PHARMACEUTICAL COMPOSITION OR FOOD COMPOSITION, AND METHOD FOR ASSESSING EFFECT OF ACTIVE INGREDIENT IN VIVO
20190382464 ยท 2019-12-19
Assignee
Inventors
Cpc classification
C12N2310/20
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N2800/80
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
C12Q2565/60
CHEMISTRY; METALLURGY
A61K48/00
HUMAN NECESSITIES
C07K2319/30
CHEMISTRY; METALLURGY
C12N15/1138
CHEMISTRY; METALLURGY
A61K31/713
HUMAN NECESSITIES
A61K31/7105
HUMAN NECESSITIES
A23L33/00
HUMAN NECESSITIES
International classification
C07K14/705
CHEMISTRY; METALLURGY
C12N9/22
CHEMISTRY; METALLURGY
C12N15/11
CHEMISTRY; METALLURGY
Abstract
An object of the present invention is to provide a pharmaceutical composition or food or drink composition comprising an active ingredient that suppresses functional expression of Oscar protein. Another object of the present invention is to provide a pharmaceutical composition or food composition for preventing or treating kidney disease A further object of the present invention is to provide a pharmaceutical composition or food or drink composition that suppresses functional expression of Oscar in a living organism in order to suppress functional expression of FGF23. A still further object of the present invention is to provide a method for evaluating an effect, in the body, of an active ingredient that suppresses functional expression of Oscar protein. The above objects are achieved by at least one member selected from the group consisting of antagonists of the Oscar protein; genome editing systems that target Oscar gene; at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA, or vectors capable of expressing the RNA molecule; and antibodies that specifically bind to the Oscar protein and suppress function of the Oscar.
Claims
1-22. (canceled)
23. A method for preventing or treating kidney disease comprising administering an active ingredient to an individual who needs prevention or treatment of kidney disease, wherein the active ingredient suppresses functional expression of Oscar protein.
24. The method according to claim 23, wherein the active ingredient is at least one member selected from the group consisting of antagonists of the Oscar protein; genome editing systems that target Oscar gene; at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA, or vectors capable of expressing the RNA molecule; and antibodies that specifically bind to the Oscar protein and suppress the function of the Oscar.
25. The method according to claim 24, wherein the active ingredient is an antagonist of the Oscar protein, and the antagonist is a soluble receptor of the Oscar.
26. The method according to claim 24, wherein the active ingredient is a genome editing system that targets the Oscar gene, and the genome editing system is a CRISPR/Cas9 system comprising a sequence that targets the Oscar gene.
27. A method for suppressing functional expression of FGF23 comprising administering an active ingredient to an individual who needs suppression of functional expression of FGF23, wherein the active ingredient suppresses functional expression of Oscar protein.
28. The method according to claim 27, wherein the active ingredient is at least one member selected from the group consisting of antagonists of the Oscar protein; genome editing systems that target Oscar gene; at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA, or vectors capable of expressing the RNA molecule; and antibodies that specifically bind to the Oscar protein and suppress the function of the Oscar.
29. The method according to claim 28, wherein the active ingredient is an antagonist of the Oscar protein, and the antagonist is a soluble receptor of the Oscar.
30. The method according to claim 28, wherein the active ingredient is a genome editing system that targets the Oscar gene, and the genome editing system is a CRISPR/Cas9 system comprising a sequence that targets the Oscar gene.
31. A method comprising administering an active ingredient to an individual who has a high measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens in a specimen, and/or a high measurement value of mRNA of the protein in a specimen, wherein the active ingredient suppresses functional expression of Oscar protein.
32. The method according to claim 31, wherein the active ingredient is at least one member selected from the group consisting of antagonists of the Oscar protein; genome editing systems that target Oscar gene; at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA, or vectors capable of expressing the RNA molecule; and antibodies that specifically bind to the Oscar protein and suppress the function of the Oscar.
33. The method according to claim 32, wherein the active ingredient is an antagonist of the Oscar protein, and the antagonist is a soluble receptor of the Oscar.
34. The method according to claim 32, wherein the active ingredient is a genome editing system that targets the Oscar gene, and the genome editing system is a CRISPR/Cas9 system comprising a sequence that targets the Oscar gene.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
DESCRIPTION OF EMBODIMENTS
1. Explanation of Terms
[0099] First, terms used in the present specification, claims, and abstract are explained. Unless otherwise stated, terms used in the present specification, claims, and abstract are in accordance with the definitions in this section.
[0100] Oscar mRNA as used herein includes, for example, RNA shown in Table 1, splicing variants of the RNA, and the RNA having SNPs. Oscar protein includes, for example, proteins translated from RNA shown in Table 1, splicing variants of the RNA, and the RNA having SNPs. Oscar gene includes, for example, genes indicated by the Gene IDs of Table 1.
TABLE-US-00001 TABLE 1 Animal species Ref. Seq. No.* Gene ID Mouse NM_001290377.1 232790 NM_175632.3 Rat NM_001184973.1 292537 XM_006228020.3 Human NM_206818.2 126014 NM_130771.4 NM_133169.4 NM_133168.4 NM_001282349.1 NM_001282350.1 *NCBI Reference Sequence Number
[0101] Functional expression means that original functions of Oscar proteins or FGF23 proteins are exhibited. For example, the functional expression of Oscar protein is a function to increase the expression of FGF23 mRNA; a function to activate osteoclasts via NFATc1; a function to activate immune cells via calcium release, immune cell maturation, inhibition of apoptosis, and antigen transport and antigen presentation by an MHC class II antigen; or a function to enhance a pro-inflammatory response via IL-8. Such a function of Oscar can be evaluated by a method described in the section 3. Evaluation of function of Oscar protein described later.
[0102] The functional expression of FGF23 protein is a function to suppress the expression of NaPi-2a and NaPi-2c in the kidneys, and suppress phosphorus reabsorption in the kidneys; a function to induce the expression of CYP24A1 while suppressing the expression of CYP27B1 in the kidneys and inhibit synthesis of 1,25-dihydroxyvitamin D, thereby suppressing phosphorus absorption in the intestinal tract; a function to suppress secretion of PTH from the parathyroid glands; or a function to induce the expression of Klotho in the kidneys and/or activate the function of Klotho.
[0103] Such a function of FGF23 protein is suppressed by suppressing the functional expression of Oscar protein.
[0104] Suppressing the functional expression refers to suppressing or decreasing exhibition of an aforementioned function of Oscar protein or FGF23 protein, and suppressing the expression of Oscar protein or FGF23 protein.
[0105] Active ingredient as used herein is not limited, as long as it can suppress the functional expression of Oscar protein in the body of an individual. Examples include antagonists of Oscar protein; genome editing systems that target Oscar gene; at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that targets Oscar mRNA or vectors capable of expressing the RNA molecule; at least one member selected from antibodies that specifically bind to Oscar protein and suppress function of the Oscar protein; and inhibitors of Oscar protein.
[0106] In the present invention, the antagonist may be a type that competitively inhibits a target (competitive inhibitory-type), or a type that non-competitively inhibits a target (non-competitive inhibitory-type). The antagonist is preferably a competitive inhibitory-type.
[0107] Examples of competitive inhibitory-type antagonists include substances that compete with a molecule for binding to Oscar protein as a target (hereinafter also referred to as competitive substances).
[0108] The antagonist is preferably, for example, a soluble receptor of Oscar protein. The soluble receptor comprises an amino acid sequence of a ligand-binding region in the Oscar protein. The soluble receptor may also comprise, for example, the Fc portion of an immunoglobulin or synthetic polymer polyethylene glycol (PEG) as a molecule other than the amino acid sequence of the ligand-binding region in the Oscar protein. In the case of humans, an example of the soluble receptor is the soluble receptor set forth in NP_996554.2 (SEQ ID NO: 1), which is capable of inhibiting activation of Oscar protein. In the case of humans, the soluble receptor comprises, among the sequence of the 1st to 228th amino acids of the amino acid sequence set forth in SEQ ID NO: 1, at least the sequence of the 1st to 220th amino acids, preferably the sequence of the 1st to 228th amino acids. The soluble receptor may comprise an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, still even more preferably at least 95% homology to the sequence of the 1st to 228th amino acids of the amino acid sequence set forth in SEQ ID NO; 1, in place of the amino acid sequence set forth in SEQ ID NO 1. The soluble receptor is preferably, for example, a soluble receptor comprising a peptide comprising the amino acid sequence set forth in SEQ ID NO: 2 or a peptide having the same amino acid sequence as the amino acid sequence of the peptide, except that one to three amino acids are substituted, deleted, or inserted, the amino acid sequence being capable of inhibiting activation of human Oscar. In the case, of mice, an example of the soluble receptor is the soluble receptor set forth in NP_783440.1 (SEQ ID NO: 3), which is capable of inhibiting activation of Oscar. The soluble receptor comprises, among the sequence of the 1st to 235th amino acids of the amino acid sequence set forth in SEQ ID NO: 3, at least the sequence of the 1st to 225th amino acids, and preferably the sequence of the 1st to 235th amino acids. The soluble receptor may comprise an amino acid sequence with at least 70%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, still even more preferably at least 95% homology to the sequence of the 1st to 235th amino acids of the amino acid sequence set forth in SEQ ID NO: 3, in place of the amino acid sequence set forth in SEQ ID NO: 3. The soluble receptor is preferably a soluble receptor comprising a peptide comprising the amino acid sequence set forth in SEQ ID NO: 4 or a peptide having the same amino acid sequence as the amino acid sequence of the peptide, except that one to three amino acids are substituted, deleted, or inserted, the amino acid sequence being capable of inhibiting activation of mouse Oscar.
[0109] When the antagonist is systemically administered, it can be administered in an amount of 0.01 to 1,000 mg/day per kg of body weight of an adult.
[0110] When the antagonist is locally administered, it can be administered in an amount of 0.01 to 100 mg per cm.sup.2 of target tissue.
[0111] Genome editing systems that target Oscar gene as used herein are not particularly limited, as long as they are systems that enable recombination to take place in the Oscar gene in the body of an individual. Examples include a CompoZr Zinc Finger Nuclease (ZFN) system, TAL effector nuclease (TALEN) system, Clustered regularly interspaced short palindromic repeats/CRISPR associated protein 9 (CRISPR/Cas9) system, and the like. A CRISPR/Cas9 system is preferable. A CRISPR/Cas9 system using a vector is preferable. In the CRISPR/Cas9 system using a vector, a nucleic acid encoding CRISPR and a nucleic acid encoding Cas9 may be located on different vectors, or one vector. The promoter for allowing CRISPR to function is not particularly limited, and is preferably a U6 promoter. The promoter for allowing Cas9 to function is not particularly limited, and is preferably a promoter that is expressed in mammalian cells, such as a cytomegalovirus promoter. As the CRISPR/Cas9 system, a commercially available vector such as pX330-U6-Chimeric_BB-CBh-hSpCas9 vector can be preferably used.
[0112] The sequence that targets Oscar gene (hereinafter also referred to as Oscar gene target sequence) to be incorporated into the CRISPR sequence is not limited, as long as it is a sequence that can be incorporated into guide RNA (also called gRNA or crRNA) by the CRISPR/Cas9 system, and transcribed to achieve recombination of the Oscar gene. It is generally said that a sequence of about 20 nucleotides in the 5 upstream region of nucleotide sequence NGG present in the Oscar gene can be selected as the Oscar gene target sequence. The Oscar gene target sequence can be designed using a known publicly available design tool, such as Optimized CRISPR design tool (website of Massachusetts Institute of Technology, Zhang Lab (http://crispr.mit.edu/)), E-CRISP (http://www.e-crisp.org/E-CRISP/(German Cancer Research Center)), ZiFiT Targeter (http://zifit.partners.org/ZiFit/(Zing Finger Consortium)), Cas9 design (http://cas9.cbi.pku.edu.cn (Peking University)), CRISPRdirect (http://crispr.dbcls.jp (University of Tokyo)), or CRISPR-P (http://cbi.hzau.edu.cn/crispr/ (Huazhong Agricultural University)).
[0113] Examples of sequences that target human Oscar gene include the sequences shown in
[0114] Moreover, when single nucleotide polymorphisms (SNPs) are present in a PAM sequence, it is preferable to avoid such a sequence. When SNPs of an individual are known, it is preferable to optimize the target sequence according to each SNP.
[0115] The selected sequence of 20 nucleotides may be 1, 2, 3, or 4 nucleotides shorter, preferably 1, 2, or 3 nucleotides shorter, in the 5 end region of the Oscar gene target sequence. The 5 end region of the Oscar gene target sequence may include a sequence of one or two nucleotides upstream of a sequence shown in
[0116] The CRISPR/Cas9 system may be transfected into cells as a vector. Alternatively, a combination of gRNA, trans-activating crRNA (tracrRNA), and RNA encoding Cas9 artificially synthesized or synthesized by in vitro transcription may be introduced into cells.
[0117] Further, in the genome editing system, donor oligo DNA, such as single-stranded oligodeoxynucleotides (ssODNs), may be co-introduced. The ssODNs can be designed by a known method.
[0118] When the genome editing system that targets Oscar gene is administered to an individual, it may be administered systemically or locally. In the case of systemic administration, it is preferably administered intravenously. When the genome editing system is a system in which a nucleic acid based on DNA, for example, a lentivirus-derived or adenovirus-derived vector that can be expressed in an individual may be used as a vector. In addition, the vector may be administered to an individual with a nucleic acid delivery reagent, such as a liposome. When the genome editing system is a system in which a nucleic acid based on RNA, a vector may be administered with a liposome. Such a vector is preferably linearized as necessary.
[0119] When the genome editing system is administered systemically, it can be administered in an amount of 10.sup.10 to 10.sup.18 vg/day per kg of body weight of an adult.
[0120] When the genome editing system is administered locally, a vector or RNA can be injected into target tissue using a syringe or a catheter. In this case, a nucleic acid delivery reagent, such as a liposome, may also be used. In the case of local administration, the genome editing system can be administered in an amount of 10.sup.9 to 10.sup.16 vg/day per cm.sup.2 of target tissue.
[0121] In both systemic administration and local administration, the genome editing system can be administered in a single dose, or multiple doses. When the genome editing system is administered in multiple doses, the administration can be repeated every three days, every five days, or every other week. When the genome editing system is administered in multiple doses, it can be administered twice, 5 times, 10 times, 15 times, 20 times, or 24 times.
[0122] In this embodiment, RNA molecule that target Oscar mRNA is not particularly limited, as long as it can target Oscar mRNA and suppress expression of the Oscar protein. Examples include RNA molecules that have an action to degrade target mRNA, such as siRNA, shRNA, dsRNA, or miRNA; and/or RNA molecules that suppress translation of target MRNA. The sequences of these RNA molecules can be appropriately designed by a person skilled in the art according to a known method on the basis of information regarding the nucleotide sequence of the target gene described above. The RNA molecules may be prepared based on a known method, or commercially available RNA molecules may be used. As the RNA molecules, siRNA, shRNA, and miRNA are preferable, and siRNA and shRNA are particularly preferable.
[0123] The vector capable of expressing the RNA molecule that targets Oscar mRNA is not particularly limited, as long as it is capable of expressing the RNA molecule that suppresses the expression of the Oscar protein, in the body of an individual or in cells. An example of the vector is a vector expressing hairpin RNA. The vector expressing hairpin RNA comprises, for example, at least a sense strand DNA nucleotide sequence having the same sequence as the sense strand of target mRNA (note that uracil in mRNA is replaced by thymine); a loop nucleotide sequence that forms a loop structure after transcription; an antisense strand DNA nucleotide sequence capable of complementarily binding to all or a portion of the sense strand DNA nucleotide sequence; and a terminator sequence, downstream of a promoter nucleotide sequence suitable for expression of short RNA, such as a U6 promoter. Examples of vectors include plasmid vectors, adenovirus vectors, retrovirus vectors, lentivirus vectors, and the like.
[0124] When at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA or a vector capable of expressing the RNA molecule is administered systemically, it can be administered in an amount of 0.1 to 1,000 mg/day per kg of body weight of an adult. The vector can be linearized as necessary.
[0125] When at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA or a vector capable of expressing the RNA molecule is administered locally, the vector or RNA can be injected into target tissue using a syringe or a catheter. In this case, a nucleic acid delivery reagent, such as a liposome, may also be used. In the case of local administration, the RNA or vector can be administered in an amount of 0.01 to 100 mg/day per cm.sup.2 of target tissue.
[0126] In both systemic administration and local administration, at least one RNA molecule selected from the group consisting of siRNA, shRNA, and miRNA that target Oscar mRNA or a vector capable of expressing the RNA molecule can be administered in a single dose, or multiple doses. When the RNA or vector is administered in multiple doses, the administration can be repeated every three days, every five days, or every other week. When the RNA or vector is, administered in multiple doses, it can be administered twice, 5 times, 10 times, 15 times, 20 times, or 24 times.
[0127] In the present invention, antibodies that bind to the Oscar protein are not limited, as long as they can specifically bind to the Oscar protein, and suppress the functional expression of the protein. The antibodies may be polyclonal antibodies or monoclonal antibodies. The polyclonal antibodies and monoclonal antibodies can be suitably prepared by a person skilled in the art according to a known method. When the antibodies are monoclonal antibodies, they may be chimeric antibodies, humanized antibodies, or human antibodies prepared by a known method. The antibodies may also be antibody fragments, such as Fab, F(ab).sub.2, a diabody, scFv, a minibody, a peptibody, or a mimetibody. Examples of antibodies that bind to the Oscar protein include antibodies described in WO2013/011059A1.
[0128] When an antibody that binds to the Oscar protein is administered systemically, it can be administered in an amount of 0.01 to 1,000 mg/day per kg of body weight of an adult.
[0129] When an antibody that binds to the Oscar protein is administered locally, it can be administered in an amount of 0.01 to 100 mg per cm.sup.2 of target tissue.
[0130] Kidney disease as used herein refers to any abnormality or disease of the kidneys that causes declined kidney function, and is not particularly limited as long as there is some impairment in the kidneys functionally or physically. Specific examples include acute kidney disease such as acute renal failure, acute pyelonephritis, acute glomerulonephritis (e.g., glomerulonephritis accompanied by hemolytic streptococcal infection, and rapidly progressive glomerulonephritis), and acute disease (e.g., cardiorenal syndrome type 1) among kidney disease accompanied by heart disease; chronic kidney disease such as chronic pyelonephritis, reflux nephropathy, interstitial nephritis, polycystic kidney disease, chronic glomerulonephritis (e.g., IgA nephropathy and glomerulonephritis due to systemic lupus erythematosus (lupus nephritis)), chronic disease (e.g., cardiorenal syndrome type 2) among kidney disease accompanied by heart disease, diabetic nephropathy, kidney glomerular fibrosis, and like chronic nephritis; nephrotic syndrome; and kidney tumor; and like. The kidney disease is preferably acute kidney disease. As another embodiment, the kidney disease is preferably kidney disease accompanied by ischemic heart disease, particularly acute kidney disease accompanied by ischemic heart disease (e.g., cardiorenal syndrome type 1). The kidney disease is preferably at least one disease selected from the group consisting of declined kidney function, chronic kidney disease, and renal failure.
[0131] Declined kidney function as used herein refers to, in the case of humans, a condition in which, for example, at least one kidney disease marker (preferably other than urinary proteins) shown in Tables 2-1 to 2-3 below, which are generally measured in clinical examination, falls outside a threshold range. More preferably, the kidney disease marker is at least one member selected from the group consisting of serum urea nitrogen, serum creatinine, serum inorganic phosphorus, fibrinogen in urine, creatinine clearance, 24-hour creatinine clearance estimated glomerular filtration rate (eGFR), urea clearance, inulin clearance, sodium thiosulfate clearance, renal plasma flow, filtration fraction, fractional excretion of sodium, fractional excretion of lithium, phenolsulfonphthalein test, concentration test, dilution test, free water clearance, free water reabsorption, maximal tubular excretory capacity, maximal tubular reabsorption capacity, rate of phosphate reabsorption, 2-microglobulin, and 1-microglobulin,
[0132] Declined kidney function as used herein refers to, in the case of humans, a condition in which, for example, at least one kidney disease marker shown in Tables 2-1 to 2-3 below falls outside a threshold range.
TABLE-US-00002 TABLE 2-1 Item Threshold Unit Measurement method Serum Total protein 6.7 to 7.8 g/dl Biuret method Albumin 3.8 to 5.3 mg/dl BCG method Urea nitrogen 8 to 20 mg/dl Urease-GLDH method Creatinine Male: 0.6 to 1.0 mg/dl Enzymatic method Female: 0 4 to 0.8 Uric add Male: 3 to 7.7 mg/dl Uricase-POD method Female: 2 to 7.7 Ammonia 12 to 66 g/dl GLDH method Sodium 136 to 145 mEq/l ISE Potassium 3.4 to 4.5 mEq/l ISE Chlorine 100 to 108 mEq/l ISE Total calcium 8.6 to 10.1 mg/dl OCPC method Magnesium 1.8 to 2.3 mg/dl Enzymatic method Inorganic Adult: 2.2 to 4.1 mg/dl Enzymatic method phosphorus Child: 4.0 to 7.0 Copper 71 to 132 g/dl Chelate colorimetric method Amylase 40 to 126 IU/l JSCC standardization corresponding method FGF23 Full-length assay pg/ml ELISA threshold: 10 to 50 RU/ml C-terminal assay threshold: 150 Whole Red blood cell count Male: 414 to 563 10.sup.4/l Electrical resistance- blood Female: 373 to 495 type automatic blood cell counter Hemoglobin Male: 12.9 to 17.4 g/dl Oxyhemoglobin Female: 10.7 to 15.3 method Pyruvic acid 0.30 to 0.94 mg/dl Enzymatic method
TABLE-US-00003 TABLE 2-2 Item Threshold Unit Measurement method Arterial blood O.sub.2 saturation SaO.sub.2 94 to 99 % gas O.sub.2 partial pressure PaO.sub.2 80 to 100 Torr analysis/acid- CO.sub.2 partial pressure PaCO.sub.2 35 to 45 Torr base pH 7.35 to 7.45 equilibrium HCO.sub.3.sup. 22 to 26 mEq/l Base excess (BE) 2.2 to +2.2 mEq/l Buffer base (BB) 46 to 52 mEq/l Standard bicarbonate 21 to 25 mEq/l (SB) Urine Urinary output 600 to 1,600 ml/day Specific gravity (spot urine) 1.006 to 1.030 pH 4.5 to 7.5 Urinary protein 20 to 120 mg/day Pyrogallol red-Mo coloring method Albumin 5.7 2.6 mg/day Glucose 2 to 20 mg/dl Urinary Red blood cell count <5 /400x field sediment Leukocyte count <5 Epithelial cell count Less than 1 (excluding squamous epithelium) Cast count <1
TABLE-US-00004 TABLE 2-3 Item Threshold Unit Measurement method Kidney Creatinine clearance (Ccr) 70 to 130 ml/min function 24-Hour creatinine clearance Male: 62 to 108 ml/ min Female: 57 to 78 Glomerular filtration rate (GFR) Male: 129 26 ml/min Female: 97 13 Urea clearance Maximum clearance: ml/min 62 to 77 Standard clearance: 45 to 55 Inulin clearance (GFR) Male: 72 to 176 ml/min/1.73 m.sup.2 Female: 81 to 137 ml/min/1.73 m.sup.2 Sodium thiosulfate clearance Male: 90 to 138 ml/min Female: 86 to 120 Renal plasma flow (RPF) 350 to 650 ml/min C.sub.PAII Filtration fraction (FF) 0.18 to 0.22 GRF/RPF Fractional excretion of sodium 1 % Fractional excretion of lithium 20 to 30 % Phendsulfonphthalein (PSP) test 100 mOsm/kg 15 min value: 25 % 120 min value: 55 % Concentration test 1.025 (Specific Fishberg gravity) Dilution test 1.006 (Specific Fishberg gravity) Free water clearance At the time of water ml/min diuresis: 13 to 15 Free water reabsorption At the time of ml/min concentration: 1.5 to 2.0 Maximal tubular excretory 81 11 mg/min/1.48 m.sup.2 T.sub.mPAII capacity Maximal tubular reabsorption 340 18 mg/min/1.48 m.sup.2 T.sub.mPAII capacity Rate of phosphate reabsorption 80 to 96 % %TRP .sub.2- Microglobulin Serum: 0.8 to 0.2 mg/l LPIA Urine: 11 to 253 g/day LPIA (30 to 340) (g/l) .sub.1- Microglobulin Serum: 10 to 30 mg/l EIA Urine: 1.8 0.9 mg/l EIA
[0133] The kidney disease markers described above can he measured according to known methods described in, for example, Kanai's Manual of Clinical Laboratory Medicine, Revised 32nd Edition (edited by Masamitsu Kanai; Kanehara & Co., Ltd.).
[0134] Acute renal failure as used herein is a disease in which kidney function is rapidly declined. For example, acute renal failure is a disease in which the serum creatinine value is rapidly increased to 2.0 to 2.5 mg/dl or more (a disease in which the serum creatinine value is increased by 50% or more compared to the previous value when there is underlying declined kidney failure), or a disease in which the serum creatinine value is increased at a rate of 0.5 mg/dl/day or more and urea nitrogen is increased at a rate of 10 mg/dl/day or more. Acute renal failure includes (1) prerenal acute renal failure, caused by a decrease in renal bloodflow; (2) renal acute renal failure, in which there is damage in the renal parenchyma; and (3) postrenal acute renal failure, caused by urine flow disorder downstream of the kidneys. Acute renal function to which the present invention is preferably applied is prerenal acute renal failure and renal acute renal failure, and preferably prerenal acute renal failure.
[0135] Kidney disease accompanied by heart disease is also called cardiorenal syndrome. Cardiorenal syndrome includes acute and chronic clinical states, and is categorized into multiple types. Among these, type 1 and type 2 are triggered by heart disease. Type 1 is acute cardiorenal syndrome, and type 2 is chronic cardiorenal syndrome. Type 1 may be triggered by ischemic heart disease or the like.
[0136] Cardiorenal syndrome type 1 is a condition that falls under any of the following stages 1 to 3 due to some sort of heart disease: [0137] Stage 1: The serum creatinine value is increased to about 1.5 to 1.9 times the threshold, or the serum creatinine value is increased by 0.3 mg/dl or more compared to the previous value in the same individual, and the urinary output is about 0.5 ml/kg/hour over a period of 6 to 12 hours. [0138] Stage 2: The serum creatinine value is increased to about 2.0 to 2.9 times the threshold, and urinary output of less than 0.5 mL/kg/hour persists for 12 hours or more. [0139] Stage 3: The serum creatinine value is increased to about 3 times the threshold, the serum creatinine value is increased by 4.0 mg/dL or more compared to the previous value the same individual, renal replacement therapy is started, or eGFR is decreased to less than 35 mL/min/1.73 m.sup.2 in a patient under the age of 18; and, in addition to any of the above four conditions, urinary output of less than 0.3 mL/kg/hour persists for 24 hours or more, or anuria persists for 12 hours or more.
[0140] Chronic kidney disease as used herein refers to, when the subject is a human, a condition in which kidney damage (for example, urine abnormalities such as proteinuria including microalbuminuria, abnormal urinary sediment, imaging abnormalities such as a single kidney and polycystic kidney disease, declined kidney function such as increased serum creatinine, electrolyte abnormalities such as hypokalemia due to tubular damage, abnormalities in histopathological examination such as renal biopsy), or declined kidney function, i.e., an estimated GFR (glomerular filtration rate) of less than 60 mL/min/1.73 m.sup.2, persists for 3 months or more, according to the Clinical Practice Guidebook for Diagnosis and Treatment of Chronic Kidney Disease 2012 (edited by the Japanese Society of Nephrology).
[0141] Here, the estimated GFR (eGFR) can be calculated using the estimation formulas (eGFRcreat) from a serum creatinine value shown in Table 3 below. The estimation formulas (eGFRcys) based on serum cystatin C can be applied to those who have extremely low muscle mass, such as lower-extremity amputees.
TABLE-US-00005 TABLE 3 Male eGFRcreat (mL/min/1.73 m.sup.2) = 194 Cr.sup.1.094 age.sup.0.287 eGFRcys (mL/min/1.73 m.sup.2) = (104 Cys-C.sup.1.019 0.996.sup.age) 8 Female eGFRcreat (mL/min/1.73 m.sup.2) = 194 Cr.sup.1.094 age.sup.0.287 0.739 eGFRcys (mL/min/1.73 m.sup.2) = (104 Cys-C.sup.1.019 0.996.sup.age 0.929) 8 *This evaluation of kidney function is performed for persons aged 18 or older.
[0142] For example, in the case in which protein is used as an index, when the results of a urine test 3 months or more prior and a recent urine test show that the subject has a persistent urinary protein level of 0.15 g/gCr or more, such a condition can be diagnosed as chronic kidney disease. When the subject has diabetes and the results of an albuminuria test 3 months or more prior and a recent albuminuria test show that the subject has a persistent urinary albumin level of 30 mg/gCr or more, such a condition can be diagnosed as chronic kidney disease.
[0143] For children, a threshold of serum creatinine (Cr) can be determined by using an enzymatic method for Japanese children, and used to evaluate children with kidney function abnormalities. For example, the eGFR in % for children aged 2 or older but 11 or younger can be represented by equation 1 below.
eGFR (%)=(0.3body height (m)/serum Cr value in subject)100 Equation 1
[0144] In the case of non-human mammals, such as cats and dogs, it can be predicted whether a non-human mammal has chronic kidney disease from, for example, average daily water intake or urine specific gravity.
[0145] The severity of chronic kidney disease can be determined based on, for example, Table 4 below in the case of humans (Table 4 is Table 2 in the Clinical Practice Guidebook for Diagnosis and Treatment of Chronic Kidney Disease, 2012).
TABLE-US-00006 TABLE 4 Primary disease proteinuria category A1 A2 A3 Diabetes Urinary albumin Normal Microalbuminuria Macroalbuminuria quantification (mg/day) Less than 30 30~299 300 or more Urinary albumin/Cr ratio (mg/gCr) High blood Urinary protein Normal Mild High pressure Nephritis quantification (g/day) proteinuria proteinuria Polycystic kidney Urinary protein/Cr ratio Less than 0.15 0.15~0.49 0.50 or more Renal graft (g/gCr) Unknown Others GFR G1 Normal or 90 A B C Category elevated value (MI/MIN/ G2 Normal or 60~89 A B C 1.73M2 mild reduction G3a Mild to 45~59 B C D moderate reduction G3b Moderate to 30~44 C D D severe reduction G4 Severe 15~29 D D D reduction G5 End-stage <15 D D D kidney disease (ESKD) The severity is evaluated by a stage in which the primary disease, the GFR category, and the proteinuria category are combined. Regarding the severity of CKD, the risks of mortality, end-stage kidney disease, and cardiovascular mortality increase as the stage increases in the order of B, C, and D with reference to the stage A.
[0146] Renal failure as used herein is included in the chronic kidney disease described above. For example, in the case of humans, renal failure refers to a condition in which eGFR is less than 45 ml/min/1.73 m.sup.2, preferably less than 30 ml/min/1.73 m.sup.2, and more preferably less than 15 ml/min/1.73 m.sup.2 in chronic kidney disease.
[0147] The disease associated with FGF23 is not limited, as long as it is a disease that develops in association with overexpression of FGF23. Examples include hypophosphatemic rickets/osteomalacia, autosomal dominant hypophosphatemic rickets/osteomalacia, autosomal recessive hypophosphatemic rickets/osteomalacia, X-linked hypophosphatemic rickets/osteomalacia, tumor-induced rickets/osteomalacia, secondary hyperparathyroidism, abnormal phosphorous metabolism in acute kidney disease or chronic kidney disease, chronic kidney disease-mineral and bone disorder (CKD-MBD), McCune-Albright syndrome, Osteoglophonic dysplasia, epidermal nevus syndrome, familial tumoral calcinosis, X-linked hypophosphatemia, and the like.
[0148] Individual as used herein is not particularly limited, and includes humans and non-human mammals. Examples of non-human mammals include bovines, horses, sheep, goats, pigs, dogs, cats, rabbits, monkeys, and the like. Humans, cats, and dogs are preferable. There is no limitation on the age or sex of the individual.
[0149] Subject is an individual to which an active ingredient is to be administered. The subject is preferably an individual with a history of declined kidney function or other kidney disease. Individuals that may be the subject preferably have symptoms, such as polyuria, thirst, increased water intake, excessive gastric juice, vomiting, bloody urine, and general malaise. Further, individuals that may be the subject include individuals suspected of having kidney damage or chronic kidney disease according to a known diagnostic method, such as a medical interview, a urine test, a biochemical test of blood, kidney diagnostic imaging, or a renal biopsy, disease animal models, and the like.
[0150] Test tissue as used herein refers to tissue from which a measurement value described later is to be obtained. For example, the test tissue is living tissue in vitro, for example, collected from an individual that may he the subject, and cultured in vitro. The tissue may be an entire organ or a portion of an organ.
[0151] Test cell as used herein refers to a cell from which a measurement value described later is to be obtained. For example, the test cell is a living cell in vitro, for example, collected from an individual that may be the subject, and cultured in vitro. The cell may be a cell whose passage capability is limited, such as a primary cultured cell; or may be a so-called cultured cell whose passage capability is maintained. Such cells may be cells prepared by genetic engineering.
[0152] Specimen as used herein includes cells, tissue (the adrenal glands, aorta, brain, lungs, pancreas, pituitary gland, skin, skull, skeletal muscle, spleen, testes, thyroid gland, kidneys, colon, eyeballs, heart, liver, submandibular glands, thymus, adipose tissue, stomach, jejunum, ileum, and the like), body fluids (sweat, secretions from skin, lacrimal fluid, saliva, spinal fluid, ascites fluid, and pleural effusion), urine, blood samples, and the like, derived from a subject described above. As specimens, adipose tissue, skin, hair roots, salivary glands (parotid glands, submandibular glands, and sublingual glands, and preferably parotid glands), sweat, secretions from skin, lacrimal fluid, saliva, urine, and blood samples are preferable; and saliva, salivary glands (particularly preferably parotid glands), adipose tissue, hair roots, skin, secretions from skin, and sweat are more preferable.
[0153] Moreover, specimen may include test tissue itself, a portion of test tissue, a test cell itself, a portion of a test cell, and a culture supernatant of test tissue or a test cell.
[0154] In the section 2. Method for obtaining each measurement value described later, when a measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and/or a measurement value of mRNA of the protein is obtained, the specimen is preferably saliva, salivary glands (particularly preferably parotid glands), blood sample, saliva, or like body fluid. In the same section, when a measurement value of mRNA of a kidney function prediction marker protein is obtained, the specimen is preferably the parotid glands or saliva. When a measurement value relating to at least one protein selected from the group consisting of fibrinogens and/or a measurement value of mRNA of the protein is obtained, the specimen is preferably the kidneys; or a body fluid such as a blood sample or urine. In the same section, when a measurement value of mRNA of a kidney function prediction marker protein is obtained, the specimen is preferably the kidneys.
[0155] Blood sample as used herein includes blood (whole blood) collected from a subject, or serum, plasma, or the like prepared from the blood. The blood sample is preferably serum or plasma, and more preferably serum. When the measurement value of mRNA is obtained, it is preferable to use whole blood. The type of anticoagulant used for collecting plasma is not particularly limited. The type of blood sample of a subject used for measurement and the type of blood sample used for determining a predetermined threshold may be the same or different, and are preferably the same. When plasma is used as a blood sample, it is preferable that plasma for determining a predetermined threshold is prepared from blood collected using the same anticoagulant as used for plasma of the subject.
[0156] Further, the specimen may be a fresh specimen, or may be a preserved specimen. When the specimen is preserved, it can be preserved in a room-temperature environment, a refrigerated environment, or a frozen environment; and cryopreservation is preferable.
[0157] Further, a specimen collected from a subject, test tissue, or test cell treated with an active ingredient may be referred to as active-ingredient-treated specimen in the present specification. In addition, a specimen collected from a subject, test tissue, or test cell that is not treated with an active ingredient may be referred to as untreated specimen in the present specification.
[0158] Healthy individual is not particularly limited. Preferably, the healthy individual is a human or non-human mammal that is described in the explanation of the term individual and that does not show abnormal data in biochemical tests, blood tests, urine tests, serum tests, physiological tests, etc. The age and sex of the healthy individual are not particularly limited.
[0159] Proline-rich proteins (PRPs) as used herein include acidic PRPs (aPRPs) including PRH1 and PRH2; basic PRPs (bPRPs) including PRB1, PRB2, and PRB4; glycosylated. PRPs (GPRPs) including PRB3; PRPMP5; PRP2; splicing variants thereof; post-translationally modified variants thereof; and the like.
[0160] PRPs expressed from a group of genes that cluster around 132055403 to 132601236 of chromosome 6 (mm10 database; GRCm38/mm10; December, 2011) in the case of mice, PRPs expressed from a group of genes that cluster around 10824960 to 11395565 of chromosome 12 (hg38 database; GRCh38/hg38: December, 2013) in the case of humans, splicing variants thereof, post-translationally modified variants thereof, and the like are preferable. At least one member selected from the group consisting of PRH1, PRP2, PRB1, and PRPMP5, splicing variants thereof, and post-translationally modified variants thereof is more preferable.
[0161] The PRH1 protein is preferably NCBI Reference sequence ID: NP_035304.4 in the case of mice, and a protein expressed from the gene shown in NCBI Gene ID: 5554 (updated on Nov. 22, 2015) in the case of humans. The PRH1 protein may also include splicing variants thereof, post-translationally modified variants thereof, and the like.
[0162] The PRP2 protein is preferably NCBI Reference sequence ID: NP_113687.2 in the case of mice, and may also include splicing variants thereof, post-translationally modified variants thereof, and the like.
[0163] The PRB1 protein is preferably NCBI Reference sequence ID: NP_941071.1 in the case of mice, and a protein expressed from the gene shown in NCBI Gene ID: 5542 (updated on Jan. 3, 2016) in the case of humans. The PRB1 protein may also include splicing variants thereof, post-translationally modified variants thereof, and the like.
[0164] The PRPMP5 protein is preferably NCBI Reference sequence ID: NP_001019876.2 in the case of mice, and may also include splicing variants thereof, post-translationally modified variants thereof, and the like.
[0165] The PRH1 mRNA is preferably NCBI Reference sequence ID: NM_011174.4 in the case of mice, and mRNA expressed from the gene shown in NCBI Gene ID: 5554 (updated on Nov. 22, 2015) in the case of humans. The PRH1 mRNA may also include splicing variants thereof and the like.
[0166] The PRP2 mRNA is preferably NCBI Reference sequence ID: NM_031499.2 in the case of mice, and may also include splicing variants thereof and the like.
[0167] The PRB1 mRNA is preferably NCBI Reference sequence ID: NM_198669.1 in the case of mice, and mRNA expressed from the gene shown in NCBI Gene ID: 5542 (updated on Jan. 3, 2016) in the case of humans. The PRB1 MRNA may also include splicing variants thereof and the like.
[0168] The PRPMP5 mRNA is preferably NCBI Reference sequence ID: NM_001024705.2 in the case of mice, and may also include splicing variants thereof and the like.
[0169] Fibrinogen (Fg) is a homodimer in which two polypeptide chains are linked by disulfide bonds, and each of the two polypeptide chains contains an A chain, a B chain, and a chain. The A chain, B chain, and chain are individually encoded by three independent genes (FGA, FGB, FGG). Fibrinogens include FGA, FGB, FGG, and splicing variants thereof. In the case of humans, for example, FGA protein is NCBI Reference sequence ID: NP_000499.1 or NP_068657.1; FGB protein is NCBI Reference sequence ID: NP_005132.2 or NP_005132.2; FGG protein is NCBI Reference sequence ID: NP_068656.2 or NP_000500.2. In the case of humans, for example, FGA mRNA is NCBI Reference sequence ID: NM_000508.4 or NM_021871.3; FGB mRNA is NCBI Reference sequence ID: NM_005141.4 or NM_001184741.1; and FGG mRNA is NCBI Reference sequence ID: NM_021870.2 or NM_000509.5.
[0170] In the case of mice, for example, FGA protein is NCBI Reference sequence ID: NP_034326.1 or NP_001104518.1; FGB protein is NCBI Reference sequence ID: NP_862897.1; and FGG protein is NCBI Reference sequence ID: NP_598623.1 or NP_001304034.1. In the case of mice, for example, FGA mRNA is NCBI Reference sequence ID: NM_0NM_001111048.2.4 or NM_010196.4; FGB mRNA is NCBI Reference sequence ID: NM_181849.3 and FGG mRNA is NCBI Reference sequence ID: NM_133862.2 or NM_001317105.1. Measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) or measurement value relating to at least one protein selected from the group consisting of fibrinogens refers to a value reflecting the amount or concentration of at least one protein selected from the group consisting of PRPs, or at least one protein selected from the group consisting of fibrinogens. When the measurement value is indicated by amount, it may be expressed on either a mole basis or a mass basis; however, it is preferable to indicate the amount on a mass basis. When the value is expressed in terms of concentration, it may be a molar concentration or a ratio of a mass per constant volume of a specimen (mass/volume), preferably a mass/volume ratio. The value reflecting the amount or concentration may be the above, or the intensity of a signal such as fluorescence or luminescence. The measurement value relating to at least one protein selected from the group consisting of PRPs may be the measurement value of at least one protein itself selected from the group consisting of PRPs, or a value measured as the amount of proline after treating at least one protein selected from the group consisting of PRPs with an enzyme or the like. Praline can be measured by, for example, the method shown in Reference Example 3.
[0171] Measurement value of at least one mRNA selected from the group consisting of proline-rich proteins (PRPs) or measurement value of at least one mRNA selected from the group consisting of fibrinogens may be represented by the number of copies (absolute amount) of each mRNA present in a certain amount of a specimen; or may be a value reflecting the relative expression level to that of a housekeeping gene, such as 2-microglobulin mRNA, GAPDH mRNA, Maea mRNA, or -actin mRNA. The measurement value may also be represented by the intensity of a signal such as fluorescence or luminescence.
[0172] Anti-PRP antibody or anti-fibrinogen antibody is not limited, as long as the antibody specifically binds to at least one protein selected from the group consisting of PRPs, or at least one protein selected from the group consisting of fibrinogens. For example, any of polyclonal antibodies, monoclonal antibodies, and fragments thereof (for example, Fab, F(ab).sub.2, etc.) obtained by immunizing a non-human animal with at least one protein selected from the group consisting of PRPs or a part thereof, or at least one protein selected from the group consisting of fibrinogens or a part thereof, as an antigen can be used. Additionally, immunoglobulin classes and subclasses are not particularly limited. Moreover, the anti-PRP antibody or anti-fibrinogen antibody may be a chimeric antibody. Further, the anti-PRP antibody or anti-fibrinogen antibody may be scFv or the like.
[0173] Examples of proteins used as an antigen for preparing an anti-PRP antibody or an anti-fibrinogen antibody include the entirety or a part of at least one protein selected from the group consisting of PRPs, or the entirety or a part of at least one protein selected from the group consisting of fibrinogen.
[0174] Nucleic acid for PRP mRNA detection as used herein is not limited, as long as it contains a sequence that specifically hybridizes to at least one mRNA selected from the group consisting of PRPs, or to a reverse transcription product of the mRNA. Nucleic acid for fibrinogen mRNA detection is not limited, as long as it contains a sequence that specifically hybridizes to at least one mRNA selected from the group consisting of fibrinogens, or to a reverse transcription product of the mRNA. The nucleic acid for detection may be DNA or RNA, and the nucleotides contained in the nucleic acid for detection may be naturally occurring nucleotides or artificially synthesized nucleotides.
[0175] The length of the nucleic acid for detection is not particularly limited. When the nucleic acid for detection is used, as a capture probe in, for example, a microarray, the length of sequence that hybridizes to a target nucleic acid is preferably about 100 mer, more preferably about 60 mer, and even more preferably about 20 to 30 mer. The capture probe can be produced with, for example, a known oligonucleotide synthesizer. The capture probe may contain a sequence that does not hybridize to the target nucleic acid.
[0176] When the nucleic acid for detection is a primer used for PCR reactions, the length of sequence that hybridizes to a target nucleic acid is preferably about 50 mer, more preferably about 30 mer, and even more preferably about 15 to 25 mer. The primer can be produced with, for example, a known oligonucleotide synthesizer. The primer may contain a sequence that does not hybridize to the target nucleic acid. The primer may be labeled with a fluorescent dye or the like.
[0177] A probe for quantification that is decomposed during a PCR reaction may also be used for real-time quantification of a PCR product in RT-PCR, in addition to primers. The probe for quantification is not limited as long as it hybridizes to a target nucleic acid. The probe for quantification is preferably a nucleic acid with a length of about 5 to 20 mer that contains a sequence that hybridizes to a target nucleic acid. Further, it is preferred that the probe for quantification is labeled at one end with a fluorescent dye, and at the other end with a quencher of the fluorescent dye.
[0178] When the measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) (hereinafter may be abbreviated as measurement value of a PRP protein in the present specification) is measured, a measurement method using an anti-PRP antibody described above can be used in the process in order to obtain the measurement value. A known ELISA method or the like can be used as the measurement method for obtaining the measurement value of a PRP protein.
[0179] When the Measurement value relating to at least one protein selected from the group consisting of fibrinogens (hereinafter maybe abbreviated as measurement value of a fibrinogen protein in the present specification) is measured, a measurement method using an anti-fibrinogen antibody described above can be used in the process in order to obtain the measurement value. A known ELISA method or the like can be used as the measurement method for obtaining the measurement value of a fibrinogen protein.
[0180] In this embodiment, an anti-PRP antibody for antigen capture or an anti-fibrinogen antibody for antigen capture can be immobilized on a solid phase such as a microplate, fluorescent beads, or magnetic beads in advance, and a complex between the immobilized anti-PRP antibody or anti fibrinogen antibody and an antigen in a specimen can be formed. The amount or concentration of the PRP protein or fibrinogen protein contained in the specimen can be measured by detecting the complex immobilized on the solid phase or the complex formed on the solid phase by a method known in the art. In this embodiment, a complex between an anti-PRP antibody for antigen capture or an anti-fibrinogen antibody for antigen capture and an antigen in a specimen may be formed in advance, and then immobilized on a solid phase.
[0181] The method for immobilizing an antibody for antigen capture on a solid phase is not particularly limited. An antibody may be directly immobilized or indirectly immobilized with another substance interposed therebetween by using a known method. Examples of direct binding include physical adsorption and the like. Preferably, for example, an immunoplate may be used to directly physically bind an antibody to the microplate.
[0182] The shape of the solid phase is not particularly limited. Examples include microplates, microtubes, test tubes, beads, and the like. The material of the solid phase is not particularly limited. For example, polystyrene, polypropylene, and the like can be used for microplates, microtubes, test tubes, etc. In the case of beads, Polystyrene xMAP (registered trademark) Beads (Luminex), MagPlex (registered trademark) Microspheres (Luminex), and the like can be used.
[0183] This method may comprise, following the formation of the complex, an operation of washing the solid phase. In washing, for example, PBS containing a surfactant or the like may be used.
[0184] In this method, the complex can be detected by using an anti-PRP antibody for detection labeled with a labeling substance or an anti-fibrinogen antibody for detection labeled with a labeling substance; or using an unlabeled anti-PRP antibody or anti-fibrinogen antibody, an anti-immunoglobulin antibody labeled with a labeling substance and capable of binding to the unlabeled anti-PRP antibody or anti-fibrinogen antibody, etc. It is preferable to use a labeled anti-PRP antibody for detection, or a labeled anti-fibrinogen antibody for detection. It is also preferable that the epitope in the antigen of the antibody for detection is different from the epitope in the antigen of the antibody for antigen capture.
[0185] The labeling substance used for the antibody for detection or the labeled anti-immunoglobulin antibody is not particularly limited, as long as the labeling substance generates a detectable signal. Examples include fluorescent substances, radioactive isotopes, enzymes, and the like. Examples of enzymes include alkaline phosphatase, peroxidase, and the like. Examples of fluorescent substances include fluorescent dyes such as fluorescein isothiocyanate (FITC), rhodamine, and Alexa Fluor (registered trademark), fluorescent proteins such as GFP, and the like. Examples of radioactive isotopes include .sup.125I, .sup.14C, .sup.32P, and the like. Among them, alkaline phosphatase or peroxidase is preferable as the labeling substance.
[0186] The antibody for detection is obtained by labeling an antibody with the above-mentioned labeling substance by a labeling method known in the art. Alternatively, such labeling may be performed using a commercially available labeling kit or the like. For the labeled immunoglobulin antibody, the same method as the labeling of the antibody for detection may be used, or a commercially available product may be used.
[0187] In this method, the measurement value of the kidney function prediction marker contained in the specimen can be obtained by detecting a signal generated by the labeling substance of the labeled antibody contained in the complex. Here, detecting a signal includes qualitatively detecting the presence or absence of a signal, quantifying the signal intensity, and semi-quantitatively detecting the signal intensity. Such semi-quantitative detection refers to indicating the signal intensity in stages such as no signal generation, weak, medium, and strong. In this step, it is preferable to detect the signal intensity quantitatively or semi-quantitatively.
[0188] As the method for detecting a signal, a known method may be used. In this method, a measurement method according to the type of signal derived from the above-mentioned labeling substance may be appropriately selected. For example, when the labeling substance is an enzyme, detection of a signal may be performed by measuring a signal such as light or color generated by the reaction of the enzyme with a substrate using a known device such as a luminometer or a spectrophotometer.
[0189] The substrate of an enzyme can be appropriately selected from known substrates depending on the type of enzyme. For example, when alkaline phosphatase is used as an enzyme, examples of substrates include chemiluminescent substrates such as CDP-Star (registered trademark) (disodium 4-chloro-3-(methoxyspiro[1,2-dioxetane-3,2-(5-chloro)tricyclo[3.3.1.1.sup.3,7]decan]-4-yl)phenyl phosphate), and chromogenic substrates such as 5-bromo-4-chloro-3-indolyl phosphate (BCIP), disodium 5-bromo-6-chloro-3-indolyl phosphate, and p-nitrophenyl phosphate. When the labeling substance is peroxidase, examples of substrates include tetramethylbenzidine (TMB) and the like.
[0190] When the labeling substance is a radioactive isotope, a signal, i.e., radiation, can be measured using a known device such as a scintillation counter. When the labeling substance is a fluorescent substance, a signal, i.e., fluorescence, can be measured using a known device such as a fluorescence microplate reader or Luminex (registered trademark) system (Luminex). The excitation wavelength and the fluorescence wavelength can be appropriately determined according to the type of fluorescent substance used.
[0191] The detection results of the signal can be used as the measurement value of the PRP protein, or the measurement value of the fibrinogen protein. For example, when the signal intensity is quantitatively detected, the measurement value itself of the signal intensity or a value calculated from the measurement value of the signal intensity can be used as the measurement value of the kidney function prediction marker protein.
2. Method for Measuring PRP mRNA or Fibrinogen mRNA
[0192] The methods for obtaining a measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens, and a measurement value of mRNA of the protein in the present specification are not limited, as long as the measurement values can be obtained. For example, they can be obtained according to the methods described below.
[0193] A known measurement method, such as a microarray method, an RNA-Seq analysis method, or a quantitative RT-PCR method, can be used to obtain the measurement value of at least one mRNA selected from the group consisting of proline-rich proteins (PRPs) (hereinafter may be abbreviated as measurement value of PRP mRNA in the present specification), or the measurement value of at least one mRNA selected from the group consisting of fibrinogens (hereinafter may be abbreviated as measurement value of fibrinogen mRNA in the present specification). As probes used for the microarray method, probes of one's choosing, or known probes, may be synthesized and used; or a commercially available microarray chip may be used.
[0194] In this method, any of total RNA and mRNA extracted from a specimen may be used. It is preferred that the specimen used for total RNA and mRNA extraction is subjected to RNA extraction immediately after being collected from an individual; or is frozen (preferably under an atmosphere at 196 C. or less (rapidly cooled in liquid nitrogen)) immediately after being collected from an individual, and stored at 80 C. or less until RNA extraction.
[0195] The method for extracting total RNA and mRNA from a specimen is not particularly limited, and a known extraction method may be used.
[0196] Quantification by the microarray method may be performed according to a known method. The expression level of each mRNA may be expressed as the relative expression level to that of a housekeeping gene; or expressed as the measurement value of the signal intensity of, for example, a fluorescent dye.
[0197] Quantification by RT-PCR may be performed by conducting a reverse transcription reaction using total RNA or mRNA extracted from a specimen as a template, and performing analysis by a real-time PCR method or the like with the obtained cDNA as a template by using specific primers for each mRNA. In this case, the expression level of each mRNA may be expressed as the relative expression level to that of a housekeeping gene; or expressed as the measurement value of the signal intensity of, for example, a fluorescent dye.
[0198] In the RNA-Seq analysis method, mRNA extracted from a specimen is fragmented, cDNA is synthesized by reverse transcription reaction using these fragments as a template, and libraries are prepared. The nucleotide sequence of each fragment contained in each library is determined by using a next-generation sequencer, the obtained information is mapped to a reference gene sequence, and the expression level of mRNA is represented as RPKM (Reads Per Kilobase per Million). RPKM may be represented as the intensity of a signal in, for example, a heat map.
[0199] The detection results of the signal can be used as the expression level of each mRNA. For example, when the signal intensity is quantitatively detected, the measurement value itself of the signal intensity, or a value calculated from the measurement value of the signal intensity, can be used as the expression level of each mRNA.
[0200] Examples of the value calculated from the measurement value of the signal intensity include a value obtained by subtracting, from the measurement value of the signal intensity, the measurement value of the signal intensity of a negative control sample; a value obtained by dividing the measurement value of the signal intensity by the measurement value of the signal intensity of a positive control sample; a combination thereof; and the like. Examples of negative control samples include specimens of healthy subjects and the like. Examples of positive control samples include specimens containing individual mRNAs at a predetermined expression level.
[0201] The detection results obtained by using the ELISA method, Western blotting method, quantitative RT-PCR method, RNA-Seq method, and reporter assay, and the measurement results of a chemical mediator can be used as evaluation results of function of Oscar protein. The evaluation results may be quantitative data, semi-quantitative information such as high and low, or qualitative data such as present and not present.
[0202] A situation in which the measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) in a specimen and/or the measurement value of mRNA of the protein in a specimen is high includes at least a case in which the measurement value derived from the specimen is higher than the measurement value of a healthy individual. This situation also includes a case in which the measurement value is higher when compared with a pest measurement value in the same individual. Further, a situation in which the measurement value relating to at least one protein selected from the group consisting of fibrinogens in a specimen and/or the measurement value of mRNA of the protein in a specimen is high includes at least a case in which the measurement value derived from the specimen is higher than the measurement value of a healthy individual. This situation also includes a case in which the measurement value is higher when compared with a past measurement value in the same individual.
3. Evaluation of Function of Oscar Protein
[0203] In the present invention, the method for evaluating the function of Oscar protein is not particularly limited, as long as the function of Oscar protein can be evaluated. Function of Oscar protein as used herein is the original function of Oscar protein.
[0204] An example of the method for evaluating the function of Oscar protein is a method in which the presence or absence of, for example, phosphorylation or dephosphorylation of a protein downstream in the signaling pathway to which Oscar protein belongs; an increase or decrease in the expression level of a protein located downstream; activation or inactivation of the transcriptional regulatory region of a protein located downstream; or the like is detected. More specifically, when the measurement value of FGF23 protein, which is considered to be a protein downstream of Oscar protein, and/or the measurement value of mRNA of the protein in a specimen treated with a test substance is decreased, it can be determined that the test substance is a candidate substance for an active ingredient. When the measurement value of a fibrinogen protein, which is considered to be a protein downstream of Oscar protein, and/or the measurement value of mRNA of the protein in a specimen treated with a test substance is decreased, it can be determined that the test substance is a candidate substance for an active ingredient. When the measurement value of a proline-rich protein (PRP), which is considered to be a protein downstream of Oscar protein, and/or the measurement value of mRNA of the protein in a specimen treated with a test substance is decreased, it can be determined that the test substance is a candidate substance for an active ingredient. Further, when the activity of lipoprotein lipase in a specimen treated with a test substance is enhanced, it can be determined that the test substance is a candidate substance for an active ingredient.
[0205] For example, the presence or absence of phosphorylation of a protein can be detected by a known method, such as Western blotting. For example, an increase or decrease in the expression level of a protein can be detected by a known method, such as the ELISA method, Western blotting method, quantitative RT-PCR method, or RNA-Seq method. Further, activation or inactivation of the transcriptional regulatory region can he detected by a reporter assay. Examples of reporters include firefly luciferase, Renilla luciferase, GFP (Green Fluorescent Protein), -galactosidase, and the like. The reporter assay can be performed according to a known method.
[0206] An example of another method for evaluating the function of Oscar protein is a method in which the binding activity of NFATc1 is observed by a reporter assay. More specifically, the binding activity can be observed by the method described in, for example, JCI 2011; 121: 3505/J Immunol 2015; 194: 3317. The function of Oscar protein can be measured by, for example, a method in which an Oscar ligand is added to NFAT-GFP reporter cells expressing a protein in which the Oscar extracellular domain is fused to the TCR CD3 signal chain, and then downstream signaling by binding of Oscar to the Oscar ligand is quantified using the amount of GFP fluorescence.
[0207] Moreover, an example of another method for evaluating the function of Oscar protein is a method in which the concentration of calcium in monocytes or dendritic cells is measured. The concentration of calcium in the cells can be measured by a known method.
[0208] Examples of another method for evaluating the function of Oscar protein include a method in which the expression level of Bc1-2 is measured by the Western blotting method or the like; and a method in which apoptosis inhibitory action is evaluated by the TUNEL method.
4. Pharmaceutical Composition and Food or Drink Composition
[0209] The present invention includes, as an embodiment, a pharmaceutical composition or a food or drink composition. Moreover, the present invention includes, as an embodiment, a pharmaceutical composition or food or drink composition for preventing or treating kidney disease. The pharmaceutical composition or food or drink composition comprises, as an active ingredient, a substance capable of regulating the functional expression of Oscar protein.
[0210] As shown in Example 1 and Experimental Example 1 described later, a substance capable of regulating the functional expression of Oscar protein can be used for suppressing the functional expression of FGF23. Moreover, as shown in Non-patent Literature 2 to 5, it has been reported that the fibrinogen concentration in urine or blood is increased in patients with chronic kidney disease (CKD), acute kidney injury, renal fibrosis, glomerulonephritis, or like disease. Furthermore, as shown in Example 2 described later, a substance capable of regulating the functional expression of Oscar protein can be used for suppressing the expression of a fibrinogen gene in model mice ingested a diet with high phosphorus content; therefore, a substance capable of regulating the functional expression of Oscar protein is believed to improve kidney function. In the model mice ingested a diet with high phosphorus content, the mRNA expression of PRPs in the parotid glands and the amount of secretion of PRPs in saliva are increased before creatinine, which is a kidney function marker, shows changes. On the other hand, this increased expression is mitigated by a substance capable of regulating the functional expression of Oscar protein, as shown in Example 2.
[0211] The present invention thus includes, as another embodiment, a pharmaceutical composition or food or drink composition for use in suppressing the functional expression of FGF23. The present invention includes, as another further, embodiment, a pharmaceutical composition or food or drink composition for being administered to an individual with a high measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens in a specimen, and/or a high measurement value of mRNA of the protein in a specimen.
[0212] Preventing kidney disease as used herein includes preventing the onset of kidney disease; and includes suppressing a shift from normal state to declined kidney function, a shift from declined kidney function to chronic kidney disease, or a shift from a state of a lower category to a state of a higher category in the GFR categories shown in Table 4 in chronic kidney disease. Treating kidney disease includes improving or curing kidney disease. Here, improving means that data about at least one of the items shown in Tables 2-1 to 2-3 is shifted toward the threshold.
[0213] The pharmaceutical composition according to a first embodiment of the present invention can be prepared by combining the active ingredient described above with suitable carriers or additives. As carriers and additives that can be used for preparing the pharmaceutical composition, carriers and additives widely used in typical drugs can be used according to the dosage form of the pharmaceutical composition. Examples of carriers and additives include excipients, binders, disintegrators, lubricants, coloring agents, taste enhancers, flavor enhancers, surfactants, and the like.
[0214] When the active ingredient is a peptide, an antibody, an antibody fragment, an RNA molecule, a plasmid vector, or the like, a transfection reagent containing a polymer, a lipid, magnetism, etc., may be used as a carrier.
[0215] The dosage form of the pharmaceutical composition for oral administration is not particularly limited, and examples include tablets, powders, granules, capsules (including hard capsules and soft capsules), fluids, pills, suspensions, emulsions, and the like. The dosage form of the pharmaceutical composition for parenteral administration include injections, drops, suppositories, nasal drops, preparations for transpulmonary administration, and the like.
[0216] When the pharmaceutical composition is prepared in the form of a solid oral composition, such as tablets, powders, granules, pills, and capsules, examples of usable carriers include excipients such as lactose, saccharose, sodium chloride, glucose, urea, starch, calcium carbonate, kaolin, crystalline cellulose, silicic acid, methylcellulose, glycerol, sodium alginate, and gum arabic; binders such as simple syrups, liquid glucose, liquid starch, gelatin solutions, polyvinyl alcohol, polyvinyl ether, polyvinylpyrrolidone, carboxymethylcellulose, shellac, methylcellulose, ethylcellulose, water, ethanol, and potassium phosphate; disintegrators such as dried starch, sodium alginate, powdered agar, powdered laminaran, sodium hydrogencarbonate, calcium carbonate, polyoxyethylene sorbitan fatty acid esters, sodium lauryl sulfate, stearic acid monoglycerides, starch, and lactose; disintegration inhibitors such as saccharose, stearic acid, cocoa butter, and hydrogenated oils; absorption enhancers such as sodium lauryl sulfate; humectants such as glycerol and starch; adsorbents such as starch, lactose, kaolin, bentonite, and colloidal silicic acid; lubricants such as purified talc, stearic acid salts, powdered boric acid, and polyethylene glycol; and the like. Tablets may be optionally provided with general coatings to provide sugar-coated tablets, gelatin-coated tablets, enteric-coated tablets, film-coated tablets, double-layer tablets, multi-layer tablets, and the like.
[0217] When the pharmaceutical composition is prepared in the form of a pill, which is a solid oral composition, examples of usable carriers include excipients such as glucose, lactose, starch, cacao butter, hydrogenated vegetable oils, kaolin, and talc; binders such as powdered gum arabic, powdered tragacanth, and gelatin; disintegraters such as laminaran and agar; and to like.
[0218] When the pharmaceutical composition is prepared in the form of a capsule, which is a solid oral composition, it is prepared by mixing the active ingredient with carriers mentioned above, and filling a hard capsule, a soft capsule, or the like with the mixture.
[0219] When the preparation is a liquid preparation, it may take the form of a water-based or oil-based suspension, solution, syrup, or elixir; and can be prepared according to a common method, using generally used additives.
[0220] When the pharmaceutical composition is prepared in the form of an injection, examples of usable carriers include diluents such as water, ethyl alcohol, macrogol, propylene glycol, ethoxylated isostearyl alcohol, polyoxylated isostearyl alcohol, and polyoxyethylene sorbitan fatty acid esters; pH-adjusters such as sodium citrate, sodium acetate, and sodium phosphate; buffers such as dipotassium phosphate, trisodium phosphate, sodium hydrogen phosphate, and sodium citrate; stabilizers such as sodium pyrosulfite, EDTA, thioglycolic acid, and thiolactic acid; saccharides such as mannitol, inositol, maltose, sucrose, and lactose for use as binders in freeze-drying; and the like. In this case, glucose or glycerol may be incorporated in the pharmaceutical preparation in an amount sufficient to prepare an isotonic solution. General solubilizing agents, soothing agents, topical anesthetics, etc., may also be added to the solution. Subcutaneous, intramuscular, and intravenous injections can be prepared according to common methods by adding these carriers.
[0221] When the preparation is prepared in the form of a drop, it can be prepared by dissolving the compound to be administered in an isotonic electrolyte infusion preparation, such as physiological saline or Ringer's solution.
[0222] The dose of the pharmaceutical composition of the present invention is not particularly limited as long as the effects of the present invention are achieved, and can be suitably determined according to the dosage form; the age, sex, and condition of a patient; etc. For example, the daily dose is about 0.1 to 1,000 mg/kg, and preferably about 0.5 to 500 mg/kg, in terms of the amount of the active ingredient in an adult (15 years of age or older) (calculated based on the assumption that the body weight is about 60 kg).
[0223] The food or drink composition according to the present embodiment includes general food and food with health claims (foods with function claims, food with nutrient function claims, food for specified health uses). The definition and classification of food with health claims are in accordance with those prescribed by the Health Promotion Act and the Food Sanitation Act in Japan.
[0224] The food or drink composition according to a second embodiment of the present invention includes food and drink (pet food) for pets (e.g., dogs, cats, hamsters, rabbits, and birds), and food and drink (feed compositions) for livestock (cattle, pigs, poultry).
[0225] The food or drink composition according to the present embodiment is not particularly limited. Examples include drinks (e.g., milk beverages, lactic acid bacteria beverages, fruit-juice-containing soft drinks, carbonated drinks, fruit juice drinks, vegetable drinks, vegetable and fruit drinks, alcohol, sports drinks, powder drinks, and tea drinks), chilled desserts (e.g., jelly, bavarois, and custard pudding), iced desserts (e.g., ice cream, ice milk, lacto ice (ice cream with a milk solids content of 3% or more), and sherbet), confectioneries (e.g., cookies, biscuits, rice crackers, candies, chocolates, and gum), bread, noodles (e.g., Chinese noodles, pasta, wheat-flour noodles, buckwheat noodles, and somen (thin noodles)), soups (including powdered soup and soup cubes), seasonings (e.g., dressings, jellied seasonings, sauces, mayonnaise-like sauces, and sauces for dipping, basting, etc.), and the like.
[0226] Moreover, the food or drink composition according to the present invention includes not only food and drink in the forms described above, but also food or drink compositions in the form of a supplement and food for the sick (including food for persons in need of nursing care and food for persons with dysphagia). When the food or drink composition is prepared as a composition in the form of a supplement or as food for the sick, preferable forms thereof are, for example, fluids (drinkable preparations), syrups, dry syrups, jelly preparations (including jelly preparations prepared at the time of use; the same applies hereinafter), granules, powders, pills, tablets, capsules (hard capsules, soft capsules), lozenges, and chewables, in view of ease of continuous intake. Fluids (drinkable preparations), jelly preparations, granules, tablets, and capsules (hard capsules, soft capsules) are preferable, and fluids (drinkable preparations) and jelly preparations are more preferable. The composition in such a form can be prepared by an ordinary method for producing preparations using pharmaceutically acceptable carriers or additives according to the form of each preparation, as explained in the section of the pharmaceutical composition described above.
[0227] If the domestic laws of a country prohibit the use, for the food or drink composition, of a statement concerning the relationship between the composition and a disease, the statement concerning the relationship with the disease can be changed so as not to violate the domestic laws. For example, an expression, such as for keeping the kidneys in a good state (in a healthy state), may be indicated as a use of the food or drink composition.
[0228] The dose of the food or drink composition according to the present invention is not particularly limited as long as the effects of the present invention are achieved, and can be suitably determined according to the dosage form; the age, sex, and condition of a patient; etc. For example, the daily dose is about 0.1 to 1,000 mg/kg, and preferably about 0.5 to 500 mg/kg, in terms of the amount of the active ingredient in an adult (15 years of age or older) (calculated based on the assumption that the body weight is about 60 kg).
5. Evaluation of Effect of Active Ingredient in Body
5-1. Method for Supporting Evaluation of Effect of Active Ingredient in Body
[0229] The present invention includes, as a third embodiment, a method for supporting the evaluation of an effect, in the body, of an active ingredient that suppresses functional expression of Oscar protein. Specifically, the third embodiment comprises a step of obtaining a measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens contained in a specimen collected from a subject to which the active ingredient has been administered (a treated specimen), and/or a measurement value of mRNA of the protein contained in a specimen collected from the subject; and a step of evaluating the effect of the active ingredient based on the measurement value(s) obtained by the obtaining step. The method may also comprise a second obtaining step of obtaining a measurement value relating to the at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens, and/or a measurement value of mRNA of the protein in a specimen collected from a subject, test tissue, or test cell that is not treated with the active ingredient (an untreated specimen). The method may further comprise a step of comparing the measurement value(s) of the treated specimen with the measurement value(s) of the untreated specimen. Moreover, in the evaluation step, the effect of the active ingredient in the body can be evaluated based on the comparison result obtained by the measurement value comparison step. Specifically, when the measurement value(s) of the treated specimen are lower then the measurement value(s) of the untreated specimen, it can be determined that the active ingredient is effective in the body.
[0230] Here, the subject, test tissue, or test cell that is not treated with the active ingredient is a subject, test tissue, or test cell that has never been treated with the test substance. Instead of using this, a comparison may be made with a measurement value relating to the at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens, and/or a measurement value of mRNA relating to the protein. Hereinafter, the same applies to the fourth and fifth embodiments.
5-2. System Configuration
[0231]
[0232] The evaluation device 1 includes, for example, a general-purpose personal computer, and comprises a CPU 101 for performing data processing described later, a memory 102 serving as a work area for data processing, a storage unit 103 for storing processed data, a bus 104 for transmitting data between the units, and an interface unit 105 (hereinafter referred to as I/F unit) for performing data input and output between the evaluation device and external devices. The input unit 3 and the display unit 4 are connected to the evaluation device 1. The input unit 3 includes, for example, a keyboard; and the display unit 4 includes, for example, a liquid crystal display. The input unit 3 and the display unit 4 may be integrated and implemented as a display with a touch panel. The evaluation device 1 need not be a single device; and the CPU 101, the memory 102, the storage unit 103, and the like may be located in separate places, and connected via a network. The evaluation device may also be a device that omits the input unit 3 and the display unit 4, and that does not require an operator.
[0233] The evaluation device 1 and the analysis device 5a or the analysis device 5b are also not necessarily located in one place, and may be configured such that the devices located in separate places are communicatively connected to each other via a network.
[0234] In the explanation below, a process performed by the evaluation device 1 means a process performed by the CPU 101 of the evaluation device 1 based on an evaluation program stored in the storage unit 103 or the memory 102 shown in
[0235] The analysis device 5a is a device for measuring the amount or concentration of a protein, and comprises a sample placement area 51, a reaction unit 52, and a detection unit 53. A specimen, collected from a subject, set in the sample placement area 51 is dispensed into and incubated in a microplate that is placed in the reaction unit 52 and on which an antibody against an kidney function prediction marker for antibody capture is immobilized. The unreacted antigen is removed, if necessary. Thereafter, a detection antibody is dispensed into the microplate, followed by incubation. The unreacted antigen is removed if necessary, and a substrate for detecting the detection antibody is dispensed into the microplate. The microplate is transferred to the detection unit 53, and a signal generated by reaction with the substrate is measured. Another embodiment of the analysis device 5a is a device for measuring the expression level of mRNA by microarray analysis. A reverse transcription reaction product set in the sample placement area 51 is dispensed into a microarray chip set in the reaction unit 52, followed by hybridization. After the microarray chip is washed, it is transferred to the detection unit 53, and a signal is detected.
[0236] Further, another embodiment of the analysis device 5a is a device for measuring the expression level of mRNA by RT-PCR. A reverse transcription reaction product set in the sample placement area 51 is dispensed into a microtube set in the reaction unit 52, and a reagent for quantitative PCR is subsequently dispensed into the microtube. A signal in the tithe is detected by the detection unit 53 while performing a PCR reaction in the reaction unit 52.
[0237] The analysis device 5b is a device for measuring the expression level of mRNA by the RNA-Seq method, and comprises a sequence analysis unit 54. A sample subjected to a reaction for RNA-Seq is set in the sequence analysis unit 54, and analysis of nucleotide sequences is performed in the sequence analysis unit 54.
[0238] The analysis devices 5a or 5b are connected to the evaluation device 1 by a wired or wireless connection. The analysis device 5a A/D converts the measurement value of a protein or the measurement value of mRNA and transmits it as digital data to the evaluation device 1. Similarly, the analysis device 5b A/D converts the measurement value of mRNA, and transmits it as digital data to the evaluation device 1. Therefore, the evaluation device 1 can obtain, as digital data that can be computed, the measurement value of a protein or the measurement value of mRNA.
5-3. Evaluation Device
[0239] The present invention includes, as the fourth embodiment, a device for evaluating an effect, in the body, of an active ingredient that suppresses functional expression of Oscar protein, the device comprising the following computation means:
[0240] means for obtaining a measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens contained in a specimen collected from a subject to which the active ingredient has been administered (a treated specimen), and/or a measurement value of mRNA of the protein contained in a specimen collected from the subject; and
[0241] means for evaluating the effect of the active ingredient based on the measurement value(s) obtained by the obtaining means.
[0242] The fourth embodiment may further comprises:
[0243] second obtaining means for obtaining a measurement value relating to the at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens, and/or a measurement value of mRNA relating to the protein in a specimen collected from a subject, test tissue, or test cell that is not treated with the active ingredient (an untreated specimen); and
[0244] means for comparing the measurement value(s) of the treated specimen with the measurement value(s) of the untreated specimen. Further, the evaluation means may evaluate the effect of the active ingredient in the body based on the comparison result obtained by the measurement value comparison means. The evaluation means can determine that the active ingredient is effective in the body when the measurement value(s) of the treated specimen are lower than the measurement value(s) of the untreated specimen.
[0245] In this embodiment, an effect, in the body, of an active ingredient that suppresses functional expression of Oscar protein can be evaluated by the system 100 (
[0246]
[0247] In other words, the evaluation device 1 is a device for evaluating an effect, in the body, of an active ingredient that suppresses functional expression of Oscar protein, the device executing the following computation functions by the CPU 101:
[0248] a first obtaining function for obtaining a measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens contained in a specimen collected from a subject to which the active ingredient has been administered (a treated specimen), and/or a measurement value of mRNA of the protein contained in a specimen collected from the subject; and
[0249] a function for evaluating the effect of the active ingredient based on the measurement value(s) obtained by the obtaining function.
[0250] Preferably, the evaluation device 1 further executes the following functions by the CPU 101:
[0251] a second obtaining function for obtaining a measurement value relating to the at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens, and/or a measurement value of mRNA of the protein in a specimen collected from a subject, test tissue, or test cell that is not treated with the active ingredient (an untreated specimen); and
[0252] a function for comparing the measurement value(s) of the treated specimen with the measurement value(s) of the untreated specimen,
[0253] wherein the evaluation function evaluates the effect of the active ingredient in the body based on the comparison result obtained by the measurement value comparison function, and the evaluation function determines that the active ingredient is effective in the body when the measurement value(s) of the treated specimen are lower than the measurement value(s) of the untreated specimen.
[0254] In this embodiment, a measurement value M11 relating to each protein is put into the evaluation device 1 from the analysis device 5a, and a measurement value M21 of mRNA of the protein is put into the evoluation device 1 from the analysis device 5a or 5b. Similarly, a measurement value M12 relating to the protein in an untreated specimen is also put into the evaluation device 1 from the analysis device 5a, and a measurement value M22 of mRNA of the protein is also put into the evaluation device 1 from the analysis device 5a or 5b.
[0255] The measurement values M11 and M12 relating to the protein and the measurement values M21 and M22 of mRNA of the protein in the treated specimen and the untreated specimen may also be put into the evaluation device 1 from a third-party organization (not shown) via a network.
[0256] Moreover, the functional blocks, i.e., the first measurement value obtaining unit 11, the second measurement value obtaining unit 12, the measurement value comparison unit 13, and the effect determination unit 14, are not necessarily executed by a single CPU, and may be processed by multiple CPUs in a distributed manner. For example, these functional blocks may be configured such that the functions of the first measurement value obtaining unit 11 and the second measurement value obtaining unit 12 are executed by a CPU of a first computer, and such that the functions of the measurement value comparison unit 13 and the effect determination unit 14 are executed by a CPU of a second computer, i.e., another computer.
5-4. Evaluation Program
[0257] In order to carry out the processing for steps S11 to S17 in
[0258] Specifically, the evaluation program according to the fourth embodiment of the present invention is an evaluation program that, when executed by a computer, causes the computer to carry out the following processing to evaluate an effect, in the body, of an active ingredient that suppresses functional expression of Oscar protein:
[0259] first obtaining processing of obtaining a measurement value relating to at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens contained in a specimen collected from a subject to which the active ingredient has been administered (a treated specimen), and/or a measurement value of mRNA of the protein contained in a specimen collected from the subject; and
[0260] processing of evaluating the effect of the active ingredient based on the measurement value(s) obtained by the obtaining processing.
[0261] The evaluation program may further cause the computer to carry out second obtaining processing of obtaining a measurement value relating to the at least one protein selected from the group consisting of proline-rich proteins (PRPs) and fibrinogens, and/or a measurement value of mRNA of the protein in a specimen collected from a subject, test tissue, or test cell that is not treated with the active ingredient (an untreated specimen); and processing of comparing the measurement value(s) of the treated specimen with the measurement value(s) of the untreated specimen. In the evaluation processing, the effect of the active ingredient in the body may be evaluated based on the comparison result obtained by the measurement value comparison processing. In the evaluation processing, it can be determined that the active ingredient is effective in the body when the measurement value(s) of the treated specimen are lower than the measurement value(s) of the untreated specimen.
[0262] In this embodiment, as shown in
5-5. Evaluation Method
[0263]
[0264] In step S11, the first measurement value obtaining unit 11 obtains a measurement value M11 relating to each protein and/or a measurement value M21 of mRNA of the protein in a treated specimen.
[0265] In step S12, the second measurement value obtaining unit 12 obtains a measurement value M12 relating to the protein and/or a measurement value M22 of mRNA of the protein in an untreated specimen.
[0266] In step S13, the measurement value comparison unit 13 compares the measurement value(s) of the treated specimen obtained in step S11 with the measurement value(s) of the untreated specimen obtained in step S12. The comparison result is output to the effect determination unit 14.
[0267] The effect determination unit 14 determines that the active ingredient is effective in the body based on the comparison result obtained by the measurement value comparison unit 13. More specifically, when the comparison result indicates that the measurement value(s) of the treated specimen are lower (YES in step S14), the effect determination unit 14 determines, in step S15, that the active ingredient is effective in the body.
[0268] More specifically, when a value obtained by dividing M11 by M12 or a value obtained by dividing M21 by M22 is, for example, 0.85 or less, preferably 0.7 or less, and more preferably 0.5 or less, the measurement value comparison unit 13 determines that the active ingredient is effective in the body, and outputs the comparison result such that the active ingredient is effective.
[0269] In step S17, the effect determination unit 14 outputs the result determined in step S15. In this embodiment, whether the active ingredient is effective in the body is displayed on the display unit 4, and the determination result is stored in the storage unit 103 in the evaluation device 1. The determination result may be displayed on a display unit of an external computer terminal connected to the evaluation device 1 via the internet, for example, a display unit of a computer terminal in a third-party organization (not shown), instead of displaying the determination result on the display unit 4.
[0270] When the comparison result indicates that the measurement value(s) of the treated specimen are not lower in step S14, the processing proceeds to step S16, and the effect determination unit 14 determines that the active ingredient is not effective in the body. In this case, the result such that the active ingredient is not effective may be displayed on the display unit 4.
6. Genome Editing System and Kit Comprising the System
[0271] The present invention includes a genome editing system comprising a sequence that targets Oscar gene described in the above section 1. Explanation of terms. The genome editing system is preferably a CRISPR/Cas9 system comprising a sequence that targets Oscar gene. The CRISPR/Cas9 system comprising a sequence that targets Oscar gene may be a combination of gRNA, tracrRNA, and RNA encoding Cas9. In this case, the gRNA, tracrRNA, and RNA encoding Cas9 may be provided in the same package, or in separate packages.
[0272] The genome editing system comprising a sequence that targets Oscar gene according to the present invention may be provided in the form of a kit.
[0273] For example, when the genome editing system is a vector, the kit may comprise, in addition to the vector, a package insert, a transfection reagent, such as a liposome, a buffer for dissolving the vector, a sequestering agent, and the like.
[0274] When the genome editing system is RNA, the kit may comprise, in addition to the RNA, a package insert, a transfection reagent such as a liposome, a buffer for dissolving the RNA, an RNase inhibitor, a sequestering agent, and the like. Moreover, the kit may comprise both gRNA and RNA encoding Cas9, or may comprise only gRNA.
[0275] The kit can be used for preventing, improving, or treating kidney disease.
EXAMPLES
[0276] The present invention is described in more detail below with reference to examples. The present invention, however, should not be construed as limited to the examples.
Example 1
Preparation of Soluble Human Oscar-Fc Fusion Protein
[0277] An expression plasmid containing a nucleotide sequence encoding a soluble human Oscar-Fc fusion protein was expressed in animal cells, thereby preparing the soluble human Oscar-Fc fusion protein shown in SEQ ID NO: 2. The preparation of the protein was outsourced to ProteinExpress Co., Ltd. (Chiba, Japan).
TABLE-US-00007 <AminoacidsequenceofhumanOscar-humanIgG1> (SEQIDNO:2) MALVLILQLLTLWPLCHTDITPSVAIIVPPASYHPKPWLGAQPATVVTPG VNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGG SYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANV SLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCY YHTPSAPYVLSQRSEVLVISWEGEGPEARPASDKTHTCPPCRAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLRQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVESCSVMHEALHNHYTQ KSLSLSPGK*
[0278] (The underline indicates a hinge region. The upstream from the hinge region indicates the sequence of human Oscar, and the downstream from the hinge region indicates the human IgG1 sequence.)
1. Preparation of Cells
[0279] FreeStyle 293-F cells were subcultured in Freestyle 293 Expression Medium (Invitrogen). The subculture was performed using a 500 ml flask at the following conditions: a shaking speed of 120 r.p.m., a carbon dioxide concentration of 8%, and a temperature of 37 C. (170 mL of medium). The cells were diluted at 610.sup.5 cells/mL to a total amount of 1 L the day before transfection, and cultured for 24 hours. After the culture, the number of cells was adjusted to 110.sup.6 cells/mL, and the cells were used for transfection.
2. Expression Test
[0280] 2.1 mL of 293fectin Transfection Reagent (Invitrogen) was added to 30 mL of OptiPRO SFM (Invitrogen) pre-warmed to 37 C., thereby preparing a reagent solution. Similarly, 1 mg of pcDNA3 (Invitrogen) containing kozak-hOscar-hIgG1-intronXbaI having the following sequence was added to 30 mL of OptiPRO SEM, thereby preparing a DNA solution. The prepared reagent solution and DNA solution were incubated at room temperature for 5 minutes. The reagent solution and DNA solution after the 5 minutes were mixed to prepare a transfection solution. The transfection solution was incubated at room temperature for 20 minutes and added to the culture medium adjusted for transfection, followed by sampling on day 1, day 2, and day 3 after the start of the transfection. The culture was then terminated on day 4. The obtained samples were centrifuged to separate into a supernatant and a precipitate. The protein expression was confirmed by SDS-PAGE and Western blotting.
TABLE-US-00008 <kozak-hOscar-hIgG1-intronXbaI> (SEQIDNO:5) aagcttgccaccATGGCCCTCGTGCTTATCCTCCAACTTCTCACGCTT TGGCCTCTGTGCCACACCGACATTACTCCGTCTGTTGCGATAATTGTC CCTCCCGCCTCTTATCACCCTAAACCTTGGCTGGGCGCACAGCCAGCT ACTGTGGTTACTCCTGGGGTGAACGTAACACTGCGCTGCCGTGCTCCT CAGCCCGCCTGGAGATTTGGGTTGTTTAAGCCCGGAGAGATAGCACCA CTGCTGTTTCGGGATGTGTCCTCAGAGCTGGCTGAGTTCTTCCTGGAA GAGGTCACTCCTGCCCAAGGAGGCAGCTATCGGTGCTGTTATAGGCGG CCGGATTGGGGACCCGGCGTTTGGTCCCAACCATCTGATGTGCTCGAA CTGCTTGTGACAGAAGAGCTGCCCAGACCTAGCTTGGTAGCCTTGCCC GGTCCTGTCGTCGGACCTGGTGCCAATGTTTCTCTTCGATGTGCCGGA AGGCTGCGCAATATGTCCTTTGTACTGTATAGGGAGGGAGTAGCCGCA CCTCTGCAGTATAGGCATAGCGCTCAGCCCTGGGCGGATTTTACTCTG CTTGGTGCCAGAGCACCCGGGACCTATTCCTGCTACTACCACACTCCT TCCGCACCCTACGTCCTGTCACAGAGATCAGAAGTGCTCGTGATCTCC TGGGAGGGAGAAGGCCCAGAAGCCGACAAAACTCACACATGCCCACCG TGCCCAGgtaagccagcccaggcctcgccctccagctcaaggcgggac aggtgccctagagtagcctgcatccagggacaggccccagccgggtgc tgacacgtccacctccatctcttcctcagCACCTGAACTCCTGGGGGG ACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACCCTCATGAT CTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGA AGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCA TAATGCCAAGACAAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCG TGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAA GGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGA GAAAACCATCTCCAAAGCCAAAGgtgggacccgtggggtgcgagggcc acatggacagaggccggctcggcccaccctctgccctgagagtgactg ctgtaccaacctctgtccctacagGGCAGCCCCGAGAACCACAGGTGT ACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGGTCAGCC TGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGT GGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCG TGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGG ACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGC ATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTC CGGGTAAATGAtctaga
3. Purification using Bipo Resin Protein A
[0281] The culture supernatant (1 L) was loaded on Bipo Resin Protein A (10 mL) to purify a target protein. After washing with PBS, elution of the target protein was performed using 100 mM citric acid buffer (pH 2.5) (5 mL5). The eluate was neutralized with 1M Tris-HCI (pH 9.0). After the purification, protein purification was confirmed in each fraction by SDS-PAGE and Western blotting. The results confirmed a band of the target protein in the elution fraction. The fraction containing the target protein was collected, followed by a buffer exchange into PBS (total amount: 50 mL). Thereby, 1 mg/mL of a soluble human Oscar-Fc fusion protein was obtained.
Example 2
Experiment of Administration of Soluble Human Oscar-Fc Fusion Protein to HP Model Mice
[0282] HP mice (mice ingested a diet with high phosphorus content) were obtained by feeding mice a diet with high phosphorus content. The soluble human Oscar-Fc fusion protein was administered to this model every week.
1. Phosphorus Overload
[0283] Mice ingested a diet with high phosphorus content (HP) were obtained by feeding mice (C57BL/6N, 8 weeks old, male) a diet containing 2% inorganic phosphorus (TD.10662, OrientalBioService, Inc.) as a special phosphorus diet. Mice ingested a diet with low phosphorus content (LP) were fed a diet containing 0.35% inorganic phosphorus (TD.10662 modified type, OrientalBioService, Inc.).
2. Administration of Soluble Human Oscar-Fc Fusion Protein and Collection of Tissue
[0284] The soluble human Oscar-Fc fusion protein (10 mg/kg) was intraperitoneally administered weekly from the start date of the diet with high phosphorus content (week 0) to week 4, i.e., a total of five times. In this experiment, physiological saline was administered to a control group. Tissue was collected the day after completion of the intraperitoneal administration on week 4, i.e., the fifth intraperitoneal administration. The animals from which the tissue was to be collected were euthanized by cervical dislocation after blood was collected in an EDTA-supplemented tube from the orbit under tribromoethanol anesthesia (250 mg/kg), and the organs and tissue (the skull, brain, pituitary gland, parotid glands, thyroid gland, heart, lung, pancreas, kidney, adrenal glands, liver, spleen, thymus, aorta, femoral muscle, skin, testis, adipose tissue, stomach, jejunum, ileum, colon, and bone marrow cells) were collected. After the wet weights of the collected organs and tissue were measured, the organs and tissue were rapidly frozen in liquid nitrogen and stored at 80 C. The collected blood was centrifuged at 1200 g for 10 minutes at room temperature. After the centrifugation, the supernatant plasma was collected and stored at 80 C.
3. Analysis of Gene Expression in Each Tissue
[0285] 3-1. RNA Extraction from Each Tissue
[0286] Each cryopreserved tissue was individually homogenized in TRIzol Reagent (Thermo Fisher Scientific, MA, USA) with a PT10-35 GT Polytron homogenizer (KINEMATICA, Luzern, Switzerland) at 15,000 r.p.m. for 10 minutes, or homogenized using zirconia beads of different sizes (1.5 mm diameter50, 3 mm diameter5, 5 mm diameter2) with a Cell Destroyer PS1000 or PS2000 (Bio Medical Science Inc., Tokyo, Japan) at 4,260 r.p.m. for 45 seconds at 4 C. After incubation at room temperature for 5 minutes to separate proteins, 0.2 ml of chloroform was added per 1 mL of TRIzol, and the tube was capped. Subsequently, the mixture was vortexed vigorously for 15 seconds. After the vortexing, the mixture was incubated at room temperature for 3 minutes and centrifuged at 12,000 g for 15 minutes at 4 C., and the RNA-containing aqueous layer was collected in a fresh tube. An equal amount of 70% ethanol was added to the collected aqueous layer, and mixed. Then, 700 L of the mixture was applied to each RNeasy Mini column (Qiagen), and purified RNAs were collected according to the RNeasy Mini kit (Qiagen) standard protocol. The quality and concentration of each of the collected RNAs was evaluated by using NanoDrop (Thermo Fisher Scientific, MA, USA).
3-2. qRT-PCR
[0287] 0.5 to 1 g of total RNA obtained from each tissue was used as a template for cDNA synthesis, and cDNA was synthesized using Oligo dT20 Primer according to the standard protocol of SuperScript III First-Strand Synthesis SuperMix (Life Technologies). After the synthesized cDNA was diluted 20-fold with TE buffer (10 mM Tris-HCl, pH 8.0, 0.1 mM EDTA), real-time PCR was performed with a LightCycler 480 II (Roche) according to the standard protocol of LightCycler 480 SYBR Green I Master (Roche, Basel, Switzerland), and Cp values were measured. The relative expression level of each gene to a reference gene was quantified by comparing the Cp value obtained for each gene with the Cp value for Maea as the reference gene. The primer pairs used in the real-time PCR are as shown in Table 5. All of the primers were designed by using Primer-BLAST (NCBI).
TABLE-US-00009 TABLE5 SEQID SEQID Gene Forward NO. Reverse NO. 1 Maea AAGACCTTGAGTAGTTGCCCA (6) TGCTCGATCCTACGTTTGCAG (7) 2 Fgf23 AGGAGCCATGACTCGAAGGT (8) GCTCACCAGGTAGTGATGCTT (9) 3 Prb1 ACCCCAGCATGGAAACAAAG (10) AAGAATGGTATTGAAGTCATCTGTC (11) 4 Prh1 ACCCCGTGAAGAAAATCAGAA (12) TAACAGGCGGTCTTGGTTGG (13) 5 Prp2 TGGTGGTCCTGTTTACAGTGG (14) TTCTGAAGTTCTTCACGGGGT (15) 6 Prpmp5 CCTACGAAGACTCAAATTCTCAGC (16) GAGGACCATGGTGGTGTCC (17) 7 B2m GCTCGGTGACCCTGGTCTTT (18) AATGTGAGGCGGGTGGAACT (19) 8 Fgg CTCCATCGGAGAAGGACAGC (2016) AGGTCCTGAAAGTCCATTGTCC (2017)
4. Measurement of Concentration of FGF23 in Plasma by ELISA Method
[0288] The concentration of FGF23 in plasma was measured using an ELISA kit sold by KAINOS Laboratories, Inc. (TCY4000). A plasma sample cryopreserved in a freezer was thawed on ice, and the sample undiluted or the sample diluted 5-fold with standard solution 1 (FGF-23 concentration, 0 pg/ml) supplied with the kit was used for measurement.
[0289] 50 l of the diluted sample or a sample for a calibration curve was added to each well of an ELISA plate supplied with the kit. The plate was sealed, followed by stirring and incubating at room temperature for 2 hours. After the 2 hours, the sample in each well was aspirated and discarded. 300 l of a wash solution supplied with the kit was then added to each well, and the wash solution was removed. This operation was performed four times. After the wash solution was thoroughly removed, 100 l of an enzyme-labeled antibody solution (FGF-23 Conjugate) supplied with the kit was added to each well, and the plate was sealed, followed by stirring and incubating at room temperature for 1 hour. After the 1 hour, the sample in each well was aspirated and discarded. 300 l of the wash solution supplied with the kit was then added to each well, and the wash solution was removed. This operation was performed four times. After the wash solution was thoroughly removed, 100 l of a substrate solution (Substrate) supplied with the kit was added to each well, and the plate was allowed to stand at room temperature for 30 minutes in the shade. Thereafter, 100 l of a reaction stop solution (Stop Solution) supplied with the kit was added to each well, followed by gentle shaking. Absorbance at 450 nm was then measured with an absorbance microplate reader (Multiskan GO, Thermo Fisher Scientific Inc.). The concentration of FGF23 in plasma was calculated by making a calibration curve from the measurement result of recombinant. FGF23 supplied with the kit.
5. Statistical Analysis
[0290] In statistical analysis, Student's t-test or one-way analysis of variance was performed, and then significant differences were determined by the Tukey-Kramer test. The case in which the p-value is less than 0.05 was defined as being significant.
6. Results
[0291] Hereinafter, in the drawings, HP4W indicates mice 4 weeks after the start of the diet with high phosphorus content, and LP4W indicates mice 4 weeks after the start of the diet with low phosphorus content (control group). sOscar indicates mice to which the soluble human Oscar-Fc fusion protein was administered, and NS indicates mice to which physiological saline was administered in place of the soluble human Oscar-Fc fusion protein. WT (12W) indicates 12-week-old male wild-type mice fed a normal diet.
[0292]
[0293]
[0294] As described later, qRT-PCR analysis in the bones of the 1-week model of Oscar gene mutant mice fed the diet with high phosphorus content showed that the increase in the expression of renal failure early marker FGF23 gene was significantly suppressed. In this experiment, administering the soluble human Oscar-Fc fusion protein, which has an effect of inhibiting ligand binding to Oscar, from the early stage of phosphorus overload suppressed the expression of the FGF23 gene, which is deeply involved in clinical states such as chronic kidney disease, in the bones; and further suppressed the increase in the concentration of FGF23 in plasma. This showed the potential of administering the soluble human Oscar-Fc fusion protein as a novel treatment method for improving a clinical state caused by an excess phosphorus state, such as kidney damage.
[0295] To evaluate the effect of the soluble Oscar-Fc fusion protein on kidney function, the expression of a kidney function marker was confirmed in the kidneys of HP4W_NS, HP4W_sOscar, and LP4W.
[0296] In the kidneys, the expression of the Fgg gene, which is a fibrinogen gene whose expression is induced by a diet with high phosphorus content, was significantly suppressed by administration of the soluble Oscar-Fc fusion protein (
Experimental Example I
Establishment of Oscar Gene Mutant Mice
[0297] 1. Construction of gRNA and Cas9 Expression Vector
[0298] gRNA sequences (Oscar-gRNA1 and Oscar-gRNA2) were designed, and oligo DNA encoding the gRNA sequences was synthesized using an Optimized CRISPR design tool (publicly available on the website of Massachusetts Institute of Technology, Zhang Lab (http://crispr.mit.edu/)). The Oscar gene target sequences contained in these sequences are the following sequences: ACAGCTGGAGTATCAGCGAC (SEQ ID NO: 20) in Oscar-gRNA1 and GCTCACAGAGAGTCGACAGC (SEQ ID NO: 21) in Oscar-gRNA2, which are present in exon 1 of the Oscar gene. These were individually inserted into pX330-U6-Chimeric_BB-CBh-hSpCas9, which is a Cas9 expression vector (pX330-Oscar-gRNA1 and pX330-Oscar-gRNA2). The nucleotide sequences of the gRNA insertion sites in the obtained vectors were determined to confirm that gRNA was inserted as designed. In addition, single-stranded oligodeoxynucleotides (ssODNs) were individually synthesized so as to include the respective Oscar gene target sequences. The donor oligo DNA region was designed so that a stop codon is placed immediately downstream of the Serine coding sequence of the predetermined Oscar-gRNA1 cleavage site, and immediately downstream of the Leucine coding sequence of the predetermined Oscar-gRNA2 cleavage site (
TABLE-US-00010 ssODNsforOscar-gRNA1: (SEQIDNO:22) GCCAAGGATCCACACACAGGGGAGGGGACAGCTCACAGAGAGTCGACA GCTGGAGTATCAGcctcagaagaactcgtcaagaagtcaCGACAGGAC CATGGTGGGCACTCTCCGTGGAGCTGAGGAAAAGGTTGACCCTGCCTT TTT ssODNsforOscar-gRNA2: (SEQIDNO:23) ATAGCCCTCAGCCCAGCCAAGGATCCACACACAGGGGAGGGACAGCTC ACAGAGAGTCGAcctcagaagaactcgtcaagaagtcaCAGCTGGAGT ATCAGCGACAGGACCATGGTGGGCACTCTCCGTGGAGCTGAGGAAAAG GT
2. Establishment of Oscar Gene Mutant Mice
[0299] pX330-Oscar-gRNA1 and pX330-Oscar-gRNA2 were individually injected into C57BL/6N Slc fertilized eggs together with the corresponding ssODNs. The fertilized eggs after the injection were injected into the oviducts of pseudopregnant ICR female mice. The genotype of the F0 mice was confirmed by PCR (for the primers, see Table 5) and direct sequencing. F1 mice were obtained by mating the F0 mice.
[0300] The genotype of each mouse was determined by direct sequencing and high-resolution melting (HRM) analyses using the primers shown in Table 5.
[0301]
Experimental Example II
Establishment of Disease Model Mice
1. Establishment of UNx/HPi Model Mice
[0302] UNx/HPi mice (unilateral nephrectomy-a diet with high phosphorus content-ingested mice) were obtained by feeding mice a diet with high phosphorus content after unilateral nephrectomy. As a control, mice were obtained by feeding them a diet with low phosphorus content after a sham operation.
1-1. Unilateral Nephrectomy
[0303] After mice (C57BL/6J, 8 weeks old, male) were anesthetized by intraperitoneal administration of Avertin (250 mg/kg), the skin was incised from the back. The right renal artery and vein, and ureter were ligated. After cutting on the distal side of the ligation, the right kidney was removed, and the incision was closed. The control mice were subjected to a sham operation. In the sham operation, the right renal artery and vein, and ureter were exposed, and the incision was closed without ligation. In order to wait for the mice to completely recover from operative stress, the mice were fed a 0.54% inorganic phosphorus-containing normal diet (CE-2, CLEA Japan, Inc.) for 4 weeks.
1-2. Phosphorus Overload and Collection of Tissue
[0304] From 4 weeks after the completion of the operation (12 weeks old), the unilaterally nephrectomized mice were given a diet with high phosphorus content in which contains 2% inorganic phosphorus (TD.10662, OrientalBioService, Inc.) (hereinafter also referred to as the kidney disease group). The sham-operated mice were given a diet with low phosphorus content in which contains 0.35% inorganic phosphorus (TD.10662 modified type, OrientalBioService, Inc.) (hereinafter also referred to as the Sham group).
[0305] The model mice of chronic kidney disease were obtained by a modification of the method described in Hu M. C. et al. (J Am Soc Nephrol 22, 124-136, 2011). In Hu M. C. et al., the remaining kidney (left kidney) is subjected to ischemic-reperfusion injury at the time of unilateral nephrectomy in Item 1 above. However, in this modification, ischemia-reperfusion was not performed. Tissue was collected 1 week (E), 4 weeks (M), and 8 weeks (L) after the start of the a diet with high phosphorus content (the diet with low phosphorus content in the Sham group).
[0306] The animals from which the tissue was to be collected were euthanized by cervical dislocation after blood was collected from the orbit under anesthesia, and the organs and tissue (bone marrow, brain, skin, heart, kidney, liver, lung, pancreas, skeletal muscle, spleen, testis, thymus, adipose, colon, stomach, adrenal glands, aorta, eyes, ileum, jejunum, pituitary gland, skull, salivary glands, and thyroid gland) were collected. After the wet weights of the collected organs and tissue were measured, the organs and tissue were rapidly frozen in liquid nitrogen and stored at 80 C.
2. Establishment of Model of Phoshorus-Overloaded Mice
2-1. Phosphorus Overload
[0307] WT mice (C57BL/6N, 7 weeks old, male) or Oscar gene mutant mice (7-16 weeks old, male/female) were fed a 0.54% inorganic phosphorus-containing normal diet (CE-2, CLEA Japan, Inc.) for 1 week. Thereafter, the mice were given a diet with high phosphorus content in which contains 2% inorganic phosphorus (TD.10662, OrientalBioService, Inc.) or a diet with low phosphorus content in which contains 0.35% inorganic phosphorus (TD.10662 modified type, OrientalBioService, Inc.) as a special phosphorus diet.
2-2. Collection of Tissue
[0308] The skull was collected at the time of the start of the special phosphorus diet fed to the WT mice (8 weeks old), 1 day, 3 days, 1 week (9 weeks old), and 4 weeks (12 weeks old) after the start. In the Oscar gene mutant mice, the skull was collected 1 week after the start of the special phosphorus diet. The animals from which the tissue was to be collected were euthanized by cervical dislocation after being anesthetized by intraperitoneal administration of Avertin (250 mg/kg), and the tissue was collected. After the weight of the collected tissue was measured, the tissue was rapidly frozen in liquid nitrogen, and stored at 80 C.
Experimental Example III
Analysis of Gene Expression in Each Tissue
[0309] 1. Extraction of RNA from Each Tissue
[0310] Each cryopreserved tissue was individually homogenized in TRIzol Reagent (Thermo Fisher Scientific, MA, USA) with a PT10-35 GT Polytron homogenizer (KINEMATICA, Luzern, Switzerland) at 15,000 r.p.m. for 10 minutes; or ground with a mortar and pestle in liquid nitrogen, dried, and then homogenized in TRIzol Reagent (Thermo Fisher Scientific, MA, USA) with a PT10-35 GT Polytron homogenizer (KINEMATICA, Luzern, Switzerland) at 15,000 r.p.m. for 10 minutes; or homogenized using zirconia beads of different sizes (1.5 mm diameter50, 3 mm diameter5, 5 mm diameter2) with Cell Destroyer PS1000 or PS2000 (Bio Medical Science Inc., Tokyo, Japan) at 4,260 r.p.m. for 45 seconds at 4 C. After incubation at room temperature for 5 minutes to separate proteins, 0.2 mL of chloroform was added per mL of TRIzol, and the tube was capped. Subsequently, the mixture was vortexed vigorously for 15 seconds. After the vortexing, the mixture was incubated at room temperature for 3 minutes and centrifuged at 12,000 g for 15 minutes at 4 C., and the RNA-containing aqueous layer was collected in a fresh tube. An equal amount of 70% ethanol was added to the collected aqueous layer, and mixed. Then, 700 L of the mixture was applied to each RNeasy Mini column (Qiagen), and purified RNAs were collected according to the RNeasy Mini kit (Qiagen) standard protocol. The quality and concentration of each of the collected RNAs was evaluated by using NanoDrop (Thermo Fisher Scientific, MA, USA).
2. Analysis of RNA Expression (RNA-Seq)
(1) Obtaining RNA-Seq Data
[0311] RNA-Seq data was obtained using the samples described above by the following procedure.
a. Quality Check
[0312] Quality testing of the samples was performed based on the following items. [0313] Concentration measurement using NanoDrop (spectrophotometer) [0314] Concentration measurement and quality check using Agilent 2100 Bioanalyzer
b. Preparation of Sample
[0315] A library for a HiSeq next-generation sequencer was prepared with a SureSelect Strand-Specific RNA library preparation kit in the following manner. [0316] i. Collection of poly (A)+RNA (mRNA) from total RNA using Oligo (dT) magnetic beads [0317] ii. Fragmentation of RNA [0318] iii. cDNA synthesis [0319] iv. Double-stranded cDNA synthesis [0320] v. Terminus repair, phosphorylation, A tail addition [0321] vi. Ligation of adapters with indices [0322] vii. 13-cycle PCR [0323] viii. Purification with magnetic beads
c. Obtaining Data Using Next-Generation Sequencer
[0324] Sequencing was performed using a HiSeq 2500 or 4000 next-generation sequencer (Illumina) in the following manner. [0325] i. Addition of sequencing reagent [0326] Reagent: TruSeq PE Cluster Kit v3cBotHS (1 flowcell) <PE-401-3001> (Illumina) [0327] Reagent: TruSeq SBS Kit v3 HS (200 cycle) <FC-401-3001> (Illumina) [0328] ii. Single-base extension reaction [0329] iii. Removal of unreacted bases [0330] iv. Incorporation of fluorescent signal [0331] v. Removal of protecting groups and fluorescence [0332] The cycle was repeated (e.g., cycle 2, cycle 3 . . . ) and these steps were carried out to 100 cycles. [0333] vi. For the opposite strand (Read 2), i to v were carried out to 100 cycles.
(2) Analysis of RNA-Seq Data
(2)-1. Analysis of Output Data Obtained Using Next-Generation Sequencer
[0334] The following information processing was carried out for the output data. [0335] i. Base calling: text data of nucleotide sequences was obtained from the output raw data of analysis (image data). [0336] ii. Filtering: selection of read data by predetermined filtering was performed. [0337] iii. Sorting based on index sequences: sample data was sorted based on index information.
(2)-2. Secondary Analysis of Output Data
[0338] The data file (Fastq format) obtained using an Illumina HiSeq 2500 or 4000 was uploaded on Galaxy (https://usegalaxy.org/) downloaded to a local server. Thereafter, analysis was carried out using Bowtie2 (http://bowtie-bio.sourceforge.net/bowtie2/index.shtml) to map each sequence to mouse genome map information mm10. The BAM file obtained using Bowtie2 was analyzed using Cufflinks (http://cole-trapnell-lab.github.io/cufflinks/) to calculate the FPKM (RPKM) of genes. That is, in this analysis, all RNAs expressed in each tissue were analyzed.
3. qRT-PCR
[0339] 1 g of total RNA obtained from each tissue was used as a template for cDNA synthesis, and cDNA was synthesized using Oligo dT20 primer according to the standard protocol of Superscript III First-Strand Synthesis SuperMix (Life Technologies). After the synthesized cDNA was diluted 20-fold with TE buffer (10 mM Tris-HCl, pH 8.0, 0.1 mM EDTA), real-time PCR was performed with a LightCycler 480 II (Roche) according to the standard protocol of LightCycler 480 SYBR Green I Master (Roche, Basel, Switzerland), and Cp values were measured. The relative expression level of each gene to a reference gene was quantified by comparing the Cp value obtained for each gene with the Cp value for 2-microglobulin (B2m) as the reference gene. The primer pairs used in the real-time PCR are as shown in Table 6. All of the primers were designed by using Primer BLAST (NCBI).
TABLE-US-00011 TABLE6 SEQID Target Sequence NO. Forwardprimerfor CTACTTAGCGACAACGTCCT 24 Direct-sequence analysis Reverseprimerfor GCCTTGGGGTTTGAAGGTTT 25 Direct-sequence analysis Sequenceprimerfor CAGAGGCTATGACTGTTCCA 26 Direct-sequence analysis Forwardprimerfor GGCAGGGTCAACCTTTTCCT 27 HRManalysis Reverseprimerfor AGGGACAGCTCACAGAGACT 28 HRManalysis Forwardprimer:B2m GCTCGGTGACCCTGGTCTTT 29 Reverseprimer:B2m AATGTGAGGCGGGTGGAACT 30 Forwardprimer:Oscar CGGGCATGAGTTTTGCACTG 31 Reverseprimer:Oscar TGGGTATAGTCCAAGGAGCCA 32 Forwardprimer:Fgf23 AGGAGCCATGACTCGAAGGT 33 Reverseprimer:Fgf23 GCTCACCAGGTAGTGATGCTT 34
4. Analysis of Differentially Expressed Genes
[0340] To extract differentially expressed genes, the number of annotation reads of each transcript in sequence data mapped by Bowtie2 was counted by using HTSeq-count (parameter: -r was pos, and -s was no) The obtained results were analyzed by DESeq2 (Love, M. I., Huber, W. & Anders, S.; Genome biology 15, 550, doi:10.1186/s13059-014-0550-8 (2014)) with default settings. Expression differences were compared in E-UNx/HPi vs. E-/M-/L-Sham (n=3), M-UNx/HPi vs. E-/M-/L-Sham (n=3), and L-UNx/HPi vs. B-/M-/L-Sham (n=3). Gene ontology (GO) enrichment analysis was performed using R package topGO. In the gene ontology (GO) enrichment analysis, the case in which the result of the DESeq2 analysis is 1 or more and the p-value is less than 0.05 was defined as log.sub.2 (fold-change).
5. Statistical Analysis
[0341] In statistical analysis, Student's t-test or one-way analysis of variance was performed, and then significant differences were determined by the Tukey -Kramer test. The case in which the p-value is less than 0.05 was defined as being significant (* p<0.05, ** p<0.01, and *** p<0.001). In the scatter plots, the average value is indicated by a horizontal line.
6. Results
[0342]
[0343] FGF23 is a master regulator of inter-organ cross talk between the parathyroid glands, bones, and kidneys in kidney disease. The expression of the FGF23 gene in the skull increased in the UNx/HPi model mice (HPi) at E-UNx/HPi, M-UNx/HPi, and L-UNx/HPi, compared with that in the sham-operated mice (LPi) (
[0344] Next, the expression of the Oscar gene and the FGF23 gene over time after the feed of the mice was switched from the normal diet to the diet with low phosphorus content or the diet with high phosphorus content was examined in the skull.
[0345] Further, what effect an increase in the expression of Oscar in the bones has on the expression of FGF23 in the bones was examined. The Oscar gene mutant mice obtained in Item I. above were fed a diet with high phosphorus content, and the expression of FGF23 in the bones was examined by qRT-PCR. The results revealed that the expression of FGF23 did not increase in the bones of the Oscar gene mutant mice even if they were fed the diet with high phosphorus content, as shown in
[0346] The above results showed that Oscar up-regulates the expression pathway of FGF23. This indicated that suppressing the functional expression of Oscar enables suppression of the functional expression of FGF23, and further that suppressing the functional expression of Oscar enables control of disease associated with FGF23.
Experimental Example IV
Measurement of Creatinine in Plasma
[0347] Mice (C57BL/6N, 8 weeks old, male) were fed a diet with high phosphorus content in which contains 2% inorganic phosphorus (TD.10662, OrientalBioService, Inc.) or a diet with low phosphorus content in which contains 0.35% inorganic phosphorus (TD.10662 modified type, OrientalBioService, Inc.) as a special phosphorus diet for 4 weeks. Thereafter, plasma samples (LP4W, HP4W) were collected and cryopreserved. A plasma sample (WT (12W)) was collected from 12-week-old male mice (C57BL/6N) fed a normal diet, and cryopreserved. 8-week-old male mice (CS7BL/6N) were subjected to unilateral nephrectomy, and after being adapted for 4 weeks, the mice were fed a diet with high phosphorus content for 4 weeks. Thereafter, a plasma sample (UNx/HP4W) was collected and cryopreserved. Creatinine values in plasma were measured using 100 l of each sample by an enzymatic method.
[0348]
[0349] From the fact that the expression of PRPs and Fgg increased in the HP4W model and the UNx/HP4W model, it was believed that measuring PRPs and Fgg enables detection of declined kidney function earlier than the amount of creatinine in blood increases. Therefore, it was believed that a decline in kidney function can be suppressed in an early stage by administering the soluble human Oscar-Fc fusion protein at a stage when the amount of creatinine has not yet increased, and when PRPs and Fgg are increased.
Reference Example 1
Expression of PRPs in Model of Phosphorus-Overloaded Mice
1. Establishment of Model of Phosphorus-Overloaded Mice
[0350] Mice (CS7BL/6, 7 weeks old, male) that had not been subjected to unilateral nephrectomy were fed a 0.54% inorganic phosphorus-containing normal diet (CE-2, CLEA Japan, Inc.) for 1 week. Thereafter, the mice were given a diet which contains 2% inorganic phosphorus (TD.10662, OrientalBioService, Inc.) as a diet with high phosphorus content or a diet which contains 0.35% inorganic phosphorus (TD.10662 modified type, OrientalBioService, Inc.) as a diet with low phosphorus content. In each group, n=10.
2. Analysis of Proline-Rich Protein (PRP) Gene Expression in Salivary Glands
(1) Collection of Tissue
[0351] The salivary glands and skull were collected 1 week (9 weeks old) and 4 weeks (12 weeks old) after the start of the diet with high phosphorus content or the diet with low phosphorus content in the mice. Regarding the salivary glands, the submandibular glands, sublingual glands, parotid glands, and surrounding connective tissue (including lymph nodes) were separately collected individually. The animals from which the tissue was to be collected were euthanized by cervical dislocation after being anesthetized by intraperitoneal administration of Avertin (250 mg/kg), and the tissue was collected. After the weight of the collected tissue was measured, the tissue was rapidly frozen in liquid nitrogen, and stored at 80 C.
(2) Analysis of RNA
[0352] i. Extraction of RNA from Each Tissue
[0353] Each cryopreserved tissue was individually homogenized in TRIzol Reagent (Life Technologies) with a Cell Destroyer PS1000 (Bio Medical Science Inc.). After incubation at room temperature for 5 minutes to separate proteins, 0.2 mL of chloroform was added per mL of TRIzol, and the tube was capped. Subsequently, the mixture was vortexed vigorously for 15 seconds. After the vortexing, the mixture was incubated at room temperature for 3 minutes and centrifuged at 12,000 g for 15 minutes at 4 C., and the RNA-containing aqueous layer was collected in a fresh tube. An equal amount of 70% ethanol was added to the collected aqueous layer, and mixed. Then, the mixture was applied to an RNeasy Mini column (Qiagen), and purified RNAs were collected according to the RNeasy Mini kit (Qiagen) standard protocol. The quality and concentration of each of the collected RNAs was evaluated by 1% agarose electrophoresis and NanoDrop.
ii. cDNA Synthesis and Quantifying Relative Expression Level by Real-Time PCR
[0354] 1 g of total RNA obtained from each tissue was used as a template for cDNA synthesis, and cDNA was synthesized using Oligo dT20 primer according to the standard protocol of Superscript III First-Strand Synthesis SuperMix (Life Technologies). After the synthesized cDNA was diluted 20-fold with TE buffer (10 mM Tris-HCl, pH 8.0, 0.1 mM EDTA), real-time PCR was performed with a LightCycler 480 II (Roche) according to the standard protocol of LightCycler 480 SYBR Green I Master (Roche), and Cp values were measured. The relative expression level (2.sup.Cp) of each gene to a reference gene was quantified by comparing the Cp value obtained for each gene with the Cp value for 2-microglobulin (B2m) or Maea as the reference gene. The expression of PRP genes (PRPs: Prb1, Prh1, Prp2, Prpmp5) was examined in each salivary gland tissue, and the expression of FGF23 was examined in the skull. The primer pairs used in the real-time PCR are as shown in Table 5.
(3) Results
[0355] As shown in
Example 3
Expression of PRPs in Subject Who Ingested Diet with High Phosphorus Content
(1) Subject
[0356] Subjects were selected according to the following inclusion criteria. [0357] i. Person who is able to fully understand this study plan, and is able to give consent by themselves [0358] ii. Person aged 20 years or older at the time of obtaining consent
[0359] However, persons who meet any of the following criteria were excluded from the subjects. [0360] i. Person with a history of kidney disease to date [0361] ii. Person having a cardiovascular risk factor (obesity, high blood pressure, diabetes, smoking) [0362] iii. Person who is deemed unsuitable as a subject by a researcher
(2) Diet with High Phosphorus Content Ingestion
[0363] A diet with high phosphorus content group (group A) was asked to ingest a diet with high phosphorus content in addition to a normal diet. A normal diet group (group B) was a subject group that ingests a normal diet; the normal diet group was, however, asked to ingest as few phosphorus-rich foods as possible.
[0364] Both group A and group B were asked to refrain from ingesting phosphorus-rich foods (foods listed in Table 7) as much as possible from Day 7. Group A was asked to select one of the dietary patterns shown in Table 8, and ingest the diet from Day 1 for 7 days. Group B was asked to ingest a normal diet (refrain from ingesting phosphorus-rich foods as much as possible). Table 9 shows the diet and saliva collection schedule.
TABLE-US-00012 TABLE 7 Fish and shellfish dried whitebait, dried small sardine, sardine, sand lance, splendid alfonsino, ayu (sweetfish), smelt, eel, dried squid, dried shrimp, salmon roe, cod roe, sea urchin, etc. Pulses freeze-dried tofu, soybean, soybean flour, pea, fermented soybean, etc. Dairy products processed cheese, skim milk powder, milk, etc. Flesh egg yolk, beef jerky, liver, etc. Nuts sesame, pine nut, cashew nut, almond, pistachio, peanut, walnut, etc. Processed foods rich in inorganic phosphorus as a food additive pastry, instant noodles, Chinese noodles, confectionery (biscuit, cookie)/seasoning for sprinkling over rice, rice ball containing solid ingredients, take-out meal in a box, savory bread, instant Chinese noodles, ham/sausage, bacon, frozen food, hamburger steak, fish meat/fish-paste product, food boiled in soy sauce, pastry, biscuit, cookie, carbonated drink, etc. Processed foods in which the following are indicated as ingredients lye water (potassium phosphate, sodium phosphate) yeast food (phosphoric acid salt) emulsifier etc. leavening agent (calcium phosphate) binding agent (phosphoric acid salt, potassium polyphosphate) agent for quality improvement (sodium polyphosphate)
TABLE-US-00013 TABLE 8 Pattern A Drink Skim milk (Megmilk Snow Brand .sup.1 L (powder: 96 g) 960 mg Mainichi Honebuto*) Pattern B Side dish 6P cheese (Megmilk Snow Brand*) 18 g 6 pieces 800 mg Snack One of snacks a to c 200 mg between meals Pattern C Staple food Cup Noodles* (Nissin*) 1 120 mg Drink Skim mik (Megmilk Snow Brand 500 ml (powder: 48 g) 480 mg Mainichi Honebuto*) Side dish 6P cheese (Megmilk Snow Brand*) 18 g 3 pieces 400 mg Pattern D Drink Skim milk (Megmilk Snow Brand 500 ml (powder: 48 g) 480 mg Mainichi Honebuto*) Side dish 6P cheese (Megmilk Snow Brand*) 18 g 3 pieces 400 mg Snack One of snacks a to c 200 mg between meals Snack a: popcorn (Seven & i), one bag (90 g) Snack b: chocolate bar (Meiji Milk Chocolate), two bars (116 g) Snack c: Glico Pucchin Purin* (pudding), 67 g 3 (201 g) The asterisk (*) indicates a registered trademark.
TABLE-US-00014 TABLE 9 Day 7 Day 6 Day 5 Day 4 Day 3 Day 2 Day 1 Day 1 Day 2 Day 3 Day 4 Day 5 Day 6 Day 7 Group A (high- phosphorus diet group
(3) Preparation of Saliva Sample
[0365] Saliva was collected with a Saliva Collection Aid (SCA) (Salimetrics LLC, Carlsbad, Calif.) on Days 1, 1, 3, 5, and 7. The collected saliva was stored in a freezer before measurement.
[0366] The saliva was stored in the freezer until measurement after collection from the subjects. At the time of measurement, the cryopreserved saliva was thawed, and part of the saliva was transferred to a 1.5-mL tube, followed by centrifugation at 1,000 g for 15 minutes at 4 C. After the centrifugation, the supernatant was collected, and PRPs in saliva samples obtained by diluting the supernatant 100- to 800-fold (hPRH2) or 10,000- to 80,000-fold (hPRB1, hPRB2) in phosphate buffer (PBS) were quantified by ELISA.
(4) ELISA Protocol
[0367] The concentrations of human PRPs in each saliva sample were measured by using ELISA kits sold by Cloud-Clone Corp. (SED810Hu (for detection of hPRB1), SED809Hu (for detection of hPRB2), SED812Hu (for detection of hPRH2)).
[0368] 100 l of the saliva sample or a sample for a calibration curve containing a recombinant protein in a predetermined amount, which is supplied with each kit, was added to each well of an ELISA plate supplied with the kit. The plate containing the sample was sealed, followed by incubation at 37 C. for 2 hours. After the incubation, the sample in each well was aspirated and discarded, and 100 pl of Detection Reagent A containing a biotin-labeled antibody prepared according to the kit protocol was added to each well. The plate was sealed, followed by incubation at 37 C. for 1 hour. After the incubation, the solution in each well was aspirated and discarded, and each well was washed three times with a wash solution. After the wash solution was thoroughly removed, 100 l of Detection Reagent B containing enzyme-labeled avidin prepared according to the kit protocol was added to each well. The plate was sealed, followed by incubation at 37 C. for 30 minutes. After the 30 minutes, the solution in each well was aspirated and discarded, and each well was washed five times with a wash solution. After the wash solution was thoroughly removed, 90 l of a substrate solution supplied with the kit was added to each well. The plate was sealed, followed by incubation at 37 C. for 20 minutes (hPRB1, hPRB2) or 40 minutes (PRH2). Thereafter, 50 l of a reaction stop solution supplied with the kit was added to each well, and absorbance at 450 nm was measured with an absorbance microplate reader (Multiskan GO, Thermo Fisher Scientific Inc.). The concentration of each protein, i.e., the concentration of each of PRPs in the saliva, was calculated by making a calibration curve using each recombinant protein supplied with the kit.
(5) Results
[0369]
[0370] Phosphorus intake was calculated, from the ingested diets. Phosphorus intake ratio in
Reference Example 2
Expression of PRPs in Patient with Kidney Disease
(1) Subject
[0371] Subjects were selected according to the following inclusion criteria. [0372] i. Patient diagnosed with chronic kidney disease or diabetic nephropathy [0373] Regarding chronic kidney disease, patient in GFR category G3 to G5 [0374] Regarding diabetic nephropathy, patient in clinical stage 1 to 3 [0375] Patient with multiple myeloma and at risk for kidney disease [0376] Alternatively, healthy subject (including subject at risk for lifestyle-related disease) [0377] ii. Person who is able to fully understand this study plan, and is able to give consent by themselves [0378] iii. Person aged 20 years or older at the time of obtaining consent
[0379] However, persons who meet any of the following criteria were excluded from the subjects. [0380] i. Person who is deemed unsuitable as a subject by a researcher [0381] ii. HBs antigen-positive person, HCV antibody-positive person [0382] iii. Subject undergoing dialysis
[0383] Table 10 shows clinical data of subjects diagnosed with chronic kidney disease or diabetic nephropathy.
TABLE-US-00015 TABLE 10 Subject No. 1 2 3 4 5 6 Reference value Unit Underlying disease CKD MM MM CKD CKD CKD Notes MDS, ML ML MDS MDS Body height 166.8 147.7 167.8 156.3 152.2 160.7 Body weight 61.6 55.2 65.4 55.2 53.2 60.8 BMI 22.14 25.3 23.28 22.6 26.67 23.16 Age 72 77 72 81 85 75 Sex M M M M M M Blood pressure 106/52 122/64 120/82 125/80 138/75 113/59 Blood cell count WBC 1500 3100 5600 6300 2900 1300 3400-8600 /l RBC 262 242 302 351 328 237 429-571(M), 369-491(F) 10{circumflex over ()}4/l Hb 9 7.6 9.6 10.9 9 7.4 13.4-17.1(M), 11.4-15.1(F) g/dl Ht 26.5 23.7 29.9 33.5 29.7 23.2 39.9-50.1(M), 34.9-45.1(F) % Plt 0.4 0.8 21.7 22.8 3.1 1.8 14.9-35.1 10{circumflex over ()}4/l Biochemical data GOT 16 10 19 20 23 19 13-33 U/L GPT 13 15 32 24 12 14 6.0-27 U/L GTP 15 35 16 49 18 30 10-47 U/L Neutral fat 186 96 157 165 101 199 30-149 mg/dl HDL-Chol 39.5 50.8 52.4 50.4 47 24 40-96 mg/dl LDL-Chol 93 63 70 104 90 86 70-139 mg/dl Creatinine 2.05 0.85 1.19 1.27 1.31 1.12 0.4-0.7 mg/dl eGFR 25.9 66.6 47 42.3 40.3 49.6 Inorganic P 3.8 3.5 4.5 3.1 3.6 2.6 2.5-4.7 mg/dl BUN 23.9 23.1 22.3 19.7 37.6 12.3 8.0-22 mg/dl Albumin 3.3 3.4 3 3.7 3.8 2.7 4.0-5.0 mg/dl FGF23 (serum) 162 33 122 12 69 46 ?? pg/ml Fasting blood sugar 89 79 102 77 109 89 70-109 mg/dl HbA1c (NGSP) 5.8 5.7 6.2 6 5.4 6.2 4.6-6.2 % Urinary protein 2+ Urinary sugar L-FABP (urine) concentration 9.26 106.82 1.77 4.42 2.84 9.76 ?? ng/ml L-FABP in terms of creatinine 13.35 177.41 2.37 7.93 4.94 19.06 8.4 or less g/gCr hPrb1 in saliva 145.9 472.8 1018.1 904.1 602.2 1013.6 g/ml CKD: chronic kidney disease, MM: multiple myeloma, MDS: myelodysplastic syndrome, ML: malignant lymphoma
(2) Measurement of hPRB1
[0384] The concentration of hPRB1 in saliva of each subject was measured according to the methods of Example 3 (3) and (4).
[0385] Statistical analysis was performed by using Student's t-test.
(3) Results
[0386] As shown in
Reference Example 3
Expression of PRPs in Subject Who Ingested Diet with High Phosphorus Content (2)
[0387] The proteins in saliva collected from the subjects of Reference Example 2(1) were decomposed with a proteolytic enzyme, and the concentration of proline was measured to examine whether the proline concentration correlates with the diet with high phosphorus content.
(1) Decomposition of Protein in Saliva and Derivatization of Decomposition Product
[0388] After cryopreserved saliva was thawed, 700 L of the saliva was transferred to a 1.5-mL tube and centrifuged at 1,000g for 15 minutes at 4 C., and the supernatant was collected. 10.5 L of the saliva supernatant was diluted 20-fold with 199.5 L of Digestion Buffer (0.1 M Tris-HCl (pH 7.5), 0.5% SDS). 100 L of the diluted saliva supernatant was transferred to a 1.5-mL tube. 20 L of Pronase (10 g/mL) was added to 100 L of the diluted saliva supernatant, and the tube was wrapped with aluminum foil, followed by reacting at room temperature for 1 hour.
[0389] 1.5 L of 2-isopropylmalic acid (internal standard) was added per mL of chromatography grade methanol, and a requisite amount of the resulting solution was prepared. Subsequently, 500 L of the methanol solution containing 2-isopropylmalic acid was added to the Pronase reaction mixture, and the mixture was stirred by vortexing for 30 seconds for spin-down. After the mixture was allowed to stand at room temperature for 5 minutes, 200 L, of ultrapure water was added, and the mixture was stirred by vortexing for 30 seconds and centrifuged at 4600g for 5 minutes at 4 C. 400 L of the first supernatant was transferred from the centrifuge tube to another 1.5-mL tube. 200 L of ultrapure water was added to the first supernatant, and the mixture was stirred by vortexing for 30 seconds and centrifuged at 4600g for 5 minutes at 4 C. 400 L of the second supernatant was transferred from the centrifuge tube to an ultrafiltration unit cup (Hydrophilic PTFE membrane, 0.2 m; Millipore) and centrifuged at 9100g for 15 minutes at 4 C. The filtrate was dried under reduced pressure at 65 C. for one hour and 30 minutes. 50 L of a pyridine solution containing 20 mg/ML methoxyamine hydrochloride was added to the residue after drying, and the mixture was shaken with a shaker at 37 C. for 90 minutes. Thereafter, 50 L of N-methyl-N-trimethylsilyltrifluoroacetamide (MSTFA) was further added, and the mixture was shaken with a shaker at 37 C. for 30 minutes, and trimethylsilylated.
(2) GCMS Measurement
[0390] GCMS-TQ8030 (Shimadzu Corporation) was used for GCMS, and DB-5 (30 m0.25 mm (inner diameter)1.00 um (film thickness)) (Agilent Technologies) was used as a capillary column for GC. GC was performed under the following temperature increase conditions: the temperature was increased at a rate of 4 C./min from 100 C. to 320 C. The injector port temperature was 280 C. Helium was used as a carrier gas, and made to flow at a rate of 39.0 cm/sec. The energy of the electron ionization was 150 eV, the ion source temperature was 200 C., and proline-2TMS {142.10/73.0} and 2-isopropylmalic acid {216.10/147.10} were measured in MRM mode. 1 L of the sample was injected, the splitless mode was used, and measurement was performed at a detector voltage of 1.50 kV.
(3) Analysis of GCMS Data
[0391] Analysis was performed by using GCMS Solution Ver. 4.2 data analysis software and the GCMS Metabolites Database (Shimadzu Corporation). A dilution series of purified praline at the following six points: 0.02, 0.01, 0.005, 0.0005, 0.00005, and 0.000005 (nmol/L) was prepared, and a calibration curve was prepared by using known concentrations of praline.
[0392] The concentration of proline was determined by dividing the peak area of proline by the peak area of the internal standard (2-isopropylmalic acid) to obtain a ratio, and applying the ratio to the calibration curve.
(4) Quantification Results
[0393] As shown in
DESCRIPTION OF REFERENCE NUMERALS
[0394] 1 Evaluation device [0395] 3 Input unit [0396] 4 Display unit [0397] 5a Analysis device [0398] 5b Analysis device [0399] 11 First measurement value obtaining unit [0400] 12 Second measurement value obtaining unit [0401] 13 Measurement value comparison unit [0402] 14 Effect determination unit [0403] 52 Reaction/electrophoresis unit [0404] 53 Detection unit [0405] 100 System [0406] 101 CPU [0407] 102 Memory [0408] 103 Storage unit [0409] 104 Bus [0410] 105 Interface unit [0411] 109 Storage medium