51, RS 1410, Speight 168, Speight 172, Speight 179, Speight 210, Speight 220, Speight 225, Speight 227, Speight 234, Speight G-28, Speight G-70, Speight H-6, Speight H20, Speight NF3, TI 1406, TI 1269, TN 86, TN86LC, TN 90, TN 97, TN97LC, TN D94, TN D950, TR (Tom Rosson) Madole, VA 309, VA359, AA 37-1, B13P, Xanthi (Mitchell-Mor), Bel-W3, 79-615, Samsun Holmes NN, KTRDC number 2 Hybrid 49, Burley 21, KY8959, KY9, MD 609, PG01, PG04, P01, P02, P03, RG11, RG 8, VA509, AS44, Banket Al, Basma Drama B84/31, Basma I Zichna ZP4/B, Basma Xanthi BX 2A, Batek, Besuki Jember, C104, Coker 347, Criollo Misionero, Delcrest, Djebel 81, DVH 405, Galpao Comum, HBO4P, Hicks Broadleaf, Kabakulak Elassona, Kutsage E1, LA BU 21, NC 2326, NC 297, PVH 2110, Red Russian, Samsun, Saplak, Simmaba, Talgar 28, Wislica, Yayaldag, Prilep HC-72, Prilep P23, Prilep PB 156/1, Prilep P12-2/1, Yaka JK-48, Yaka JB 125/3, TI-1068, KDH-960, TI-1070, TW136, Basma, TKF 4028, L8, TKF 2002, GR141, Basma xanthi, GR149, GR153, Petit Havana. Low converter subvarieties of the above, even if not specifically identified herein, are also contemplated. In one embodiment, the Burley type of Nicotiana tabacum is used.

    [0206] Embodiments are also directed to compositions and methods for producing mutant plants that have been modified to modulate the expression or activity of a HMA polynucleotide(s) described herein (or any combination thereof as described herein). Advantageously, the mutant plants that are obtained may be similar or substantially the same in overall appearance to control plants. Various phenotypic characteristics such as degree of maturity, number of leaves per plant, stalk height, leaf insertion angle, leaf size (width and length), internode distance, and lamina-midrib ratio can be assessed by field observations.

    [0207] One aspect relates to a seed of a mutant plant. Suitably, the seed is a tobacco seed. A further aspect relates to pollen or an ovule of a mutant plant that is described herein. In addition, there is provided a mutant plant as described herein which further comprises a nucleic acid conferring male sterility.

    [0208] Also provided is a tissue culture of regenerable cells of the mutant plant or a part thereof as described herein, which culture regenerates plants capable of expressing all the morphological and physiological characteristics of the parent. The regenerable cells include but are not limited to cells from leaves, pollen, embryos, cotyledons, hypocotyls, roots, root tips, anthers, flowers and a part thereof, ovules, shoots, stems, stalks, pith and capsules or callus or protoplasts derived therefrom.

    [0209] A still further aspect, relates to a cured or dried plant materialsuch as cured or dried leaf or cured or dried tobaccoderived or derivable from a mutant plant or cell, wherein expression of one or more of the HMA polynucleotides described herein or the activity of the protein encoded thereby is reduced and which results in reduced levels of Cd therein.

    [0210] Embodiments are also directed to compositions and methods for producing mutant plants or plant cells that have been modified to modulate the expression or activity of the one or more of the HMA polynucleotides or HMA polypeptides described herein which can result in plants or plant components (for example, leavessuch as cured or dried leaves) or plant cells with reduced levels of Cd as described herein.

    [0211] Suitably the visual appearance of the plants described herein is substantially the same as the control plant. Suitably, the biomass and leaf size is substantially unchanged as compared to the control plant. In one embodiment, the leaf weight of the mutant plant is substantially the same as the control plant. In one embodiment, the leaf number of the mutant plant is substantially the same as the control plant. In one embodiment, the leaf weight and the leaf number of the mutant plant is substantially the same as the control plant. In one embodiment, the stalk height of the mutant plants is substantially the same as the control plants at, for example, one, two or three or more months after field transplant or 10, 20, 30 or 36 or more days after topping. For example, the stalk height of the mutant plants is not less than the stalk height of the control plants. In another embodiment, the chlorophyll content of the mutant plants is substantially the same as the control plants. In another embodiment, the stalk height of the mutant plants is substantially the same as the control plants and the chlorophyll content of the mutant plants is substantially the same as the control plants. In other embodiments, the size or form or number or colouration of the leaves of the mutant plants is substantially the same as the control plants.

    [0212] A reduction in expression as compared to a control may be from about 5% to about 100%, or a reduction of at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 98%, or 100%, which includes a reduction in transcriptional activity or polynucleotide expression or polypeptide expression or a combination thereof.

    [0213] A reduction in activity as compared to a control may be from about 5% to about 100%, or a reduction of at least 10%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 90%, at least 95%, at least 98%, or 100%.

    [0214] Polynucleotides and recombinant constructs described herein can be used to modulate the expression of NtHMA4 as described herein in a plant species of interest, suitably tobacco. Polynucleotides and recombinant constructs described herein can be used to express the mutant NtHMA4 polypeptides as described herein in a plant species of interest, suitably tobacco.

    [0215] In certain embodiments, the leaf phenotype and growth rate of the mutant plant or part thereof is the same as the control plant. An example of a double mutation that confers these properties is G251D/Q561*.

    [0216] In certain embodiments, the leaf phenotype of the mutant plant or part thereof is the same as the control plant and the mutant plant or part thereof exhibits at an early stage delayed growth as compared to the control plant. Delayed growth at an early stage is not considered to be problematic because at harvest time, biomass differences as compared to the control plants are not observed. An example of a double mutant that confers these properties is T402I/Q561*.

    [0217] In certain embodiments, the leaf phenotype of the mutant plant or part thereof is the same as the control plant except for the presence of necrotic lesions at an early stage and the mutant plant or part thereof exhibits delayed growth as compared to the control plant at an early stage. The presence of necrotic lesions is not problematic because necrotic lesions are not observed under most conditions at harvest time in the field. An example of a double mutant that confers these properties is Q293*/Q561* or Q293*/W265* or E296K/Q561* or Q464*/Q561* or Q293*/G235E. Suitably, the amount of growth of the mutant plants or part thereof as described herein is not reduced as compared to the control plant.

    [0218] Suitably, the mutant plants or part thereof as described herein do not exhibit a dwarf phenotype as compared to the control plant. Suitably, the mutant plants or part thereof as described herein do not exhibit a dwarf phenotype at harvest time as compared to the control plant harvest time.

    [0219] Suitably, the mutant plants or part thereof as described herein do not show a biomass (leaf weight) reduction as compared to the control. Suitably, the mutant plants or part thereof as described herein do not show a biomass (leaf weight) reduction at harvest time as compared to the control.

    [0220] In certain embodiments, the mutant plants may be supplemented with zinc during growth.

    [0221] Various embodiments are directed to methods for reducing the expression level of one or more polynucleotides described herein by integrating multiple copies of the polynucleotide into a plant genome, comprising: transforming a plant cell host with an expression vector that comprises a promoter operably-linked to one or more polynucleotides described herein. The polypeptide encoded by a recombinant polynucleotide can be a native polypeptide, or can be heterologous to the cell.

    [0222] A plant carrying a mutant allele of one or more polynucleotides described herein (or any combination thereof as described herein) can be used in a plant breeding program to create useful lines, varieties and hybrids. In particular, the mutant allele is introgressed into the commercially important varieties described above. Thus, methods for breeding plants are provided, that comprise crossing a mutant plant as described herein with a plant comprising a different genetic identity. The method may further comprise crossing the progeny plant with another plant, and optionally repeating the crossing until a progeny with the desirable genetic traits or genetic background is obtained. One purpose served by such breeding methods is to introduce a desirable genetic trait into other varieties, breeding lines, hybrids or cultivars, particularly those that are of commercial interest. Another purpose is to facilitate stacking of genetic modifications of different genes in a single plant variety, lines, hybrids or cultivars. Intraspecific as well as interspecific matings are contemplated. The progeny plants that arise from such crosses, also referred to as breeding lines, are examples of non-naturally occurring plants of the disclosure.

    [0223] In one embodiment, a method is provided for producing a non-naturally occurring or mutant plant comprising: (a) crossing the mutant plant with a second plant to yield progeny tobacco seed; (b) growing the progeny seed, under plant growth conditions, to yield the non-naturally occurring plant. The method may further comprise: (c) crossing the previous generation of non-naturally occurring plant with itself or another plant to yield progeny seed; (d) growing the progeny seed of step (c) under plant growth conditions, to yield additional non-naturally occurring plants; and (e) repeating the crossing and growing steps of (c) and (d) multiple times to generate further generations of non-naturally occurring plants. The method may optionally comprises prior to step (a), a step of providing a parent plant which comprises a genetic identity that is characterized and that is not identical to the mutant plant. In some embodiments, depending on the breeding program, the crossing and growing steps are repeated from 0 to 2 times, from 0 to 3 times, from 0 to 4 times, 0 to 5 times, from 0 to 6 times, from 0 to 7 times, from 0 to 8 times, from 0 to 9 times or from 0 to 10 times, in order to generate generations of non-naturally occurring plants. Backcrossing is an example of such a method wherein a progeny is crossed with one of its parents or another plant genetically similar to its parent, in order to obtain a progeny plant in the next generation that has a genetic identity which is closer to that of one of the parents. Techniques for plant breeding, particularly plant breeding, are well known and can be used in the methods of the disclosure. The disclosure further provides non-naturally occurring plants produced by these methods. Certain embodiments exclude the step of selecting a plant.

    [0224] In some embodiments of the methods described herein, lines resulting from breeding and screening for variant genes are evaluated in the field using standard field procedures. Control genotypes including the original unmutagenized parent are included and entries are arranged in the field in a randomized complete block design or other appropriate field design. For tobacco, standard agronomic practices are used, for example, the tobacco is harvested, weighed, and sampled for chemical and other common testing before and during curing or drying. Statistical analyses of the data are performed to confirm the similarity of the selected lines to the parental line. Cytogenetic analyses of the selected plants are optionally performed to confirm the chromosome complement and chromosome pairing relationships.

    [0225] DNA fingerprinting, single nucleotide polymorphism, microsatellite markers, or similar technologies may be used in a marker-assisted selection (MAS) breeding program to transfer or breed mutant alleles of a gene into other plants, as described herein. For example, a breeder can create segregating populations from hybridizations of a genotype containing a mutant allele with an agronomically desirable genotype. Plants in the F2 or backcross generations can be screened using a marker developed from a genomic sequence or a fragment thereof, using one of the techniques listed herein. Plants identified as possessing the mutant allele can be backcrossed or self-pollinated to create a second population to be screened. Depending on the expected inheritance pattern or the MAS technology used, it may be necessary to self-pollinate the selected plants before each cycle of backcrossing to aid identification of the desired individual plants. Backcrossing or other breeding procedure can be repeated until the desired phenotype of the recurrent parent is recovered.

    [0226] In a breeding program, successful crosses yield F1 plants that are fertile. Selected F1 plants can be crossed with one of the parents, and the first backcross generation plants are self-pollinated to produce a population that is again screened for variant gene expression (for example, the null version of the gene). The process of backcrossing, self-pollination, and screening is repeated, for example, at least 4 times until the final screening produces a plant that is fertile and reasonably similar to the recurrent parent. This plant, if desired, is self-pollinated and the progeny are subsequently screened again to confirm that the plant exhibits variant gene expression. In some embodiments, a plant population in the F2 generation is screened for variant gene expression, for example, a plant is identified that fails to express a polypeptide due to the absence of the gene according to standard methods, for example, by using a PCR method with primers based upon the nucleotide sequence information for the polynucleotide(s) described herein (or any combination thereof as described herein).

    [0227] Hybrid varieties can be produced by preventing self-pollination of female parent plants (that is, seed parents) of a first variety, permitting pollen from male parent plants of a second variety to fertilize the female parent plants, and allowing F1 hybrid seeds to form on the female plants. Self-pollination of female plants can be prevented by emasculating the flowers at an early stage of flower development. Alternatively, pollen formation can be prevented on the female parent plants using a form of male sterility. For example, male sterility can be produced by cytoplasmic male sterility (CMS), or transgenic male sterility wherein a transgene inhibits microsporogenesis and/or pollen formation, or self-incompatibility. Female parent plants containing CMS are particularly useful. In embodiments in which the female parent plants are CMS, pollen is harvested from male fertile plants and applied manually to the stigmas of CMS female parent plants, and the resulting F1 seed is harvested.

    [0228] Varieties and lines described herein can be used to form single-cross F1 hybrids. In such embodiments, the plants of the parent varieties can be grown as substantially homogeneous adjoining populations to facilitate natural cross-pollination from the male parent plants to the female parent plants. The F1 seed formed on the female parent plants is selectively harvested by conventional means. One also can grow the two parent plant varieties in bulk and harvest a blend of F1 hybrid seed formed on the female parent and seed formed upon the male parent as the result of self-pollination. Alternatively, three-way crosses can be carried out wherein a single-cross F1 hybrid is used as a female parent and is crossed with a different male parent. As another alternative, double-cross hybrids can be created wherein the F1 progeny of two different single-crosses are themselves crossed.

    [0229] A population of mutant plants can be screened or selected for those members of the population that have a desired trait or phenotype. For example, a population of progeny of a single transformation event can be screened for those plants having a desired level of expression or activity of the polypeptide(s) encoded thereby. Physical and biochemical methods can be used to identify expression or activity levels. These include Southern analysis or PCR amplification for detection of a polynucleotide; Northern blots, S1 RNase protection, primer-extension, or RT-PCR amplification for detecting RNA transcripts; enzymatic assays for detecting enzyme or ribozyme activity of polypeptides and polynucleotides; and protein gel electrophoresis, Western blots, immunoprecipitation, and enzyme-linked immunoassays to detect polypeptides. Other techniques such as in situ hybridization, enzyme staining, and immunostaining and enzyme assays also can be used to detect the presence or expression or activity of polypeptides or polynucleotides.

    [0230] Mutant plant cells and plants are described herein comprising one or more recombinant polynucleotides, one or more polynucleotide constructs, one or more double-stranded RNAs, one or more conjugates or one or more vectors/expression vectors.

    [0231] Without limitation, the mutant plants described herein may be modified for other purposes either before or after the expression or activity has been modulated according to the present disclosure. Suitably, the mutant plants remain as non-GMO plants despite these further modifications. One or more of the following genetic modifications can be present in the mutant plants. In one embodiment, one or more genes that are involved in the conversion of nitrogenous metabolic intermediates is modified resulting in plants (such as leaves) that when cured, produces lower levels of at least one tobacco-specific nitrosamine than control plants. Non-limiting examples of genes that can be modified include, as described herein, genes encoding an asparagine synthetase, such as CYP82E4, CYP82E5 and CYP82E10 which participate in the conversion of nicotine to nornicotine and are described in WO2006091194, WO2008070274, WO2009064771 and PCT/US2011/021088 and as described herein. In another embodiment, one or more genes that are involved in heavy metal uptake or heavy metal transport are modified resulting in plants or parts of plants (such as leaves) having a lower heavy metal content than control plants or parts thereof without the modification(s). Non-limiting examples include genes in the family of multidrug resistance associated proteins, the family of cation diffusion facilitators (CDF), the family of Zrt-, Irt-like proteins (ZIP), the family of cation exchangers (CAX), the family of copper transporters (COPT), the family of heavy-metal P-type ATPases (for example, HMAs, as described in WO2009074325), the family of homologs of natural resistance-associated macrophage proteins (NRAMP), and the family of ATP-binding cassette (ABC) transporters (for example, MRPs, as described in WO2012/028309, which participate in transport of heavy metals, such as Cd. The term heavy metal as used herein includes transition metals. Examples of other modifications include herbicide tolerance, for example, glyphosate is an active ingredient of many broad spectrum herbicides. Glyphosate resistant transgenic plants have been developed by transferring the aroA gene (a glyphosate EPSP synthetase from Salmonella typhimurium and E. coli). Sulphonylurea resistant plants have been produced by transforming the mutant ALS (acetolactate synthetase) gene from Arabidopsis. OB protein of photosystem II from mutant Amaranthus hybridus has been transferred in to plants to produce atrazine resistant transgenic plants; and bromoxynil resistant transgenic plants have been produced by incorporating the bxn gene from the bacterium Klebsiella pneumoniae. Another exemplary modification results in plants that are resistant to insects. Bacillus thuringiensis (Bt) toxins can provide an effective way of delaying the emergence of Bt-resistant pests, as recently illustrated in broccoli where pyramided crylAc and crylC Bt genes controlled diamondback moths resistant to either single protein and significantly delayed the evolution of resistant insects. Another exemplary modification results in plants that are resistant to diseases caused by pathogens (for example, viruses, bacteria, fungi). Plants expressing the Xa21 gene (resistance to bacterial blight) with plants expressing both a Bt fusion gene and a chitinase gene (resistance to yellow stem borer and tolerance to sheath) have been engineered. Another exemplary modification results in altered reproductive capability, such as male sterility. Another exemplary modification results in plants that are tolerant to abiotic stress (for example, drought, temperature, salinity), and tolerant transgenic plants have been produced by transferring acyl glycerol phosphate enzyme from Arabidopsis; genes coding mannitol dehydrogenase and sorbitol dehydrogenase which are involved in synthesis of mannitol and sorbitol improve drought resistance. Other exemplary modifications can result in plants with improved storage proteins and oils, plants with enhanced photosynthetic efficiency, plants with prolonged shelf life, plants with enhanced carbohydrate content, and plants resistant to fungi; plants encoding an enzyme involved in the biosynthesis of alkaloids. Transgenic plants in which the expression of S-adenosyl-L-methionine (SAM) and/or cystathionine gamma-synthase (CGS) has been modulated are also contemplated.

    [0232] One or more such traits may be introgressed into the mutant plants from another cultivar or may be directly transformed into it. The introgression of the trait(s) into the mutant plants may be achieved by any method of plant breeding known in the art, for example, pedigree breeding, backcrossing, doubled-haploid breeding, and the like (see, Wernsman, E. A, and Rufty, R. C. 1987. Chapter Seventeen. Tobacco. Pages 669-698 In: Cultivar Development. Crop Species. W. H. Fehr (ed.), MacMillan Publishing Co, Inc., New York, N.Y 761 pp.). Molecular biology-based techniques described above, in particular RFLP and microsatellite markers, can be used in such backcrosses to identify the progenies having the highest degree of genetic identity with the recurrent parent. This permits one to accelerate the production of varieties having at least 90%, suitably at least 95%, more suitably at least 99% genetic identity with the recurrent parent, yet more suitably genetically identical to the recurrent parent, and further comprising the trait(s) introgressed from the donor parent. Such determination of genetic identity can be based on molecular markers known in the art.

    [0233] The last backcross generation can be selfed to give pure breeding progeny for the nucleic acid(s) being transferred. The resulting plants generally have essentially all of the morphological and physiological characteristics of the mutant plants, in addition to the transferred trait(s) (for example, one or more single gene traits). The exact backcrossing protocol will depend on the trait being altered to determine an appropriate testing protocol. Although backcrossing methods are simplified when the trait being transferred is a dominant allele, a recessive allele may also be transferred. In this instance, it may be necessary to introduce a test of the progeny to determine if the desired trait has been successfully transferred.

    [0234] Various embodiments provide mutant plants as well as biomass in which the expression level of NtHMA4 polynucleotides is reduced to reduce the Cd content therein.

    [0235] Parts of such plants, particularly tobacco plants, and more particularly the leaf lamina and midrib of tobacco plants, can be incorporated into or used in making various consumable products including but not limited to aerosol forming materials, aerosol forming devices, smoking articles, smokable articles, smokeless products, and tobacco products. Examples of aerosol forming materials include but are not limited to tobacco compositions, tobaccos, tobacco extract, cut tobacco, cut filler, cured or dried tobacco, expanded tobacco, homogenized tobacco, reconstituted tobacco, and pipe tobaccos. Smoking articles and smokable articles are types of aerosol forming devices. Examples of smoking articles or smokable articles include but are not limited to cigarettes, cigarillos, and cigars. Examples of smokeless products comprise chewing tobaccos, and snuffs. In certain aerosol forming devices, rather than combustion (or burning), a tobacco composition or another aerosol forming material is heated, for example, by one or more electrical heating elements, to produce an aerosol. Typically in such heated smoking articles, an aerosol is generated by the transfer of heat from a heat source to a physically separate aerosol-forming substrate or material, which may be located within, around or downstream of the heat source. During smoking, volatile compounds are released from the aerosol-forming substrate by heat transfer from the heat source and entrained in air drawn through the smoking article. As the released compounds cool, they condense to form an aerosol that is inhaled by the user. Such devices include, for example, electrically heated aerosol-generating devices in which an aerosol is generated by the transfer of heat from one or more electrical heating elements of the aerosol-generating device to the aerosol-forming substrate of a heated smoking article.

    [0236] In another type of heated aerosol forming device, an aerosol is produced by the transfer of heat from a combustible fuel element or heat source to a physically separate aerosol forming material, which may be located within, around or downstream of the heat source. Smokeless tobacco products and various tobacco-containing aerosol forming materials may contain tobacco in any form, including as dried particles, shreds, granules, powders, or slurry, deposited on, mixed in, surrounded by, or otherwise combined with other ingredients in any format, such as flakes, films, tabs, foams, or beads. As used herein, the term smoke is used to describe a type of aerosol that is produced by smoking articles, such as cigarettes, or by combusting an aerosol forming material.

    [0237] In one embodiment, there is also provided cured plant material from the mutant tobacco plants described herein. Processes of curing green tobacco leaves are known by those having ordinary skill in the art and include without limitation air-curing, fire-curing, flue-curing and sun-curing. The process of curing green tobacco leaves depends on the type of tobacco harvested. For example, Burley and certain dark strains are usually air-cured, and pipe tobacco, chewing tobacco, and snuff are usually fire-cured.

    [0238] Smokeless tobacco products incorporating tobacco plants as described herein can be manufactured in any format suitable for comfort in a consumer's oral cavity. Smokeless tobacco products contain tobacco in any form, including as dried particles, shreds, granules, powders, or a slurry deposited on, mixed in, surrounded by, or otherwise combined with other ingredients in any format, such as flakes, films, tabs, foams, or beads. Smokeless tobacco products may be wrapped with a material, which may be edible or nonedible. Liquid contents of smokeless tobacco products can be enclosed in a form, such as beads, to preclude interaction with a water-soluble wrapper. The wrapper may be shaped as a pouch to partially or completely enclose tobacco-incorporating compositions, or to function as an adhesive to hold together a plurality of tabs, beads, or flakes of tobacco. A wrapper may also enclose a mouldable tobacco composition that conforms to the shape of a consumer's mouth. An orally disintegrable wrapper may enclose smokeless tobacco, for example, as dry snuff or soluble tobacco, and may be formed on continuous thermoforming or horizontal form/fill/seal equipment or other suitable packaging equipment using edible films (which may or may not contain tobacco). Exemplary materials for constructing a wrapper include film compositions comprising HPMC, CMC, pectin, alginates, pullulan, and other commercially viable, edible film-forming polymers. Wrappers that are not orally disintegrable may be composed of woven or nonwoven fabrics, of coated or uncoated paper, or of perforated or otherwise porous plastic films. Wrappers may incorporate flavouring and/or colouring agents. Smokeless products can be assembled together with a wrapper utilizing any method known to persons skilled in the art of commercial packaging, including methods such as blister packing and stik-packing, in which a small package can be formed by a vertical form/fill/seal packaging machine.

    [0239] In another embodiment, there is also provided dried plant material from the mutant plants described herein. Processes of drying leaves are known by those having ordinary skill in the art and include without limitation air-drying and sun-drying. The exact process of drying leaves depends on the type of plant that is harvested. Suitably, the plant material is dried after harvesting. Thus, the use of dried material and post-harvested dried material is contemplated herein. The drying process may activate one or more senescence associated genes. The expression of activity of the genes and proteins described herein can be monitored during curing or drying.

    [0240] In another embodiment, there is described tobacco products including tobacco-containing aerosol forming materials comprising plant materialsuch as leaves, suitably cured or dried leavesfrom the mutant tobacco plants described herein. The tobacco products described herein can be a blended tobacco product which may further comprise unmodified tobacco. The amount of Cd in the field grown plant, part of the plant, plant material, plant product or tobacco product described herein can be reduced by at least about 33%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94% or 95% or more, when compared to the wild-type counterpart. As HMA4 acts in root-to-shoot Cd translocation, reducing or eliminating the activity or expression of HMA4 can lead to reduced Cd accumulation in leaves and increased Cd accumulation in roots.

    [0241] In certain embodiments, it may be desirable to grow the plants described herein in the presence of fertilisers. In one embodiment, the fertiliser may comprise or consist of Zn which is added to the field either before or during the time that the plants are grown. This supplementation may help to replenish or restore the Zn content in the plant whilst still have reduced levels of Cd. This supplementation may help to restore the phenotype of the plant whilst still having reduced levels of Cd. Zn addition may increase stalk height and/or leaf weight.

    [0242] Seeds from plants described herein can be conditioned and bagged in packaging material by means known in the art to form an article of manufacture. Packaging material such as paper and cloth are well known in the art. A package of seed can have a label, for example, a tag or label secured to the packaging material, a label printed on the package that describes the nature of the seeds therein.

    [0243] Compositions, methods and kits for genotyping plants for identification, selection, or breeding can comprise a means of detecting the presence of a polynucleotide (or any combination thereof as described herein) in a sample of polynucleotide. Accordingly, a composition is described comprising one of more primers for specifically amplifying at least a portion of one or more of the polynucleotides and optionally one or more probes and optionally one or more reagents for conducting the amplification or detection.

    [0244] In one embodiment, there is also provided cured or dried plant material from the mutant plants described herein. For example, processes of curing or drying tobacco leaves are known by those having skills in the field and include without limitation air-curing, fire-curing, flue-curing and sun-curing. The process of curing green tobacco leaves depends on the type of tobacco harvested as described herein.

    [0245] In another embodiment, there is described tobacco products including tobacco products comprising plant materialsuch as leaves, suitably cured plant materialsuch as cured or dried leavesfrom the mutant plants described herein or which are produced by the methods described herein. The tobacco products described herein may further comprise unmodified tobacco.

    [0246] In another embodiment, there is described tobacco products comprising plant material, suitably leavessuch as cured or dried leaves, from the mutant plants described herein. For example, the plant material may be added to the inside or outside of the tobacco product and so upon burning a desirable aroma is released. The tobacco product according to this embodiment may even be an unmodified tobacco or a modified tobacco. The tobacco product according to this embodiment may even be derived from a mutant plant which has mutations in one or more genes other than the genes disclosed herein.

    [0247] The invention is further described in the Examples below, which are provided to describe the invention in further detail. These examples, which set forth a preferred mode presently contemplated for carrying out the invention, are intended to illustrate and not to limit the invention.

    EXAMPLES

    Example 1Materials & Methods

    [0248] HMA4 Sequences NtHMA4.1 (protein sequence: SEQ ID NO:1, Genbank: CCQ77798.1; nucleotide sequence: SEQ ID NO:3, Genbank: HF675181.1) and NtHMA4.2 (protein sequence: SEQ ID NO:2, Genbank: CCW03243.1; nucleotide sequence: SEQ ID NO:4, Genbank: HF937054.1)

    Plant Material

    [0249] TN90 (PI 543792, TC 586, USDA-GRIN database), K326 (PI 552505, TC 319, USDA-GRIN database). AA37 is presumably a cross between a South American dark tobacco and American Burley germplasm.

    Generation of HMA4 RNAi Plants

    [0250] For construction of an HMA4 RNAi construct, a sequence of exon 7 of HMA4.1 (5-TGAGAGCAAGTCAGGTCATCCGATGGCAGCCGCTCTGGTGGACTATGCACAATCAAAT TCCGTTGAGCCAAAGCCTGATAGAGTTGAGCAGTTTCAAAATTTTCCTGGTGAAGGGAT ATTTGGAAGAATTGATGGAATGGAAATCTATGTCGGGAATAGGAAAATTTCTTCAAGAG CTGGATGTACCACAG-3) is used in sense and antisense direction and part of the adjacent intron (5-TAAATGGTTGAATCATTTCTTATGCTCATAGTAGAGATAAAACATCAGA GTTATAATTATAAGTATATGATTTCTCCAGTTAATTTTGCTGTTAGATTTTCTTTGACCTGT TTAGCACTAATGCGGTGGATGTTTGAAT-3) is employed as hairpin loop. The construct is designed with Gateway sites and synthesized by Geneart (Invitrogen, Life technologies, Regensburg, Germany). Then it is transferred into an expression vector using the Gateway technology and corresponding enzymes (Invitrogen, Life technologies, Carlsbad, Calif., USA). Agrobacterium tumefaciens is transformed with the expression vector and is used for tobacco leaf disc transformation using previously described methods (Horsch et al., 1985). TO primary transformants are grown on soil and their roots analysed for HMA4 expression. Best performing lines (lowest HMA4 expression) are identified and the T1 generation and wild type plants are grown on agar medium and total roots are again analysed for HMA4 expression.

    EMS Mutant Lines and TILLING

    [0251] A mutant population is created by treating tobacco AA37 seeds with the mutagenic agent ethyl methanesulfonate (EMS). A DNA library of about 9800 M2 generation EMS-treated plants (representing the segregating progeny of 1050 M1 generation variants) is screened for mutations in the two HMA4 genes. Five amplicons are sequenced and analysed for mutations in HMA4.1 and in HMA4.2, respectively. The following primer pairs are used for amplification: HMA4.1-Exon 1: forward primer 5-GCATGTTCTTATAAGAGAAACTC-3, reverse primer 5-GTGAATTTATTTAACAAGCCACA-3; HMA4.1-Exon2: forward primer 5-CCAAAATTGTTTCTGCTTCTCC-3, reverse primer 5-CGTCATATAAATTGGGACAAAAG-3; HMA4.1-Exon4/5: forward primer 5-GTGTCTTTATTTTCTCACTGATA-3, reverse primer 5-TAGTGACGTGATTCATAAGACAA-3; HMA4.1-Exon6: forward primer 5-ATCAGTCCTTTCACTTGACCC-3, reverse primer 5-AACCATTAGAGCCATTTCAGAA-3; HMA4.1-Exon7/8: forward primer 5-GATACTGCAATACAAAAGCACAT-3, reverse primer 5-CACTTACTTGGTAATACGTTCT-3; HMA4.2-Exon1: forward primer 5-TTGCTACTCTGGGTTGCTAC-3, reverse primer 5-TCAAGTTTAAAGTTTGCTTCTAC-3; HMA4.2-Exon2: forward primer 5-TGTGCATACATAACGTAAATCG-3, reverse primer 5-ATCAAATACCACATAAGTAGGG-3; HMA4.2-Exon4/5: forward primer 5-TTTAGTCACTTTGACATAAATGG-3, reverse primer 5-AAGACAGAGAACAAGTTCACAT-3; HMA4.2-Exon6: forward primer 5-TCAGTCCTTTCGCTTGACCT-3, reverse primer 5-GAGAATGTGGTACTCGCAAG-3; HMA4.2-Exon7/8: forward primer 5-ATACATTGAGGACACATAATCG-3, reverse primer 5-TATACCCCATTCTGACCCTTG-3. The amplification products are sequenced according to the Sanger method on ABI XL3730 (Applied Biosystems, Life Technologies, Foster City, Calif., USA). The amplification primers are likewise used for sequencing, except for HMA4.2-Exon6, where a nested reverse primer 5-TTATGAATATATGCTACAAATCAC-3 is used for sequencing. In order to select mutant lines with impact on protein function, stop mutations as well as missense mutations are chosen.

    Greenhouse Conditions for Plant Cultivation.

    [0252] The following solutions are used for fertilization, all solutions are purchased from Yara Benelux B.V. (Vlaardingen, The Netherlands): Flue cured: macroelements: 666.5 mg NO3-I-1, 18 mg NH4+I-1 (total of 165.39 mg N I-1), 88.78 mg P2O5 I-1, 306.25 mg K2O I-1, 49.99 mg Mg I-1, 185.61 mg Ca I-1, 369.60 mg SO42-I-1; microelements: 0.839 mg Fe I-1, 0.549 mg Mn I-1, 0.262 mg Zn I-1, 0.216 mg B I-1, 0.048 mg Cu I-1, 0.048 mg Mo I-1. Burley: macroelements: 850.3 mg NO3-I-1, 18.5 mg NH4+1-1 (total of 207.35 mg N I-1), 91.31 mg P2O5 I-1, 383.65 mg K2O I-1, 49.99 mg Mg I-1, 185.61 mg Ca I-1, 369.60 mg SO42-I-1; microelements: 0.839 mg Fe I-1, 0.549 mg Mn I-1, 0.327 mg Zn I-1, 0.324 mg B I-1, 0.048 mg Cu I-1, 0.048 mg Mo I-1. HMA4 RNAi lines are fertilized in two parallel experiments with either Flue Cured or Burley solution. The varying nitrate content in the solutions does not have a differential effect on Cd levels or HMA4 phenotype. (Data presented in this study are from plants fertilized with Flue Cured solution.) AA37 lines are fertilized with the Burley solution. For Zn addition, 0.1 g of Zn in the form of ZnSO4.H2O (Landor, Birsfelden, Switzerland) is applied, diluted in 100 ml H2O. All plants are grown in 10 L pots, in a 16 h:8 h light:dark cycle.

    Field Trials

    [0253] The field trial is carried out in a field in Switzerland (Vaud). All plants are sown in floating trays (according to agricultural practices) and grown in a greenhouse prior to transplanting. Plants are grouped into genotypic classes. Plants are grouped into experimental units which are repeated six times in the field. In the first year, for each mutation combination, 10 plants carrying both mutations in a homozygous state are grown adjacent with 10 plants homozygous only for the mutation in HMA4.1, 10 plants homozygous only for the mutation in HMA4.2 and 10 plants that are null-segregant plants for both HMA4 genes. For the double nonsense mutants, also two other genotypes are included (in three replicates): 10 plants that are homozygous nonsense mutants for HMA4.1 and heterozygous nonsense mutants for HMA4.2 and 10 plants that are homozygous nonsense mutants for HMA4.2 and heterozygous nonsense mutants for HMA4.1, these latter groups only containing one functional non-mutant allele. In the second year, for each mutation combination, 20 plants carrying both mutations in a homozygous state are grown adjacent with 20 plants that are null-segregant plants for both HMA4 genes. The field is fertilized according to standard practices for Burley cultivation.

    [0254] Two field trials are carried out in one year in two fields in two tobacco growing regions containing high cadmium. For each mutation combination, 20 plants carrying both mutations in a homozygous state are grown adjacent with 20 plants that were null-segregant plants for both HMA4 genes.

    Expression Analysis Using qPCR

    [0255] Total RNA is extracted from tobacco using the RNeasy Plant Mini Kit (Qiagen, Hilden, Germany). The RNA is digested using RQ1 RNase-free DNase (Promega, Madison, Wis., USA) and reverse transcribed using an oligo dT17 primer, dTNPs, RNasin Plus RNase Inhibitor and M-MLV Reverse Transcriptase, RNase (H-), Point Mutant (all from Promega, Madison, Wis., USA). qRT-PCR is performed on the Mx3005P system (Stratagene, Agilent, Waldbronn, Germany). Amplification reactions are carried out with the HMA4.1 forward primer (5-TCATGCAGAAATAAGAAGTGCCAG-3) an the HMA4.1 reverse primer (5-ATGGATGCTTAGAGAGTCCAGGA-3) or with the HMA4.2 forward primer (5-GTTATGCGGAAATAAGAAGTGCCTA-3) and the HMA4.2 reverse primer (5-CATGGATGCTTAGAGAGTCCAGAC-3) using SYBR 2-step QRT Low Rox (Thermo Scientific, Surrey, UK). As an internal standard, the actin9 gene is used with forward primer (5-CTATTCTCCGCTTTGGACTTGGCA-3) and reverse primer (5-AGGACCTCAGGACAACGGAAACG-3).

    DNA Extraction and Plant Genotyping

    [0256] Leaf samples are extracted using the BioSprint 96 (Qiagen, Hilden, Germany) together with the BioSprint 96 DNA plant kit (Qiagen, Hilden, Germany). DNA samples are used in a TaqMan reaction in order to determine the plant genotype. Taqman is carried out using the ABI PRISM 7900HT Sequence Detection System (Applied Biosystems, Life Technologies, Foster City, Calif., USA) and TaqMan Fast Advanced Master Mix (Applied Biosystems, Foster City, Calif., USA). The following Taqman primers (Microsynth, Balgach, Switzerland) and probes (Applied Biosystems, Life Technologies, Warrington, UK) are employed: HMA4.1 Q293*: mutant-probe 5-AGGATGGCATAGCT-3, Wild-type (WT) probe 5-AGGATGGCACAGCT-3, forward primer 5 CTGGCACTACAAATCTAAATGGTAGTATAGTATTT-3, reverse primer 5-CTGGTGTATAATATTTAGCACACTTGTCG-3; HMA4.1 E296K: mutant-probe 5-CACAGCTTGTCAAAG-3, WT probe 5-CACAGCTTGTCGAAG-3, forward primer 5-CTGGCACTACAAATCTAAATGGTAGTATAGTATTT-3, reverse primer 5-CTGGTGTATAATATTTAGCACACTTGTCG-3; HMA4.1 T402I: mutant-probe 5-TTTGACAAAACAGGGATTA-3, WT probe 5-TTTGACAAAACAGGGACTA-3, forward primer 5-CCATGTGTTGCGCACTTTCA-3, reverse primer 5-AACTCGGTCACCATAAATTCTCCTT-3; HMA4.1 G251D: mutant-probe 5-AGAAAACACTGACAGACG-3, WT probe 5-AAAACACTGACAGGCG-3, forward primer 5-AAGTCGTAAATGTTGATGAAGTCAAGG-3, reverse primer 5-CAGCCCAGACCGTTGAATCTC3; HMA4.1 V351M: mutant-probe 5-CTTTGGTCACATTGATGA-3, WT probe 5-TTGGTCACATTGGTGAGT-3, forward primer 5-GGCTATATCAGCTTCTTTGGCAATT-3, reverse primer 5-AACACATGGCAACTGGTGTAGATAGA-3; HMA4.1 G382R: mutant-probe 5-TTCTGTTTAAAAGAGCAGAG-3, WT probe 5-TCTGTTTAAAGGAGCAGAGTA-3, forward primer 5-CCATGTGTTGCGCACTTTCA-3, reverse primer 5-AACTCGGTCACCATAAATTCTCCTT-3; HMA4.2 W265*: mutant-probe 5-ATAGATTCAACGGTCTAGG-3, WT probe 5-TTCAACGGTCTGGGC-3, forward primer 5-GGTGAAACTATACCTATTGATGGAGTTGTAA-3, reverse primer 5-CACTAAATAAATGAAGCATGAAGGAATACTAC-3; HMA4.2 Q561*: mutant-probe 5-CAACCATGTGTAGGAT-3, WT probe 5-TGCCAACCATGTGCAG-3, forward primer 5-TTGGTGTAAAAGAAGCAATGAGAGAG-3, reverse primer 5-ATCATTTCAGCGTATTGCAGAATTT-3.

    Analysis of Elemental Composition

    [0257] At harvest time, mid-lower stalk positions of mature plants are harvested in pooled samples for each field plot (1 leaf per plant). From individual greenhouse plants, two mid-lower stalk position leaves (same leaf position for all plants) are harvested. The harvested material is dried in the oven at 60 C. until completely dry.

    [0258] The sample analysis is carried out by ALS (Prague, Czech Republic). Samples are homogenized and mineralized by acids and hydrogen peroxide prior to analysis. Zn and Cd are measured by mass spectrometry with inductively coupled plasma (ICP-MS) according to CZ_SOP_DO6_02_002 (US EPA 200.8, CSN EN ISO 17294-2).

    Bioinformatics Analysis

    [0259] Mutation tolerance scores are derived using the SIFT software (Ng and Henikoff, 2003), based on a database of plant sequences from UniProt (downloaded Dec. 30th 2012). RNA-seq libraries are made using the Illumina TruSeq RNA Sample prep kit and sequenced on an Illumina HiSeq-2500. Base calling and sample demultiplexing are performed using Illumina HiSeq Control Software and CASAVA pipeline software. The reads are mapped to the previously published genome (Sierro et al., 2014) using the Tophat2 software (Kim et al. 2013; version 2.0.11). Differential gene expression is calculated using Cuffdiff (Trapnell et al, 2013, version 2.2.1).

    Statistics

    [0260] When the analytical value is below LOQ, the LOQ value are considered for calculation and graphical representation. For evaluation of significance, 2-sided T-tests are performed, using the Satterthwaite correction for the heterogeneity of variance. For the field experiments, paired t-tests on ratios were conducted for the mutant plots and their corresponding control plots. Raw p-values were calculated for the probability that it is by chance that mean (mutant)<0.8*mean (control), in order to determine a significant Cd/Zn reduction below the measuring uncertainty (20%).

    Example 2Identification of Orthologs of the A. thaliana HMA2/3/4 Transporters and NtHMA4 Expression Analysis

    [0261] The Arabidopsis transporters HMA2, HMA3 and HMA4 are closely related. While HMA2 and HMA4 are involved in Zn and Cd root-to-shoot translocation (Wong and Cobbett, 2009), HMA3 is in Cd accumulation by root vacuolar storage of Zn, Cd, Co and Pb (Gravot et al., 2004; Morel et al., 2009). Based on Arabidopsis sequences, the tobacco genome is screened for putative AtHMA2/3/4 orthologs and two homologs of HMA4, HMA4.1 and HMA4.2, inherited from N. sylvestris and N. tomentosiformis respectively, are found in N. tabacum.

    [0262] The expression pattern of HMA4.1 and HMA4.2 is investigated in the two main tobacco cultivars, TN90 and K326. Flue cured tobacco types (K326) require fertilization less rich in nitrogen compared to Burley type (TN90) tobacco (Lewis et al., 2012). These differences in fertilization practices also partially explain why Cd content was found to be higher in Burley type tobacco compared to flue cured tobacco (Lugon-Moulin et al., 2006). The expression pattern of NtHMA4.1 and NtHMA4.2 is analysed in different tissues of TN90 and K326 tobacco plants, grown in the field. In these two cultivars, both genes are found to be especially expressed in root and flower tissues, but also to a smaller extent in all other tissues (FIG. 1). This pattern is in accordance with GUS-expression data reported by Hussain et al. (2004) for Arabidopsis and by Hermand et al. (2014) for tobacco.

    Example 3Effect of NtHMA4 Silencing on Leaf Cd Accumulation and Phenotype

    [0263] To evaluate the potential of NtHMA4 tobacco genes as targets for reducing Cd, RNAi constructs are designed against both NtHMA4 homologs. DNA fragments are cloned into binary vectors under the control of the constitutive MMV promoter (Dey and Maiti, 1999) and transformed in the two above-mentioned cultivars TN90 and K326. For each tobacco type, an RNAi line is selected, based on the reduced expression of both HMA4 homeologs (FIG. 2). Five plants per line and their respective untransformed controls are grown on soil, with and without Zn supplementation.

    [0264] Representative plants of each line are depicted in FIG. 3a. Their respective content in Cd and Zn is shown in FIGS. 3b and c. Both TN90 and K326 HMA4 RNAi lines are very low in Cd (around LOQ=0.05 ppm) compared to control plants (>0.55 ppm Cd) in both cultivars. Besides this more than 10-fold reduction in Cd, an around 4-fold Zn reduction observed. With respect to the plant biomass (stalk height and leaf weight) the K326 HMA4 RNAi line performs very well and is not significantly smaller, with even slightly heavier leaves than the control plants (FIG. 3d, e). Leaf shape differ only slightly, transgenic leaves being rounder with thicker veins (FIG. 3a). By contrast, TN90 HMA4 RNAi lines displays stunted growth and necrotic patches on the leaves (FIG. 3a, d). Leaves are thicker compared to the TN90 WT control (FIG. 3f). Based on fresh and dry weight measurements, these plants exhibits increased water content (FIG. 3g). The experiment is repeated under high nitrate fertilization, however nitrogen supply does not affect Cd levels and phenotype (data not shown). In conclusion, these results demonstrate that silencing both HMA4 homeologs in both tobacco cultivars reduces leaf Cd more than 10-fold and Zn around 4-fold. However, despite similar Cd/Zn reduction in both varieties, phenotypic effects were very different between K326 and TN90 with K326 performing better.

    [0265] Interestingly, it is observed that treating HMA4 RNAi plants with Zn replenished plant Zn content to almost control levels and restored the normal (Burley) plant phenotype in TN90 whilst still keeping reduced Cd levels (FIG. 3a-c, hatched bars). Zn addition increases stalk height and leaf weight in the TN90 RNAi line and decreases water content and leaf thickness in both TN90 and K326 HMA4 RNAi plants (FIG. 3d-g, hatched bars). This shows that Zn can complement HMA4 RNAi and restore the WT phenotype, keeping more than 90% reduced Cd content.

    Example 4Cd Reduction in the Field Requires Combination of NtHMA4 Mutations

    [0266] For tobacco breeding, an EMS population of the cultivar AA37 is screened for mutations in HMA4. AA37 is a cultivar derived from a crossing between a South American dark tobacco and American Burley germplasm, it is therefore more closely related to TN90 than to K326 (Fricano et al., 2012). Comparable expression profiles suggest that both HMA4 homeologs (FIG. 1 and FIG. 2) are involved in Zn and Cd translocation from root to shoot. Therefore, exons coding for catalytically important domains are screened for point mutations in both HMA4 copies. All amino acid substitutions identified in NtHMA4.1 and NtHMA4.2 are analysed for possible impact on protein function using the SIFT program (Ng and Henikoff, 2003). A small SIFT score (<0.05) implies that an amino acid residue is likely not tolerated at the functional level. In NtHMA4.1 and in NtHMA4.2 36 and 33 mutations are identified, respectively, including 2 nonsense mutations in each of the homeologs and 15 missense mutations in each homeolog with a SIFT score ratio below 0.05 (Table 10). The SIFT score is used as a tool to facilitate the selection of mutations.

    [0267] Mutations in both HMA4 isoforms are combined by crossings. Such crossings include at least one nonsense mutation and a second mutation which was either a nonsense mutation or a SIFT predicted missense mutation. Before each greenhouse and field test, the segregating offspring are grown in floating trays, genotyped using Taqman and grouped into individual classes prior to soil transplantation.

    [0268] In a greenhouse experiment, six combinations of mutations are tested. For each of them, eight plants carrying two homozygous mutations are grown together with eight plants homozygous for only one mutation in HMA4.1, eight plants homozygous only for a mutation in HMA4.2 and eight null-segregant plants for both HMA4 genes. For the double nonsense mutants, also two other genotypes are included: eight plants that are homozygous nonsense mutants for HMA4.1 and heterozygous nonsense mutants for HMA4.2 and eight plants that are homozygous nonsense mutants for HMA4.2 and heterozygous nonsense mutants for HMA4.1, these latter groups only containing one functional non-mutant allele. After five and eleven weeks growth on soil (a), lower stalk position leaves are harvested for fresh weight determination (b) and Cd, Zn analysis (FIG. 4c, d).

    [0269] Unlike the simple nonsense mutants and the nonsense mutants with one functional HMA4 allele, only the double nonsense mutant HMA4.1 Q293*/HMA4.2 Q561* shows a similar Cd reduction as the reduction observed for the HMA4 RNAi plants. After five weeks growth on soil, homozygous double nonsense mutants shows a Cd reduction from 0.6 ppm in control plants to levels around the limit of quantification (LOQ=0.05 ppm), while Zn content is only reduced by one third (FIG. 4c, d). Cd analysis after eleven weeks shows that the greenhouse plants with further plant growth diluted Cd in the increasing biomass. Mean control levels are at around 0.3 ppm Cd while the two double mutant lines analysed shows Cd levels below the limit of quantification (FIG. 4c). Interestingly, single nonsense mutants and mutant plants carrying only one functional HMA4 allele shows intermediate Zn content while exhibiting control Cd levels. These Zn levels seem sufficient for normal growth, as no growth difference is observed in these plants, compared to the control. The homozygous double nonsense mutants on the other hand show a 50% reduction in leaf weight after five weeks of growth. However, after eleven weeks, mutant plants reach the same size as the control (FIG. 4a, b), only flowering is slightly delayed.

    [0270] Of the other mutant combinations investigated after five weeks growth, two other combinations (E296K/Q561* and T402I/Q561*) show a similar Cd reduction as the double nonsense mutant while containing only one third of control Zn content (FIG. 5a, b). These two lines display likewise delayed growth: at an early stage T402I/Q561* showed about 25% leaf weight reduction and E296K/Q561* showed 50% reduced leaf weight (FIG. 5c). After growth for six more weeks, there are no significant differences in leaf size and height any more between controls and double mutants. However, in the double mutant lines flower formation is slightly delayed. Two other mutation combinations (G382R/Q561* and G251 D/Q561*) do not show significant Cd reduction. All Cd and Zn data are summarized in Table 8. For the control group in Table 8 values of all individual control plants are grouped together.

    [0271] Altogether, these experiments show that both HMA4 genes need to be at least partially impacted to reduce Cd levels significantly.

    Example 5Validation of Cd Reduction in Two Field Trials Under Moderate Cd Conditions

    [0272] Two field experiments are conducted under moderate cadmium conditions in order to confirm the greenhouse data. In the first experiment, the same genotype groups (single mutants, double mutants and control plants) are grown in six replicate plots. Each replicate unit contains 10 plants of the double mutant, the HMA4 WT control and the two simple mutants, respectively. For the double nonsense mutants, also the two other genotypes containing one functional non-mutant allele are included (homozygous nonsense mutants for HMA4.1/heterozygous nonsense mutants for HMA4.2 and heterozygous nonsense mutants for HMA4.1/homozygous nonsense mutants for HMA4.2). Plants are grown for 14 weeks in a field in Switzerland. Plant phenotypes are investigated and leaves at mid-stalk position harvested, dried and subjected to Cd/Zn analysis. P-values are calculated for the probability that the observed reduction in Cd in the mutant by more than 20% compared to the control is by chance.

    [0273] Globally, the field and the greenhouse data are corresponding. While the single mutants do not show any Cd reduction compared to the controls (Table 2), the same double mutant lines that had been low in Cd in the greenhouse (T402I/Q561*; E296K/Q561*; Q293*/Q561*), as well as an additional double nonsense mutant (Q293*/W265*), shows likewise more than ten-times reduced Cd content under field conditions with a probability p<0.05 (highest p-value=0.0054) that the mean double mutant value is at least 20% reduced (Table 4). Besides these four lines, line G251D/Q561* show 30% Cd reduction, however, in this line the Cd content is not significantly more than 20% reduced (p-value=0.1029). While Zn content is reduced by around 70% in the greenhouse, the low Cd lines (T402I/Q561*; E296K/Q561*; Q293*/Q561*; Q293*/W265*) grown in the field show only a maximum of around 50% Zn reduction (Table 4). In the first field trial, leaf weight is reduced in line E296K/Q561*, whereas in the three other low Cd lines (T402I/Q561*; Q293*/Q561*; Q293*/W265*) leaf weight is not significantly affected (FIG. 6b). Plant and leaf morphology is not affected by the mutations. However, for lines E296K/Q561*, Q293*/Q561* and Q293*/W265*, necrotic spots are observed on the lower leaves, especially at an early growth stage. The double mutants T402I/Q561* and G251D/Q561* show the best phenotypes and do not display necrotic lesions at any time. These two lines are hardly distinguishable from their controls.

    [0274] In a second field trial, the same mutation combinations are grown together with additional combinations (18 in total) in the field. This time one experimental unit contains 20 homozygous HMA4 double mutant plants and 20 HMA4 WT control plants. The single mutants are not analysed again. The Cd/Zn data are shown in Table 5; graphs on Cd data and phenotypic data are depicted in FIG. 7. The same lines that show a Cd reduction in the first field trial, show again a comparable Cd reduction; except line G251D/Q561* which even shows 70% Cd reduction this time. Besides these lines, one more double nonsense mutations is analysed (Q464*/Q561*) and shows as expected a very strong Cd reduction of 94%. Likewise the new mutation combination Q293*/G235E show 94% Cd reduction. The mutation combinations Q293*/L223F and Q293*/D234N exhibit intermediate Cd reduction (37% and 27%, respectively). The lines Q293*/Q561*, Q293*/W265*, Q464*/Q561*, Q293*/G235E, E296K/Q561*, T402I/Q561*, G251D/Q561*, and Q293*/L223F show a significant more than 20% Cd reduction (p<0.05; highest p-value=0.0007). The line Q293*/D234N shows a 27% Cd reduction, but the reduction is not bigger than 20% with p<0.05. All other double mutants analysed only show less than 20% Cd reduction and thus are not interesting for further development. The mutation combinations Q293*/Q561* and Q293*/W265*, Q464*/Q561*, Q293*/G235E and E296K/Q561* show necrotic spots on the leaves and reduced growth rate at an early stage. However, at harvest time, no clear difference is seen between these double mutants and their controls. Leaf dry weight of most mutant lines in the field is similar to their control plants (FIG. 7b). In some cases, leaf dry weight differs slightly from the controls, however, without being correlated to the Cd reduction.

    Example 6Validation of Cd Reduction in Two Field Trials Under High Cd Conditions

    [0275] In two small field trials, five promising low Cd mutation combinations (the double nonsense mutation combination Q293*/Q561* as well as the combinations Q293*/G235E, E296K/Q561*, T402I/Q561* and G251 D/Q561*) as well as their respective controls are grown in two regions that are known for high Cd content. Cd/Zn data are shown in Table 6; graphs on Cd and phenotypic data are shown in FIG. 8. The control plants accumulate around 3 ppm Cd, whereas the Cd content is reduced by 80% and by 90% for mutation combinations Q293*/Q561*, Q293*/G235E, E296K/Q561* and T402I/Q561* in the first (field 3) and second region (field 4), respectively. For the combination G251D/Q561* the Cd reduction is at around 45% in both field locations. For all lines the probability that the mean is below 20% is significant (p<0.05; highest p-value=0.0068). No impact on leaf weight is observed (FIG. 8b).

    [0276] Altogether, the field data show that under agricultural field conditions, even in different regions, HMA4 mutation combinations have the potential to reduce Cd content by 5 to 10-fold. Plant development and yield do not seem to be impacted at a later stage in the cultivar AA37.

    Example 7NtHMA4 is the Key Enzyme for Root-to-Shoot Cd Translocation

    [0277] In HMA4 RNAi lines as well as HMA4 double nonsense mutants described herein, leaf Cd can be reduced by more than 10-fold, indicating that Cd root-to shoot transfer in tobacco is essentially dependent on HMA4. Mutations in both HMA4 genes are necessary to breed for low Cd tobacco. Under both greenhouse and field conditions, HMA4 double nonsense mutants exhibit 90% Cd reduction. Under all Cd conditions tested, a nonsense mutation in only one of the HMA4 genes is not able to reduce Cd content in tobacco plants.

    [0278] Interestingly, under extremely high non-naturally occurring Cd conditions, 50% reduction of Cd has been observed in plants carrying only one nonsense mutation in one of the NtHMA4 genes (Hermand, 2014). This corresponds to what has been observed in Arabidopsis, where on high Cd agar medium, the knockout of AtHMA4 reduced shoot Cd content by more than 50%, whereas simultaneous knockout of both these transporter genes leads to an even greater reduction (Wong and Cobbett, 2009). Our study on NtHMA4.1 and NtHMA4.2 demonstrates that results from artificial systems need to be confirmed under soil and field conditions to evaluate the impact of a mutation for plant breeding.

    [0279] Like for many crop species diverse tobacco cultivars exist. They exhibit large differences e.g. in fertilization requirements and accumulation of amino acids and sugars (Lewis et al., 2012). In the three cultivars analysed, TN90, K326 and AA37, HMA4 disruption shows a comparable effect, i.e. in all of these cultivars Cd reduction by more than 90% is achieved. However, despite the comparable effect seen on Cd and Zn reduction, plant performance is very different. While K326 is only slightly affected by the lack of HMA4, exhibiting rounder leaf shape and increased leaf veins with constant biomass and plant size, TN90 shows strongly stunted growth and necrotic lesions, whereas AA37, not being a typical Burley plant like TN90, displays only small effects. This underlines the metabolic differences between tobacco cultivars with respect to Zn homeostasis. Supply of Zn to the soil is able to restore the phenotype which indicates that other transporters can compensate for HMA4 and mediate Zn uptake, although on a lower level.

    Example 8Low Cd Combined with Unaffected Phenotype Requires Fine-Tuning of Both NtHMA4 Homeologs

    [0280] In order to minimize phenotypic effects of HMA4 double knockout, a second mutation is identified in one of the HMA4 genes. The aim is that when breeding this combination in a variety of choice, it is sufficient to reduce Cd significantly, but without affecting the plant phenotype. While in the AA37 EMS mutant background an effect is especially visible at an early growing stage, no clear impact on growth and biomass can be observed at a later stage. However, according to the data of the HMA4 RNAi lines (FIG. 3) according to the variety of interest and especially in Burley varieties, a negative impact on growth might occur.

    [0281] In the following, mutation combinations that are considered especially useful for further plant breeding are described. Besides the double HMA4 knockout mutants (Q293*/Q561*, Q293*/W265*, Q464*/Q561*), further combinations were identified with comparable Cd reduction (80-90%):

    [0282] While the double mutants E296K/Q561* and Q293*/G235E show a similar phenotype as the double knockout mutants at an early stage (necrotic lesions, reduced growth), the T402I/Q561* mutant plants displays better growth and do not exhibit necrotic patches on the leaves at an early stage. The combination G251D/Q561* provides 30 to 70% Cd reduction and a phenotype that cannot be distinguished from the control. Two more mutations combinations (Q293*/L223F and Q293*/D234N) only show low Cd reduction (37% and 27%, respectively in one field trial).

    [0283] A second greenhouse experiment was performed with additional mutation combinations in which the combination H438Y/W265* showed 58% Cd reduction and no impact on phenotype (Table 9).

    [0284] The above described mutation combinations offer the possibility to dose Cd and Zn content and to find the optimal mutation combination for each cultivar. For a cultivar such as Burley, which is more impacted by lack of HMA4 as shown in transgenic lines (FIG. 3), it might be necessary to use an intermediate solution (e.g. G251D/Q561*, H438Y/W265*, Q293*/L223F, or Q293*/D234N).

    [0285] In the following, the localisation of the mutations was investigated (FIG. 9). Heavy metal ATPases comprise three domains that are important for catalytic function: the phosphorylation (P), nucleotide binding (N) and actuator (A) domains. The P-domain is composed of the N- and C-terminal parts of the third cytoplasmic loop. The middle part of the loop is the N-domain. A DKTGT motif is found in the P-domain. The aspartate residue in this motif is predicted to be phosphorylated in the active enzyme during catalysis. In the A-domain, the catalytically active TGE(S) loop protrudes from the structure, interacting with the phosphorylated site in the ATP-binding domain (Banci et al., 2009).

    [0286] Five functional mutations that have an impact on Cd uptake are found in the A (actuator)-domain of the transporter (L223F, D234N, G235E, G251D, E296K) with G251* being localised in the TGES motif. It is known from other HMA transporters that mutations occurring in the A-domain either destabilize the fold of the domain or affect interactions with the other domains of the enzyme (Banci et al., 2009). The T402I mutation is found in the DKTGT motif, the P (phosphorylation)-domain in the third cytoplasmic loop of the protein. The H438Y mutation is found in the HP motif of the N (nucleotide binding)-domain in the third cytoplasmic loop of the protein which might act by impairing nucleotide coordination. In conclusion, two mutations are necessary to inhibit Cd translocation, one of them being a full knockout and the second a nonsense or a missense mutation likely located either in the A-domain, in the DKTGT motif of the P-domain or in the HP locus of the N-domain in the second HMA4 copy.

    [0287] Altogether, this work highlights the need to identify a suitable system to measure the effect of HMA4 mutations and their combinations on Cd content and phenotype. This work shows the importance of fine-tuning HMA4 root-to-shoot translocation system in order to obtain low Cd tobacco without phenotypic alterations for all cultivars on interest.

    REFERENCES

    [0288] Arnould, S., Delenda, C., Grizot, S., Desseaux, C., Paques, F., Silva, G. H., and Smith, J. (2011). The I-Crel meganuclease and its engineered derivatives: applications from cell modification to gene therapy. Protein Eng Des Sel. 24(1-2):27-31. [0289] Banci, L., Bertini, I., Cantini, F., Migliardi, M., Natile, G., Nushi, F., and Rosato, A. (2009). Solution structures of the actuator domain of ATP7A and ATP7B, the Menkes and Wilson disease proteins. Biochemistry 48(33): 7849-7855 [0290] Bortesi, L., and Fischer, R. (2015). The CRISPR/Cas9 system for plant genome editing and beyond. Biotechnol Adv. 33(1):41-52. [0291] Chen, K, and Gao, C. (2014). Targeted genome modification technologies and their applications in crop improvements. Plant Cell Rep. 33(4):575-583. [0292] Chen, L., Hao, L., Parry, M. A., Phillips, A. L., and Hu, Y. G. (2014). Progress in TILLING as a tool for functional genomics and improvement of crops. J Integr Plant Biol. 56(5):425-443. [0293] Dey, N., and Maiti, I. B. (1999). Structure and promoter/leader deletion analysis of mirabilis mosaic virus (MMV) full-length transcript promoter in transgenic plants. Plant Mol Biol. 40(5):771-82. [0294] Fricano, A., Bakaher, N., Del Corvo, M., Piffanelli, P., Donini, P., Stella, A., Ivanov, N. V., and Pozzi, C. (2012). Molecular diversity, population structure, and linkage disequilibrium in a worldwide collection of tobacco (Nicotiana tabacum L.) germplasm. BMC Genet. 13:18. doi: 10.1186/1471-2156-13-18. [0295] Gravot, A., Lieutaud, A., Verret, F., Auroy, P., Vavasseur, A., and Richaud, P. (2004). AtHMA3, a plant P1B-ATPase, functions as a Cd/Pb transporter in yeast. FEBS Lett. 561(1-3):22-28. [0296] Hermand, V., Julio, E., Dorlhac de Borne, F., Punshon, T., Ricachenevsky, F. K., Bellec, A., Gosti, F., and Berthomieu, P. (2014) Inactivation of two newly identified tobacco heavy metal ATPases leads to reduced Zn and Cd accumulation in shoots and reduced pollen germination. Metallomics, 6(8), 1427-1440. [0297] Horsch, R. B., Fry, J. E., Hoffmann, N. L., Wallroth, M., Eichholtz, D., Rogers, S. G. and Fraley, R. T. (1985). A Simple and General Method for Transferring Genes into Plants. Science, 227, 1229-1231 [0298] Hussain, D., Haydon, M. J., Wang, Y, Wong, E., Sherson, S. M., Young, J, Camakaris J, Harper J F, Cobbett C S. (2004) P-type ATPase heavy metal transporters with roles in essential zinc homeostasis in Arabidopsis. Plant Cell, 16(5), 1327-1339. [0299] Kim, D., Pertea, G., Trapnell, C., Pimentel, H., Kelley, R., and Salzberg, S. L. (2013). TopHat2: accurate alignment of transcriptomes in the presence of insertions, deletions and gene fusions. Genome Biology 14:R36. [0300] Korenkov, V., King, B., Hirschi, K., and Wagner, G. J. (2009). Root-selective expression of AtCAX4 and AtCAX2 results in reduced lamina cadmium in field-grown Nicotiana tabacum L. Plant Biotechnol J 7(3):219-226. [0301] Lewis, R. S., Parker, R. G., Danehower, D. A., Andres, K., Jack, A. M., Whitley, D. S., and Bush, L. P. (2012) Impact of alleles at the Yellow Burley (Yb) loci and nitrogen fertilization rate on nitrogen utilization efficiency and tobacco-specific nitrosamine (TSNA) formation in air-cured tobacco. J Agric Food Chem. 60, 6454-6461. [0302] Liedschulte, V., Laparra, H., Battey, J., Goepfert, S., and Bovet, L. Missense or nonsense mutations in either HMA4.1 or HMA4.2 do not significantly reduce cadmium content in the leaves of tobacco plants grown under field conditions. Poster session presented at: The 12th Solanaceae conference; 2015 Oct. 25-29; Bordeaux, France. [0303] Lugon-Moulin, N., Martin, F., Krauss, M. R., Ramey, P. B., and Rossi L. (2006) Cd concentration in tobacco (Nicotiana tabacum L.) from different countries and its relationship with other elements. Chemosphere 63, 1074-1086. [0304] Morel, M., Crouzet, J., Gravot, A., Auroy, P., Leonhardt, N., Vavasseur, A., and Richaud, P. (2009). AtHMA3, a P1 B-ATPase allowing Cd/Zn/Co/Pb vacuolar storage in Arabidopsis. Plant Physiol., 149(2), 894-904. [0305] Ng, P. C., and Henikoff, S. (2003). SIFT: Predicting amino acid changes that affect protein function. Nucleic Acids Res. 31(13):3812-4. [0306] Petolino, J. F. (2015). Genome editing in plants via designed zinc finger nucleases. In Vitro Cell Dev Biol Plant. 51(1):1-8. [0307] Puchta, H., and Fauser, F. (2013). Gene targeting in plants: 25 years later. Int J Dev Biol. 57(6-8):629-37. [0308] Qiwei, S., and Caixia, G. (2015). Research progress of genome editing and derivative technologies in plants. Yi Chuan. 37(10):953-973. [0309] Sambrook, J., Fritsch, E. F., and Maniatis, T. (1989). Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. [0310] Schneider, C. A., Rasband, W. S., Eliceiri, K. W. 2012. NIH Image to ImageJ: 25 years of image analysis. Nature Methods 9, 671-675, 2012. [0311] Sierro, N., Battey, J. N. D., Ouadi, S., Bakaher, N., Bovet, L., Willig, A., Goepfert, S., Peitsch, M. C., and Ivanov, N. V. (2014) The tobacco genome sequence and its comparison with those of tomato and potato. Nature Communications 5, Article number: 3833 [0312] Trapnell, C., Hendrickson, D., Sauvageau, M., Goff, L., Rinn, J. L., and Pachter, L. (2013). Differential analysis of gene regulation at transcript resolution with RNA-seq. Nature Biotechnology 31: 46-53. [0313] Wong, C. K., and Cobbett C. S. (2009) HMA P-type ATPases are the major mechanism for root-to-shoot Cd translocation in Arabidopsis thaliana. New Phytol., 181(1), 71-78. [0314] Wright, D. A., Li, T., Yang, B., and Spalding, M. H. (2014) TALEN-mediated genome editing: prospects and perspectives. Biochem J. 462(1):15-24.

    [0315] Any publication cited or described herein provides relevant information disclosed prior to the filing date of the present application. Statements herein are not to be construed as an admission that the inventors are not entitled to antedate such disclosures. All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in cellular, molecular and plant biology or related fields are intended to be within the scope of the following claims.

    TABLE-US-00002 SEQUENCES SEQIDNO:1 AminoacidsequenceofNicotianatabacumheavymetalATPase(NtHMA4.1) GenBankAccessionNo:CCQ77798. 1 MVESEKMNETKKLSKSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDS 61 LLISPQQIVKALNQARLEASIRVKGEKNYQKKWPSPFAIGSGILLGLSFLKYFFAPFQWL 121 ALAAVAVGIPPIIFRGVAAVRNLTLDINILVLIAVAGSIVLHDYWEAGTIVFLFAIAEWL 181 ESRASHKATAAMSSLVNIVPPTAVLAESGEVVNVDEVKVNSILAVKAGETIPIDGVVVEG 241 ECDVDEKTLTGESFPVSKQRDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQN 301 KKSKTQRYIDKCAKYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVL 361 STPVAMCCALSKAATSGLLFKGAEYLETLAKIKIMAFDKTGTITKGEFMVTEFKSLIDGF 421 SLNTLLYWVSSIESKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEI 481 YVGNRKISSRAGCTTVPEIEGDSFKGKSVGYIFLGSSPAGIFSLSDVCRIGVKEAMRELK 541 QMGIKTAMLTGDCYAAANHVQDQLGGALDEFQAELLPEDKATIIKGFQKEAPTAMIGDGL 601 NDAPALATADIGISMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIIS 661 VVTKAAIVALAIAGYPLVWAAVLADTGTCLLVILNSMLLLRGGTRRHGKKCWRSSTPSHA 721 PHHKDKASCCKSENAPQLCCSDIESQKKCTSQSCSSEVCVPRCQPVSSGSKSCGNNQCPD 781 SIENSGFHSHRRPQCCSSKMAAKACQSAVSESKSCGNNQCPDSVENSGFHSHPRPECCSS 841 KMAAKACQSAVSESKSCGNNQCPDSVENSGFHSHPRPQCCSSKMAAKAGQSALSESKSCG 901 NNNCSDSIHKSNCHSLTNSLVCSSKMSAPQCHSATSSNKSCGSTKCSDFSDKKCCQSDKI 961 PQTCSTKKSAPGCQSAVSGSKSCGNSKCSDSKDNSSHPSHPDHQTCMSKLCAPQSQSATS 1021 SSRTCGNTKCSDTNSKNSCYSQTNSESCSSKMSGPSCKTANSGSRSCRNKKCQDSATENS 1081 FHSPLTNPLSGEKLSEQKSLDLVRKDKESSHDLRHGCSDEEHDHTNLDKAYDSCALQECC 1141 YSVQGNKTDVSETGIQETAHCDSTNQTCQTASSGSMTCGNDKILDSLSIHGCHSHDNPLH 1201 EENNLEQKILDVVGEGIKSPHAVGHGCSDKEHDHSHPEKAYDSCATDDCCFSVQVHGIDD 1261 VSKSEIQETAHCDSTKQSMVISSSCKHEPKDQVNHCGLHSKTTPTDEELAKLVRRCCKYK 1321 PCHDVRSGCRKHAAECGPTVRSTINILRDNHHHYLDCSGRKVCSLLEKRHIGGCCDSFRK 1381 ECCAKKKHLGASFGGGLSEIVIE SEQIDNO:2 AminoacidsequenceofNicotianatabacumheavymetalATPase(NtHMA4.2) GenBankAccessionNo:CCW03243.1. 1 MVESEKMNDTKNLSKSYFDVLGICCTSEVVLVEKILKNLEGVKEVSVIVTTKTVIVIHDS 61 LLISQQQIVKALNQARLEASIRVKGEKNYQKKWPSPFAIGSGILLGLSFLKYFFAPFQWL 121 ALAAVAVGIPPIIFRGVAAVRNLTLDINILVLIAVTGSIVLHDYWEAGTIVFLFTIAEWL 181 ESRASHKATAAMSSLVNIVPPTAVLAESGEVVNVDEVKLNSILAVKAGETIPIDGVVMEG 241 ECDVDEKTLTGESFPVSKQIDSTVWAGTTNLNGYISVKTTALAEDCAVARMAQLVEDAQN 301 KKSKTQRYIDKCAKYYTPAIVAISASLAIVPTALRVHNRNEWYRLALVTLVSACPCALVL 361 STPVAMCCALSKAATSGLLFKGAEYLETLAKIKIMAFDKTGTITRGEFMVTEFKSLVDGL 421 GLNTLLYWVSSIESKSGHPMAAALVDYAQSNSVEPKPDRVEQFQNFPGEGIFGRIDGMEI 481 YVGNRKISSRAGCTTVPEIEGDSFQGKSVGYIFLGSSPAGIFGLSDVCRIGVKEAMRELK 541 QMGIKTAMLTGDCYAAANHVQDQLGGAMDEFQAELLPEDKATIIKGFQKEAPTAMIGDGL 601 NDAPALATADIGISMGISGSALAKETGHVILMTNDIGRIPKAARLARRVRRKIVENMIIS 661 VVTKAAIVALAIAGYPLVWAAVLADTGTCLLVILNSMLLLRVGTHRHGKKCCRSATPSHA 721 PNHKDKASCCKSENAPQLCCSDIESQKKCTSQSCSSEVCVPRCQPVSSGSKSCGNNQCPD 781 SVENSGFHSHPRPQCCSSKMASKACQSAVSESKSCGNNQCPDSVENSGFHSHPRPQCCSS 841 KMASKACQSAVSESKSCGNNQCPDSVENSGFHSHPRPQCCSLKMASKACQSAVSESKSCG 901 NNQCPDSVENSGFHSHPRPQCCSSKMAAKACQSAVSESKSCGNNNCSESIYKSSCHSLTS 961 SLVCSSKMSAPQCHSATSSSKSCGSTKCSNFSDKKCCQYDKIPQTCSTKKSAPGCQSAVS 1021 GSKSCGDSKCSDSKDNSSHPSHPDHQICTSKLCAPQSQSATSSSRTCGNMKCSDTNSKNS 1081 CYSHTNSESCSSKMSGPACKTANSGSRLCGNKKCLDSANENSFHSLTNPLCEEKLLEKES 1141 LDLARKDRESNHDLSHGCSDEEHDHLNLDKAHDSCALQECCYSVQGNKTDVSETGIQEAA 1201 HCDSINQTCQTAISGSMTCGNNKSLDSLSIHGCHSHDSPLHKESNLEQKSLDVAGEGIKS 1261 PHAVGQGCSDKEHNHSHPEKAYDSCATDDCCFSVQVHGIDDVSRSEIQETAHCDSTKQST 1321 VIPSSCEHEPKDQVNHCGSHSKSIPTDEELAKLVRRCCKYKPCHDVRSGCRKHAAECGPT 1381 VRSTINILRDNHHHHLDCSGRKVCSLLEKRHIGGCCDSFRKECCAKNNHLGASFGGGLSE 1441 IVIE SEQIDNO:3 PolynucleotidesequenceofNicotianatabacumheavymetalATPase(NtHMA4.1) GenBankAccessionNo:HF675181.1. 1 agagaaggagaaaaatggtggaaagtgaaaaaatgaatgaaacaaagaagttgagcaaga 61 gctattttgatgttttgggaatttgctgtacttcagaagttgttctagttgaaaaaattc 121 tcaagaatcttgaaggggttaaagaggtttcagtaattgtcacaacaaagactgtcattg 181 ttattcatgattctcttctcatttctccgcaacaaattgttaaagcattgaatcaagcaa 241 gattagaagcaagcataagagtgaaaggagagaaaaactaccaaaagaaatggccaagtc 301 catttgcaattggcagtggaatattgcttggactctcatttttgaagtacttttttgcac 361 ctttccaatggttagcacttgcagctgttgcagttgggattcctccaattatttttagag 421 gtgtggctgccgtgcgaaacctcactcttgacatcaacattcttgttttaatagcagtgg 481 ctggatcaattgttttacacgattattgggaagctggtactattgtcttcttattcgcca 541 ttgcagaatggctagagtcaagggcaagtcacaaggctaccgctgctatgtcatcactgg 601 tcaatatagtccctccaacagcagttttagctgaaagcggagaagtcgtaaatgttgatg 661 aagtcaaggtgaatagcattcttgctgtgaaagctggtgaaactatacctattgatggag 721 ttgtagtggaaggggaatgtgacgtggacgagaaaacactgacaggcgagtcgtttccag 781 tttctaagcaaagagattcaacggtctgggctggcactacaaatctaaatggctatatca 841 gtgttaagactacggctttggctgaagattgtgcggtggctaggatggcacagcttgtcg 901 aagatgctcagaacaagaaatcaaaaacccaaagatacatcgacaagtgtgctaaatatt 961 atacaccagcaattgtggctatatcagcttctttggcaattgttcctactgcattaagag 1021 ttcacaatcgaaatgaatggtatcgcttggctttggtcacattggtgagtgcatgtccgt 1081 gtgcacttgttctatctacaccagttgccatgtgttgcgcactttcaaaagcagcaacgt 1141 ccggtcttctgtttaaaggagcagagtaccttgagactctagctaaaatcaaaatcatgg 1201 cttttgacaaaacagggactataactaaaggagaatttatggtgaccgagttcaagtctc 1261 tgattgatggttttagtctcaatacactgctttactgggtttcaagcattgagagcaagt 1321 caggtcatccgatggcagccgctctggtggactatgcacaatcaaattccgttgagccaa 1381 agcctgatagagttgagcagtttcaaaattttcctggtgaagggatatttggaagaattg 1441 atggaatggaaatctatgtcgggaataggaaaatttcttcaagagctggatgtaccacag 1501 taccagaaatagagggtgatagtttcaaaggaaagtctgttggatacatatttttgggat 1561 catctccagctggaattttcagtctttccgatgtttgtcgaattggtgtaaaagaagcaa 1621 tgagagaactgaagcagatgggtatcaaaaccgcgatgcttactggtgattgttatgcag 1681 ctgccaaccatgtgcaggatcagttaggtggagctttggatgaatttcaagcagaactcc 1741 taccagaggacaaggcaacaatcatcaagggttttcagaaggaagctccaacagcgatga 1801 taggcgacggccttaatgatgctcctgcattagcaacagctgacattggcatctcaatgg 1861 gcatctctgggtcagctctcgctaaagaaacaggccatgttatactaatgacaaatgaca 1921 tcggaagaataccgaaagctgcacgtcttgctagaagagttcgaaggaagattgttgaga 1981 atatgattatatcagtcgttacaaaggctgccatagttgcattggcaatagcaggttatc 2041 cattggtttgggctgctgtcctcgcagatactgggacatgcttgctagtgattttgaaca 2101 gcatgctacttctacgaggaggcacacgcagacatgggaaaaaatgttggagatcttcta 2161 ctccttcgcatgctccccaccacaaagacaaagcttcatgttgcaagtcggaaaatgctc 2221 cccagctgtgttgctctgatattgagtcacaaaagaaatgtacaagtcaatcatgctcgt 2281 ccgaggtgtgtgttccaagatgtcaacctgtctcctcaggatcaaagtcatgtggaaata 2341 atcagtgcccagactccattgaaaatagtggttttcattctcatcgccgtcctcaatgct 2401 gctcgtcgaagatggctgctaaagcatgccaatctgcagtttcagaatcaaagtcatgcg 2461 gaaataatcagtgcccagactccgttgaaaatagtggttttcattctcatccccgtcctg 2521 aatgctgctcgtcgaagatggctgctaaagcgtgccaatctgcagtttcagaatcaaagt 2581 catgtggaaataatcagtgcccagactccgttgaaaatagtggttttcattctcatcccc 2641 gtcctcaatgctgttcatcgaagatggctgctaaagcaggccaatctgcactttcagaat 2701 caaagtcatgtggaaataacaattgctcagactccattcacaagagtaattgtcattctt 2761 taactaactctctagtatgttcttccaagatgtctgctccacaatgtcattctgctactt 2821 caagcaacaaatcatgtggaagtaccaagtgctccgacttcagtgacaaaaaatgttgtc 2881 aatccgacaaaattcctcaaacgtgctctaccaagaagtctgctccaggatgtcaatctg 2941 cagtttctgggtctaaatcatgtggaaatagcaagtgttcagactcaaaagacaatagta 3001 gccatccttcacatcccgatcatcaaacatgcatgtctaagttgtgtgctccacaaagcc 3061 aatctgcaacttcaagctccaggacatgtggaaatacaaagtgctcggacaccaatagca 3121 agaattcttgttattcacaaaccaactctgaatcatgctcttcaaagatgtctggtccat 3181 catgcaaaactgctaattcaggttcaaggtcatgcagaaataagaagtgccaggactctg 3241 caaccgagaacagttttcattcaccacttactaatccactcagtggggaaaagctttcgg 3301 agcagaaaagcttggatttagtccgaaaagataaggaatcaagtcatgatcttcgtcatg 3361 gctgctctgacgaggaacatgatcatacaaatttagacaaggcatatgacagttgtgcct 3421 tacaagaatgttgttattcggttcaaggcaataaaactgatgtatcagaaactggaatcc 3481 aggaaactgctcattgtgacagcaccaatcaaacatgccaaactgcaagttcaggatcga 3541 tgacatgcggaaatgataagatcctggactctctaagcatccatggttgtcattcgcatg 3601 ataatccactccacgaggagaacaacttggagcagaaaatcttggatgttgttggagaag 3661 gtataaaatcacctcatgctgtcggtcatggctgttcggacaaggaacacgatcactcac 3721 atccagaaaaggcatatgacagttgtgcaacagatgattgttgtttttcagttcaagtcc 3781 atggcattgacgacgtatcaaaaagtgaaattcaagaaactgctcattgtgacagcacaa 3841 agcagagcatggtcatctccagcagctgcaaacatgaaccaaaagatcaggtaaatcact 3901 gtggacttcactctaaaactactccaactgatgaagaactagccaagctggttagaagat 3961 gctgcaaatacaaaccatgccacgacgtccgttctggctgcaggaagcatgctgcagaat 4021 gtggtccaaccgttcgatcaaccatcaatatcttacgggacaaccatcatcattacctag 4081 actgcagtggtcgtaaggtttgttcgctgttggagaagagacacatcggtggatgctgtg 4141 acagcttcagaaaagaatgttgtgccaagaaaaaacaccttggagcaagttttggaggag 4201 gtttatcagaaattgtcatagagtagatgcaatccgaagtgtacat SEQIDNO:4 PolynucleotidesequenceofNicotianatabacumheavymetalATPase(NtHMA4.2) GenBankAccessionNo:HF937054.1. 1 atagaaagaagagaatggtggaaagtgagaaaatgaatgacacaaagaatctgagcaaga 61 gctattttgatgttttgggaatttgctgtacttcagaagttgttcttgttgaaaaaattc 121 tcaagaatcttgaaggggttaaagaggtttcagtaattgtcacaacaaagactgtcattg 181 ttattcatgattctctcctcatttctcagcaacaaattgttaaagcattgaatcaagcaa 241 gattagaagcaagtataagagtgaaaggagagaaaaactaccaaaagaaatggccaagtc 301 catttgcaattggcagtggaatattgcttggactctcatttttgaagtacttttttgcac 361 ctttccaatggttagcacttgcagctgttgcagttgggattcctccaattatttttaggg 421 gtgtggctgccgtgcgaaacctcactcttgacatcaacattcttgttttaatagcagtga 481 cgggatcaattgttttacacgattattgggaagctggtactattgtcttcttattcacca 541 ttgcagaatggctagagtcaagggcaagtcacaaggctactgctgctatgtcatcactgg 601 tcaatatagtccctccaacagcagttttagctgaaagtggagaagtcgtaaatgttgatg 661 aagtcaagttgaatagcattcttgctgttaaagctggtgaaactatacctattgatggag 721 ttgtaatggaaggggaatgtgacgtggacgagaaaacactgacaggcgagtcgtttccag 781 tttctaagcaaatagattcaacggtctgggctggcactacaaatctaaatggctatatca 841 gtgttaagactacggctttggctgaagattgtgcggtggctaggatggcgcagcttgtcg 901 aagatgctcagaacaagaaatcaaaaacccaaagatacattgacaagtgtgctaaatatt 961 atacaccagcaattgtggctatatcagcttctttggcaatagttcctactgcattaagag 1021 ttcacaatcgaaatgagtggtatcgcttggctttggtcacgttggtgagtgcatgtccgt 1081 gtgcacttgtgctatctacaccagttgccatgtgttgtgcactttctaaagcagcaacgt 1141 ccggtcttctgtttaaaggagcagagtaccttgagactcttgctaaaatcaaaatcatgg 1201 cttttgacaaaacagggactataactagaggagaatttatggtgaccgagttcaagtctc 1261 tggttgatggtcttggtctcaatacactgctttactgggtttcaagtattgagagcaagt 1321 caggtcatccgatggcagccgctctggttgactatgcacaatcaaattccgttgagccaa 1381 agcctgatagagttgagcagtttcaaaattttcctggtgaagggatatttggaagaattg 1441 atggaatggaaatctatgtcgggaataggaaaatttcttcaagagctggatgtactacag 1501 taccagaaatagagggtgatagtttccaaggaaagtctgttggatacatatttttgggat 1561 catctcccgctggaattttcggtctttccgatgtttgtcgaattggtgtaaaagaagcaa 1621 tgagagagctgaagcagatgggtatcaaaaccgcgatgcttactggtgattgttatgcag 1681 ctgccaaccatgtgcaggatcagttaggtggagctatggatgaatttcaagcggaactct 1741 taccagaggacaaggcaacaatcatcaagggttttcagaaggaagctccaacagcgatga 1801 taggcgacggccttaatgatgctcctgcattagcaacagctgacattggcatctcaatgg 1861 gcatctctgggtcagctctcgcgaaagaaacaggccatgttatactaatgacaaatgaca 1921 tcggaagaataccaaaagctgcacgtcttgctagaagagttcgaaggaagattgttgaga 1981 atatgattatatcagtcgttacaaaggccgccatagttgcattggcaatagcaggttatc 2041 cattggtttgggctgctgtcctcgcggatactgggacatgcttgctagtgatcttgaaca 2101 gcatgctacttctacgagtaggcacacacagacatgggaaaaaatgttgtagatctgcta 2161 ctccttcgcatgctcccaaccacaaagacaaagcttcttgttgcaagtcggaaaatgctc 2221 cgcagctgtgttgctctgatattgagtcacaaaagaaatgtacgagtcaatcatgctcgt 2281 ccgaggtgtgtgttccaagatgtcaacctgtctcctcgggatcaaagtcatgtggaaata 2341 atcagtgcccagactccgttgaaaatagtggttttcattctcatccccgtcctcaatgct 2401 gctcgtcgaagatggcttctaaagcatgccaatctgcagtttcagaatcaaagtcatgtg 2461 gaaataatcagtgcccagactccgttgaaaatagtggttttcattctcatccccgccctc 2521 aatgctgctcgtctaagatggcttctaaagcatgccaatctgcagtttcagaatcaaagt 2581 catgtggaaataatcagtgcccagactccgttgaaaatagtggttttcattctcatcccc 2641 gtcctcaatgctgctcgttgaagatggcttctaaagcatgccaatctgcagtttcagaat 2701 caaagtcatgtggaaataatcagtgcccagactccgttgaaaatagtggttttcattctc 2761 atccccgtcctcaatgctgctcgtcgaagatggctgctaaagcatgccaatctgcagttt 2821 cagaatcaaagtcatgtggaaataacaattgctcggagtccatttacaagagtagttgtc 2881 attctttaacaagttctctagtatgttcttccaagatgtctgctccacaatgtcattctg 2941 ccacttcaagctccaaatcatgtggaagtaccaagtgctccaacttcagtgacaaaaaat 3001 gttgccaatatgacaaaattcctcaaacgtgctctaccaagaagtctgctccaggatgtc 3061 aatctgcagtttctgggtctaaatcatgtggagatagcaagtgttcagactcgaaagaca 3121 atagtagccatccttcacatcccgatcatcaaatatgcacgtctaagttgtgtgctccac 3181 aaagccaatctgcaacttcaagctccaggacatgtggaaatatgaagtgctcggacacca 3241 atagcaagaattcttgttattcacataccaactctgaatcatgctcttcaaagatgtctg 3301 gtccagcatgcaaaactgctaattcaggttcaaggttatgcggaaataagaagtgcctag 3361 actctgcaaacgagaacagttttcattcacttactaatccactctgtgaggaaaagcttt 3421 tggagaaggaaagcttggatttagcccgaaaagatagggaatcaaatcatgatcttagtc 3481 atggttgctctgacgaggaacatgatcatctaaatttagacaaggcacatgacagttgtg 3541 ccttacaagaatgttgttattctgttcaaggcaataaaactgatgtatcagaaactggaa 3601 tccaggaagctgctcattgtgacagcatcaatcaaacatgccaaactgcaatttcaggat 3661 caatgacatgcggaaataataagagtctggactctctaagcatccatggttgtcattcac 3721 atgatagtccactccacaaggagagcaacttggagcagaaaagcttggatgttgctggag 3781 aaggtataaaatcacctcatgctgtcggtcaaggctgttcggacaaggagcacaatcact 3841 cgcatccagaaaaggcgtatgacagttgtgcaacagacgattgttgtttttcagttcaag 3901 tccatggcattgacgacgtatcaagaagtgaaattcaagaaactgctcattgtgacagca 3961 caaaacagagcacggtcatccccagcagctgcgaacatgaaccaaaagatcaggtaaatc 4021 actgtggatctcactctaaaagtattccaactgatgaagaactagccaagctggttagaa 4081 gatgctgcaaatacaaaccatgccacgatgtccgctctggctgcaggaagcatgctgcag 4141 aatgtggtccaaccgttcgatcaaccatcaatatcttacgggacaaccatcatcatcatc 4201 tagactgcagtggtcgtaaggtttgttcgctgttggagaagagacacattggtggatgct 4261 gtgacagcttcagaaaagaatgttgtgccaagaacaatcaccttggagcaagttttggag 4321 gaggtttatcagaaattgtcatagagtagatgcaatctgaagtgtacatatgttgt

    TABLE-US-00003 TABLE 1 Level of Level of Mutation Cd in % Cd Zn in % Zn denomination leaf reduction leaf reduction Mutation (WO913) (ppm) vs control (ppm) vs control Control E3-277-Wild type 92.3 26.5 92 (mean SD, n = 4) R529* E3-277 - Mutant 7.2 (mean, 92% 62.3 32% homozygous (HMA-DT R342*) n = 2) Control BB16NN (Control) ~560 E387K 276B5 (Hma-B ~160 ~71% homozygous E200K) E387K 276B8 (Hma-B ~250 ~55% homozygous E200K) E387K 276B18 (Hma-B ~250 ~55% homozygous E200K) Control 277S (Wild type) 525.0 R529* 277Htz (HMA-DT 232.6 56% heterozygous R342*) Control 425S (Wild type) 207.0 W265* 425M (Hma-AS 36.1 83% homozygous W78*) Control 90S (Wild type) 77.2 L294F 90M (HMA-AS 25.7 67% homozygous L107F)

    [0316] Summary of Cd and Zn data in single HMA mutants as described in WO2012/041913A1. The denomination of the mutants in WO'913 differs from the mutant denomination herein and the mutants described in Hermand et al., 2014. This is due to the incomplete sequence used in WO'913. In the first column, the corresponding standard denomination is used.

    TABLE-US-00004 TABLE 2 Level of Cd in % Cd % Zn shoots reduction vs Level of reduction vs Mutation (ppm) the control Zn (ppm) the control Control ~135 2300 P294S ~50 63% 2900 0% missense E387K ~70 48% 1700 26% missense W265* ~50 63% 1100 52% nonsense G515R ~70 48% 2000 13% missense R259* ~60 56% 1500 35% nonsense

    [0317] Summary of data reported in FIGS. 4a and 4c of Hermand et al. (2014) Metallomics. 6(8): 1427-1440

    TABLE-US-00005 TABLE 3 Field trial 1 (moderate Cd region): Field data of single mutants Control: Mutant: % Cd Control: Mutant: % Zn Level of Level of reduction Level of Level of reduction Cd in leaf Cd in leaf in mut vs p Zn in leaf Zn in leaf in mut vs p Mutation (ppm) (ppm) ctrl value (ppm) (ppm) ctrl value HMA4.1 0.91 0.1 0.92 0.13 0% 0.9731 19.2 7.4 23.8 6.3 0% 0.9906 W265* HMA4.1 0.87 0.11 1 0.09 0% 1.0000 18.6 6.9 16.6 4.7 11% 0.9983 Q561* HMA4.2 0.85 0.13 0.89 0.12 0% 0.9997 18.9 4.6 17.7 3.7 6% 0.9115 Q293* HMA4.2 0.89 0.07 0.92 0.1 0% 0.9946 24.5 15.8 13.4 3.6 45% 0.1779 E296K HMA4.2 0.87 0.09 0.93 0.15 0% 0.9984 21.9 5.8 14.4 1.6 34% 0.0557 T402I HMA4.2 0.88 0.15 0.93 0.07 0% 0.9984 .sup.16 3.9 15.1 2.8 6% 0.9700 G251D HMA4.2 0.93 0.06 0.93 0.09 0% 0.9995 14.8 2.6 17.3 5.7 0% 0.9840 G382R HMA4.2 0.83 0.11 0.95 0.12 0% 0.9957 17.8 5.4 14.2 2.sup. 20% 0.6459 V351M Cd/Zn values (mean standard deviation) of pooled samples of plots of homozygous single mutants and their null-segregant controls grown in a large scale field experiment. % of Cd/Zn reduction is calculated compared to the control values. The p-value (paired T-test) is calculated for the probability that the mean (mutant line) is by chance <0.8 * mean (control line). For lines with significant >20% Cd/Zn reduction (p < 0.05), the p-values are highlighted in bold. In the field trial, for seven mutation combinations, the respective single mutants, double mutants and control plants were grown in six replicate plots (5 for Q293*/Q561*, 4 for E296/Q561* and 3 for Q293*/W265*). Each replicate unit contains 10 plants of the double mutant, the HMA4 WT control and the two simple mutants, respectively. As the mutations Q293* and Q561* occur in several combinations, the data for these single mutations are based on 8 and 33 plot values respectively. The single mutant plants do not show a biomass (leaf weight) reduction as compared to the control which can be seen in FIG. 6.

    TABLE-US-00006 TABLE 4 Field trial 1 (moderate Cd region): Field data of double mutants Mutation Control: Mutant: % Cd Control: Mutant: % Zn combination Level of Level of reduction Level of Level of reduction (HMA4.1/ Cd in leaf Cd in leaf in mut vs p Zn in leaf Zn in leaf in mut vs p HMA4.2) (ppm) (ppm) ctrl value (ppm) (ppm) ctrl value Q293*/Q561* 0.82 0.15 0.058 0.008 93% 0 18.6 3.sup. 12.9 5.1 31% 0.1204 Q293*/W265* 0.91 0.1 0.069 0.012 92% 0.0013 19.2 7.4 21.6 20 0% 0.6331 E296K/Q561* 0.89 0.07 0.093 0.104 90% 0.0054 24.5 15.8 12.1 4.7 51% 0.0377 T402I/Q561* 0.87 0.09 0.042 0.003 95% 0 21.9 5.8 .sup.10 1.9 54% 0.0043 G251D/Q561* 0.88 0.15 0.59 0.13 33% 0.1029 .sup.16 3.9 .sup.14 2.6 13% 0.9056 G382R/Q561* 0.93 0.06 0.83 0.07 11% 0.9993 14.8 2.6 15.6 4.3 0% 0.9990 V351M/Q561* 0.83 0.11 0.91 0.06 0% 0.9994 17.8 5.4 18.7 5.1 0% 0.9794 Cd/Zn values (mean standard deviation) of pooled samples of plots of homozygous double mutants and their null-segregant controls grown in a large scale field experiment. % of Cd/Zn reduction is calculated compared to the control values. The p-value (paired T-test) is calculated for the probability that the mean (mutant line) is by chance <0.8 * mean (control line). For lines with significant >20% Cd/Zn reduction (p < 0.05), the p-values are highlighted in bold. In the field trial, segregating seed lots of seven mutation combinations are sown and analysed for their genotype. For each mutation combination, four genotype groups are grown in six replicate plots (5 for Q293*/Q561*, 4 for E296/Q561* and 3 for Q293*/W265*). Each replicate unit contains 10 plants of the double mutant, the HMA4 WT control and the two simple mutants, respectively. Phenotypic data (leaf fresh weight) is shown in FIG. 6.

    TABLE-US-00007 TABLE 5 Field trial 2 (moderate Cd region): Field data of double mutants Mutation Control: Mutant: % Cd Control: Mutant: % Zn combination Level of Level of reduction Level of Level of reduction (HMA4.1/ Cd in leaf Cd in leaf in mut vs p Zn in leaf Zn in leaf in mut vs p HMA4.2) (ppm) (ppm) ctrl value (ppm) (ppm) ctrl value Q293*/Q561* 0.61 0.07 0.064 0.021 89% 0 37.4 5.5 13.7 3.6 63% 0.0007 Q293*/W265* 0.49 0.12 0.058 0.005 88% 0.0007 33.5 7.4 13.2 1.7 61% 0.0151 Q464*/Q561* 0.66 0.07 0.043 0.003 94% 0 37.1 7.5 9.4 1.6 75% 0 Q293*/G235E 0.64 0.06 0.04 0 94% 0 33.7 5.9 8.5 1.8 75% 0 E296K/Q561* 0.61 0.12 0.047 0.018 92% 0 33.8 6.9 10.7 2.4 68% 0.0002 T402I/Q561* 0.71 0.14 0.041 0.002 94% 0 39.2 5.3 9.3 0.7 76% 0 G251D/Q561* 0.74 0.13 0.22 0.06 70% 0 34.5 6.7 9.1 1.1 74% 0.0002 Q293*/L223F 0.61 0.11 0.38 0.09 37% 0.0002 36.5 5.6 25.4 3.1 31% 0.0118 Q293*/D234N 0.47 0.03 0.34 0.05 27% 0.1494 30.5 7.1 10.8 0.8 65% 0.0072 A188V/Q561* 0.58 0.06 0.48 0.1 17% 0.5872 36.7 6.5 34.9 7.6 5% 0.9866 G382R/Q561* 0.65 0.12 0.56 0.07 14% 0.8572 36.8 6.4 35.2 5.8 4% 0.9997 Q293*/A369V 0.46 0.04 0.4 0.05 14% 0.9007 33.3 4.3 .sup.32 4.1 4% 0.9929 Q293*/A374V 0.47 0.07 0.43 0.06 9% 0.9645 36.5 7.9 31.9 4.8 12% 0.958 V351M/Q561* 0.66 0.05 0.63 0.06 6% 0.9823 34.1 5.2 32.9 4.7 4% 0.9999 T189I/Q561* 0.69 0.09 0.67 0.11 3% 0.9829 40.8 4.4 45.3 7.2 0% 1 Q293*/S27L 0.58 0.09 0.61 0.06 0% 0.9996 32.8 5.2 34.8 7.7 0% 0.9977 Q293*/A188V 0.48 0.07 0.51 0.08 0% 0.9999 30.6 7.7 29.8 3.4 3% 0.9761 G128E/Q561* 0.71 0.08 0.85 0.15 0% 0.9997 36.4 7.4 31.1 5.2 15% 0.9737 Cd/Zn values (mean standard deviation) of pooled samples of plots of homozygous double mutants and their null-segregant controls grown in a large scale field experiment. % of Cd/Zn reduction is calculated compared to the control values. The p-value (paired T-test) is calculated for the probability that the mean (mutant line) is by chance <0.8 * mean (control line). For lines with significant >20% Cd/Zn reduction (p < 0.05), the p-values are highlighted in bold. In the field trial, for 18 mutation combinations, double mutants and their control plants were grown in six replicate plots (4 for Q293*/W265* and for Q293*/D234N). Each replicate unit contained 20 plants of the double mutant and the HMA4 WT control, respectively. Phenotypic data (leaf dry weight) is shown in FIG. 7.

    TABLE-US-00008 TABLE 6 Field data of field trials 3 and 4: high Cd regions Mutation Control: Mutant: % Cd Control: Mutant: % Zn combination Level of Level of reduction Level of Zn Level of reduction (HMA4.1/ Cd in leaf Cd in leaf in mut vs p in leaf Zn in leaf in mut vs p HMA4.2) (ppm) (ppm) ctrl value (ppm) (ppm) ctrl value Field 3: high Cd region 1 Q293*/Q561* 3.05 0.71 0.61 0.24 80% 0.0003 94.8 15.5 22.9 5.7 76% 0.0000 Q293*/G235E 3.49 0.79 0.58 0.26 84% 0.0003 114.3 19.1 21.8 5.1 81% 0.0000 E296K/Q561* 3.09 0.82 0.4 0.19 87% 0.0001 112.7 22.8 20.1 4.5 82% 0.0000 T402I/Q561* 2.38 0.8 0.47 0.16 80% 0.0009 81.9 9.7 20.8 2.5 75% 0.0001 G251D/Q561* 2.89 0.75 1.56 0.38 46% 0.0014 .sup.107 18.6 25.3 4.6 76% 0.0000 Field 4: high Cd region 2 Q293*/Q561* 2.65 2.52 0.16 0.08 94% 0.0068 32.1 10.7 11.4 1.1 65% 0.0303 Q293*/G235E 3.81 2.88 0.18 0.04 95% 0.0006 .sup.38 8.2 12.3 1.6 68% 0.0018 E296K/Q561* 2.9 2.5 0.13 0.02 96% 0.0009 36.3 8.6 14.5 1.6 60% 0.0052 T402I/Q561* 2.81 1.98 0.27 0.11 90% 0.0001 30.7 9.2 16.4 2.7 47% 0.0439 G251D/Q561* 4.01 1.84 2.27 0.97 43% 0.0056 38.8 10.6 14.2 1.8 63% 0.0107 Cd/Zn values (mean standard deviation) of pooled samples of plots of homozygous double mutants and their null-segregant controls grown in a two field experiments in high cadmium regions. % of Cd/Zn reduction is calculated compared to the control values. The p-value (paired T-test) is calculated for the probability that the mean (mutant line) is by chance <0.8 * mean (control line). For lines with significant >20% Cd/Zn reduction (p < 0.05), the p-values are highlighted in bold. In the field trial, for five mutation combinations, double mutants and their control plants were grown in five replicate plots. Each replicate unit contained 20 plants of the double mutant and the HMA4 WT control, respectively. Only plots with acceptable growth for both mutant and control were analysed (5 plots for most lines, except: in field 3: 4 plots for T402I/Q561*; in field 4: 4 plots for G251D/Q561* and 3 plots for Q293*/Q561*). Phenotypic data (cured leaf weight) is shown in FIG. 8.

    TABLE-US-00009 TABLE 7 Length (amino Amino acid residues acids) Description 1-90 90 Cytoplasmic N-terminal sequence (HMA domain) 91-112 22 Transmembrane domain 1 113-115 3 Extracellular sequence 116-135 20 Transmembrane domain 2 136-142 7 first cytoplasmic loop 143-163 21 Transmembrane domain 3 164-164 1 Extracellular sequence 165-183 21 Transmembrane domain 4 186-311 126 second cytoplasmic loop (A-domain) 312-334 23 Transmembrane domain 5 335-342 8 Extracellular sequence 343-360 18 Transmembrane domain 6 361-653 293 third cytoplasmic loop (P-domain and N-domain) 654-673 20 Transmembrane domain 7 674-677 4 Extracellular sequence 678-697 20 Transmembrane domain 8 698-1403 (HMA4.1)/ 706 (HMA4.1)/ Cytoplasmic C-terminal 1444 (HMA4.2) 747(HMA4.2) sequence

    [0318] The domain structure of HMA4 was deduced from sequence alignments with the Arabidopsis HMA2 and HMA4 proteins and their respective domain annotation by UniProt (AtHMA2: Q9SZW4; AtHMA4: O64474).

    TABLE-US-00010 TABLE 8 Greenhouse data of selected double mutants % Cd % Zn Mutation Level of Cd reduction Level of Zn reduction combination in leaf (ppm) vs control in leaf (ppm) vs control Control 0.66 0.24 32.5 12.1 Q293*/Q561* 0.059 0.015 91% 10.7 3.43 67% E296K/Q561* 0.051 0.003 92% 8.18 2.61 75% T402I/Q561* 0.077 0.016 88% 7.99 1.20 75% G251D/Q561* 0.42 0.12 37% 15.3 13.2 53% G382R/Q561* 0.55 0.13 (17%) 22.5 5.77 31% V351M/Q56* 0.53 0.15 (19%) 19.8 4.60 39% Cd/Zn values (mean standard deviation) of eight plants (six plants for Q293*/A374V) that are homozygous double mutants (mutations indicated as homozygous mutation in HMA4.1/homozygous mutation in HMA4.2) and the null-segregant controls of all double mutants (54 plants total). % of Cd/Zn reduction are calculated compared to the control values. In order to make the table less complex, all 54 control plants are analysed together in the above table and the Cd/Zn values of the double mutant plots are compared with all controls. (T-tests are performed and values in brackets indicate no significant reduction at P < 0.05.) Plants in this experiment are grown in large pots in the greenhouse. Plant morphology and yield analysed after four and eleven weeks of growth in pots are indicated.

    TABLE-US-00011 TABLE 9 Greenhouse data of further selected double mutants % Cd % Zn Mutation Level of Cd reduction Level of Zn reduction Combination in leaf (ppm) vs control in leaf (ppm) vs control Control 0.31 0.09 33.9 4.57 H438Y/W265* 0.13 0.06 58% 12.2 2.4 64% L36F/Q561* 0.38 0.16 0% 28.8 5.34 15% Leaf Cd/Zn values (mean standard deviation of 9 replicate plants for H438Y/W265* and of 6 replicate plants for L36F/Q561*) of two additional combinations of homozygous HMA4 mutants (mutations indicated as homozygous mutation in HMA4.1/homozygous mutation in HMA4.2) and the same number of null-segregant controls for each double mutant. % of Cd/Zn reduction are calculated compared to the control values.

    TABLE-US-00012 TABLE 10 WT Mut. AA SIFT SIFT Mut. SIFT/ Exon change score score WT SIFT HMA4.1- Ex 1 S16R 1 0.022 0.022 HMA4.1- Ex 1 V30I 0.454 0.074 0.164 HMA4.1- Ex 1 L36F 1 0.003 0.003 HMA4.1- Ex 1 E44K 1 0.291 0.291 HMA4.1- Ex 1 T50I 0.277 0.066 0.238 HMA4.1- Ex 2 E78K 1 0.167 0.167 HMA4.1- Ex 2 A98V 1 0.540 0.540 HMA4.1- Ex 2 G128E 1 0.029 0.029 HMA4.1- Ex 2 P130L 0.095 0.281 2.948 HMA4.1- Ex 2 A138V 1 0.184 0.184 HMA4.1- Ex 4/5 A188V 1 0.004 0.004 HMA4.1- Ex 4/5 T189I 1 0.015 0.015 HMA4.1- Ex 4/5 A191T 1 0.093 0.093 HMA4.1- Ex 4/5 V217I 1 0.280 0.280 HMA4.1- Ex 4/5 G251D 1 0 0 HMA4.1- Ex 4/5 A266T 1 0.005 0.005 HMA4.1- Ex 4/5 A287V 0.635 1 1.575 HMA4.1- Ex 4/5 Q293* STOP HMA4.1- Ex 4/5 E296K 1 0 0 HMA4.1- Ex 4/5 C312Y 1 0.348 0.348 HMA4.1- Ex 6 T349I 0.153 0.101 0.658 HMA4.1- Ex 6 V351M 1 0.003 0.003 HMA4.1- Ex 6 S376F 1 0.017 0.017 HMA4.1- Ex 6 G382R 1 0.002 0.002 HMA4.1- Ex 6 T402I 1 0 0 HMA4.1- Ex 6 E407K 1 0.340 0.340 HMA4.1- Ex 7/8 S434N 1 0.018 0.018 HMA4.1- Ex 7/8 G437S 0.161 1 6.219 HMA4.1- Ex 7/8 H438Y 1 0 0 HMA4.1- Ex 7/8 A448T 1 0.003 0.003 HMA4.1- Ex 7/8 Q464* STOP HMA4.1- Ex 7/8 R474K 0.366 1 2.731 HMA4.1- Ex 7/8 M478I 0.243 0.028 0.117 HMA4.1- Ex 7/8 T494I 0.651 0.145 0.222 HMA4.1- Ex 7/8 V496I 1 0.181 0.181 HMA4.1- Ex 7/8 H559Y 1 0.429 0.429 HMA4.2- Ex 1 M7I 0.377 0.359 0.954 HMA4.2- Ex 1 D19N 1 0.008 0.008 HMA4.2- Ex 1 S27L 1 0.018 0.018 HMA4.2- Ex 1 L31F 1 0.028 0.028 HMA4.2- Ex 1 L62F 1 0.033 0.033 HMA4.2- Ex 2 G106E 0.513 0.238 0.465 HMA4.2- Ex 2 L145F 1 0.165 0.165 HMA4.2- Ex 4/5 A188V 1 0.003 0.003 HMA4.2- Ex 4/5 P200L 1 0.005 0.005 HMA4.2- Ex 4/5 S221N 0.545 0.096 0.176 HMA4.2- Ex 4/5 L223F 1 0.019 0.019 HMA4.2- Ex 4/5 A224V 1 0.152 0.152 HMA4.2- Ex 4/5 D234N 1 0 0 HMA4.2- Ex 4/5 G235E 1 0.001 0.001 HMA4.2- Ex 4/5 G251D 1 0 0 HMA4.2- Ex 4/5 W265* STOP HMA4.2- Ex 6 P331T 0.120 0.038 0.318 HMA4.2- Ex 6 P331S 0.120 0.019 0.154 HMA4.2- Ex 6 T349M 0.286 0.021 0.075 HMA4.2- Ex 6 V364V 1 0.089 0.089 HMA4.2- Ex 6 A369V 1 0.001 0.001 HMA4.2- Ex 6 A374V 1 0.008 0.008 HMA4.2- Ex 6 G419D 0.583 1 1.715 HMA4.2- Ex 7/8 S452F 1 0.005 0.005 HMA4.2- Ex 7/8 D476Y 1 0.001 0.001 HMA4.2- Ex 7/8 G506R 1 0.006 0.006 HMA4.2- Ex 7/8 V509F 1 0.057 0.057 HMA4.2- Ex 7/8 G510E 1 0.401 0.401 HMA4.2- Ex 7/8 P518S 0.459 0.187 0.407 HMA4.2- Ex 7/8 A519V 1 0.562 0.562 HMA4.2- Ex 7/8 G523S 1 0.759 0.759 HMA4.2- Ex 7/8 T546I 1 0.061 0.061 HMA4.2- Ex 7/8 Q561* STOP List of identified and validated mutations in HMA4.1 and HMA4.2. Amino acid changes are indicated and the corresponding SIFT scores. Interesting mutations are highlighted in bold (nonsense mutation or missense mutation with SIFT score of the substituted aa <0.05 of the original SIFT score.

    TABLE-US-00013 TABLE 11 Examples of mutation combinations expected to reduce Cd content in leaf Other possible Mutation in Mutation in combinations HMA4.1 HMA4.2 Combination 1 Q464* W265* Combination 2 Q464* L223F Combination 3 Q464* D234N Combination 4 Q464* G235E Combination 5 E296K W265* Combination 6 E296K L223F Combination 7 E296K D234N Combination 8 E296K G235E Combination 9 T402I W265* Combination 10 T402I L223F Combination 11 T402I D234N Combination 12 T402I G235E Combination 13 G251D W265* Combination 14 G251D L223F Combination 15 G251D D234N Combination 16 G251D G235E Combination 17 H438Y Q561* Combination 18 H438Y L223F Combination 19 H438Y D234N Combination 20 H438Y G235E

    TABLE-US-00014 TABLE 12 Examples of mutation combinations expected to reduce Cd content in leaf Other possible Mutation in Mutation in combinations HMA4.2 HMA4.1 Combination 1 Q464* W265* Combination 2 Q464* L223F Combination 3 Q464* D234N Combination 4 Q464* G235E Combination 5 E296K W265* Combination 6 E296K L223F Combination 7 E296K D234N Combination 8 E296K G235E Combination 9 T402I W265* Combination 10 T402I L223F Combination 11 T402I D234N Combination 12 T402I G235E Combination 13 G251D W265* Combination 14 G251D L223F Combination 15 G251D D234N Combination 16 G251D G235E Combination 17 H438Y Q561* Combination 18 H438Y L223F Combination 19 H438Y D234N Combination 20 H438Y G235E