Beta-hexosyl-transferases and uses thereof
10513695 ยท 2019-12-24
Assignee
Inventors
- Jose M. Bruno-Barcena (Raleigh, NC, US)
- Suzanne Dagher (Dearborn, MI, US)
- Maria Azcarate-Peril (Raleigh, NC, US)
Cpc classification
A23L19/00
HUMAN NECESSITIES
A23G9/34
HUMAN NECESSITIES
C12Y302/01023
CHEMISTRY; METALLURGY
C12N9/2402
CHEMISTRY; METALLURGY
A23V2002/00
HUMAN NECESSITIES
International classification
A23L29/00
HUMAN NECESSITIES
A23G9/34
HUMAN NECESSITIES
A23L19/00
HUMAN NECESSITIES
Abstract
This invention relates generally to the discovery of novel recombinant forms of -hexosyl-transferases (BHT) and uses thereof to produce galacto-oligosaccharides (GOS) or as food additives.
Claims
1. An isolated DNA encoding a recombinant -hexosyl-transferase (rBHT) protein having the amino acid sequence set forth in SEQ ID NO: 12, 14, or 20.
2. The isolated DNA encoding the recombinant -hexosyl-transferase (rBHT) protein of claim 1 having the amino acid sequence set forth in SEQ ID NO: 12 or 14.
3. The isolated DNA encoding the recombinant -hexosyl-transferase (rBHT) protein of claim 1, wherein the nucleotide sequence of the DNA has at least 97% sequence identity with the nucleic acid sequence set forth in SEQ ID NO: 11, 13, or 19.
4. The isolated DNA encoding the recombinant -hexosyl-transferase (rBHT) protein of claim 3, wherein the nucleotide sequence of the DNA has at least 97% sequence identity with the nucleic acid sequence set forth in SEQ ID NO: 13 or 15.
5. A method for producing enzymatically active recombinant -hexosyl-transferase (rBHT) protein in a cultured eukaryotic host cell which comprises transforming the eukaryotic host cell with a plasmid under the control of a suitable promotor wherein the plasmid contains an isolated DNA encoding a rBHT protein having the amino acid sequence set forth in SEQ ID NO: 12, 14, or 20 wherein the promoter is operably linked to the isolated DNA, and culturing the transformed cell under conditions such that the rBHT protein is produced, wherein the rBHT protein produced by the transformed cell has 3-hexosyl-transferase enzymatic activity.
6. The method of claim 5, wherein the enzymatically active rBHT protein has a specific activity of 8 U/mg at 20 C.
7. The method of claim 5, wherein the eukaryotic host cell is a yeast cell.
8. An isolated DNA encoding a recombinant -hexosyl-transferase (rBHT) protein wherein the nucleotide sequence of the DNA has at least 99.5% sequence identity with the nucleic acid sequence set forth in SEQ ID NO: 11, 13, or 19 wherein the rBHT protein has -hexosyl-transferase enzymatic activity.
9. The isolated DNA coding for the recombinant -hexosyl-transferase (rBHT) protein of claim 8, wherein the nucleotide sequence of the DNA has at least 99.5% sequence identity with the nucleic acid sequence set forth in SEQ ID NO: 11 or 13.
Description
4. BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
5. DETAILED DESCRIPTION OF THE INVENTION
(11) This invention reports several methods for the expression of the S. singularis BHT including, but not limited to, a method using a codon optimized, synthetic rBht gene (GenBank accession number JF29828) expressed in Pichia pastoris. We investigated the kinetics of GOS production from lactose by the secreted recombinant -hexosyl-transferase (rBHT) as compared to P. pastoris resting cells harboring membrane-bound rBHT.
(12) rBHT proteins, as meant herein, includes full length rBHT proteins and fragments and/or variants thereof, which includes proteins encoded by naturally-occurring allelic variants of the rBHT gene, as well as recombinantly-produced rBHT proteins, which may contain some sequence changes relative to naturally-occurring rBHT proteins.
(13) A recombinant protein is one resulting from the process of genetic engineering. The term genetic engineering refers to a recombinant DNA or nucleic acid method used to create a cell that expresses a gene at elevated levels or at lowered levels, or expresses a mutant form of the gene. In other words, the cell has been transfected, transformed or transduced with a recombinant polynucleotide molecule, and thereby altered so as to cause the cell to alter expression of a desired polypeptide.
(14) galacto-oligosaccharide or GOS means a galactose-containing polysaccharide with two or more sugar units such as Gal-Gal or [Gal].sub.n-Glc (1n8), including -D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Glc, -D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Glc, and -D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Gal(1.fwdarw.4)--D-Glc.
(15) 5.1. Signal Sequences
(16) Soluble secreted proteins and proteins expressed on the cell surface often comprise an N-terminal signal sequence, which is a hydrophobic sequence that mediates insertion of the protein through the membrane bounding the endoplasmic reticulum (ER) in a eukaryotic cell. Type 1 transmembrane proteins also comprise signal sequences. Signal sequences, as meant herein are amino-terminal hydrophobic sequences which are usually enzymatically removed following the insertion of part or all of the protein through the ER membrane into the lumen of the ER. Thus, it is known in the art that a signal sequence can be present as part of a precursor form of a secreted or transmembrane protein, but will generally be absent from the mature form of the protein. When a protein is said to comprise a signal sequence, it is to be understood that, although a precursor form of the protein does contain the signal sequence, a mature form of the protein will likely not contain the signal sequence. Signal sequences may contain a residue adjacent to and immediately upstream from the cleavage site (position 1) and another residue at position 3, which are important for this enzymatic cleavage. Nielsen et al. 1997 Protein Eng 10(1) 1-6; von Heijne 1983 Eur J Biochem 133(1) 7-21; von Heijne 1985 J Mol Biol 184 99-105, the portions of which describe signal sequences and how to identify them are incorporated herein by reference. Signal sequences can be identified as described by Nielsen et al. (supra). Examples of signal peptides or sequences that are functional in mammalian host cells include the following: the Saccharomyces cerevisiae pre-pro-alpha-mating factor signal sequence the signal sequence for interleukin-7 (IL-7) described in U.S. Pat. No. 4,965,195: the signal sequence for interleukin-2 receptor described in Cosman et al. 1984 Nature 312 768-771); the interleukin-4 receptor signal peptide described in EP Patent 0 367 566; the type 1 interleukin-1 receptor signal sequence described in U.S. Pat. No. 4,968,607; the type II interleukin-1 receptor signal peptide described in EP Patent 0 460 846. Many other signal sequences are known in the art.
(17) 5.2. rBHT Protein
(18) The instant invention encompasses secreted, soluble versions of rBHT, as well as versions comprising a transmembrane domain that can be expressed on a cell surface. Such proteins can be isolated, that is, be part of a purified protein preparation in which the rBHT protein constitutes at least 80% or at least 90% of the protein present in the preparation. The invention further includes rBHT proteins encoded by the rBHT nucleic acids described below. An rBHT protein, as meant herein, encompasses a protein comprising the amino acid sequence of SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20, as well as fragments, derivatives, and variants thereof, including fusion proteins. The amino acid sequence of SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20 includes a signal sequence.
(19) 5.3. Conservative Substitutions
(20) In some embodiments the substitutions can be conservative amino acid substitutions. Examples of conservative amino acid substitutions, unlikely to affect biological activity, include the following: alanine for serine, valine for isoleucine, aspartate for glutamate, threonine for serine, alanine for glycine, alanine for threonine, serine for asparagine, alanine for valine, serine for glycine, tyrosine for phenylalanine, alanine for proline, lysine for arginine, aspartate for asparagine, leucine for isoleucine, leucine for valine, alanine for glutamate, aspartate for glycine, and these changes in the reverse. See e.g. Neurath et al., The Proteins, Academic Press, New York (1979), the relevant portions of which are incorporated herein by reference. Further, an exchange of one amino acid within a group for another amino acid within the same group is a conservative substitution, where the groups are the following: (1) alanine, valine, leucine, isoleucine, methionine, norleucine, and phenylalanine: (2) histidine, arginine, lysine, glutamine, and asparagine; (3) aspartate and glutamate; (4) serine, threonine, alanine, tyrosine, phenylalanine, tryptophan, and cysteine; and (5) glycine, proline, and alanine.
(21) 5.4. Glycosylation
(22) rBHT proteins may be glycosylated to varying degrees or not glycosylated. As an illustration, an rBHT protein of the invention may comprise one or more N- or O-linked glycosylation sites in addition to those already found in a protein comprising SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20. One of skill in the art would be aware that asparagine residues that are part of the sequence Asn Xxx Ser/Thr (where Xxx is any amino acid except proline) can serve as sites of addition for N-glycans. In addition, there are many serine and threonine residues that may serve as O-linked glycosylation sites. Glycosylation may increase in vivo half-life or alter biological activity. Variants of rBHT proteins also include proteins comprising one, two, three, four, five, six, seven, eight, nine, or ten more N- and/or O-linked glycosylation sites than are present in SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20 as long as the resulting protein can act as a glycosyl hydrolase and a -hexosyl-transferase. Variant rBHT proteins also include those that have one, two, three, four, or five fewer N- and/or O-linked glycosylation sites than are present in SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20 as long as they can act as a glycosyl hydrolase and a -hexosyl-transferase.
(23) rBHT proteins, as meant herein, can be fusion proteins comprising at least one rBHT polypeptide, which can comprise an amino acid sequence that is a variant and/or a fragment of SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20 (as explained above), and at least one other moiety. The other moiety can also be a non-protein moiety such as, for example, a polyethylene glycol (PEG) moiety or a cytotoxic, cytostatic, luminescent, and/or radioactive moiety. Attachment of PEG has been shown to increase the in vivo half-life of at least some proteins. Moreover, cytotoxic, cytostatic, luminescent, and/or radioactive moieties have been fused to antibodies for diagnostic or therapeutic purposes.
(24) A variety of polypeptides other than rBHT can be fused to an rBHT polypeptide for a variety of purposes such as, for example, to increase in vivo half-life of the protein, to facilitate identification, isolation and/or purification of the protein, to increase the activity of the protein, and to promote oligomerization of the protein.
(25) Many polypeptides can facilitate identification and/or purification of a recombinant fusion protein of which they are a part. Examples include polyarginine, polyhistidine, or HATrM (Clontech), which is a naturally-occurring sequence of non-adjacent histidine residues that possess a high affinity for immobilized metal ions. rBHT proteins comprising these polypeptides can be purified by, for example, affinity chromatography using immobilized nickel or TALON resin (Clontech), which comprises immobilized cobalt tons. See e.g. Knol et al. 1996 J Biol Chem 27(26) 15358-15366. Polypeptides comprising polyarginine allow effective purification by ion exchange chromatography. Other useful polypeptides include, for example, the antigenic identification peptides described in U.S. Pat. No. 5,011,912 and in Hopp et al. 1988 Bio/Technology 6 1204. One such peptide is the FLAG peptide, which is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody, enabling rapid assay and facile purification of expressed recombinant fusion protein. A murine hybridoma designated 4E11 produces a monoclonal antibody that binds the FLAG peptide in the presence of certain divalent metal cations, as described in U.S. Pat. No. 5,011,912. The 4E11 hybridoma cell line has been deposited with the American Type Culture Collection under Accession No. HB 9259. Monoclonal antibodies that bind the FLAG peptide can be used as affinity reagents to recover a polypeptide purification reagent that comprises the FLAG peptide. Other suitable protein tags and affinity reagents are: 1) those described in GST-Bind system (Novagen), which utilizes the affinity of glutathione-S-transferase fusion proteins for immobilized glutathione; 2) those described in the T7-TAG affinity purification kit, which utilizes the affinity of the amino terminal 11 amino acids of the T7 gene 10 protein for a monoclonal antibody; or 3) those described in the STREP-TAG system (Novagen), which utilizes the affinity of an engineered form of streptavidin for a protein tag. Some of the above-mentioned protein tags, as well as others, are described in Sassenfeld 1990 TIBTECH 8: 88-93, Brewer et al., in Purification and Analysis of Recombinant Proteins, pp. 239-266, Seetharam and Sharma (eds.), Marcel Dekker, Inc. (1991), and Brewer and Sassenfeld, in Protein Purification Applications, pp. 91-111, Harris and Angal (eds.), Press, Inc., Oxford England (1990). The portions of these references that describe protein tags are incorporated herein by reference. Further, fusions of two or more of the tags described above, such as, for example, a fusion of a FLAG tag and a polyhistidine tag, can be fused to an rBHT protein of the invention.
(26) 5.5. rBHT Nucleic Acids
(27) The invention encompasses isolated nucleic acids, including, for example DNAs and RNAs, that encode the rBHT proteins described herein, which include proteins comprising the amino acid sequence of SEQ ID NO. 2, 4, 6, 8, 10, 12, 14, 16, 18 or 20 and fragments and/or variants thereof. Preferably, the proteins have the amino acid sequence of SEQ ID NO. 12 or 14. These nucleic acids are useful for, inter alia, producing recombinant proteins having glycosyl hydrolase and a -hexosyl-transferase activity. Such nucleic acids can be modified genomic DNA or cDNA. Preferably, the nucleic acids can comprise an uninterrupted open reading frame encoding an rBHT protein. Nucleic acid molecules of the invention include DNA and RNA in both single-stranded and double-stranded form, as well as the corresponding complementary sequences. An isolated nucleic acid is a nucleic acid that has been separated from adjacent genetic sequences present in the genome of the organism from which the nucleic acid was isolated, in the case of nucleic acids isolated from naturally-occurring sources, in the case of nucleic acids synthesized chemically, such as oligonucleotides, or enzymatically from a template, such as polymerase chain reaction (PCR) products or cDNAs, it is understood that the nucleic acids resulting from such processes are isolated nucleic acids. An isolated nucleic acid molecule refers to a nucleic acid molecule in the form of a separate fragment or as a component of a larger nucleic acid construct.
(28) The present invention also includes nucleic acids comprising the sequence of SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, or a fragment thereof or nucleic acids that hybridize under moderately stringent conditions, and optionally highly stringent conditions, to nucleic acids comprising the nucleotide sequence of SEQ ID NO 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, which is the nucleotide sequence of the full length rBHT cDNA, wherein the nucleic acid encodes a protein that can act as a glycosyl hydrolase and a -hexosyl-transferase. Hybridization techniques are well known in the art and are described by Sambrook, J., E. F. Fritsch, and T. Maniatis (Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and 11, 1989) and Current Protocols in Molecular Biology (F. M. Ausubel et al., eds., John Wiley & Sons, Inc., sections 2.10 and 6.3-6.4 1995), the relevant portions of which are incorporated by reference herein. Moderately stringent conditions for filter hybridizations include hybridization in about 50% formamide, 6SSC at a temperature from about 42 C. to 55 C. and washing at about 60 C. in 0.5SSC, 0.1% SDS. Highly stringent conditions are defined as hybridization conditions as above, but with washing at approximately 68 C. in 0.2SSC, 0.1% SDS. SSPE (1SSPE is 0.15 M NaCl, 10 mM NaH.sub.2PO.sub.4, and 1.26 mM EDTA, pH 7.4) can be substituted for SSC (1SSC is 0.15 M NaCl and 15 mM sodium citrate) in the hybridization and wash buffers; washes, optionally at least two washes, are performed for 15 minutes after hybridization is complete.
(29) It should be understood that the wash temperature and wash salt concentration can be adjusted as necessary to achieve a desired degree of stringency by applying the basic principles that govern hybridization reactions and duplex stability, as known to those skilled in the art and described further below (see e.g., Sambrook et al., supra). When nucleic acids of known sequence are hybridized, the hybrid length can be determined by aligning the sequences of the nucleic acids (for example, using GAP) and identifying the region or regions of optimal sequence complementarity. The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be 5 C. to 10 C. less than the melting temperature (Tm) of the hybrid, where Tm is determined according to the following equations. For hybrids less than 18 base pairs in length, Tm (degrees C.)=2(# of A+T bases)+4(# of G+C bases). For hybrids above 18 base pairs in length, Tm (degrees C.)=81.5+16.6(log.sub.10[Na.sup.+])+0.41 (% G+C)(600 N), where N is the number of bases in the hybrid, and [Na.sup.+] is the concentration of sodium ions in the hybridization buffer. Each such hybridizing nucleic acid has a length that is at least 15 nucleotides (or at least 18 nucleotides, or at least 20, or at least 25, or at least 30, or at least 40, or at least 50, or at least 100. Sambrook et al., supra.
(30) rBHT nucleic acids include nucleic acids comprising the following polynucleotides: (1) all or a fragment of SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, wherein the fragment encodes an rBHT protein that can act as a glycosyl hydrolase and a -hexosyl-transferase; (2) a polynucleotide including nucleotide sequences at least 80%. 85%, 90%. 95%, 97%, 98%, 99%, 99.5%, or 99.7% identical to SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, wherein the alignment window is at least 100, 125, 150, 175, 200, 225, 250, 300, 400, 500, 600, 800, 1000. or 1200 nucleotides long and wherein the sequence encodes an rBHT protein that can act as a glycosyl hydrolase and a -hexosyl-transferase; (3) a polynucleotide that comprises not more than 1, 2, 3, 4, 6. 8, 10, 15, 20, 25, or 30 alteration(s) of a single nucleotide relative to SEQ ID NO. 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, wherein an alteration can be an insertion, deletion or substitution of a single nucleotide, and wherein the polynucleotide encodes an rBHT protein can act as a glycosyl hydrolase and a -hexosyl-transferase; and (4) a polynucleotide that encodes an rBHT protein as described herein, which includes fragments, derivatives and variants of a rBHT protein. In a preferred embodiment, the rBHT protein is produced by replacing the leader sequence with a heterologous secretion signal peptide.
(31) 5.6. Methods of Making rBHT Proteins
(32) rBHT proteins can be made as follows. A nucleic acid that encodes an rBHT protein, as described herein, can be introduced into a vector, which can be introduced into a host cell. Vectors and host cells comprising nucleic acids encoding an rBHT protein are encompassed by the invention. The host cell containing the nucleic acids encoding an rBHT protein can be cultured under conditions such that the rBHT protein can be expressed. The expressed rBHT protein can then be obtained from the medium in which the cells are cultured or from the cells and purified by any of the many appropriate means known in the art. In addition, genetic engineering methods for the production of rBHT proteins include the expression of the polynucleotide molecules in cell free expression systems, in cellular hosts, in tissues, and in animal models, according to known methods.
(33) The vector can include a selectable marker and an origin of replication, for propagation in a host. The vector can further include suitable transcriptional or translational regulatory sequences, such as those derived from mammalian, microbial, viral, or insect genes, operably linked to the nucleic acid encoding the rBHT protein. Examples of such regulatory sequences include transcriptional promoters, operators, or enhancers, mRNA ribosomal binding sites, and appropriate sequences that control transcription and translation. Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA encoding the target protein. Thus, a promoter nucleotide sequence is operably linked to an rBHT nucleic sequence if the promoter nucleotide sequence directs the transcription of the rBHT protein-encoding sequence. If the rBHT protein is a fusion protein, a nucleic acid sequence encoding a portion of the fusion protein, for example, a signal sequence, can be part of a vector, and a nucleic acid encoding an rBHT protein can be inserted into the vector such that a protein comprising the added signal sequence plus the rBHT protein is encoded by the vector.
(34) Suitable host cells for expression of rBHT proteins include prokaryotic cells, yeast cells, plant cells, insect cells, and higher eukaryotic cells. The regulatory sequences in the vector will be chosen such that they are operable in the host cell. Suitable prokaryotic host cells include bacteria of the genera Escherichia, Bacillus, and Salmonella, as well as members of the genera Pseudomonas, Streptomyces, and Staphylococcus. For expression in prokaryotic cells, for example, in E. coli the polynucleotide molecule encoding an rBHT protein preferably includes an N-terminal methionine residue to facilitate expression of the recombinant polypeptide. The N-terminal methionine may optionally be cleaved from the expressed polypeptide. Suitable yeast host cells include cells from genera including Saccharomyces, Pichia, and Kluveromyces. Preferred yeast hosts are S. cerevisiae and P. pastoris. A suitable system for expression in an insect host cell is described, for example, in the review by Luckow and Summers (1988 BioTechnology 6 47-55), the relevant portions of which are incorporated herein by reference. Suitable mammalian host cells include the COS-7 line of monkey kidney cells (Gluzman et al. 1981 Cell 23 175-182), baby hamster kidney (BHK) cells, Chinese hamster ovary (CHO) cells (Puck et al. 1958 PNAS USA 60 1275-1281), CV-1 (Fischer et al. 1970 Int J Cancer 5 21-27), 293 cells from human kidney (American Type Culture Collection (ATCC) catalog no. CRL-10852), and human cervical carcinoma cells (HELA) (ATCC CCL 2). The relevant portions of the references referred to in this paragraph are incorporated herein by reference.
(35) Expression vectors for use in cellular hosts generally comprise one or more phenotypic selectable marker genes. Such genes encode, for example, a protein that confers antibiotic resistance or that supplies an auxotrophic requirement. A wide variety of such vectors are readily available from commercial sources. Examples include pGEM vectors (Promega), pSPORT vectors, and pPROEX vectors (InVitrogen, Life Technologies, Carlsbad, Calif.), Bluescript vectors (Stratagene), and pQE vectors (Qiagen). Yeast vectors will often contain an origin of replication sequence from a yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene. Vectors replicable in both yeast and E. coli (termed shuttle vectors) may also be used. In addition to the above-mentioned features of yeast vectors, a shuttle vector will also include sequences for replication and selection in E. coli. Direct secretion of the target polypeptides expressed in yeast hosts may be accomplished by the inclusion of nucleotide sequence encoding the yeast a-factor leader sequence at the 5 end of the rBHT-encoding nucleotide sequence. Brake 1989 Biotechnology 13 269-280.
(36) Examples of suitable expression vectors for use in mammalian host cells include pcD A3.1/Hygro (Invitrogen), pDC409 (McMahan et al. 1991 EMBO J 10: 2821-2832), and pSVL (Pharmacia Biotech). Expression vectors for use in mammalian host cells can include transcriptional and translational control sequences derived from viral genomes.
(37) Commonly used promoter sequences and enhancer sequences that can be used to express rBHT RNA include, but are not limited to, those derived from human cytomegalovirus (CMV). Adenovirus 2, Polyomavirus, and Simian virus 40 (SV40). Methods for the construction of mammalian expression vectors are disclosed, for example, in Okayama and Berg (1982 Mol Cell Biol 2: 161-170), Cosman et al. (1986 Mol Immunol 23:935-941), Cosman et al. (1984 Nature 312: 768-771), EP-A-0367566, and WO 91/18982. The relevant portions of these references are incorporated herein by reference.
(38) 5.7. Purification Tags
(39) In addition to the 6HIS tag described herein a variety of purification methods may be used such as affinity tags, such as antigenic tags (e.g., FLAG (Sigma-Aldrich, Hopp et al. 1988 Nat Biotech 6:1204-1210), hemagluttanin (HA) (Wilson et al., 1984 Cell 37:767), Intein fusion expression systems (New England Biolabs, USA) Chong et al. 1997 Gene 192(2), 271-281, or maltose-binding protein (MBP)), glutathione S transferase (GST)/glutathione, poly His/Ni or Co (Gentz et al., 1989 PNAS USA 86:821-824). Fusion proteins containing GST-tags at the N-terminus of the protein are also described in U.S. Pat. No. 5,654,176 (Smith). Magnetic separation techniques may also be used such as Strepavidin-DynaBeads (Life Technologies, USA). Alternatively, photo-cleavable linkers may be used, e.g., U.S. Pat. No. 7,595,198 (Olejnik & Rothchild). Many other systems are known in the art and are suitable for use with the present invention.
(40) 5.8. Methods of Making Galacto-Oligosaccharides (GOS)
(41) In one embodiment of the invention, the galacto-oligosaccharides (GOS) are produced by incubating the cell expressing the rBHT in a medium that comprises a disaccharide substrate such as for example lactose or cellobiose. In one embodiment, the GOS is produced from lactose simultaneously with a glucose removal system. The glucose removal system may be a generally recognized as safe (GRAS) organism.
(42) 5.9. Formulations
(43) Another aspect of the invention concerns use of the rBHT protein or cells expressing rBHT to produce a foodstuff or a dietary supplement containing galacto-oligosaccharides (GOS). The foodstuff may be diary foodstuff such as yogurt, cheese or fermented dairy products. The rBHT or cell expressing rBHT may be part added to the foodstuff or dietary supplements. The rBHT may be dried using Spray Dry; a quick and gentle method of obtaining even the smallest quantities of temperature sensitive substances in powder form. The dried rBHT also may be encapsulated form using the Spray dryer's ability to coat particles, immobilize solid material in a matrix and manufacture microcapsules (www.buchi.com/Mini_Spray_Dryer_B-290.179.0 DOT html). Other drug delivery applications using functional GRAS encapsulating agents and technologies may be used. The dried rBHT tablet and powder forms may be analysed for rBHT rate of activity once rehydrated in buffer containing lactose and in milk products.
(44) Examples of the foodstuffs include, but are not limited to, infant formula, dairy products, beverages, and dietary supplements. See Table 2 below.
(45) TABLE-US-00002 TABLE 2 Food group Food group category Infant formulas for term Infant formula infants and baby foods Infant meal replacement drinks Baby juice Baby yoghurt drinks Baby dessert Baby snack Dairy products Yoghurt Frozen dairy desserts Milk beverages Milk Milk drinks Syrup flavoring for milk Meal replacement drinks Milk substitutes Fruit drinks and Fruit drinks (vitamin/mineral water quenchers fortified) and energy drinks Fitness waters and thirst quenchers Fruit preparations Fruit pie filling Fruit prep Jelly jam
(46) Any of the above-described rBHT proteins may be delivered in the form of a composition, that is, with one or more additional components such as a physiologically acceptable carrier, excipient, or diluent. For example, a composition may comprise a soluble rBHT protein as described herein plus a buffer, an antioxidant such as ascorbic acid, a low molecular weight polypeptide (such as those having less than 10 amino acids), a protein, amino acids, carbohydrates such as glucose, sucrose, or dextrin, chelating agent such as EDTA, glutathione, and/or other stabilizers, excipients, and/or preservatives. The composition may be formulated as a liquid or a freeze-dried powder. Further examples of components that may be employed in pharmaceutical formulations are presented in Remington's Pharmaceutical Sciences, 16.sup.th Ed., Mack Publishing Company, Easton, Pa., (1980), the relevant portions of which are incorporated herein by reference.
(47) Compositions comprising therapeutic molecules described above can be administered by any appropriate means including, but not limited to, parenteral, topical, oral, nasal, vaginal, rectal, or pulmonary (by inhalation) administration. If injected, the composition(s) can be administered intra-articularly, intravenously, intraarterially, intramuscularly, intraperitoneally or subcutaneously by bolus injection or continuous infusion. Localized administration, that is, at the site of disease, is contemplated, as are transdermal delivery and sustained release from implants, skin patches, or suppositories. Delivery by inhalation includes, for example, nasal or oral inhalation, use of a nebulizer, inhalation in aerosol form, and the like. Administration via a suppository inserted into a body cavity can be accomplished, for example, by inserting a solid form of the composition in a chosen body cavity and allowing it to dissolve. Other alternatives include eye drops, oral preparations such as pills, lozenges, syrups, and chewing gum, and topical preparations such as lotions, gels, sprays, and ointments. In most cases, therapeutic molecules that are polypeptides can be administered topically or by injection or inhalation.
(48) The therapeutic molecules described above can be administered at any dosage, frequency, and duration that can be effective to treat the condition being treated. The dosage depends on the molecular nature of the therapeutic molecule and the nature of the disorder being treated. Treatment may be continued as long as necessary to achieve the desired results. The periodicity of treatment may or may not be constant throughout the duration of the treatment. For example, treatment may initially occur at weekly intervals and later occur every other week. Treatments having durations of days, weeks, months, or years are encompassed by the invention. Treatment may be discontinued and then restarted.
(49) Maintenance doses may be administered after an initial treatment. Dosage may be measured as milligrams per kilogram of body weight (mg/kg) or as milligrams per square meter of skin surface (mg/m.sup.2) or as a fixed dose, irrespective of height or weight. These are standard dosage units in the art. A person's skin surface area is calculated from her height and weight using a standard formula. For example, a therapeutic rBHT protein can be administered at a dose of from about 0.05 mg kg to about 10 mg/kg or from about 0.1 mg/kg to about 1.0 mg kg. Alternatively, a dose of from about 1 mg to about 500 mg can be administered. Or a dose of about 5 mg, 10 mg. 15 mg 20 mg, 25 mg, 30 mg. 35 mg, 40, mg, 45, mg, 50 mg, 55 mg, 60 mg, 100 mg, 200 mg, or 300 mg can be administered.
(50) The article a and an are used herein to refer to one or more than one (i.e., to at least one) of the grammatical objects of the article. By way of example, an element means one or more elements.
(51) Throughout the specification the word comprising, or variations such as comprises or comprising, will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps. The present invention may suitably comprise, consist of, or consist essentially of, the steps, elements, and/or reagents described in the claims.
(52) The following Examples further illustrate the invention and are not intended to limit the scope of the invention.
6. EXAMPLES
(53) 6.1. Materials and Methods
(54) Design of a Codon Optimized -Hexosyl-Transferase Gene.
(55) The DNA coding sequence for the S. singularis -hexosyl-transferase gene (16) (GenBank accession number AB 126324; 1,782 bp) was assembled by joining exons using Clone Manager software (Cary, N.C.). The coding sequence was redesigned based on P. pastoris and E. coli preferred codons, optimized for minimum free energy (619.9), specific restriction sites (5 NcoI and 3 NotI), and GC content (48.89%). This redesigned version of the gene was labeled rBht (GenBank accession number JF29828), synthesized and inserted into pGS21a and pUC57 to generate pJB100 and pJB107, respectively (Table 1). The DNA sequence of rBht was confirmed (GenScript, Piscataway, N.J.).
(56) Construction of Plasmids Containing rBht for Expression in E. coli.
(57) Cloning procedures were carried out as previously described (32). E. coli strains used for cloning and expression of rBHT are listed in Table 3. Restriction endonucleases and T4 DNA ligase were obtained from New England Biolabs (Beverly, Mass.). The plasmids pJB100 and pJB107 were digested with NcoI and NotI, and the fragment containing the rBht gene was inserted into Novagen plasmids to generate the expression plasmids pJB101, pJB103, pJB104, pJB105, and pJB106 (see Table 3 for a description of the constructions).
(58) Expression of rBHT Fusion Constructions in E. coli BLR.
(59) The expression was carried out as described in the pET system manual TB055 8th Edition 02/99 (Novagen). Briefly, the expression plasmids were transformed into E. coli BLR and after IPTG induction screened for rBHT activity. In vivo rBHT activity was assessed by incubating IPTG induced BLR cells in 50 mM sodium phosphate buffer at pH 4 and pH 6, and 50 g.Math.ml.sup.1 cell penetrating chromogenic substrate X-GAL (Table 4). Cultures were incubated overnight at 37 C. for visualization of the appearance of color. BL21 cells containing endogenous -galactosidase activity were used as the positive control.
(60) Production of Anti-rBHT.
(61) Anti-rBHT antiserum was produced using rBHT-6HIS expressed and purified from E. coli BLR cells harboring pJB101. Purification of rBHT-6HIS present in the cell free extract fraction was performed by using nickel agarose gel chromatography according to the manufacturer's instructions (QIAGEN, Germany) and then further purified by electro-elution from gels according to manufacturer's instructions (Bio-Rad, Richmond, Calif.). The pure protein was used for rabbit immunization (Cocalico Biologics Reamstown, Pa.). Additional antibodies used in the study are listed in Table 4.
(62) Electrophoresis and Immunoblotting.
(63) Sodium dodecyl sulfate polyacrylaminde gel electrophoresis (SDS-PAGE-4-12%) was routinely carried out in the Laemmli system (23). Proteins were visualized by Coomassie blue (Bio-Rad, Richmond, Calif.) or silver staining (Bio-Rad, Richmond, Calif.). SeeBlue plus (Invitrogen, Carlsbad, Calif.) was used as a molecular mass marker. Immunoblot analysis on duplicate PAGE gels was carried out as previously described (7) except detection was performed using alkaline phosphatase conjugated goat anti-rabbit or goat anti-mouse antibodies (Rockland Immunochemicals, Gilbertsville, Pa.) and visualized using NBT (nitro-blue tetrazolium chloride) and BCIP (5-bromo-4-chloro-3-indolyphosphate p-toluidine salt) premixed solution (Sigma-Aldrich, St. Louis, Mo.).
(64) Construction of P. pastoris Recombinant Strain.
(65) The rBht gene was PCR amplified from pJB107 using primers JBB1 and JBB2 to add XhoI and NotI restriction sites in frame with Saccharomyces cerevisiae pre-pro-alpha-mating factor signal sequence contained in pPIC9, followed by a 6HIS tag, and a modified TEV protease cleavage site (Table 2). The PCR product was ligated into pPIC9 XhoI and Nod restriction sites to generate pJB108 (Table 3). Correct in-frame ligation was confirmed by sequencing (Sequatech, Mountain View, Calif.) using primers 5 AOX1 and 3 AOX1 (Table 4).
(66) P. pastoris GS115 (Table 1) was electro-transformed with pJB108 linearized with Sacl (Invitrogen's Pichia expression kit manual, version M) using a Bio-Rad Gene Pulser (Bio-Rad, Richmond, Calif.). Recombinants were selected on histidine deficient Regeneration Dextrose (RDB-agar plates) at 30 C. His' colonies were randomly selected, and the genomic integration of the expression cassette was verified by PCR using primers 5 AOX1, 3 AOX1, and -Factor (Table 4). The methanol utilization (mu.sup.+) phenotype of recombinant GS115/rBht was determined according to the procedure outlined in Invitrogen's Pichia expression kit manual, version M.
(67) rBHT Production in P. pastoris.
(68) To select a high-level producer of the recombinant rBHT, six His.sup.+ isolates were grown in yeast extract peptone dextrose medium (YPD) at 30 C. and 250 rpm for 12 h and then used to inoculate 100 ml buffered glycerol complex medium (BMGY) to an initial OD.sub.600=0.1. When the culture exceeded an OD.sub.600=10, methanol was added to a final concentration of 0.5% at 24 h intervals until the culture exceeded an OD.sub.600=50 after which methanol was added every 12 h. Media samples were analyzed for presence of BHT activity and by Western blot using rabbit anti-rBHT every 24 h to determine the optimal harvest time. The selected GS115/rBht recombinant was routinely grown in 0.5 L BMGY and induced with methanol for 6 days.
(69) Purification of Secreted rBHT.
(70) Culture supernatants (500 ml) were fractionated with ammonium sulfate. Precipitates between 60%-80% ammonium sulfate were resuspended in 50 mM sodium phosphate buffer (pH 6). After desalting and concentrating with an Amicon MWCO 15 membrane (Amicon Inc., Beverly, Mass.) the solution was applied to a 1/30 (5 ml) Mono Q pre-equilibrated column (Quarternary amino ethyl) (Amersham Biosciences). The column was then washed with 50 ml of buffer and eluted with 3 column volumes of a linear gradient of sodium chloride from 0 to 0.2 M in 50 mM sodium phosphate buffer (pH 6.0) at a flow rate of 1 ml.Math.min.sup.1. The eluate was collected in 1 ml portions. The active fractions were pooled, concentrated and resuspended in 10 mM sodium phosphate (pH 6.8), then applied to a Bio-Gel HT hydroxyapatite column (Bio-Rad, Richmond, Calif.) (1/10 2 ml) pre-equilibrated with the same buffer, washed with 10 mM sodium phosphate (pH 6.8), and eluted with 50 mM sodium phosphate (pH 6.8). The fractions with the highest specific activity contained pure rBHT with specific activity of 8.2 U.Math.mg.sup.1. Enzymatic activity was assayed (described below) on all chromatography fractions and purification steps were carried out at 25 C.
(71) Determination of Molecular Mass.
(72) Culture medium concentrated 20 fold by ultrafiltration (0.5 ml) was applied to a size exclusion column Superdex 200 (Amersham Biosciences) 1/30 (18 ml) pre-equilibrated with 50 mM sodium phosphate buffer, pH 6.0, 0.1 M NaCl. Fractions of 0.5 ml were collected at a flow rate of 0.5 ml.Math.min.sup.1 and assayed for rBHT activity using ONP-Glu as the substrate and by zymogram as described below. Elution of rBHT and molecular mass standards were monitored at 280 nm. The column was calibrated using the following molecules: Thyroglobulin, 669 kDa; Ferritin, 440 kDa; Catalase, 232 kDa; Lactate dehydrogenase, 140 kDa; Bovine Serum Albumin; 67 kDa (GE, Healthcare). The molecular mass of rBHT was extrapolated from a calibration plot of log molecular mass (Y axis) versus elution volume (X axis). All chromatographic steps were carried out at 25 C.
(73) Enzymatic Activity Assays.
(74) The initial reaction rate of rBHT was measured by a modification of the Kuby's method (13,22) under the established conditions. Briefly the reactions were performed in a volume of 250 l containing 1.3 mM ONP-Glu and 50 mM sodium phosphate buffer (pH 5). The assays were carried out for 10 min under the established conditions and stopped by adding 1 volume of 0.25 M Na.sub.2CO.sub.3. The reaction mixture containing boiled rBHT and substrate served as negative control. Assays were always performed in duplicate with a reliability of 5%. Samples of cell-free broth, and protein concentrates were obtained as described above. Resting cells (harboring membrane-bound rBHT) prewashed with 50 mM sodium phosphate buffer (pH 5.0) were assayed, under established conditions. When X-GAL was the substrate of the reaction the concentration was 50 g.Math.ml.sup.1 in 50 mM sodium phosphate buffer (pH 4).
(75) One unit (U) of enzyme activity equals 1 mol of o-nitrophenol released per min under the assay conditions. Specific activity is defined as Units/mg protein. Molar extinction coefficients of o-nitrophenol were: =0.033 mM.sup.1cm.sup.1, pH 4; =0.036 mM.sup.1cm.sup.1, pH 5; =0.038 mM.sup.1cm.sup.1, pH 6. The amount of o-nitrophenol released was extrapolated from a calibration plot of the o-nitrophenol absorbance at 405 nm (Y axis) versus o-nitrophenol concentration (X axis).
(76) Enzymatic activities were also visualized by zymograms. Native PAGE were performed using a modification of the protocol described by Gallagher (8). Proteins from E. coli lysates or P. pastoris supernatants were solubilized in 5% (w/v) sucrose/10 g.Math.ml.sup.1 Bromophenol blue and separated in 6% native polyacrylamide gels, utilizing as running buffer 50 mM sodium phosphate buffer (pH 6). The gel was kept cool in a Mighty Small Hoefer electrophoresis apparatus where cold water was re-circulated during electrophoresis at 60 mA for 5 h. After electrophoresis, the gel was rinsed twice in wash buffer (50 mM sodium phosphate buffer, pH 4.0) for 10 min. The zymograms were developed for 24 h by laying filter paper soaked in wash buffer containing 50 g.Math.ml.sup.1 X-GAL at 20 C. A blue precipitate defined the location of the enzyme.
(77) Enzyme Kinetics.
(78) Series of enzyme dilutions ranging from 0 to 1.2 U.Math.ml.sup.1 were assayed in 50 mM sodium phosphate (pH 5) at 42 C. The enzymatic activity assay was initiated by adding 1.3 mM ONP-Glu and the absorbance monitored at 405 nm for 1 min intervals for a total of 20 min. The experimental absorbance values were plotted against time showing linear proportionality up to 0.6 U.Math.ml.sup.1 for at least 20 min while at enzyme concentrations above 1.0 U.Math.ml.sup.1 the absorbance values plateau prior to 5 min.
(79) The Michaelis-Menten constants (k.sub.m and V.sub.max) of 0.2 U.Math.ml.sup.1 rBHT (at 42 C.) were determined by varying ONP-Glu from 0 to 10.4 mM in 50 mM sodium phosphate (pH 5) and measuring the initial reaction rate at 20 C., 30 C., 40 C., and 50 C. The kinetic constants at each temperature were determined with OriginPro 7.5 using nonlinear regression of the Hill equation with a Hill coefficient of 1. The values obtained under the established conditions were as follows (T, k.sub.m, V.sub.max): (20 C., 0.37 mM, 0.09 mM.Math.min.sup.1), (30 C., 0.48 mM, 0.12 mM.Math.min.sup.1), (40 C., 0.71 mM, 0.23 mM.Math.min.sup.1) and (50 C., 1.3 mM, 0.42 mM.Math.min.sup.1). The fitting coefficients of regression (R.sup.2) were 0.9869, 0.99065, 0.99115 and 0.98996 at 20 C., 30 C., 40 C. and 50 C., respectively.
(80) Characterization of rBHT.
(81) Enzymatic activity assays were performed under the established conditions described above. The influence of pH on enzyme activity was tested in buffer solutions including 50 mM sodium phosphate (pH 5.0 to 11.0), 50 mM citrate (pH 2.0 to 5.0) and 50 mM phosphate-citrate (pH 2 to 11) (
(82) GOS Production and Analysis.
(83) The standard transgalactosylation reactions, utilizing either purified rBHT or P. pastoris resting cells (harboring membrane-bound enzyme), were initiated by adding standardized amounts of enzyme (0.5 Ug.sup.1 lactose) in 5 mM sodium phosphate buffer (pH 5.0) containing lactose (22 gL.sup.1 or 200 gL.sup.1) at 30 C. or 42 C.
(84) Products and substrates of the reactions were analyzed by high-performance liquid chromatography (HPLC) (Shimadzu Corporation, Kyoto, Japan) under isocratic conditions at 65 C. and at 0.4 ml.Math.min.sup.1 flow rate. The mobile phase was 5 mM sulfuric acid (H.sub.2SO.sub.4) using an Alltech IOA-1000 organic acids column (300 mm by 7.8 mm) (Alltech, IL) coupled to a refractive-index detector. The column was calibrated using; galactosyl-lactose (Carbosynth (Berkshire, UK)), lactose, glucose, and galactose (Sigma-Aldrich, St. Louis, Mo.). The residual non-quantified GOS species (tetrasaccharide and pentasaccharide) are reported as signal intensity readings from the refractive-index detector.
(85) 6.2. Results
(86) Expression of a Recombinant -Hexosyl-Transferase (rBHT) in E. coli.
(87) E. coli BL21 is the most widely used host for heterologous protein production. Unfortunately, this host strain contains an active endogenous -galactosidase that interferes with the evaluation of the -hexosyl-transferase, designated as rBHT (see materials and methods). After screening different E. coli strains appropriate for pET-based expression systems including BL21, BLR, NovaBlue, Origami, and Rosetta (Table 3), E. coli BLR was confirmed as lacking of endogenous -galactosidase activity. E. coli CC 118 (AlacZ) strain was used as a control (36).
(88) The rBht gene was inserted into pET expression plasmids containing a C-terminal 6HIS or one of the four solubility-enhancing co-expression partners (glutathione-S-transferase (GST), thioredoxin (Trx), the PelB leader, and DsbA) resulting in pJB101, pJB103, pJB104, pJB105, and pJB106 (Table 3). Transformation into E. coli BLR and induction with IPTG resulted in expression of inactive rBHT either in whole cells or in cell free extracts. Immunoblotting analysis of the fusion proteins with rBHT-antiserum detected all rBHT fusion proteins at their predicted molecular masses, with the strongest reactivity observed in the insoluble fractions. To rule out possible host-dependent protein insolubility, rBHT expression was analyzed in E. coli CC 118 harboring pJB102 (pJB101 with its T7 promoter replaced with a tetracycline (TET) inducible promoter) but also proved to be unsuccessful (data not shown).
(89) Expression and Purification of rBHT from P. pastoris.
(90) P. pastoris is able to introduce post-translational modifications and is well known for its ability to produce a number of active recombinant proteins (where E. coli fails) (14). Thus, we inserted the codon optimized rBht gene into pPIC9 under the control of the alcohol oxidase promoter (AOX1), in frame with the S. cerevisiae -factor signal (sequence for protein secretion) and an N-terminal 6HIS followed by a TEV protease cleavage site (pJB108, Table 3). P. pastoris GS115 was transformed with pJB108 (GS115/rBht) and the activity of rBHT was evaluated in six GS115/rBht recombinants. The recombinant strain secreting the highest concentration of bioactive protein was studied further. Zymograms confirmed the presence of an active rBHT: only GS115/rBht gave a positive signal, while cell extracts from E. coli BLR harboring pJB101 and culture supernatants from untransformed GS115 were negative (
(91) Purification of rBHT was attempted using nickel affinity chromatography, but the HIS-tag was not present, nor was the protein detected by Western blot analysis using anti-HIS antiserum, indicating possible processing of the N-terminal signal sequence at predicted cleavage sites (16). Subsequently, the rBHT enzyme was purified (specific activity of 8.2 U.Math.mg.sup.1 at 20 C.) using Mono Q and hydroxyapatite chromatography (Table 5).
(92) 6.3. Characterization of rBHT Expressed in P. pastoris.
(93) 1. Apparent Molecular Mass of rBHT.
(94) The estimated molecular mass for a non-glycosylated fully processed rBHT that included the 6HIS and TEV protease site tag was 68 kDa. The enzyme has been previously purified as a dimer as well as a monomer with apparent molecular mass ranging from 53 to 146 kDa data that reflects variations in protein glycosylation (Table 5) (1,16). Here, the enzyme activity eluted as one monomeric peak with an experimental apparent molecular mass of 110 kDa. We surmised that the dimeric form may predominate within the acidic range of the native enzyme's pH optimum (3.7 to 6) (Table 5). However, fractions from the Superdex 200 column at pH 4.0 depicted the same profile, confirming the stable monomeric form of the recombinant enzyme. No higher molecular mass aggregates were detected by enzyme activity assay, zymogram, or Western blot. Purification of the column fractions and immunoblot analysis using anti-rBHT verified that the enzyme migrated as a single band with an apparent molecular mass of 110 kDa (
(95) 2. Substrate Specificity.
(96) ONP-Gal has traditionally been used as substrate for -galactosidases and ONP-Gal, PNP-Gal and PNP-Glu have all been used in previous studies for detection of native BHT activity (Table 5). The enzyme activities of rBHT (0.2 U.Math.ml.sup.1) were compared between the above substrates at the same experimental conditions. The recombinant enzyme was equally active in response to ONP-Glu and PNP-Glu. The substrates with a galactose in the glycon moiety were hydrolyzed at a rate of approximately 41% (ONP-Gal) and 23% (PNP-Gal) of that for ONP-Glu. These results indicate that rBHT has a narrow specificity with respect to the sugar and more flexibility toward configuration of the carbon linkage position at C2 and C4 when glucose sugar derivatives are used as substrates.
(97) 3. Optimum pH, Temperature and Thermostability of rBHT.
(98) rBHT was active within a broad pH range (from pH 3.5 to 6) displaying the highest values at pH 4.0 (
(99) The initial reaction rate measured at different temperatures ranging from 20 C. to 80 C. indicated that the enzyme was active over a temperature range from 20 C. to 50 C. with the optimum occurring between 40 C. and 50 C. (
(100) As shown in
(101) 4. Effect of Metals, Salts, Surfactants, and Solvents on rBHT Activity.
(102) Enzyme inhibition/activation was tested within a broad range of additives. rBHT did not exhibit a requirement for any of the ions tested (NH.sub.4.sup.+, Ba.sup.2+, Ca.sup.2, Cs.sup.+, Co.sup.2+, Cu.sup.2+, Li.sup.+, Rb.sup.+, Mg.sup.2+, Ni.sup.2+, Na.sup.+ and Zn.sup.2+) even though magnesium dramatically increases the enzyme activity of some -galactosidases (26). Moreover, the recombinant enzyme was fully active in the presence of 1 and 5 mM of the ion-chelating agent EDTA, confirming the above findings and a previous report (1). Additionally, compounds proven to disrupt disulfide bridges, such as Cu.sup.2+ and the reducing agents dithiothreitol (DTT) and 2-mercaptoethanol (2ME) (1,18,19), had no negative consequences on the activity. The solvents methanol, ethanol, acetone and acetonitrile only partially inhibit the enzyme (retaining 66%-81% relative activity). In contrast, the addition of 10% glycerol or 1% of SDS (a non-ionic surfactant) almost completely inhibited the enzyme.
(103) GOS Synthesis Using Purified rBHT.
(104) Once the enzyme was characterized, the secreted rBHT was tested for biotransformation of 2% lactose into GOS. The conditions of the reaction were 0.5 U rBHT.g.sup.1 of lactose at 42 C. in 5 mM sodium phosphate buffer (pH 5.0).
(105) GOS Synthesis by P. pastoris Resting Cells (Harboring Membrane-Bound rBHT).
(106) To avoid competitive inhibition and confirm that conversion of lactose into GOS could be improved upon if glucose is simultaneously eliminated from the reaction mixture, we evaluated the biotransformation of 20% lactose by resting cells of P. pastoris GS115/rBht. P. pastoris GS115/rBht harboring membrane-bound rBHT were normalized to a cell density containing 0.5 U rBHT.g.sup.1 of lactose in 5 mM sodium phosphate buffer (pH 5). Reactions were conducted for 10 days at 30 C., the optimal temperature for growth of P. pastoris, and at 42 C., the temperature for which the initial reaction rate is at its maximum for the secreted rBHT. As expected, 90% of the initial lactose was converted into GOS with no secondary products at 30 C., as compared to 51% lactose utilization at 42 C. The results indicated that resting cells were physiologically active and able to consume the glucose byproduct of the reaction, thereby avoiding competitive inhibition. However, the initial reaction rate of GOS formation at 42 C. was double the rate at 30 C. during the first 48 h. A final concentration of 80 g.Math.L.sup.1 galactosyl-lactose was reached, corresponding to a productivity of 1.6 g.Math.L.sup.1.Math.h.sup.1 at 42 C. (
(107) 6.4. Discussion
(108) In this study we optimized the DNA sequence of the -hexosyl-transferase gene from S. singularis (acc. number AB 126324) for expression in E. coli and P. pastoris. The resulting rBht gene was synthetically generated (acc. number JF29828) and expressed in E. coli. However, this bacterial host lacked the ability to incorporate post-translational modifications essential for producing a soluble and active rBHT as previously observed (16). Subsequently, the rBht gene under the control of the AOX1 promoter was successfully integrated into the P. pastoris chromosome, resulting in the expression of a fully active enzyme that was detected in the culture broth as well as associated with the cell surface. Secretion of rBHT by P. pastoris GS115 allowed us to avoid the complex purification processes that are required to obtain pure BHT from S. singularis. Furthermore, since P. pastoris naturally secretes only very low levels of native proteins, recovery of the extracellular rBHT was as simple as removal of whole cells from the medium by centrifugation or filtration (5).
(109) The molecular mass of the recombinant enzyme corresponded to a single 110 kDa catalytically active polypeptide and no smaller polypeptides or rBHT aggregates were detected. Posttranslational modifications play a critical role in protein folding, structural stability, oligomer formation and substrate recognition (17,24), so it was not surprising that the molecular mass was higher than the 68 kDa protein expressed in E. coli and predicted by the amino acid sequence. Posttranslational glycosylation of the native BHT by S. singularis has been previously reported, and a shift in the molecular mass of the purified protein from 73.9 to 66.3 kDa was observed after treatment with chitinase and EndoHf (16). Future mutagenesis of the predicted glycosylation sites should aid in determining whether glycosylation is also the cause for the shift in rBHT molecular mass.
(110) The data reported here are part of a larger study that compared the utilization of rBHT to documented data for the native S. singularis BHT (Table 5). Our study confirmed that the recombinant enzyme does not require cofactors or reducing agents often essential for -galactosides. The enzyme showed better thermostability at lower temperatures (below 40 C.) and optimal activities at temperatures from 40 C. to 50 C. and pH 3.5 to 6. Additionally, the enzyme was controlled by glucose inhibition though rBHT was not sensitive to galactose or Ag.sup.3+ as previously reported for native BHT (4,16,25,35).
(111) Lactose utilization and initial lactose concentration are two key factors that contribute to maximizing the final GOS accumulation. Here, we demonstrated a process with improved lactose utilization (90%) employing physiologically active resting cells of P. pastoris GS115/rBht. Under these conditions, the cells consume residual glucose at 30 C., circumventing glucose inhibition and ensuring a significant process improvement and a higher degree of final prebiotic purity (
(112) GS115/rBht resting cells incubated at 42 C. only converted 51% of the initial lactose into galactosyl-lactose and residual glucose (
(113) The discovery of GOS synthesis by S. singularis in the mid-20 century has encouraged the exploration for superior -galactosidases that more efficiently produce GOS (9,10,37). However, the enzymes studied showed lower lactose utilization values and higher final concentrations of undesirable byproducts when compared to the BHT from S. singularis (1,4,12,16,27,34,35). Nevertheless, advances in the industrial utilization of S. singularis BHT have been slower than desired due to the challenging multistep purification processes required to obtain pure native BHT (1,4,16). The bioactive rBHT either secreted or membrane bound enzyme from P. pastoris signifies a clear process advantage for producing GOS. Future studies will explore protein modification strategies to improve protein expression yield, protein stability, and enzyme activity.
(114) Table 6 below summarizes the constructs that were prepared in connection with this invention. All the constructs were prepared in pPIC9 but Exist as chromosomal integrants in P. pastoris.
(115) 6.5. Galacto-Oligosaccharides from Lactose-Rich Whey
(116) The global dairy market was $299.7B in 2009, and is expected to grow to $370.9B by 2014, an increase of 23.8%. Global. Dairy Industry Profile: Global. Dairy Industry Profile: Global [serial online]. October 2010:1. Available from: Business Source Complete, Ipswich, Mass. Accessed Feb. 24, 2012. Global (2012). Milk and cheese accounted for 35.2% and 28.3% of the market, respectively. Global cheese consumption is expected to reach 21 million tons in 2015. Lenoir-Wijnkoop I. & van Aalderen W M, B.G.K.D.S.A.N.MJ. Cost-effectiveness model for a specific mixture of prebiotics in The Netherlands. Eur J Health Econ (2010). The growth of the dairy market creates significant industrial waste treatment issues given the high lactose content of milk and byproducts produced during dairy processing. High lactose content waste fluids have an exceptionally high biological oxygen demand (BOD), which means that the amount of oxygen required to break down the lactose is high enough to rob other organisms of oxygen needed for survival. Therefore, many countries have enacted environmental protection laws that restrict the disposal of lactose containing fluids directly into bodies of water. Ganzle, M. G., Haase, G. & Jelen, P. Lactose: Crystallization, hydrolysis and value-added derivatives. International Dairy Journal 18, 685-694 (2008). The added burden to municipal water treatment processes can be especially costly and problematic for countries and states dependent on a dairy economy (4-6). Affertsholt-Allen T. Market developments and industry challenges for lactose and lactose derivatives. IDF Symposium Lactose and its Derivatives. Moscow. (lactose.ru/present/1Tage_Affertsholt-Allen DOT pdf. Accessed Sep. 30, 2009) (2007); Markets and Markets. U.S. Digestive Health Ingredients Market Worth $495.3 million in 2015. (www.marketsandmarkets.com/PressReleases/us-digestive-health-ingredients-market DOT asp) (2010); UBIC consulting. THE WORLD GALACTO-OLIGOSACCHARIDE MARKET. (www.ubic-consulting.com/template/fs/documents/Dairy-Ingredients/Galacto-Oligosaccharide-Ingredient-Market DOT pdf) (2010). For example, cheese manufacturing generates two products: cheese and whey. For every pound of cheese made, nine pounds of whey are generated, creating a growing surplus of whey (186 million tons in 2008), which contains 5% lactose. This lactose fraction has a BOD that is approximately 175-fold greater than typical sewage effluent, therefore the untreated waste cannot be directly disposed into bodies of water. Smithers, G. W. Whey and whey proteins. From Glitter to Gold. International Dairy Journal 18, 695-704 (2008). The traditional solution to this problem has been to bioremediate lactose-rich effluents by applying expensive processes to extract the lactose, which can then be sold as a commodity product at a ceiling value of $1.50/kg. Only 50% of the cheese whey produced annually is recycled into useful products such as food ingredients and animal feed. The rest is considered waste either because critical volumes to allow for economical recycling are not reached or due to the high degree of technical difficulty involved in biotransformation. Therefore, there is a strategic need to convert lactose into commercially viable, high value products to reduce the overall process cost and improve the US dairy industry economy.
(117) Here, we propose the simultaneous biotransformation/bioremediation of the commodity chemical lactose by applying a new food product development process as the ideal solution to this industrial problem. We have improved a method by which lactose can be converted into galactosyl-lactose derivatives called galacto-oligosaccharides (GOS) through an enzymatic reaction. GOS are classified as prebiotics, which stimulate the growth and activity of beneficial bacteria in the digestive system, and are widely used in food products such as infant formulas, nutritional supplements, yogurts, baked goods, and animal feed. Unlike the commodity product lactose, GOS are highly valued food ingredients, and the economic value of this transformation is easily demonstrated by comparing the current market price of lactose at $1.50/kg to the $5.20-8.50/kg market price of GOS. GOS are a part of a trend in digestive health food ingredients valued at $265.9 million in 2010 with an annual growth rate of 18.3% and expected to grow at a compound annual growth rate of 13.2% from 2010 to 2015.
(118) Our lactose to GOS conversion method is vastly superior to existing processes because we can reduce the overall volume of reaction by 50 fold by utilizing an efficient host to produce the enzyme, increase the volume and purity of GOS produced, and potentially generate lactose-free products. Euromonitor. Lactose-free Foods Maintain Their Global Appeal, Mar. 1, 2011. Euromonitor (2011). The lactose free product global market was $3.4B in 2009, and is expected to grow as consumers continue to focus on health and wellness functional foods. While other dairy products are extremely price sensitive, functional foods such as lactose-free products can be sold at a premium.
(119) By using the improved process described herein, US and global dairy industry and food supplement manufacturers can clearly benefit in three ways: 1) creation of large volumes of quality GOS, a health promoting food ingredient/dietary supplement with high market value, 2) simultaneous potential generation of valuable lactose free milk or whey products, and 3) cost effective reduction of environmental impact through the recycling of whey and milk byproducts.
(120) TABLE-US-00003 TABLE 3 Strains and plasmids used in this study Strains/ Source or Plasmids Description or genotype Reference Strains E. coli BL21 F.sup. ompT hsdS.sub.B(r.sub.B.sup. m.sub.B.sup.) gal dcm (DE3) Novagen BLR F.sup. ompT hsdS.sub.B(r.sub.B.sup. m.sub.B.sup.) gal dcm(srl- Novagen recA)306::Tn10(Tet.sup.R)(DE3) CC118 F2 D(ara-leu)7697 araD139 (lac)X74 (36) phoAD20 galE galK thi rpsE rpoB argE(Am) recA1 NovaBlue endA1 hsdR17(r.sub.K12.sup. m.sub.K12.sup.+) supE44 thi-1 Novagen recA1 gyrA96 relA1 lacF[proA.sup.+B.sup.+ lacI.sup.q ZM75::Tn10] (Tet.sup.R) (DE3) Origami (ara-leu)7697 lacX74 phoA PvuII Novagen phoR araD139 ahpC galE galK rpsLF[lac.sup.+ lacI.sup.q pro] gor522::Tn10 trxB (Kan.sup.R, Str.sup.R, Tet.sup.R) (DE3) Rosetta F.sup. ompT hsdS.sub.B(r.sub.B.sup. m.sub.B.sup.) gal dcm pRARE2 Novagen (Cam.sup.R)(DE3) XL1-Blue recA1 endA1 gyrA96 thi-1 hsdR17 supE44 Stratagene relA1 lac [F{acute over ()} proAB lacI.sup.qZM15 Tn10 (Tet.sup.R)] P. pastoris GS115 his4 (his.sup. mut.sup.+) Invitrogen GS115/ GS115 his4::LacZ (E. coli -galactosidase Invitrogen LacZ (117 kDa) intracellularly (his.sup.+mut.sup.+)) KM71 GS115 arg4 his4 aox1::ARG4 (his.sup. mut.sup.s) Invitrogen JB208 GS115 integrated with plasmid pJB108 This study (GS115/ (his.sup.+mut.sup.+) rBht) Plasmids E. coli pJB100 pGS21a-rBHT This study pET24d Optional C-terminal 6XHIS tag, T7lac Novagen promoter, Kan.sup.R pJB101 pET24d-rBHT-6XHIS This study pJB102 pET24d-TET promoter-rBHT-6XHIS This study pET41a GST tag, T7lac promoter, Kan.sup.R Novagen pJB103 pET41a-GST-rBHT This study pET32a Trx tag, T7lac promoter, Amp.sup.R Novagen pJB104 pET32a-Trx-rBHT This study pET22b PelB coding sequence, T7lac promoter, Novagen Amp.sup.R pJB105 pET22b-pelB-rBHT This study pET39b DsbAtag coding sequence, T7lac Novagen promoter, Kan.sup.R pJB106 pET39b-DsbA-rBht This study pJB107 pUC57-rBHT This study P. pastoris pPIC9 P. pastoris expression plasmid carrying Invitrogen AOX1 promoter and transcription terminator, HIS4, Amp.sup.r in E. coli, PBR322 ori, -factor secretion signal from S. cerevisiae pJB108 pPIC9-MF-6XHIS-TEV-rBHT This study MF, S. cerevisiae -mating factor secretion signal.
(121) TABLE-US-00004 TABLE4 Primers,antibodiesandsubstrates usedinthisstudy .sup.aSequence Source OpenReading Primers Frame JBB1 6XHIS-TEV- 5- Thisstudy rBHT ccgCTCGAGAAAAGAGAGGCTGAAG (SEQIDNO: forwardprimer CTCACCACCACCACCA 21) CCACGAAAACCTGTATTTTCAGATG ATGCTGCATGCTGCAC-3 JBB2 rBHTreverse 5- Thisstudy primer aaggaaaaaaGCGGCCGCTTACAGA (SEQIDNO: TGATTACGCCCAAATTG-3 22) JBB3 rBHTforward 5- Thisstudy internal ATCACTATGCCAGCACGCAGTG (SEQIDNO: sequencing TA-3 23) primer JBB4 rBHTreverse 5- Thisstudy internal TTTAAAGCCGATTTCACCTGCC (SEQIDNO: sequencing GC-3 24) primer 5 AOX1 AOX1 5-GACTGGTTCCAATTGACAAGC-3 Invitrogen sequencing (SEQIDNO: Primer 25) 3 AOX1 AOX1 5-GCAAATGGCATTCTGACATCC-3 Invitrogen sequencing (SEQIDNO: primer 26) -Factor -factor 5-TACTATTGCCAGCATTGCTGC-3 Invitrogen sequencing (SEQIDNO: primer 26) Antibodies Antigen Mouseanti- 6XHIS Qiagen HIS Rabbitanti- Ecoli- Sigma Bgal galactosidase Rabbitanti- -hexosyl- Thisstudy rBHT transferase Substrate Abbreviation oNP--D- ONP-Glu Sigma glucopyranoside oNP--D- ONP-Gal Sigma galactopyranoside pNP--D- PNP-Glu Sigma glucopyranoside pNP--D- PNP-Gal Sigma galactopyranoside 5-bromo-4- X-GAL Sigma chloro-3- indolyl--D- galactopyranoside .sup.aCoding regions are capitalized, restriction sites have been underlined.
(122) TABLE-US-00005 TABLE 5 Reports evaluating BHT from Sporobolomyces singularis for the production of galactooligosaccharides (GOS) Enzyme Conditions Named MM SA T pH U.g.sup.1.lac L.sub.int L.sub.util C.sub.max (Y) Used Ref - 22 3.75-4.0 10 50 STR. Growing (9) transglycosyl cells -hexosyl- 20 6.5 6 68 25(36) Cell extract (10) transferase -hexosidase 140-145 41.2.sup.a 45-50 6.5 5 Purified enzyme (1) - 45 3.7 30 73 54.sup.e(51) Batch IE, (34) galactosidase partially purified enzyme - 45 4.8 10 70 55.sup.e(53) Cont. IE, PBR, (34) galactosidase partially purified enzyme - 45 3.7 0.13 30 70 40(57) Partially purified (35) galactosidase enzyme - 53 56.sup.b 50 5.0 5.4 18 71 50(70) Purified enzyme (4) galactosidase - 146 8.69.sup.c 40 6.0 0.8 20 .sup. Purified enzyme (16) galactosidase like - 55 5.0& 60 60 41.1(68) Batch, resting (31) galactosidase 6.0 cells - 55 5.0& 60 60 40.4(67) RB IE Alginate, (31) galactosidase 6.0 resting cells -hexosyl- 110 8.2.sup.d 42 6.0 0.5 2 52 37.sup.f(71).sup.f Purified enzyme This transferase study -hexosyl- 110 42 6.0 0.5 20 52 36.sup.f(70).sup.f Batch, This transferase recombinant study resting cells -hexosyl- 110 30 6.0 0.5 20 69 51.sup.f(74).sup.f Batch, This transferase recombinant study resting cells MM molecular mass (kDa); SA specific activity (U.mg.sup.1 enzyme); T temperature ( C. ); U.g.sup.1lac units per gram initial lactose; L.sub.int initial lactose concentration (%); L.sub.util lactose utilized (%); C.sub.max maximum conversion of GOS (%) from initial lactose; (Y) conversion % (total GOS formed from utilized lactose); STR stirred tank reactor; IE immobilized enzyme; PBR packed bed reactor; Cont. IE immobilized enzyme (continuous); RB IE immobilized enzyme (repeated batch). Substrates of the enzyme reaction .sup.aONP-Gal; .sup.bPNP-Gal; .sup.cPNP- Glu; .sup.dONP-Glu. .sup.eGOS include disaccharides; .sup.fGOS values reported were performed at the value of maximum accumulation of trisaccharide (galactosyl-lactose)
(123) TABLE-US-00006 TABLE 6 Pichia pastoris rBHT Proteins Protein Construct without aMF Protein construct Amino Mol. FP Amino Mol. acid # weight Signal # Name Acid # Weight w/o aMF w/o aMF sequence Plasmid 1 aMF-6XHIS-TEV(Q/M)- 695 76599.3 606 67279.3 aMF and pPIC9 rBHT BHTss 2 aMF-6XHIS-TEV(Q/M)- 701 77422.2 612 68102.1 aMF and pPIC9 aMF-rBHT-6XHIS BHTss 3 aMF-rBHT-6XHIS 689 75805.8 600 66484.4 aMF and pPIC9 BHTss 4 aMF-rBHT 683 74981.6 594 65661.6 aMF and pPIC9 BHTss 5 aMF-rBHT(1-22)-6XHIS 667 73604.7 578 64284.6 aMF pPIC9 6 aMF-rBHT(1-22) 661 72781.8 572 63461.7 aMF pPIC9 7 rBHT-6XHIS 600 66483.3 600 66484.4 BHTss pPIC9 8 rBHT(1-22)-6XHIS 579 64414.7 579 64415.8 pPIC9 9 aMF-rBHT(1-110)-6XHIS 584 65005.4 491 55146.5 aMF pPIC9 MF = Saccharomyces cerevisiae alpha mating factor found in pPIC9 vector BHTss = BHT signal sequence found in amino acids 1-22
(124) 6.6. Secretion of -Hexosytransferase is Enhanced by Replacing Signal Domain
(125) 6.6.1. Abstract
(126) The -hexosyltransferase (BHT) from Sporobolomyces singularis is known for its ability to catalyze transgalactosylation reactions and synthesize galacto-oligosaccharides (GOS). We previously reported the heterologous expression of a bioactive full-length polypeptide (rBHT) by a recombinant strain of Pichia pastoris (GS115::MF-HIS-TEV-rBht). This recombinant strain carries the full length Bht gene preceded by the Saccharomyces cerevisiae a mating factor pre pro signal (MF), a histidine tag, and a TEV cleavage site. After methanol induction the rBHT generated by GS115::MF-HIS-TEV-rBht was only partially secreted and most of the protein remained associated to the cell membrane. To increase the amount of secreted rBHT, this work examines the uncharacterized BHT amino-terminus region (amino acids 1-110) containing two putative endogenous structural domains. The amino terminus includes a domain (amino acids 1-22) which may serve as a classical secretion leader signal while the remaining 23-110 amino acids contain a putative non-classical secretion signal. Thus, we functionally evaluated these domains by generating recombinant P. pastoris GS115 strains expressing rBHT-HIS. The results show signal interference affecting protein secretion when MF was followed by the rBht.sub.(1-22) classical leader signal (amino acids 1-22), while the substitution of the leader signal (amino acids 1-22) with the MF (MF-rBht.sub.(23-594)) enhanced P. pastoris production of both secreted and membrane bound enzyme by as much as 50 and 14 fold, respectively. To validate the BHT amino-terminus domains role promoting protein secretion, we tested the domains with a non-secreted alternative protein, the anti-3-galactosidase single chain variable antibody fragment scFv13R4. Recombinant P. pastoris strains expressing combinations of the MF and amino-terminus domains of rBHT, followed by the antibody scFv13R4 were able to generate results that correlate with the strength of secretion obtained by the recombinants expressing rBHT-HIS. Finally, active rBHT-HIS and rBHT proteins obtained from the more efficient recombinants (GS115::MF-rBht.sub.(23-594)-HIS and GS115::MF-rBht.sub.(23-594)) were purified to homogeneity and evaluated for possible alterations in enzyme activity. The enzymatic activity of the 6HIS tagged and the non-tagged secreted enzymes were comparable as shown by the rates of GOS generation.
(127) 6.6.2. Introduction
(128) There is an increasing interest in the use of enzymes for the production of functional foods, especially in the field of prebiotic production from lactose to obtain lactose derivatives. Sporobolomyces singularis can assimilate lactose and glucose but not galactose indicating that they are only capable of metabolizing the glucose portion of lactose. Moreover, the unutilized galactose monomer can be only found in the broth as a constituent of the galacto-oligosaccharides (GOS). This physiological feature led to the discovery of the -hexosyltransferase (BHT) (Blakely and Mackenzi 1021-25; Phaff and Carmo-Sousa 193-207; Spencer, de Spencer, and Laluce 147-56; Gorin, Phaff, and Spencer 1341-44; Gorin, Spencer, and Phaff 2307-17). Prebiotics such as GOS synthesized by the BHT from S. singularis are recognized as GRAS and widely used as a functional food additive (Tzortzis and Vulevic 207-44).
(129) In addition to the synthesis of GOS from lactose, BHT also catalyzes the hydrolysis of -glycosidic linkages such as ONP-Glu and PNP-Glu (Blakely and Mackenzi 1021-25). BHT enzymatic capabilities are particularly appealing with respect to competing technologies, since it is one of few enzymes capable of catalyzing the production of GOS with industrial advantages including; catalysis occurring in the absence of additional ions and cofactors as well as its ability to perform transgalactosylation reactions independently of the initial lactose concentration (Gosling et al. 307-18; Blakely and Mackenzi 1021-25).
(130) In S. singularis, Bht is an inducible gene that is repressed by glucose and when in the presence of an inductor such as lactose the generated enzyme (BHT) is mostly found associated to the cell membrane. Due to the cellular location, the purification of BHT requires multiple chromatography steps and has been recovered from S. singularis at very low yields ranging from 14% to 16% (Blakely and Mackenzi 1021-25; Cho, Shin, and Bucke 2107-11; Ishikawa et al. 331-39). Since, conventional protein purification protocols limit enzyme recovery and thereof its technological application, alternative strategies have been evaluated. The first approach consisted of exposing S. singularis to selection through mutagenesis. Applying this methodology a new strain was selected lacking glucose repression and able to generate a 10-fold increase in membrane bound BHT; however, there was no reported increase in the production of secreted enzyme (Ishikawa et al. 331-39). Alternatively, we recently described that P. pastoris GS115 is capable of secreting a biologically active recombinant rBHT polypeptide when preceded by the MF prepro secretion signal consisting of a 19 amino acid signal sequence (presequence) followed by a 66 amino acid prosequence and a dibasic Kex2 endopeptidase processing site (Kurjan and Herskowitz 933-43). In this study the analysis of the cell free extract and membrane-bound associated activity showed that the majority of the enzyme remained associated to the cell membrane. Hence showing that P. pastoris GS115 is an adequate host for production and secretion of the bioactive rBHT that will facilitate downstream processing and demonstrating the feasibility of production of both secreted and membrane-associated bioactive rBHT (Dagher et al., 2013).
(131) A further look into the native BHT protein sequence showed that it contains endogenous structural features at the amino-terminus, including amino terminal domains that may serve as suitable classical and non-classical secretion signals. Supporting these roles as leader signals, it has been shown that following treatment of S. singularis with cell wall lytic enzymes most of the released BHT was devoid of the amino terminal classical leader signal (Ishikawa et al. 331-39). Since the efficiency of gene expression and protein secretion may be affected by those protein structural elements participating in cell association and secretion, the same functions may also be extended to the protein cellular localization when expressed by P. pastoris GS115.
(132) In this study, we tested the physiological role of the BHT amino-terminal domains and their relationship with protein secretion by P. pastoris GS115. Furthermore, the secretory roles of rBHT amino-terminal domains were validated using recombinant chimeras containing as carboxyl terminal the single chain anti--galactosidase antibody scFv13R4. The antibody scFv13R4 is an example of a non-secreted hyper-stable single chain protein that is independent of disulfide bridge formation for binding activity (Martineau, Jones, and Winter 117-27). As such, scFv13R4 has been heterologously expressed in Escherichia coli, Saccharomyces cerevisiae, and Chinese hamster ovary cells (CHO) (Visintin et al. 11723-28; Grage and Rehm 254-62; Bach et al. 79-93).
(133) 6.6.3. Results
(134) In silico protein sequence analysis of the -hexosyl transferase (BHT). The carboxyl terminal portion (amino acids 111 to 594) of the BHT polypeptide (594 amino acids) has noticeably homology to -glucosidases. This glycohydrolase I (GHI) domain contains the putative catalytic acid/base, catalytic nucleophile, and three asparagine residues potentially required for protein N-glycosylation (
(135) Amino terminal domains participate in protein secretion. To investigate the probable physiological roles of the two amino terminal secretion domains (classical and non-classical secretion signals), expression of the carboxyl terminal BHT domain (amino acids 111 to 594) and the single chain anti--galactosidase antibody (scFv13R4) were tested. Stable recombinant P. pastoris GS115 strains were obtained by chromosomal integration of the appropriate modified gene combinations preceded by the rBht amino terminal domains and/or the strong 9.3 kDa MF prepro sequence. The rBht and scFv13R4 gene combinations were inserted downstream of the AOX1 promoter and followed by carboxyl-terminal 6HIS tag to assist detection and purification
(136) Replacement of the leader signal (amino acids 1 to 22) with the strong MF prepro secretion signal (GS115::MF-rBht.sub.(23-594)-HIS) increased protein secretion to more than 19 fold (9.80 g.Math.ml.sup.1) compared to expression of the full-length rBHT-HIS preceded by MF secretion signal (GS115::MF-rBht-HIS) (0.49 g.Math.ml.sup.1) (
(137) To validate that the amino-terminal domains, as described above, target proteins to the secretory pathway, we choose the antibody scFv13R4, an intracellular protein depleted of signal sequences. Diagrams of the antibody scFv13R4 chimeras are shown in FIG. (8C). The scFv13R4-HIS when expressed by GS115::scFv13R4-HIS (lacking leader secretion signals) could not be detected in the culture broth by SDS-PAGE silver staining or Western blot analysis (data not shown). Secretion of scFv13R4-HIS by GS115::rBht.sub.(1-110)-scFv13R4-HIS or GS115::rBht.sub.(23-110)-scFv13R4-HIS manifested when either scFv13R4 was fused to the Bht classical leader secretion signal (25.17 g.Math.ml.sup.1), or when fused to the Bht non-classical signal (7.03 g.Math.ml.sup.1). Likewise, as seen with BHT-HIS, secretion driven by MF, (GS115::MF-scFv13R4-HIS) provided the highest level of secreted protein (91.02 g.Math.ml.sup.1).
(138) Enzyme activity and Western blot analysis of rBHT-HIS expressed by P. pastoris GS115. To confirm that protein expression correlated with enzymatic activity, the secreted and the membrane bound rBHT-HIS activities were measured using ONP-Glu as the substrate (see Materials and Methods). All recombinant strains secreted rBHT-HIS in detectable amounts and the values of activity reflected increases in secreted protein. The protein secreted by GS115::MF-rBht.sub.(23-594)-HIS displayed an enzymatic activity of 3.7 mU.Math.OD.sup.1 that was 6-fold higher than the measured activity when secretion was driven by the complete amino terminal region (amino acids 1-110) (GS115::rBht-HIS (0.63 mU.Math.OD.sup.1)). Similarly, the measured enzymatic activity of the protein secreted by GS115::MF-rBht.sub.(23-594)-HIS was 53-fold higher than obtained from the recombinant containing both the MF and the leader signals (GS115::MF-rBht-HIS (0.07 mU.Math.OD.sup.1)). The recombinant GS115::rBht.sub.(23-594)-HIS (0.26 mU.Math.OD.sup.1) show a reduced amount of active secreted enzyme Table 8.
(139) The activity of the membrane-bound enzyme displayed by resting cells of each recombinant was also tested. We found values of activity that correlate with total secreted protein showing an increase in membrane bound activity of 15-fold for the strain GS115::MF-rBht.sub.(23-594)-HIS (21.52 mU.Math.OD.sup.1) and 1.3-fold increase for the strain GS115::rBht-HIS (1.94 mU.Math.OD.sup.1) compared to GS115::MF-rBht-HIS (1.48 mU.Math.OD.sup.1). The recombinant GS115::rBht.sub.(23-594)-HIS (0.15 mU.Math.OD.sup.1) show a reduced amount of membrane bound enzyme, confirming that this recombinant redirects the protein through the putative non-classical secretion pathway. Overall these results show that neither MF nor the BHT leader secretion signal could fully complete the secretion of rBHT-HIS which may be related to the presence of a transmembrane region predicted between amino acids 177 to 199.
(140) Western blot analysis of the cell-free extracts using anti-HIS antibody confirmed the secreted protein values by GS115::MF-rBht.sub.(23-594)-HIS, GS115::rBht-HIS, and GS115::rBht.sub.(23-594)-HIS (
(141) rBHT hydrolytic activity. Additionally, we tested the secreted enzymes for both HIS-tagged and non-HIS tagged protein from GS115::MF-rBht.sub.(23-594)-HIS and GS115::MF-rBht.sub.(23-594), respectively. The enzymes delivered comparable results and were active in a wide range of temperatures (10 to 50 C.) and at pH values (2.8 to 6). Maximum activity was observed from pH 3.6 to 5 (91 to 100% of maximum activity) followed by a steady decrease down to pH 2.6 (43% of maximum) and up to pH 6.8 (29% of maximum). Likewise, the optimum temperature was found in the range of 40 and 45 C. (97 to 100% maximum activity) but rapidly decreased at temperatures above 50 C. and below 20 C. (less than 25% of maximum) (data not shown). The enzyme was stable in 50 mM sodium phosphate buffer pH 5 at 4 C. for at least 6 months and the activity was unaffected by storage at 80 C. The values for the kinetic constants for the enzyme secreted by GS115::MF-rBht.sub.(23-594)-HIS were obtained from the Hill equation (Km 0.79 mM and Vmax 3.97 mmol.Math.min.sup.1 per mg.sup.1 of enzyme at 42 C. pH 4). Those findings were in agreement with previous reports by us and others (Blakely and Mackenzi 1021-25; Cho, Shin, and Bucke 2107-11; Gorin, Phaff, and Spencer 1341-44; Gorin, Spencer, and Phaff 2307-17; Ishikawa et al. 331-39; Sakai et al. 285-93; Shin, Park, and Yang 787-92; Shin and Yang 484-89; Dagher, Azcarate-Peril, and Bruno-Brcena).
(142) rBHT stability. To examine the long-term stability of the enzyme, all the freshly induced recombinant strains were incubated in buffer containing 2% glucose and the hydrolytic activity of membrane bound and secreted rBHT was measured over time. Secreted rBHT-HIS obtained from all recombinants through classical or non-classical secretion pathway remained stable over the one-week testing period and retained more than 95% of initial activity. The same stability was observed when resting cells containing membrane-associated enzyme was expressed by GS115::MF-rBht-HIS, GS115::rBht-HIS, and GS115::MF-rBht.sub.(23-594)-HIS. However, when testing resting cells containing membrane-associated enzyme expressed by GS115::rBht.sub.(23-594)-HIS, the activity began to decrease within 24 h pointing to the alternative non-classical secretion pathway.
(143) Purification and characterization of rBHT-HIS generated by GS115::MF-rBht(23-594)-HIS. The rBHT protein expressed by GS115::MF-rBht(23-594)-HIS was purified using nickel affinity chromatography. The placement of the 6HIS tag on the carboxyl-terminus successfully allowed the single step recovery of more than 73% of the original enzymatic activity and after SDS-PAGE a single polypeptide band of approximately 110 kDa was seen (
(144) HIS tag impact on rBHT transferase activity. Recombinants GS115::MF-rBht.sub.(23-594)-HIS and GS115::MF-rBht.sub.(23-594) were further employed to comparatively evaluate whether the presence of the HIS tag may impact GOS synthesis from lactose. GOS accumulation was analyzed quantitatively by HPLC from reaction mixtures containing 220 gL.sup.1 initial lactose, 0.5 U rBHT g.sup.1 lactose and incubated at 30 C.
(145)
(146) When using resting cells expressing membrane-associated HIS and non-HIS tagged rBHT, comparative GOS accumulation and lactose consumption over time was also confirmed. (
(147) 6.6.4. Discussion
(148) Prebiotics are carbohydrate derivatives marketed as functional foods and actively promoted to improve consumer health that is intended to specifically stimulate the growth of beneficial bacteria in the gut. The fundamental force that drives development of prebiotics is the promise of more efficient production processes at lower operating costs. However, production or synthesis of specific carbohydrate derivatives by chemical methods is complex and requires protection and deprotection steps due to the presence of several hydroxyl groups of similar reactivity (Sears and Wong 2344-50). Therefore, the development of enzymatic approaches is of practical interest and genetic modification has been extensively used to modify enzymatic activity, to obtain a deeper knowledge of catalytic mechanisms, and to increase protein secretion. Proteins destined for secretion are usually preceded by amino-terminal leader signals of 20-30 amino acids and eventually processed by membrane bound signal peptidases (Von Heijne 17-21). Protein secretion by P. pastoris is influenced by the nature of the initial nucleotide sequences and occasionally requires codon optimization, as well as consideraton of glycosylation patterns, final 3-dimensional structure, culture conditions, and medium composition (Damasceno, Huang, and Batt 31-39). Additionally, the distribution of charged amino acids within leader domains plays an important role in facilitating the localization of membrane and secreted proteins (Boyd and Beckwith 1031-33).
(149) As reported previously, P. pastoris offers advantages over E. coli for the expression of rBHT thanks to its ability to efficiently incorporate post-translational modifications that allowed for the heterologous production of small amounts of bioactive rBHT. In silico analyses of BHT suggested that this enzyme contains trans-membrane domains that needed to be studied to increase secretion of the enzyme by P. pastoris. The BHT unique protein region (1-110 amino acids) contains two domains predicted to function as classical leader signal (BHT.sub.(1-22)) and non-classical secretion signal domains (BHT.sub.(23-110)). The classical leader signal also targets the protein to perform its function at the cellular membrane (as predicted by the RHYTHM method and hydropathy plots,
(150) The data presented here shows protein secretion interference by GS115::MF-rBht-HIS due to the simultaneous presence of MF and leader signal (BHT.sub.(1-22)). The levels of protein secretion were comparable to the previously reported values by GS115::MF-HIS-TEV-rBht (Dagher, Azcarate-Peril, and Bruno-Brcena). On the other hand, higher accumulation of secreted protein was obtained by the recombinants GS115::rBht-HIS and GS115::MF-rBht.sub.(23-594)-HIS lacking either MF or BHT.sub.(1-22), respectively. Therefore, demonstrating that the leader signal domain (BHT.sub.(1-22)) is involved in the signal peptide-mediated mechanism (classical secretory pathway) comparable to MF. Both leader signals were individually able to increase protein expression of membrane-associated and secreted rBHT compared to GS115::MF-rBht-HIS, containing both leader sequences. The best values for secreted (50-fold increase) and membrane-bound (14-fold increase) bioactive rBHT protein were obtained by the recombinant GS115::MF-rBht.sub.(23-594)-HIS (Table 3). The subsequent purification of the bioactive protein expressed from GS115::MF-rBht.sub.(23-594)-HIS resulted in very pure protein by SDS-PAGE with a specific activity of 18.45 U.Math.mg.sup.1 (Table 4). The molecular mass of rBHT (110 kDa) did not deviate between cell membrane-associated and secreted rBHT and displayed similar enzyme activity, thermostability, reusability and storage stability compared with rBHT from our previous study (Dagher et al., 2013).
(151) We expected that removal of both the leader domains (BHT.sub.(1-22)) and MF would hinder enzyme secretion. However, elimination of both MF and BHT.sub.(1-22) still showed low amounts of secreted protein. Also confirming that the 110 amino acid unique region contains a dual function by which the leader domain BHT.sub.(1-22) acts as an efficient secretion signal (classical secretion pathway) and the predicted BHT.sub.(23-110) domain may operate as alternative secretion signal (non-classical secretion pathway). Western blot analyses show proteolysis indicating increased protein sensitivity in the cell. The majority of the measured hydrolytic activity was detected as multiple bands below the maximal mass of 110 kDa, likely affecting the amount of secreted enzyme (
(152) Although greater amounts of protein were secreted by GS115::MF-rBht.sub.(23-594)-HIS, significant quantities remained stably bound to the membrane, possibly due to the predicted limited mobility in the membrane by the presence of the trans-membrane domain within the protein carboxy-terminus domain (amino acids 177-199). Therefore, to confirm the physiological function of these domains as secretory signals we generated new protein chimeras by replacing the rBHT.sub.(23-594) domain with the antibody scFv13R4 protein. The BHT.sub.(1-110) classical leader followed by putative non-classical leader, the BHT.sub.(23-110) putative non-classical leader, and the MF domain were placed in frame at the amino terminal position with scFv13R4. Analyses of these new recombinants were able to corroborate the leader secretory function by directing the antibody to secretion. Our results confirm that the choice of signal sequences has a strong impact on both production and secretion levels of proteins including the recombinant BHT and scFv13R4. Noteworthy is the fact that the new smaller leader signal (22 amino acids) has a size advantage compared to MF (66 amino acids) and has been demonstrated here to be a new unique sequence able to direct secretion of heterologous proteins. This leader signal domain adds a new feature that can be built into intracellular enzymes that otherwise need to be extracted by disruption using mechanical means or permeabilization with chemical treatments (Panesar et al. 530-43).
(153) Continued molecular development of BHT will help address food industries problems for enzymes with novel properties such as thermo-activity, cold stability and synthesis of specific oligosaccharides. The present findings motivate further structural analysis to elucidate features that contribute to transglycosylation activity and substrate specificity. Mutagenesis of catalytic sites and rational mutagenesis based on the 3D structure will pave the way for alterations in substrate specificity for production of novel GOS as prebiotic candidates.
(154) TABLE-US-00007 TABLE 7 Strains and plasmids used in this study Strains/ Source or Plasmids .sup.aDescription or genotype Reference Strains E. coli XL1-Blue recA1 endA1 gyrA96 thi-1 hsdR17 Stratagene supE44 relA1 lac [F{acute over ()} proAB lacI.sup.qZM15 Tn10 (Tet.sup.R)] P. pastoris GS115 his4 (his.sup. mut.sup.+) Invitrogen JB210 GS115::MF-rBht-HIS (his.sup.+ mut.sup.+) This study JB212 GS115::MF-rBht.sub.(23-594)-HIS (his.sup.+ mut.sup.+) This study JB213 GS115::MF-rBht.sub.(23-594) (his.sup.+ mut.sup.+) This study JB214 GS115::rBht-HIS (his.sup.+ mut.sup.+) This study JB215 GS115::rBht.sub.(23-594)-HIS (his.sup.+ mut.sup.+) This study JB217 GS115::MF-scFv13R4-HIS (his.sup.+ mut.sup.+) This study JB220 GS115::rBht.sub.(1-110)-scFv13R4-HIS (his.sup.+ This study mut.sup.+) JB221 GS115::rBht.sub.(23-110)-scFv13R4-HIS (his.sup.+ This study mut.sup.+) JB222 GS115::scFv13R4-HIS (his.sup.+ mut.sup.+) This study Plasmids E. coli pJB100 pGS21a-rBht Dagher, 2013 pPM163R4 pPM160 containing the anti--galacto- Martineau, sidase antibody gene scFv13R4 1998 P. pastoris pPIC9 P. pastoris integrative vector carrying Invitrogen AOX1 promoter and transcription terminator, HIS4, Amp.sup.r in E. coli, pBR322 ori, -mating factor secretion signal from S. cerevisiae (MF) pJB110 pPIC9-MF-rBht-HIS This study pJB112 pPIC9-MF-rBht.sub.(23-594)-HIS This study pJB113 pPIC9-MF-rBht.sub.(23-594) This study pJB114 pPIC9-rBht-HIS This study pJB115 pPIC9-rBht.sub.(23-594)-HIS This study pJB117 pPIC9-MF-scFv13R4-HIS This study pJB120 pPIC9-rBht.sub.(1-110)-scFv13R4-HIS This study pJB121 pPIC9-rBht.sub.(23-110)-scFv13R4-HIS This study pJB122 pPIC9-scFv13R4-HIS This study .sup.aMF, S. cerevisiae -mating factor secretion signal found in pPIC9 vector.
(155) TABLE-US-00008 TABLE 8 Secreted and membrane bound rBHT-HIS enzyme activity by different recombinants of P. pastoris Mean activity (mU .Math. OD.sup.1) SD .sup.a Ratio Secreted/ Membrane Membrane Enzyme Source Secreted bound Bound GS115::MF- 3.70 0.063 21.52 1.38 0.172 rBht.sub.(23-594)-HIS GS115::rBht-HIS 0.63 0.018 1.94 0.02 0.325 GS115::rBht.sub.(23-594)-HIS 0.26 0.003 0.15 0.02 1.606 GS115::MF-rBht-HIS 0.07 0.003 1.48 0.02 0.046
(156) TABLE-US-00009 TABLE 9 PURIFICATION OF RBHT-HIS SECRETED BY P. PASTORIS GS115::AMF-RBHT.sub.(23-594)-HIS Specific Total Total Specific activity activity in protein activity Ni Ni Ni Purif- media in media media column column column ication Recovery Enzyme Source (UL.sup.1).sup.a (mg).sup.b (U.mg.sup.1).sup.c (U).sup.d (mg).sup.e (U.mg.sup.1).sup.f (fold).sup.g (%).sup.h GS115::MF- 180.67 64.00 2.82 133.54 7.24 18.45 6.54 73.91 rBht.sub.(23-594)-HIS .sup.a1 Liter of culture was grown in BMGY broth at 28 C. .sup.bProtein concentration determined by Bradford assay. .sup.cSpecific activity is expressed as the total activity (U) divided by the total protein (mg). .sup.dTotal units following nickel chromatography purification. .sup.eTotal protein (mg) following nickel chromatography purification. .sup.fSpecific activity expressed as total activity (U) divided by total yield (mg) following nickel chromatography purification. .sup.gIncrease in specific activity. .sup.hYield expressed as total activity following nickel column chromatography divided by total activity in the broth.
(157) 6.7. References for Section 6.6 Bach, Horacio, et al. Escherichia coli maltose-binding protein as a molecular chaperone for recombinant intracellular cytoplasmic single-chain antibodies. Journal of Molecular Biology 312.1 (2001): 79-93. Boyd, Dana and Jon Beckwith. The role of charged amino acids in the localization of secreted and membrane proteins. Cell 62.6 (1990): 1031-33. Cereghino, J. L. and J. M. Cregg. Heterologous protein expression in the methylotrophic yeast Pichia pastoris. FEMS Microbiol. Rev. 24.1 (2000): 45-66. Damasceno, Leonardo, Chung Jr Huang, and Carl Batt. Protein secretion in Pichia pastoris and advances in protein production. Applied Microbiology and Biotechnology 93.1 (2012): 31-39. Grage, Katrin and Bernd H. A. Rehm. In Vivo Production of scFv-Displaying Biopolymer Beads Using a Self-Assembly-Promoting Fusion Partner. Bioconjugate Chemistry 19.1 (2007): 254-62. Kurjan, Janet and Ira Herskowitz. Structure of a yeast pheromone gene (MFa): A putative a-factor precursor contains four tandem copies of mature a-factor. Cell 30.3 (1982): 933-43. Martineau, Pierre, Peter Jones, and Greg Winter. Expression of an antibody fragment at high levels in the bacterial cytoplasm. Journal of Molecular Biology 280.1 (1998): 117-27. Panesar, Parmjit S., et al. Microbial production, immobilization and applications of B-D-galactosidase. Journal of Chemical Technology & Biotechnology 81.4 (2006): 530-43. Sears, P. and C. H. Wong. Toward automated synthesis of oligosaccharides and glycoproteins. Science 291.5512 (2001): 2344-50. Spencer, J. F. T., A. L. R. de Spencer, and C. Laluce. Non-conventional yeasts. Appl. Microbiol. Biotechnol. 58.2 (2002): 147-56. Tzortzis, George and Jelena Vulevic. Galacto-Oligosaccharide Prebiotics. Prebiotics and Probiotics Science and Technology. Ed. Dimitris Charalampopoulos and RobertA Rastall. Springer New York, 2009. 207-44. Visintin, Michela, et al. Selection of antibodies for intracellular function using a two-hybrid in vivo system. Proceedings of the National Academy of Sciences 96.21 (1999): 11723-28. Von Heijne, Gunnar. Patterns of Amino Acids near Signal-Sequence Cleavage Sites. European Journal of Biochemistry 133.1 (1983): 17-21.
7. REFERENCES
(158) 1. Blakely, J. A. and S. L. Mackenzi. 1969. Purification and properties of a b-hexosidase from Sporobolomyces singularis. Can. J. Biochem. 47:1021-1025. 2. Boehm, G., J. Jelinek, B. Stahl, K. van Laere, J. Knol, S. Fanaro, G. Moro, and V. Vigi. 2004. Prebiotics in infant formulas. J. Clin. Gastroenterol. 38:S76-S79. 3. Boehm, G. and B. Stahl. 2007. Oligosaccharides from milk. J. Nutr. 137:847S-849S. 4. Cho, Y. J., H. J. Shin, and C. Bucke. 2003. Purification and biochemical properties of a galactooligosaccharide producing b-galactosidase from Bullera singularis. Biotechnol. Lett. 25:2107-2111. 5. Cregg, J. M., T. S. Vedvick, and W. C. Raschke. 1993. Recent advances in the expression of foreign genes in Pichia pastoris. BioTechnol. 11:905-910. 6. Cuppa, G. V. and O. Gabrelll. 2008. Human milk oligosaccharides as prebiotics, p. 131-146. In J. Versalovic and M. Byand Wilson (eds.), Therapeutic microbology. Probiotics and related strategies. ASM Press Washington D.C. Chapter. 7. Dagher, S. F., J. L. Wang, and R. J. Patterson. 1995. Identification of Galectin-3 as a factor in pre-mRNA splicing. Proc. Natl. Acad. Sci. U.S.A. 92:1213-1217. 8. Gallagher, S. R. 1995. Current protocols in protein science, p. 10.3.1-10.3.11. 9. Gorin, P. A. J., H. J. Phaff, and J. F. T. Spencer. 1964. Structures of Galactosyl-lactose and Galactobiosyl-lactose produced from lactose by Sporobolomyces singularis. Can. J. Chem. 42:1341-1344. 10. Gorin, P. A. J., J. F. T. Spencer, and H. J. Phaff. 1964. Synthesis of b-galacto-b-gluco-pyranosyl disaccharides by Sporobolomyces singularis. Can. J. Chem. 42:2307-2317. 11. Gosling, A., G. W. Stevens, A. R. Barber, S. E. Kentish, and S. L. Gras. 2010. Recent advances refining galactooligosaccharide production from lactose. Food Chem. 121:307-318. 12. Grosova', M. Rosenberg, and Rebro. 2008. Perspectives and applications of immobilised b-galactosidase in food industrya review. Czech J. Food Sci. 26:1-14. 13. Hestrin, S., D. S. Feingold, and M. Schramm. 1955. Hexoside hydrolases. Meth. Enzymol. 1:231-257. 14. Higgins, D. R. 1998. Introduction to Pichia pastoris. Methods Mol. Biol. 103:1-15. 15. Hofmann. 1993. TMbaseA database of membrane spanning proteins segments. Biol. Chem. Hoppe-Seyler 374. 16. Ishikawa, E., T. Sakal, H. Ikemura, K. Matsumoto, and H. Abe. 2005. Identification, cloning, and characterization of a Sporobolomyces singularis b-galactosidase-like enzyme involved in galacto-oligosaccharide production. J. Biosci. Bioeng. 99:331-339. 17. Jenkins, N., R. B. Parekh, and D. C. James. 1996. Getting the glycosylation right: Implications for the biotechnology industry. Nat. Biotechnol. 14:975-981. 18. Katayama, K. 1984. Inhibition by copper ion of the activities of b-galactosidase and dehydrogenases of activated sludge. Japan J. Wat. Pollut. Res. 7:100-107. 19. Katayama, K. 1986. Inhibition of the activities of b-galactosidase and dehydrogenases of activated sludge by heavy metals. Water Res. 20:591-594. 20. Kim, C. S., E. S. Ji, and D. K. Oh. 2004. A new kinetic model of recombinant b-galactosidase from Kluyveromyces lactis for both hydrolysis and transgalactosylation reactions. Biochem. Biophys. Res. Comm. 316:738-743. 21. Knol, J., P. Scholtens, C. Kafka, J. Steenbakkers, S. Gro, K. Helm, M. Klarczyk, H. Schopfer, H. M. Bockler, and J. Wells. 2005. Colon microflora in infants fed formula with galacto- and fructo-oligosaccharides: More like breast-fed infants. J. Pediatr. Gastroenterol. Nutr. 40:36-42. 22. Kuby, S. A. and H. A. Lardy. 1953. Purification and kinetics of b-D-galactosidase from Escherichia coli strain-K-12. J. Am. Chem. Soc. 75:890-896. 23. Laemmll, U. K. 1970. Cleavage of structural proteins during assembly of head of bacteriophage-T4. Nat. 227:680-685. 24. Li, P. Z., A. Anumanthan, X. G. Gao, K. Ilangovan, V. V. Suzara, N. Duzgunes, and V. Renugopalakrishnan. 2007. Expression of recombinant proteins in Pichia pastoris. Appl. Biochem. Biotechnol. 142:105-124. 25. Neri, D. F. M., V. M. Balco, R. S. Costa, I. C. A. P. Rocha, E. M. F. C. Ferrera, D. P. M. Torres, L. R. M. Rodrigues, L. B. Carvalho, and J. A. Teixeira. 2009. Galacto-oligosaccharides production during lactose hydrolysis by free Aspergillus oryzae b-galactosidase and immobilized on magnetic polysiloxane-polyvinyl alcohol. Food Chem. 115:92-99. 26. Otieno, D. O. 2010. Synthesis of b-galactooligosaccharides from lactose using microbial b-galactosidases. Compr. Rev. Food Sci. Food Saf. 9:471-482. 27. Park, A. R. and D. K. Oh. 2010. Galacto-oligosaccharide production using microbial b-galactosidase: current state and perspectives. Appl. Microbiol. Biotechnol. 85:1279-1286. 28. Phaff, H. J. and L. D. Carmo-Sousa. 1962. Four new species of yeast isolated from insect frass in bark of Tsuga heterophylla (Raf.) Sargent. Antonie Van Leeuwenhoek. 28:193-207. 29. Rastall, R. A. and V. Matin. 2002. Prebiotics and synbiotics: towards the next generation. Curr. Opin. Biotechnol. 13:490-496. 30. Roberfrold, M., G. R. Gibson, L. Hoyles, A. L. McCartney, R. Rastall, I. Rowland, D. Wolvers, B. Watzl, H. Szajewska, B. Stahl, F. Guarner, F. Respondek, K. Whelan, V. Coxam, M. J. Davicco, L. Leotoing, Y. Wittrant, N. M. Delzenne, P. D. Cani, A. M. Neyrinck, and A. Meheust. 2010. Prebiotic effects: metabolic and health benefits. Br. J. Nutr. 104:S1-S63. 31. Sakal, T., H. Tsuji, S. Shibata, K. Hayakawa, and K. Matsumoto. 2008. Repeated-batch production of galactooligosaccharides from lactose at high concentration by using alginate-immobilized cells of Sporobolomyces singularis YIT 10047. J. Gen. Appl. Microbiol. 54:285-293. 32. Sambrook J. 2001. Molecular cloning: a laboratory manual. 3rd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor N.Y. 33. Scopes, R. 1995. The effect of temperature on enzymes used in diagnostics. Clin. Chim. Acta 237:17-23. 34. Shin, H. J., J. M. Park, and J. W. Yang. 1998. Continuous production of galacto-oligosaccharides from lactose by Bullera singularis b-galactosidase immobilized in chitosan beads. Process Biochem. 33:787-792. 35. Shin, H. J. and J. W. Yang. 1998. Enzymatic production of galactooligosaccharide by Bullera singularis b-galactosidase. J. Microbiol. Biotechnol. 8:484-489. 36. Temple, L. M., A. A. Weiss, K. E. Walker, H. J. Barnes, V. L. Christensen, D. M. Mlyamoto, C. B. Shelton, and P. E. Orndorff. 1998. Bordetella avium virulence measured in vivo and in vitro. Infect. Immun. 66:5244-5251. 37. Torres, D. P. M., M. D. F. Gonqalves, J. A. Teixeira, and L. R. Rodrigues. 2010. Galacto-oligosaccharides: Production, properties, applications, and significance as prebiotics. Compr. Rev. Food Sci. Food Saf. 9:438-454.
(159) It is to be understood that, while the invention has been described in conjunction with the detailed description, thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications of the invention are within the scope of the claims set forth below. All publications, patents, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
(160) TABLE-US-00010 8.SEQUENCE LISTING >gi|345649663|gb|JF298281.1| Syntheticconstructbeta-hexosyltransferase (bglA)gene,partialcds SEQIDNO.1 ATGATGCTGCATGCTGCACTGCTAGTAGCGCTGCCATGTGTTGTTTTGGCGCGCCCGGCCGGAGCGGTTA CTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATTACGAAACCCCAAGTCCGACAGCAATCCCGCT GGAGCCAACACCGACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTTAGTCGAAGCTCAGTAC CCAGTTCAAACTGCTGCAGTGACAACTTTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCAC CGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAGGGGTTTAAGTT TGGTGTTGCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGGCCCAAGTACCTGG GATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAACAATTATGATCCCGATATTACAACCAACCATT ACTACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCATTAACACTTACTCGTTTTCAATTTC ATGGACGCGTATTTATCCATTGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGATGCCGTA ATCCATAGTGCCAAGAAGTATGGTCTGGAACCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCTC TGATGCTGAAATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTTACCTATGCCAC AACTGTGTTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCTGT TCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGAAGGTATTAACAGCACCTCCGCTGTATTTC GTTGCACCTACAATGTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTATCGGGATCTAGTTGCCTCCGG GACCATTGCGGCAGGTGAAATCGGCTTTAAATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAAC GCCGATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTATG GTAATGGCGATTATCCAGATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACGGATGAAGA TAAAGGATACATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTATCGTACCGATATTTCCCATGCG GCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTGGCCAGTGTGTGAAGAAGGGT CAGATCCTTTTGCTCATGTTTACCCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTCATG GTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAAGTTTCTGACACAAACCTACCCTGCTAAGGGT GGTATTTATTTCTCGGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATTA CCTGGGATGGTCTGCGTACGCAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGA CGGGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGGGAGTGGGGTTTAGGGATGCAA CAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCCGATCTGACACGCACGTTTAAACTGAGCGCTC ACGCTTACGCCCAATTTGGGCGTAATCATCTG >gi|345649664|gb|AEO14215.1| beta-hexosyltransferase[syntheticconstruct] SEQIDNO.2 MMLHAALLVALPCVVLARPAGAVTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQY PVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTW DYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAV IHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFC SQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGN ADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHA ALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKG GIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQ QKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL FP#1aMF-6XHIS-TEV(Q/M)-rBHT(XhoI-NotI) SEQIDNO.3 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTCACCACCACCACCACCACGAAAACCTGTATTTT CAGATGATGCTGCATGCTGCACTGCTAGTAGCGCTGCCATGTGTTGTTTTGGCGCGCCCG GCCGGAGCGGTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATTACGAAACC CCAAGTCCGACAGCAATCCCGCTGGAGCCAACACCGACGGCTACCGGTACAGCAGAATTA GATGCGCTGTGGAACTTAGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACT TTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCACCGAGTTATGCATTAGCA GGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTT GCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGGCCCAAGTACC TGGGATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAACAATTATGATCCCGATATT ACAACCAACCATTACTACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCATT AACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCATTGGGCGCAGGCTATGTT AATGAAGCAGGGTTAGCCCACTATGATGCCGTAATCCATAGTGCCAAGAAGTATGGTCTG GAACCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGAAATACGGT GCCTGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTTACCTATGCCACAACTGTG TTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTC TGTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGAAGGTATTAACAGCACC TCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAAGCTCATGGTCATGCTGTTAAAGTG TATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAAATCCGAT GATAACTACCCAATCCCGGCCCGTCCAGGGAACGCCGATGACGAGGAATCAGCCAAGCGT CACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCA GATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACGGATGAAGATAAAGGA TACATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTATCGTACCGATATTTCCCAT GCGGCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTGGCCAGTG TGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCCGGGTTTGCTATTGGTCAA TCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTG AAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTCGGAATTTGGTTGG GCTGAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATTACCTGGGATGGTCTGCGT ACGCAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGGGATT AATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGGGAGTGGGGTTTAGGGATG CAACAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCCGATCTGACACGCACGTTT AAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTGTAA FP#1aMF-6XHIS-TEV(Q/M)-rBHT SEQIDNO.4 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAHHHHHHENLYFQMMLHAALLVALPCVVLARP AGAVTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTT LVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPST WDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYV NEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTV FKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKV YRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPV CEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGW AEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGM QQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHL FP#2aMF-6XHIS-TEV(Q/M)-aMF-rBHT-6XHIS(XhoI-NotI) SEQIDNO.5 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTCACCACCACCACCACCACGAAAACCTGTATTTT CAGATGATGCTGCATGCTGCACTGCTAGTAGCGCTGCCATGTGTTGTTTTGGCGCGCCCG GCCGGAGCGGTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATTACGAAACC CCAAGTCCGACAGCAATCCCGCTGGAGCCAACACCGACGGCTACCGGTACAGCAGAATTA GATGCGCTGTGGAACTTAGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACT TTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCACCGAGTTATGCATTAGCA GGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTT GCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGGCCCAAGTACC TGGGATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAACAATTATGATCCCGATATT ACAACCAACCATTACTACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCATT AACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCATTGGGCGCAGGCTATGTT AATGAAGCAGGGTTAGCCCACTATGATGCCGTAATCCATAGTGCCAAGAAGTATGGTCTG GAACCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGAAATACGGT GCCTGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTTACCTATGCCACAACTGTG TTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTC TGTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGAAGGTATTAACAGCACC TCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAAGCTCATGGTCATGCTGTTAAAGTG TATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAAATCCGAT GATAACTACCCAATCCCGGCCCGTCCAGGGAACGCCGATGACGAGGAATCAGCCAAGCGT CACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCA GATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACGGATGAAGATAAAGGA TACATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTATCGTACCGATATTTCCCAT GCGGCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTGGCCAGTG TGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCCGGGTTTGCTATTGGTCAA TCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTG AAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTCGGAATTTGGTTGG GCTGAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATTACCTGGGATGGTCTGCGT ACGCAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGGGATT AATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGGGAGTGGGGTTTAGGGATG CAACAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCCGATCTGACACGCACGTTT AAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTGCACCACCACCACCAC CACTAA FP#2aMF-6XHIS-TEV(Q/M)-aMF-rBHT-6XHIS SEQIDNO.6 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAHHHHHHENLYFQMMLHAALLVALPCVVLARP AGAVTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTT LVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPST WDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYV NEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTV FKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKV YRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYP DVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPV CEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGW AEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGM QQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH FP#3aMF-rBHT-6XHIS(XhoI-NotI) SEQIDNO.7 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTATGATGCTGCATGCTGCACTGCTAGTAGCGCTG CCATGTGTTGTTTTGGCGCGCCCGGCCGGAGCGGTTACTTATCCGGGAGCCATTCCTCTG TCCCTGACGAGCAATTACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACACCG ACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTTAGTCGAAGCTCAGTACCCA GTTCAAACTGCTGCAGTGACAACTTTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCA GATCCACCGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTT CCAAAGGGGTTTAAGTTTGGTGTTGCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAA GCCGAAGGGCGGGGCCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACGCAG TGTAACAATTATGATCCCGATATTACAACCAACCATTACTACCTGTACCCATTGGACTTT GCGCGCCTGCAACACCTAGGCATTAACACTTACTCGTTTTCAATTTCATGGACGCGTATT TATCCATTGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGATGCCGTAATC CATAGTGCCAAGAAGTATGGTCTGGAACCAGTGGGCACCGTTTTTCACTGGGATACGCCA CTGTCTCTGATGCTGAAATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGGAC TTTGTTACCTATGCCACAACTGTGTTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTT ACTTTCAATGAACCACGGGTTTTCTGTTCACAAAATAGTGGTCTGCCATACAATCTGACG TATCCAGAAGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAA GCTCATGGTCATGCTGTTAAAGTGTATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCA GGTGAAATCGGCTTTAAATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCC GATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCG GTTTATGGTAATGGCGATTATCCAGATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCG GCCCTGACGGATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTTGCGATTGAC GGGTATCGTACCGATATTTCCCATGCGGCTCTGAACGGGATCGCGAATTGTATTCGCAAC CAAAGTGACCCGAATTGGCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTAC CCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCA GCCCCGTTTATCCGCGATCAACTGAAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGT ATTTATTTCTCGGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTGCTGTAT CAAATTACCTGGGATGGTCTGCGTACGCAATACCTGACGGACTATCTGAGCCAGCTGCTG TTGGCTGTGCACAAAGACGGGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGAT AATTGGGAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGTTTGTTAATCAATCA GATCCCGATCTGACACGCACGTTTAAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGT AATCATCTGCACCACCACCACCACCACTAA FP#3aMF-rBHT-6XHIS SEQIDNO.8 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAMMLHAALLVALPCVVLARPAGAVTYPGAIPL SLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEA DPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQ CNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVI HSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWF TFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAA GEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLP ALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVY PSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLY QITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQS DPDLTRTFKLSAHAYAQFGRNHLHHHHHH FP#4aMF-rBHT(XhoI-NotI) SEQIDNO.9 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTATGATGCTGCATGCTGCACTGCTAGTAGCGCTG CCATGTGTTGTTTTGGCGCGCCCGGCCGGAGCGGTTACTTATCCGGGAGCCATTCCTCTG TCCCTGACGAGCAATTACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACACCG ACGGCTACCGGTACAGCAGAATTAGATGCGCTGTGGAACTTAGTCGAAGCTCAGTACCCA GTTCAAACTGCTGCAGTGACAACTTTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCA GATCCACCGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTT CCAAAGGGGTTTAAGTTTGGTGTTGCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAA GCCGAAGGGCGGGGCCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACGCAG TGTAACAATTATGATCCCGATATTACAACCAACCATTACTACCTGTACCCATTGGACTTT GCGCGCCTGCAACACCTAGGCATTAACACTTACTCGTTTTCAATTTCATGGACGCGTATT TATCCATTGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGATGCCGTAATC CATAGTGCCAAGAAGTATGGTCTGGAACCAGTGGGCACCGTTTTTCACTGGGATACGCCA CTGTCTCTGATGCTGAAATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGGAC TTTGTTACCTATGCCACAACTGTGTTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTT ACTTTCAATGAACCACGGGTTTTCTGTTCACAAAATAGTGGTCTGCCATACAATCTGACG TATCCAGAAGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAA GCTCATGGTCATGCTGTTAAAGTGTATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCA GGTGAAATCGGCTTTAAATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCC GATGACGAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCG GTTTATGGTAATGGCGATTATCCAGATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCG GCCCTGACGGATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTTGCGATTGAC GGGTATCGTACCGATATTTCCCATGCGGCTCTGAACGGGATCGCGAATTGTATTCGCAAC CAAAGTGACCCGAATTGGCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTAC CCATCCGGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCA GCCCCGTTTATCCGCGATCAACTGAAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGT ATTTATTTCTCGGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTGCTGTAT CAAATTACCTGGGATGGTCTGCGTACGCAATACCTGACGGACTATCTGAGCCAGCTGCTG TTGGCTGTGCACAAAGACGGGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGAT AATTGGGAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGTTTGTTAATCAATCA GATCCCGATCTGACACGCACGTTTAAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGT AATCATCTGTAA FP#4aMF-rBHT SEQIDNO.10 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAMMLHAALLVALPCVVLARPAGAVTYPGAIPL SLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEA DPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQ CNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVI HSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWF TFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAA GEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLP ALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVY PSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLY QITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQS DPDLTRTFKLSAHAYAQFGRNHL FP#5aMF-rBHT(1-22)-6XHIS(XhoI-NotI) SEQIDNO.11 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTGTTACTTATCCGGGAGCCATTCCTCTGTCCCTG ACGAGCAATTACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACACCGACGGCT ACCGGTACAGCAGAATTAGATGCGCTGTGGAACTTAGTCGAAGCTCAGTACCCAGTTCAA ACTGCTGCAGTGACAACTTTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCA CCGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAG GGGTTTAAGTTTGGTGTTGCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAA GGGCGGGGCCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAAC AATTATGATCCCGATATTACAACCAACCATTACTACCTGTACCCATTGGACTTTGCGCGC CTGCAACACCTAGGCATTAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCA TTGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGATGCCGTAATCCATAGT GCCAAGAAGTATGGTCTGGAACCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCT CTGATGCTGAAATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTT ACCTATGCCACAACTGTGTTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTC AATGAACCACGGGTTTTCTGTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCA GAAGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAAGCTCAT GGTCATGCTGTTAAAGTGTATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAA ATCGGCTTTAAATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCCGATGAC GAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTAT GGTAATGGCGATTATCCAGATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTG ACGGATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTAT CGTACCGATATTTCCCATGCGGCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGT GACCCGAATTGGCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCC GGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCG TTTATCCGCGATCAACTGAAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTAT TTCTCGGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATT ACCTGGGATGGTCTGCGTACGCAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCT GTGCACAAAGACGGGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGG GAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCC GATCTGACACGCACGTTTAAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCAT CTGCACCACCACCACCACCACTAA FP#5aMF-rBHT(1-22)-6XHIS SEQIDNO.12 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAVTYPGAIPLSLTSNYETPSPTAIPLEPTPTA TGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFAR LQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLS LMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYP EGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADD EESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGY RTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAP FIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLA VHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNH LHHHHHH FP#6aMF-rBHT(1-22)(XhoI-NotI) SEQIDNO.13 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTGTTACTTATCCGGGAGCCATTCCTCTGTCCCTG ACGAGCAATTACGAAACCCCAAGTCCGACAGCAATCCCGCTGGAGCCAACACCGACGGCT ACCGGTACAGCAGAATTAGATGCGCTGTGGAACTTAGTCGAAGCTCAGTACCCAGTTCAA ACTGCTGCAGTGACAACTTTGGTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCA CCGAGTTATGCATTAGCAGGGTATGAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAG GGGTTTAAGTTTGGTGTTGCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAA GGGCGGGGCCCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAAC AATTATGATCCCGATATTACAACCAACCATTACTACCTGTACCCATTGGACTTTGCGCGC CTGCAACACCTAGGCATTAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCA TTGGGCGCAGGCTATGTTAATGAAGCAGGGTTAGCCCACTATGATGCCGTAATCCATAGT GCCAAGAAGTATGGTCTGGAACCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCT CTGATGCTGAAATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTT ACCTATGCCACAACTGTGTTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTC AATGAACCACGGGTTTTCTGTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCA GAAGGTATTAACAGCACCTCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAAGCTCAT GGTCATGCTGTTAAAGTGTATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAA ATCGGCTTTAAATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCCGATGAC GAGGAATCAGCCAAGCGTCACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTAT GGTAATGGCGATTATCCAGATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTG ACGGATGAAGATAAAGGATACATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTAT CGTACCGATATTTCCCATGCGGCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGT GACCCGAATTGGCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCC GGGTTTGCTATTGGTCAATCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCG TTTATCCGCGATCAACTGAAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTAT TTCTCGGAATTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATT ACCTGGGATGGTCTGCGTACGCAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCT GTGCACAAAGACGGGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGG GAGTGGGGTTTAGGGATGCAACAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCC GATCTGACACGCACGTTTAAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCAT CTGTAA FP#6aMF-rBHT(1-22) SEQIDNO.14 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAVTYPGAIPLSLTSNYETPSPTAIPLEPTPTA TGTAELDALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPK GFKFGVAGAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFAR LQHLGINTYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLS LMLKYGAWQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYP EGINSTSAVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADD EESAKRHEAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGY RTDISHAALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAP FIRDQLKFLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLA VHKDGINLRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNH L FP#7rBHT-6XHIS(BamHI-NotI) Seq.IDNo.15 ATGATGCTGCATGCTGCACTGCTAGTAGCGCTGCCATGTGTTGTTTTGGCGCGCCCGGCC GGAGCGGTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATTACGAAACCCCA AGTCCGACAGCAATCCCGCTGGAGCCAACACCGACGGCTACCGGTACAGCAGAATTAGAT GCGCTGTGGAACTTAGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACTTTG GTGACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCACCGAGTTATGCATTAGCAGGG TATGAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTTGCG GGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGGCCCAAGTACCTGG GATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAACAATTATGATCCCGATATTACA ACCAACCATTACTACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCATTAAC ACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCATTGGGCGCAGGCTATGTTAAT GAAGCAGGGTTAGCCCACTATGATGCCGTAATCCATAGTGCCAAGAAGTATGGTCTGGAA CCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGAAATACGGTGCC TGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTTACCTATGCCACAACTGTGTTT AAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCTGT TCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGAAGGTATTAACAGCACCTCC GCTGTATTTCGTTGCACCTACAATGTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTAT CGGGATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAAATCCGATGAT AACTACCCAATCCCGGCCCGTCCAGGGAACGCCGATGACGAGGAATCAGCCAAGCGTCAC GAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCAGAT GTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACGGATGAAGATAAAGGATAC ATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTATCGTACCGATATTTCCCATGCG GCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTGGCCAGTGTGT GAAGAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCCGGGTTTGCTATTGGTCAATCA GCCGATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAAG TTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTCGGAATTTGGTTGGGCT GAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATTACCTGGGATGGTCTGCGTACG CAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGGGATTAAT CTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGGGAGTGGGGTTTAGGGATGCAA CAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCCGATCTGACACGCACGTTTAAA CTGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTGCACCACCACCACCACCAC TAA FP#7rBHT-6XHIS SEQIDNO.16 MMLHAALLVALPCVVLARPAGAVTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELD ALWNLVEAQYPVQTAAVTTLVTVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVA GAAIQVEGAAKAEGRGPSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGIN TYSFSISWTRIYPLGAGYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGA WQDTGDQIVKDFVTYATTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTS AVFRCTYNVLKAHGHAVKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRH EAFRIGIFAQPVYGNGDYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHA ALNGIANCIRNQSDPNWPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLK FLTQTYPAKGGIYFSEFGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGIN LRGALTWSFVDNWEWGLGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH FP#8rBHT(1-22)-6XHIS(BamHI-NotI) SEQIDNO.17 ATGGTTACTTATCCGGGAGCCATTCCTCTGTCCCTGACGAGCAATTACGAAACCCCAAGT CCGACAGCAATCCCGCTGGAGCCAACACCGACGGCTACCGGTACAGCAGAATTAGATGCG CTGTGGAACTTAGTCGAAGCTCAGTACCCAGTTCAAACTGCTGCAGTGACAACTTTGGTG ACAGTGCCCGATGATTATAAGTTTGAGGCAGATCCACCGAGTTATGCATTAGCAGGGTAT GAAACAAGCGAGATTGCCGGACTGAAGTTTCCAAAGGGGTTTAAGTTTGGTGTTGCGGGG GCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGGCCCAAGTACCTGGGAT TATCTGTGTCATCACTATGCCAGCACGCAGTGTAACAATTATGATCCCGATATTACAACC AACCATTACTACCTGTACCCATTGGACTTTGCGCGCCTGCAACACCTAGGCATTAACACT TACTCGTTTTCAATTTCATGGACGCGTATTTATCCATTGGGCGCAGGCTATGTTAATGAA GCAGGGTTAGCCCACTATGATGCCGTAATCCATAGTGCCAAGAAGTATGGTCTGGAACCA GTGGGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTGAAATACGGTGCCTGG CAAGATACTGGTGACCAAATTGTTAAGGACTTTGTTACCTATGCCACAACTGTGTTTAAG CGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTCAATGAACCACGGGTTTTCTGTTCA CAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGAAGGTATTAACAGCACCTCCGCT GTATTTCGTTGCACCTACAATGTTCTGAAAGCTCATGGTCATGCTGTTAAAGTGTATCGG GATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTTAAATCCGATGATAAC TACCCAATCCCGGCCCGTCCAGGGAACGCCGATGACGAGGAATCAGCCAAGCGTCACGAG GCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTATGGTAATGGCGATTATCCAGATGTT GTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACGGATGAAGATAAAGGATACATT AAAGGTAGCGGAGATATTTTTGCGATTGACGGGTATCGTACCGATATTTCCCATGCGGCT CTGAACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAATTGGCCAGTGTGTGAA GAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCCGGGTTTGCTATTGGTCAATCAGCC GATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCGTTTATCCGCGATCAACTGAAGTTT CTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTCGGAATTTGGTTGGGCTGAA GACGCCGAATATGATCGTCAACTGCTGTATCAAATTACCTGGGATGGTCTGCGTACGCAA TACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAAGACGGGATTAATCTG CGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGGGAGTGGGGTTTAGGGATGCAACAG AAATTCGGATTTCAGTTTGTTAATCAATCAGATCCCGATCTGACACGCACGTTTAAACTG AGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTGCACCACCACCACCACCACTAA FP#8rBHT(1-22)-6XHIS SEQIDNO.18 MVTYPGAIPLSLTSNYETPSPTAIPLEPTPTATGTAELDALWNLVEAQYPVQTAAVTTLV TVPDDYKFEADPPSYALAGYETSEIAGLKFPKGFKFGVAGAAIQVEGAAKAEGRGPSTWD YLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGAGYVNE AGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYATTVFK RYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHAVKVYR DLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNGDYPDV VKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPNWPVCE EGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSEFGWAE DAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWGLGMQQ KFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH FP#9aMF-rBHT(1-110)-6XHIS(EcoRI-NotI) SEQIDNO.19 ATGAGATTTCCTTCAATTTTTACTGCAGTTTTATTCGCAGCATCCTCCGCATTAGCTGCT CCAGTCAACACTACAACAGAAGATGAAACGGCACAAATTCCGGCTGAAGCTGTCATCGGT TACTCAGATTTAGAAGGGGATTTCGATGTTGCTGTTTTGCCATTTTCCAACAGCACAAAT AACGGGTTATTGTTTATAAATACTACTATTGCCAGCATTGCTGCTAAAGAAGAAGGGGTA TCTCTCGAGAAAAGAGAGGCTGAAGCTTACGTAGAATTCATGTTTCCAAAGGGGTTTAAG TTTGGTGTTGCGGGGGCAGCCATTCAAGTTGAAGGTGCAGCAAAAGCCGAAGGGCGGGGC CCAAGTACCTGGGATTATCTGTGTCATCACTATGCCAGCACGCAGTGTAACAATTATGAT CCCGATATTACAACCAACCATTACTACCTGTACCCATTGGACTTTGCGCGCCTGCAACAC CTAGGCATTAACACTTACTCGTTTTCAATTTCATGGACGCGTATTTATCCATTGGGCGCA GGCTATGTTAATGAAGCAGGGTTAGCCCACTATGATGCCGTAATCCATAGTGCCAAGAAG TATGGTCTGGAACCAGTGGGCACCGTTTTTCACTGGGATACGCCACTGTCTCTGATGCTG AAATACGGTGCCTGGCAAGATACTGGTGACCAAATTGTTAAGGACTTTGTTACCTATGCC ACAACTGTGTTTAAGCGTTATGGTAATGAAGTCAAGACGTGGTTTACTTTCAATGAACCA CGGGTTTTCTGTTCACAAAATAGTGGTCTGCCATACAATCTGACGTATCCAGAAGGTATT AACAGCACCTCCGCTGTATTTCGTTGCACCTACAATGTTCTGAAAGCTCATGGTCATGCT GTTAAAGTGTATCGGGATCTAGTTGCCTCCGGGACCATTGCGGCAGGTGAAATCGGCTTT AAATCCGATGATAACTACCCAATCCCGGCCCGTCCAGGGAACGCCGATGACGAGGAATCA GCCAAGCGTCACGAGGCTTTTCGCATTGGGATTTTTGCGCAACCGGTTTATGGTAATGGC GATTATCCAGATGTTGTTAAAGAAACTGTTGGAGATATGCTGCCGGCCCTGACGGATGAA GATAAAGGATACATTAAAGGTAGCGGAGATATTTTTGCGATTGACGGGTATCGTACCGAT ATTTCCCATGCGGCTCTGAACGGGATCGCGAATTGTATTCGCAACCAAAGTGACCCGAAT TGGCCAGTGTGTGAAGAAGGGTCAGATCCTTTTGCTCATGTTTACCCATCCGGGTTTGCT ATTGGTCAATCAGCCGATCCACTGTCTTCATGGTTAGTCAACTCAGCCCCGTTTATCCGC GATCAACTGAAGTTTCTGACACAAACCTACCCTGCTAAGGGTGGTATTTATTTCTCGGAA TTTGGTTGGGCTGAAGACGCCGAATATGATCGTCAACTGCTGTATCAAATTACCTGGGAT GGTCTGCGTACGCAATACCTGACGGACTATCTGAGCCAGCTGCTGTTGGCTGTGCACAAA GACGGGATTAATCTGCGAGGCGCGCTGACGTGGAGTTTTGTCGATAATTGGGAGTGGGGT TTAGGGATGCAACAGAAATTCGGATTTCAGTTTGTTAATCAATCAGATCCCGATCTGACA CGCACGTTTAAACTGAGCGCTCACGCTTACGCCCAATTTGGGCGTAATCATCTGCACCAC CACCACCACCACTAA FP#9aMF-rBHT(1-110)-6XHIS SEQIDNO.20 MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYSDLEGDFDVAVLPFSNSTN NGLLFINTTIASIAAKEEGVSLEKREAEAYVEFMFPKGFKFGVAGAAIQVEGAAKAEGRG PSTWDYLCHHYASTQCNNYDPDITTNHYYLYPLDFARLQHLGINTYSFSISWTRIYPLGA GYVNEAGLAHYDAVIHSAKKYGLEPVGTVFHWDTPLSLMLKYGAWQDTGDQIVKDFVTYA TTVFKRYGNEVKTWFTFNEPRVFCSQNSGLPYNLTYPEGINSTSAVFRCTYNVLKAHGHA VKVYRDLVASGTIAAGEIGFKSDDNYPIPARPGNADDEESAKRHEAFRIGIFAQPVYGNG DYPDVVKETVGDMLPALTDEDKGYIKGSGDIFAIDGYRTDISHAALNGIANCIRNQSDPN WPVCEEGSDPFAHVYPSGFAIGQSADPLSSWLVNSAPFIRDQLKFLTQTYPAKGGIYFSE FGWAEDAEYDRQLLYQITWDGLRTQYLTDYLSQLLLAVHKDGINLRGALTWSFVDNWEWG LGMQQKFGFQFVNQSDPDLTRTFKLSAHAYAQFGRNHLHHHHHH