Anti-Gliadin Antibodies
20240101651 ยท 2024-03-28
Inventors
- Jingqing ZHANG (Hayward, CA, US)
- Shireen Taleghani YATES (San Francisco, CA, US)
- Scott Erik SUNDVOR (San Francisco, CA, US)
- Alim SEIT-NEBI (San Diego, CA, US)
Cpc classification
C07K2317/34
CHEMISTRY; METALLURGY
C12N15/00
CHEMISTRY; METALLURGY
G01N33/577
PHYSICS
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
The present invention provides anti-gliadin antibodies and antibody fragments, and polypeptides encoding the antibodies or fragment. Also disclosed are methods and kits for the use of such antibodies, fragments, or polypeptides in detection of gliadin. Further provided are heavy chain and light chain variable sequences and associated sequences of complementarity-determining regions (CDRs).
Claims
1. A composition comprising an isolated antibody or antibody fragment comprising: (1) a heavy chain variable region comprising a CDR1 of SEQ ID NO:3, a CDR2 of SEQ ID NO:4, and a CDR3 of SEQ ID NO:5 and a light chain variable region comprising a CDR1 of SEQ ID NO:8, a CDR2 of SEQ ID NO:9, and a CDR3 of SEQ ID NO:10; or (2) a heavy chain variable region comprising a CDR1 of SEQ ID NO:13, a CDR2 of SEQ ID NO:14, and a CDR3 of SEQ ID NO: 15 and a light chain variable region comprising a CDR1 of SEQ ID NO: 18, a CDR2 of SEQ ID NO:19, and a CDR3 of SEQ ID NO:20; wherein the antibody or antibody fragment binds to gliadin at an epitope defined by the amino acid sequence set forth in any one of SEQ ID NOs:21-32; and wherein the antibody or antibody fragment is linked to a solid support.
2. The composition of claim 1, wherein the heavy chain variable region has an amino acid sequence of SEQ ID NO:2; and wherein the light chain variable region has an amino acid sequence of SEQ ID NO:7.
3. The composition of claim 1, wherein the heavy chain variable region has an amino acid sequence of SEQ ID NO: 12; and wherein the light chain variable region has an amino acid sequence of SEQ ID NO: 17.
4. The composition of claim 1, wherein the solid support is one of a microtiter plate, a microchip, or a bead.
5. The composition of claim 1, wherein the gliadin is wheat gliadin, barley hordein, or rye secalin.
6. The composition of claim 1, wherein the antibody or antibody fragment is linked to a detectable molecule.
7. The composition of claim 1, wherein the isolated antibody or antibody fragment is a first isolated antibody or antibody fragment and further comprising a second isolated antibody or antibody fragment; wherein the first isolated antibody or antibody fragment comprises a heavy chain variable region comprising a CDR1 of SEQ ID NO:3, a CDR2 of SEQ ID NO:4, and a CDR3 of SEQ ID NO:5 and a light chain variable region comprising a CDR1 of SEQ ID NO:8, a CDR2 of SEQ ID NO:9, and a CDR3 of SEQ ID NO:10; wherein the second isolated antibody or antibody fragment comprises a heavy chain variable region comprising a CDR1 of SEQ ID NO:13, a CDR2 of SEQ ID NO:14, and a CDR3 of SEQ ID NO: 15 and a light chain variable region comprising a CDR1 of SEQ ID NO: 18, a CDR2 of SEQ ID NO:19, and a CDR3 of SEQ ID NO:20; wherein the first isolated antibody or antibody fragment and the second isolated antibody or antibody fragment bind to gliadin at an epitope defined by the amino acid sequence set forth in any one of SEQ ID NOs:21-32; and wherein the first isolated antibody or antibody fragment and the second isolated antibody or antibody fragment are linked to the solid support.
8. The composition of claim 7, wherein the first isolated antibody or antibody fragment comprises the heavy chain variable region having an amino acid sequence of SEQ ID NO:2, and the light chain variable region having an amino acid sequence of SEQ ID NO:7.
9. The composition of claim 7, wherein the second isolated antibody or antibody fragment comprises the heavy chain variable region having an amino acid sequence of SEQ ID NO: 12, and the light chain variable region having an amino acid sequence of SEQ ID NO: 17.
10. A kit for detecting gliadin comprising an antibody or antibody fragment of claim 1.
11. The kit of claim 10, further comprising a solution for dissolving a sample.
12. The kit of claim 11, wherein the sample is a food or beverage sample.
13. The kit of claim 10, further comprising a positive control containing gliadin.
14. The kit of claim 10, further comprising a container.
15. The kit of claim 10, wherein the solid support is one of a microtiter plate, a microchip, or a bead.
16. A method of detecting gliadin in a sample, the method comprising contacting the sample with the composition of claim 1.
17. The method of claim 16, wherein the sample is a food or beverage sample.
18. The method of claim 16, further comprising dissolving the sample in a solution.
19. The method of claim 18, wherein the contacting the sample with the composition of claim 1 occurs after dissolving the sample in the solution.
20. The method of claim 16, wherein the gliadin includes wheat gliadin, barley hordein, or rye secalin.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
DETAILED DESCRIPTION
I. Anti-Gliadin Antibodies
[0076] Due to the significant rise in the instances of gluten-intolerance during the recent years, there is a corresponding increased need for developing a rapid and reliable means of detecting the presence of gluten in food or beverage so as to permit individuals having gluten-sensitivity to determine, in a real-world sense, their food or drink choices. The present invention provides novel anti-gliadin antibodies that can be used in a kit and method for rapid detection of gluten with high sensitivity and accuracy.
[0077] In some embodiments, the present invention provides anti-gliadin antibodies that recognize a previously undefined epitope of gliadin. This newly defined epitope is an amino acid sequence comprising SEQ ID NO:21, for example, represented by the amino acid sequence set forth in any one of SEQ ID NOs:22-29. In some examples, the antibody includes CDRs 1, 2, and 3 of the V.sub.H region (i.e., SEQ ID NOs:3, 4, 5, and 2, respectively) and CDRs 1, 2, and 3 of the V.sub.L region (i.e., SEQ ID NOs:8, 9, 10, and 7, respectively) of the 13F6 antibody as those CDRs are shown in
[0078] While the exemplary antibodies, 13F6 and 14G11, have the amino acid sequence of heavy chain variable domains set forth in SEQ ID NO:2 and SEQ ID NO:12, respective, and the amino acid sequence of light chain variable domains set forth in SEQ ID NO:7 and SEQ ID NO:17, respectively, it is well known to those of skill in the art that the same antibody binding characteristics can be conserved by maintaining the same CDRs in the heavy and light chains while the framework regions is modified (e.g., humanized). Furthermore, single chain antibodies having essentially the same antigen-binding characteristics can be made by fusion of the matching V.sub.H and V.sub.L of an antibody (e.g., 13F6 or 14G11) without including some or all of the constant regions of the heavy and light chains. The exemplary DNA sequences encoding the heavy and light chains of the anti-gliadin antibodies are provided in
[0079] The anti-gliadin antibodies of the present invention not only recognize previously undefined gliadin epitope, an amino acid sequence no longer than 8-10 amino acids comprising SEQ ID NO:21 (e.g., the epitope having the amino acid sequence of any one of SEQ ID NO:22-31), they also exhibit surprisingly high level of antigen affinity compared to known gliadin antibodies such as R5, G12, and A1, etc. See, e.g., Osman et al., J. Gastroenteroloy & Hepatology 2001, 13:1189-1193; Moron et al., PLoS ONE 2008, 3(5): e2295, 1-13. Typically the anti-gliadin antibodies of the present invention exhibit a KD in binding with wheat gliadin less than about 200 nM, about 100 nM, or about 50 nM, for example, between about 1-100 nM, about 2-50 nM, about 4-50 nM, or about 5-50 nM.
II. Production of Immunoconjugates
[0080] The anti-gliadin antibodies of the invention can be linked to detectable molecules (DM) through the DM carboxyl terminus, the DM amino terminus, through an interior amino acid residue of the DM such as cysteine, or any combination thereof. Similarly, the DM can be linked directly to heavy, light, Fc (constant region) or framework regions of the antibody. Linkage can occur through the antibody's amino or carboxyl termini, or through an interior amino acid residue. Further, multiple DM molecules (e.g., any one of from 2-10) can be linked to the anti-gliadin antibody and/or multiple antibodies (e.g., any one of from 2-5) can be linked to an DM. The antibodies used in a multivalent immunoconjugate composition of the present invention can be directed to the same or different gliadin epitopes. In addition to a covalent linkage, a non-covalent linkage (e.g., via physical adsorption) can be used in making the immunoconjugate as well.
[0081] Immunoconjugates include, but are not limited to, molecules in which there is a detectable agent linked to an antibody via a covalent linkage or non-covalent linkage (e.g., by way of physical adsorption). A detectable agent is an agent having the capability of generating a detectable signal, e.g., radioactive, colormetric, fluorescent, time-resolved fluorescence, luminescence, electrical, electrochemical, or electromagnetic signal.
A. Recombinant Methods
[0082] The nucleic acid sequence encoding a immunoconjugate comprising the anti-gliadin antibody of the present invention and a detectable moiety can be prepared by any suitable method including, for example, cloning of appropriate sequences or by direct chemical synthesis by methods such as the phosphotriester method of Narang, et al., Meth. Enzymol. 68:90-99 (1979); the phosphodiester method of Brown, et al., Meth. Enzymol. 68:109-151 (1979); the diethylphosphoramidite method of Beaucage, et al., Tetra. Lett. 22:1859-1862 (1981); the solid phase phosphoramidite triester method described by Beaucage & Caruthers, Tetra. Letts. 22(20):1859-1862 (1981), e.g., using an automated synthesizer as described in, for example, Needham-VanDevanter, et al. Nucl. Acids Res. 12:6159-6168 (1984); and, the solid support method of U.S. Pat. No. 4,458,066. Chemical synthesis produces a single stranded oligonucleotide. This may be converted into double stranded DNA by hybridization with a complementary sequence, or by polymerization with a DNA polymerase using the single strand as a template. One of skill would recognize that while chemical synthesis of DNA is limited to sequences of about 100 bases, longer sequences may be obtained by the ligation of shorter sequences.
[0083] In a preferred embodiment, the nucleic acid sequences of this invention are prepared by cloning techniques. Examples of appropriate cloning and sequencing techniques, and instructions sufficient to direct persons of skill through many cloning exercises are found in Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL (3RD ED.), Vols. 1-3, Cold Spring Harbor Laboratory (2001)), Berger and Kimmel (eds.), GUIDE TO MOLECULAR CLONING TECHNIQUES, Academic Press, Inc., San Diego CA (1987)), or Ausubel, et al. (eds.), CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, Greene Publishing and Wiley-Interscience, NY (1987-2009). Product information from manufacturers of biological reagents and experimental equipment also provide useful information. Such manufacturers include the SIGMA chemical company (Saint Louis, MO), R&D systems (Minneapolis, MN), Pharmacia LKB Biotechnology (Piscataway, NJ), CLONTECH Laboratories, Inc. (Palo Alto, CA), Chem Genes Corp., Aldrich Chemical Company (Milwaukee, WI), Glen Research, Inc., GIBCO BRL Life Technologies, Inc. (Gaithersberg, MD), Fluka Chemica-Biochemika Analytika (Fluka Chemie AG, Buchs, Switzerland), Invitrogen, San Diego, CA, and Applied Biosystems (Foster City, CA), as well as many other commercial sources known to one of skill.
[0084] Nucleic acids encoding an anti-gliadin antibody or binding fragment thereof or the detectable molecule (DM) can be modified to form the immunoconjugates of the present invention. Modification by site-directed mutagenesis is well known in the art. Nucleic acids encoding DM or anti-gliadin antibodies can be amplified by in vitro methods. Amplification methods include the polymerase chain reaction (PCR), the ligase chain reaction (LCR), the transcription-based amplification system (TAS), the self-sustained sequence replication system (3SR). A wide variety of cloning methods, host cells, and in vitro amplification methodologies are well known to persons of skill.
[0085] In one embodiment, immunoconjugates are prepared by inserting the cDNA which encodes an anti-gliadin scFv antibody into a vector which comprises the cDNA encoding the DM. The insertion is made so that the scFv and the DM are read in frame, that is in one continuous polypeptide containing a functional Fv region and a functional DM region.
[0086] Once the nucleic acids encoding a DM, anti-gliadin antibody, or an immunoconjugate of the present invention are isolated and cloned, one may express the desired protein in a recombinantly engineered cell such as bacteria, plant, yeast, insect and mammalian cells. It is expected that those of skill in the art are knowledgeable in the numerous expression systems available for expression of proteins including E. coli, other bacterial hosts, yeast, and various higher eucaryotic cells such as the COS, CHO, HeLa and myeloma cell lines. No attempt to describe in detail the various methods known for the expression of proteins in prokaryotes or eukaryotes will be made. In brief, the expression of natural or synthetic nucleic acids encoding the isolated proteins of the invention will typically be achieved by operably linking the DNA or cDNA to a promoter (which is either constitutive or inducible), followed by incorporation into an expression cassette. The cassettes can be suitable for replication and integration in either prokaryotes or eukaryotes. Typical expression cassettes contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the DNA encoding the protein. To obtain high level expression of a cloned gene, it is desirable to construct expression cassettes which contain, at the minimum, a strong promoter to direct transcription, a ribosome binding site for translational initiation, and a transcription/translation terminator. For E. coli this includes a promoter such as the T7, trp, lac, or lambda promoters, a ribosome binding site and preferably a transcription termination signal. For eukaryotic cells, the control sequences can include a promoter and preferably an enhancer derived from immunoglobulin genes, SV40, cytomegalovirus, and a polyadenylation sequence, and may include splice donor and acceptor sequences. The cassettes of the invention can be transferred into the chosen host cell by well-known methods such as calcium chloride transformation or electroporation for E. coli and calcium phosphate treatment, electroporation or lipofection for mammalian cells. Cells transformed by the cassettes can be selected by resistance to antibiotics conferred by genes contained in the cassettes, such as the amp, gpt, neo and hyg genes.
[0087] One of skill would recognize that modifications can be made to a nucleic acid encoding a polypeptide of the present invention (i.e., anti-gliadin antibody an immunoconjugate formed from the combination of the antibody and a DM) without diminishing its biological activity. Some modifications may be made to facilitate the cloning, expression, or incorporation of the targeting molecule into a fusion protein. Such modifications are well known to those of skill in the art and include, for example, termination codons, a methionine added at the amino terminus to provide an initiation, site, additional amino acids placed on either terminus to create conveniently located restriction sites, or additional amino acids (such as poly His) to aid in purification steps.
[0088] In addition to recombinant methods, the immunoconjugates, DM, and antibodies of the present invention can also be constructed in whole or in part using standard peptide synthesis. Solid phase synthesis of the polypeptides of the present invention of less than about 50 amino acids in length may be accomplished by attaching the C-terminal amino acid of the sequence to an insoluble support followed by sequential addition of the remaining amino acids in the sequence. Techniques for solid phase synthesis are described by Barany & Merrifield, THE PEPTIDES: ANALYSIS, SYNTHESIS, BIOLOGY. VOL. 2: SPECIAL METHODS IN PEPTIDE SYNTHESIS, PART A. pp. 3-284; Merrifield, et al. J. Am. Chem. Soc. 85:2149-2156 (1963), and Stewart, et al., SOLID PHASE PEPTIDE SYNTHESIS, 2ND ED. , Pierce Chem. Co., Rockford, Ill. (1984). Proteins of greater length may be synthesized by condensation of the amino and carboxyl termini of shorter fragments. Methods of forming peptide bonds by activation of a carboxyl terminal end (e.g., by the use of the coupling reagent N, N-dicycylohexylcarbodiimide) are known to those of skill.
B. Purification
[0089] Once expressed, the recombinant immunoconjugates, antibodies, and/or detectable molecules of the present invention can be purified according to standard procedures of the art, including ammonium sulfate precipitation, affinity columns, column chromatography, and the like (see, generally, R. Scopes, PROTEIN PURIFICATION, Springer-Verlag, N.Y. (1982)). Substantially pure compositions of at least about 90 to 95% homogeneity are preferred, and 98 to 99% or more homogeneity are most preferred for diagnostic uses.
[0090] Methods for expression of single chain antibodies and/or refolding to an appropriate active form, including single chain antibodies, from bacteria such as E. coli have been described and are well-known and are applicable to the antibodies of this invention. See, Buchner, et al., Anal. Biochem. 205:263-270 (1992); Pluckthun, Biotechnology 9:545 (1991); Huse, et al., Science 246:1275 (1989) and Ward, et al., Nature 341:544 (1989), all incorporated by reference herein.
[0091] Often, functional heterologous proteins from E. coli or other bacteria are isolated from inclusion bodies and require solubilization using strong denaturants, and subsequent refolding. During the solubilization step, as is well-known in the art, a reducing agent must be present to separate disulfide bonds. An exemplary buffer with a reducing agent is: 0.1 M Tris pH 8, 6 M guanidine, 2 mM EDTA, 0.3 M DTE (dithioerythritol). Reoxidation of the disulfide bonds can occur in the presence of low molecular weight thiol reagents in reduced and oxidized form, as described in Saxena, et al., Biochemistry 9: 5015-5021 (1970), incorporated by reference herein, and especially as described by Buchner, et al., supra.
[0092] Renaturation is typically accomplished by dilution (e.g., 100-fold) of the denatured and reduced protein into refolding buffer. An exemplary buffer is 0.1 M Tris, pH 8.0, 0.5 M L-arginine, 8 mM oxidized glutathione (GSSG), and 2 mM EDTA.
[0093] As a modification to the two chain antibody purification protocol, the heavy and light chain regions are separately solubilized and reduced and then combined in the refolding solution. A preferred yield is obtained when these two proteins are mixed in a molar ratio such that a 5 fold molar excess of one protein over the other is not exceeded. It is desirable to add excess oxidized glutathione or other oxidizing low molecular weight compounds to the refolding solution after the redox-shuffling is completed.
C. Detectable Labels
[0094] In some embodiments, the antibodies of the invention or a binding fragment thereof or a polypeptide comprising the antibody or fragment can be coupled to detectable labels. The linkage can be covalent or non-covalent. Detectable labels suitable for such use include any composition detectable by spectroscopic, photochemical, biochemical, immunochemical, electrical, optical or chemical means. Useful labels in the present invention include magnetic beads (e.g. DYNABEADS), fluorescent dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, green fluorescent protein, and the like), radiolabels (e.g., .sup.3H, .sup.125I, .sup.35S, .sup.14C, or .sup.32P), enzymes (e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and colorimetric labels such as colloidal gold or colored glass or plastic (e.g. polystyrene, polypropylene, latex) beads.
[0095] Means of detecting such labels are well known to those of skill in the art. Thus, for example, radiolabels may be detected using photographic film or scintillation counters, fluorescent markers may be detected using a photodetector to detect emitted illumination. Enzymatic labels are typically detected by providing the enzyme with a substrate and detecting the reaction product produced by the action of the enzyme on the substrate, and colorimetric labels are detected by simply visualizing the colored label.
D. Conjugation to the Antibody
[0096] In a non-recombinant embodiment of the invention, detectable molecules are linked to the anti-gliadin antibodies of the present invention using any number of means known to those of skill in the art. Both covalent and noncovalent attachment means may be used with anti-gliadin antibodies of the present invention.
[0097] The procedure for attaching an effector molecule to an antibody will vary according to the chemical structure of the DM. Polypeptides typically contain a variety of functional groups; e.g., carboxylic acid (COOH), free amine (NH.sub.2) or sulfhydryl (SH) groups, which are available for reaction with a suitable functional group on an antibody to result in the binding of the effector molecule.
[0098] Alternatively, the antibody is derivatized to expose or to attach additional reactive functional groups. The derivatization may involve attachment of any of a number of linker molecules, such as those available from Pierce Chemical Company (Rockford IL).
[0099] A linker, as used herein, is a molecule that is used to join the antibody to the effector molecule. The linker is capable of forming covalent bonds to both the antibody and to the effector molecule. Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, or peptide linkers. Where the antibody and the detectable molecule are polypeptides, the linkers may be joined to the constituent amino acids through their side groups (e.g., through a disulfide linkage to cysteine). In some embodiments, the linkers may be joined to the alpha carbon amino and carboxyl groups of the terminal amino acids.
[0100] In view of the large number of methods that have been reported for attaching a variety of fluorescent/chemiluminescent compounds, enzymes, dyes, and other agents (e.g., latex particles, nanoparticles, nanocrystals, colloidal gold, etc.) to antibodies one skilled in the art will be able to determine a suitable method for attaching a given agent to an antibody or other polypeptide.
III. Kits and Uses
[0101] In another embodiment, this invention provides for kits for the detection of gliadin or an immunoreactive fragment thereof, (i.e., collectively, a gliadin protein) in a food or beverage sample. A food or beverage sample as used herein is a sample of any substance intended for human consumption in the form of solid, semi-solid, or liquid that potentially could contain gliadin.
[0102] Kits will typically comprise an anti-gliadin antibody or antibody fragment of the present invention, the embodiments being as described herein. In some embodiments, the anti-gliadin antibody or antibody fragment will be an anti-gliadin Fv fragment, such as a scFv fragment, or a recombinant polypeptide comprising an anti-gliadin antibody or a gliadin-binding fragment thereof plus a heterologous amino acid sequence.
[0103] In addition the kits will typically include instructional materials disclosing means of use of an antibody of the present invention (e.g. for detection of gliadin in a sample). The kits may also include additional components to facilitate the particular application for which the kit is designed. Thus, for example, the kit may additionally contain means of detecting the label (e.g. enzyme substrates for enzymatic labels, filter sets to detect fluorescent labels, appropriate secondary labels such as a sheep anti-mouse-HRP, or the like). The kits may additionally include buffers and other reagents routinely used for the practice of a particular method. In some cases, a positive control (a gliadin-containing sample) may be included in the kit to ensure that that detection assay is operating correctly. Such kits and appropriate contents are well known to those of skill in the art.
[0104] In one embodiment of the present invention, the gliadin-detection kit comprises an immunoassay. As described above, although the details of the immunoassays of the present invention may vary with the particular format employed, the method of detecting gliadin in a food or beverage sample generally comprises the steps of contacting the sample with an antibody that specifically reacts, under immunologically reactive conditions, to gliadin. The antibody is allowed to bind to gliadin under immunologically reactive conditions, and the presence of the bound antibody is detected directly or indirectly. The anti-gliadin antibody may be used, for example, as the capture antibody of an ELISA, or as a second antibody to bind to gliadin captured by the capture antibody. In some embodiments, the kits comprise an antibody or antibody fragment pre-bound to a solid support, e.g., a microchip, a microtiter plate or a bead. As is known in the art, the presence of the second antibody is typically then detected.
[0105] The antibodies provided herein are useful as diagnostic agents and in in vitro assays to detect the presence of gliadin in test samples. For example, the antibodies 13F6 and 14G11 and variants of these antibodies as described herein can be used as the targeting moieties of immunoconjugates in immunohistochemical assays to determine whether a sample contains gliadin. If the sample is one taken from a food item that is in solid form, processing steps of grinding and mixing/solubilizing may be necessary before the immunoassay can be conducted. As such, the kit optionally contains a solution suitable for dissolving the ground food sample before an immunoassay can be performed, see, e.g., U.S. patent application Ser. No. 15/065,198, U.S. Patent Application Publication No. US20140295406A1.
EXAMPLES
[0106] The following examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of non-critical parameters that could be changed or modified to yield essentially the same or similar results.
Example 1: Production and Functional Analysis of 13F6 and 14G11
[0107] Two clones of anti-gliadin antibodies, 13F6 and 14G11, have been identified as exhibiting high and comparable responses to barley, wheat, rye and a 33-mer amino acid sequence derived from the wheat gliadin protein (SEQ ID NO: 33) (see, e.g., Shan et al., Science 297:2275-2279, 2002; Moron et al., PLoS ONE, 3(5):e2994:1-13, 2008; Moron et al., Am. J. Clin. Nutr. 87:405-414, 2008). 13F6 is an IgG2b antibody, whereas 14G11 is an IgG1 antibody.
[0108] Monoclonal antibodies 14G11 and 13F6 were raised by immunizing five (5) 8-9 week old female BALB/c mice with a 33-mer gluten specific peptide (amino acid sequence LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF (SEQ ID NO: 33), Shan et al., Science 297:2275-2279, 2002) conjugated to KHL (Keyhole limpet hemocyanin), as well as gluten prolamins using standard immunization procedure. Serum samples obtained from blood draws were used to monitor titers of target specific antibodies in animals by indirect ELISA using wheat, barley, rye prolamins and unconjugated gluten specific peptide. Two animals with the highest serum titers were given the final immunization with 10 ?g of gluten specific peptide in PBS intravenously three days before spleen harvest. Spleens of these mice were removed, spleen cells were extracted and fused with P3X63Ag8.653 mouse myeloma cells (ATCC, CRL-1580). Hybridoma cells were generated following standard protocols. Then hybridoma supernatants were collected and screened by indirect ELISA for the reactivity against gluten specific immunogenic peptide, barley, wheat, rye, oat, rice, corn and soy proteins. Purified antibodies were produced in protein A chromatography.
[0109] Specifically, both 13F6 and 14G11 show comparable responses to wheat, barley and rye proteins, but do not respond to other non-gluten grains, especially oat (
Example 2: Affinity Studies
1. Objective
[0110] The aim of the current study is to measure the binding affinities between glutenin and three monoclonal antibodies using Biacore T200.
2. Materials
[0111] Test articles are listed below in Table 1 below:
TABLE-US-00003 TABLE 1 Samples MW (kDa) Concentration (mg/ml) Gluten Obtained from PWG group. 10 It is a gluten mixture.** Based on MS, 31.7 kDa was used to calculate molar concentration 14G11 ~140 kDA estimated from SDS-PAGE 4.9 13F6 5.2 R5 8 **PWG-gliadin is a reference material that has been produced under the guidance of the Prolamin Working Group (PWG). Its isolation and characterization is described in detail in van Eckert et al. (2006). Briefly, PWG-gliadin has been extracted from a mixture of 28 European wheat cultivars. Albumins and globulins were eliminated by extraction using 0.4M NaCl solution and gliadins were extracted with 60% ethanol. The gliadin extracts were concentrated, desalted by ultrafiltration, freeze-dried, and homogenized. The residual material after lyophilization is referred to as PWG-gliadin. [0112] Biacore T200 (GE Healthcare) [0113] Series S Sensor Chip CM5 (GE Healthcare Cat.No. BR-1005-30 Lot No.:10229292) [0114] Capture antibody: Anti-mouse Fc gamma specific antibody, Cat. No. 115-005-071 (Jackson ImmunoResearch), 20 ?g/ml in 10 mM Na-acetate pH 5.0 [0115] NHS: 100 mM N-hydroxysuccinimide in H.sub.2O [0116] EDC: 400 mM 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide in H.sub.2O [0117] Ethanolamine 1 M ethanolamine hydrochloride, adjusted to pH 8.5 with NaOH [0118] Running buffer HBS-EP: 10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, 0.005% Tween-20 [0119] 50 mM HCl [0120] 10 mM Glycine-HCl, pH 2.0 [0121] 50 mM HCl, 3 M MgCl.sub.2
3. Experimental Procedures
3.1 Glutenin Immobilized Through Amine Coupling
[0122] In this experiment, glutenin protein was coated through amine coupling method, the antibodies were flowed over the sensor chip as analytes. The experiment was carried out using the following protocol. [0123] 3.1.1 Covalent Coupling of Glutenin
[0124] Coat glutenin onto the Series S Sensor Chip CMS via primary amine groups using the following conditions: [0125] (1) Equilibrate: HBS-EP, flow rate 10 ?l/min, 5 min; [0126] (2) Activate surface: inject NHS+EDC 1:1 mixture, flow rate 10 ?l/min, 7 min; [0127] (3) Couple ligand: inject glutenin (15 ?g/ml, 10 mM sodium acetate, pH 4.5), flow rate 10 ?l/min, until ?300 RU of glutenin is coated; [0128] (4) Deactivate excess reactive groups: inject ethanolamine, flow rate 10 ?l/min, 7 min. [0129] 3.1.2 Affinity Measurement
[0130] Test the pair-wise binding of test articles to the glutenin using the following assay setup: [0131] (1) Stabilize surface: Perform three start-up cycles with a dummy sample (HBS-EP buffer); [0132] (2) Equilibrate: flow running buffer over all flow cells for 1.5 hours; [0133] (3) Associate: inject the antigen at the lowest concentrations (see Parameter Summary Table below) over all flow cells, flow rate 30 ?l/min, 14G11 and 13F6, 5 min and R5, 2.5 min; [0134] (4) Dissociate: flow running buffer over all flow cells, flow rate 30 ?l/min, 14G11 and 13F6, 15 min and R5, 2.5 min; [0135] (5) Regenerate surface: flow regeneration buffer (14G11 and 13F6, 10 mM Glycine-HCl and R5, 50 mM HCl, 3 M MgCl.sub.2) 3 times, flow rate 100 ?l/min, 15 sec; [0136] (6) Increase the analyte concentration by 2 or 3 fold, repeat steps (1) through (5). All together there were five analyte concentrations and one repeat of a medium concentration (see Parameter Summary Table 2 below). The curve of the repeat cycle should coincide with that of the previous cycle to confirm that the regeneration condition was appropriate.
TABLE-US-00004 TABLE 2 Immobilization Analyte 14G11 13F6 R5 Ligand Glutenin Immobilization 283.8 level (RU) Association and Dissociation Flow rate (?l/min) 30 Association time (s) 300 300 150 Dissociation time (s) 600 600 150 Sample Concentration Concentration (nM) 3, 9, 27(?2), 3, 9(?2), 27, 20, 40, 80(?2), 81, 243 81, 243 160, 320 Regeneration Flow rate (?l/min) 100 Regeneration 15(?3) contact time (s) Regeneration 10 mM 10 mM 50 mM HCl, buffer Glycine-HCl Glycine-HCl 3M MgCl.sub.2
4. Results and Discussion
[0137] The experimental data were processed and fitted locally to 1:1 interaction model in Biacore T200 evaluation software. The model describes interaction A+B=AB, is the simplest model for kinetic evaluation, therefore is recommended as default unless there is good reason to choose a different model.
[0138] The experimental result is summarized in
[0139] The curves of medium concentrations coincided, suggesting that the regeneration conditions were good. The gluten surface was not damaged after several cycles of regeneration. The Chi.sup.2 were about or below 10% of the Rmax, which means that the fitting of experimental data to 1:1 interaction model was not perfect but reliable. The U-values of all three antibodies were low, ?5. All in all, the curve fitting is good enough and the result is reliable. The result should better reflect the real binding affinity between gluten and antibodies.
5. Summary
[0140] In this study, the binding affinities between glutenin and three monoclonal antibodies were determined. The experiment was carried out where glutenin was amine coupled to the sensor chip and antibodies were used as analytes. The result of is with good curve fitting and low U-values, and thus is reliable.
Example 3: Binding Validation and Epitope Mapping
Materials
[0141] Antigen: Modified Gliadin(PWG) [0142] 6SEN 33-Mer peptide Unconjugated,33-mer peptide (5 mg/ml) [0143] 6SEN 33-Mer peptide BSA-conjugated, BSA-33 mer peptide (5 mg/ml) [0144] Antibody: R5 monoclonal Ab (8 mg/ml) [0145] 14G11 monoclonal Ab (4.94 mg/ml) [0146] 13F6 monoclonal Ab (5.2 mg/ml) [0147] Other Reagents and Solutions: [0148] PBS buffer: NaCl 137 mM; KCl 2.7 mM; Na.sub.2HPO.sub.4 4.3 mM; KH.sub.2PO.sub.4 1.4 mM, pH 7.4 [0149] PBS-T buffer: PBS buffer with 0.05% Tween 20 [0150] Coating buffer: 0.05 M NaHCO3, pH 9.6 [0151] Blocking Buffer: PBS buffer with 5% skimmed milk [0152] TMB [0153] 1 M HCl [0154] Goat anti-mouse IgG antibody(H+L)[HRP], GenScript [0155] IRDye800CW goat anti-mouse IgG (H+L), LI-COR
TABLE-US-00005 TABLE 3 ELISA condition Ag Coating BSA (negative ctrl)/BSA-Peptide/33-mer Peptide/Modified Gliadin (PWG) (targets) 10 ?g/ml incubated at 4? C. overnight Blocking 5% MPBS, incubated at RT for 1.5 h Primary Ab diluted Ab 10x starting from 10 ?g/ml in 0.05% PBST, incubated at 4? C. for 1.5 h Secondary Ab Goat anti-mouse IgG [HRP] 0.1 ?g/ml, incubated at 4? C. for 45 min Western blot condition Blocking 5% MPBS, incubated at RT for 1 h Primary Ab diluted mAb 0.5 ?g/ml in 0.05% PBST, incubated at RT for 1.5 h Secondary Ab IRDye 800CW goat anti mouse IgG [HRP] 0.1 ?g/ml, incubated at RT for 45 min
[0156] All three mAbs bound the target specifically.
[0157] The binding affinity of R5 is lower than the other two mAbs, which is consistent with the result of affinity measurement by Biacore.
TABLE-US-00006 Antigen1isaproteinof296aminoacids. (SEQIDNO:42) MKTFLILALLAIVATTATTAVRVPVPQPQPQNPSQPQPQR QVPLVQQQQFPGQQQQFPPQQPYPQPQPFPSQQPYLQLQP FPQPQPFPPQLPYPQPPPFSPQQPYPQPQPQYPQPQQPIS QQQAQQQQQQQQQQQQQQQQQQILPQILQQQLIPCRDVVL QQHNIAHARSQVLQQSTYQPLQQLCCQQLWQIPEQSRCQA IHNVVHAIILHQQQQQQQPSSQVSLQQPQQQYPSGQGFFQ PSQQNPQAQGSVQPQQLPQFEEIRNLALQTLPRMCNVYIP PYCSTTTAPFGIFGTN
TABLE-US-00007 (SEQIDNO:43) MVRVPVPQLQPQNPSQQQPQEQVPLVQQQQFPGQQQPFPP QQPYPQPQPFPSQQPYLQLQPFPQPQLPYPQPQLPYPQPQ LPYPQPQPFRPQQPYPQSQPQYSQPQQPISQQQQQQQQQQ QQKQQQQQQQQILQQILQQQLIPCRDVVLQQHSIAYGSSQ VLQQSTYQLVQQLCCQQLWQIPEQSRCQAIHNVVHAIILH QQQQQQQQQQQQPLSQVSFQQPQQQYPSGQGSFQPSQQNP QAQGSVQPQQLPQFEEIRNLALETLPAMCNVYIPPYCTIA PVGIFGTNYR
TABLE-US-00008 (SEQIDNO:33) LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF
[0158] Peptide library design: peptide length/overlapping/offset=10aa/7aa/3aa; Cys was replaced by Ser in the peptide library; N-terminal biotinylated; crude product.
TABLE-US-00009 TABLE 4 Epitope mapping screening-condition Epitope ELISA condition Coating Streptavidin (Anchor protein); 33-Mer Peptide (positive 10 ?g/ml incubated at Ctrl); Modified Gliadin(PWG) 4? C. overnight (positive Ctrl) 10 ?g/ml incubated at 4? C. overnight Blocking 5% MPBS, incubated at RT for 1.5 h Capture crude peptide 50 ?g/ml each, / incubated at RT for 1.5 h Primary R5 2 ?g/ml; 14G11, 13F6, IgG2b Ab control mAb, IgGl control mAb 0.5 ?g/ml incubated at RT for 1.5 h, incubated at RT for 1.5 h Secondary Goat anti-mouse IgG [HRP] Ab 0.1 ?g/ml, incubated at RT for 45 min
[0159] All peptides designed from antigen 1/2/3 are available except 42,
TABLE-US-00010 (SEQIDNO:44) AQQQQQQQQQ.
[0160] The binding between peptide libraries and mAbs were assayed by ELISA. And isotype and blank PBS control binding was included.
[0161] ELISA against peptide libraries was done twice. The result is the same. The binding between mAbs and peptide binders identified from the libraries was done once again to confirm the result.
[0162] 13F6 and 14G11 seemed to recognize the same epitope. The ELISA OD450 values of 13F6 were slightly higher than those of 14G11, suggesting the binding affinity of 13F6 was slightly higher, which is consistent with the result of affinity measurement.
[0163] None of the peptides seemed to bind R5. Even at R5 concentration as high as 10 ?g/ml, none of antigen 3 peptides or QQPFP (SEQ ID NO:45)-containing peptides bound R5 (data not shown). The peptides used for this study were crude peptides with low purity, coupled with the fact that the binding affinity of R5 was extremely low, with KD of ?0.2 ?M. This might result in this outcome.
[0164] Peptide 42 (AQQQQQQQQQ (SEQ ID NO:44)) is the only one peptide that is not available. Seeing that peptide 43 (QQQQQQQQQQ (SEQ ID NO:45)) did not bind any of the three mAbs and the sequence of peptide 42 is not similar to those of identified peptide binders, it is highly possible that the peptide would not bind the mAbs.
[0165] Based on the screening result, 13 peptides could be recognized by the 13F6 and 14G11 antibodies.
[0166] These 13 peptides all have a common amino acid sequence of Q(Q/L) PYPQ. (SEQ ID NO:21) The stretch of Q(Q/L) PYPQ (SEQ ID NO:21) sequence is believed to be the core of epitopes of 13F6 and 14G11 antibodies. This is in contrast to epitope sequences of previously known anti-gliadin antibodies (A1: QLPYPQP (SEQ ID NO:26); R5: QQPFP (SEQ ID NO:45); G12: QPQLPY (SEQ ID NO:47); QPQQPY (SEQ ID NO:48); QPQLPF (SEQ ID NO:49)).
[0167] The OD450 values of group B were lower than those of group A, suggesting the C-terminal residue(s), e.g., P or PQ, contributed to antigen binding. See Table 5 below.
TABLE-US-00011 TABLE5 Common Group OD450nm sequence Peptides A ~2.0(13F6) Q(Q/L)PYPQ PQQPYPQP PQPQLPYP QLPYPQPQ PQLPYPQP PPQQPYPQ ~1.0(14G11) (P/S) QP QP LP QP PQ (SEQID (SEQID (SEQID (SEQID (SEQID (SEQID NO:24) NO:50) NO:51) NO:52) NO:53) NO:54) SPQQPYPQ QPQLPYPQ PQLPYPQP PQQPYPQS PPQLPYPQ PQ PQ QL QP PP (SEQID (SEQID (SEQID (SEQID (SEQID NO:55) NO:56) NO:57) NO:58) NO:59) B <(13F6) PQ(Q/L)PYPQ PFPPQQPY YPQPQLPY PFRPQQPY <0.5(14G11) (SEQID PQ PQ PQ NO:29) (SEQID (SEQID (SEQID NO:60) NO:61) NO:62)
[0168] All patents, patent applications, and other publications, including GenBank Accession Numbers, cited in this application are incorporated by reference in the entirety for all purposes.
TABLE-US-00012 INFORMALSEQUENCELISTING SEQIDNO:1 13F6AntibodyHeavyChainVariableRegionDNASequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 CAGATCCAGTTGGTGCAGTCTGGACCTGAGCTGAAGAAGCCTGGAGAGACAGTCAGCATCTCCT GCAAGGCTTCTGGTTATACCTTCACAGACTATTCAATGCACTGGGTGAGGCAGGCTCCAGGAAA GGGTTTAAAGTGGATGGGCTGGATAAACACTGAGACTGGTGAGCCAACATATGCAGATGACTTC AAGGGACGATTTGCCTTCTCTTTGGAAACCTCTGCCAGCACTGCCTATCTGCAGATCAACAACC TCAAAAATGAGGACACGGCTACACATTTCTGTGCTCCAAGTGTTGCCTGGTTTGCTTACTGGGG CCAAGGGACTCTGGTCACTGTCTCTACA SEQIDNO:2 13F6AntibodyHeavyChainVariableRegionAminoAcidSequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 QIQLVQSGPELKKPGETVKISCKASGYTFTDYSMHWVRQAPGKGLKWMGWINTETGEPTYADDF KGRFAFSLETSASTAYLQINNLKNEDTATHFCAPSVAWFAYWGQGTLVTVST SEQIDNO:3 13F6AntibodyHeavyChainCDR1AminoAcidSequence DYSMH SEQIDNO:4 13F6AntibodyHeavyChainCDR2AminoAcidSequence WINTETGEPTYADDFKG SEQIDNO:5 13F6AntibodyHeavyChainCDR3AminoAcidSequence SVAWFAY SEQIDNO:6 13F6AntibodyLightChainVariableRegionDNASequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 GATGTTTTGATGACCCAAACTCCACTCTCCCTGTCTGTCAGTCTTGGAGATCAGGCCTCCATCT CTTGTAGATCTAGTCAGAGCATTGTACAGAGTAATGGAAACACCCATTTAGAATGGTTCTTACA GAAACCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTTTCTGGGGTCCCA GACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCTG AGGATCTGGGAGTTTATTACTGTTTTCAAGGTTCACATGTTCCATTCACGTTCGGCTCGGGGAC AAAGTTGGAAATAAAA SEQIDNO:7 13F6AntibodyLightChainVariableRegionAminoAcidSequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 DVLMTQTPLSLSVSLGDQASISCRSSQSIVQSNGNTHLEWFLQKPGQSPKLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIK SEQIDNO:8 13F6AntibodyLightChainCDR1AminoAcidSequence RSSQSIVQSNGNTHLE SEQIDNO:9 13F6AntibodyLightChainCDR2AminoAcidSequence KVSNRFS SEQIDNO:10 13F6AntibodyLightChainCDR3AminoAcidSequence FQGSHVPFT SEQIDNO:11 14G11AntibodyHeavyChainVariableRegionDNASequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 CAGATCCAGTTGGTGCAGTCTGGACCTGAGATGAAGAAGCCTGGAGAGACAGTCAAGATTTTTT GCAAGGCTTCTGGTTATACCCTCACAGACTATTCATGCACTGGGTGAAGCAGGCTCCAGGAAA GGGTTTAAAGTGGATGGGCTGGATAAACACTGAGACTGGTGAGCCAACATATGCAGATGACTTC AAGGGACGGTGTGCCTTTTCTTTGGAAACCTCTGTCAGCACTGCCTTTTTGCAGATCAACAACC TCAAAAATGAGGACATGGGAACATATTTCTGTGCCTCCTCTGGGGCCTGGTTTAGTTACTGGGG CCAAGGGACTCTGGTCACTGTCTCTGCA SEQIDNO:12 14G11AntibodyHeavyChainVariableRegionAminoAcidSequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 QIQLVQSGPEMKKPGETVKIFCKASGYTLTDYSMHWVKQAPGKGLKWMGWINTETGEPTYADDF KGRCAFSLETSVSTAFLQINNLKNEDMGTYFCASSGAWFSYWGQGTLVTVSA SEQIDNO:13 14G11AntibodyHeavyChainCDR1AminoAcidSequence DYSMH SEQIDNO:14 14G11AntibodyHeavyChainCDR2AminoAcidSequence WINTETGEPTYADDFKG SEQIDNO:15 14G11AntibodyHeavyChainCDR3AminoAcidSequence SGAWFSY SEQIDNO:16 14G11AntibodyLightChainVariableRegionDNASequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 GATGTTTTGCTGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCCATCT CTTGCAGATCTAGTCAGACCATTGTACAAATTATGGAAACACCCATTTAGAATGGTTCCTGCA GAAACCAGGCCAGTCTCCAAAGCTCCTGATCTATAAAGTTTCCAACCGATTTTCTGGGGTCCCA GACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCTG AGGATCTGGGAATTTATTACTGCTTTCAAGGTTCACATGTTCCATTCACGTTCGGCTCGGGGAC AAAGTTGGAAATAAAA SEQIDNO:17 14G11AntibodyLightChainVariableRegionAminoAcidSequence FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4 DVLLTQTPLSLPVSLGDQASISCRSSQTIVQINGNTHLEWFLQKPGQSPKLLIYKVSNRFSGVP DRFSGSGSGTDFTLKISRVEAEDLGIYYCFQGSHVPFTFGSGTKLEIK SEQIDNO:18 14G11AntibodyLightChainCDR1AminoAcidSequence RSSQTIVQINGNTHLE SEQIDNO:19 14G11AntibodyLightChainCDR2AminoAcidSequence KVSNRFS SEQIDNO:20 14G11AntibodyLightChainCDR3AminoAcidSequence FQGSHVPFT SEQIDNO:21 AminoAcidSequenceforEpitope1 Q(Q/L)PYPQ SEQIDNO:22 AminoAcidSequenceforEpitope2 QQPYPQ SEQIDNO:23 AminoAcidSequenceforEpitope3 QLPYPQ SEQIDNO:24 AminoAcidSequenceforEpitope4 Q(Q/L)PYPQ(P/S) SEQIDNO:25 AminoAcidSequenceforEpitope5 QQPYPQP SEQIDNO:26 AminoAcidSequenceforEpitope6 QLPYPQP SEQIDNO:27 AminoAcidSequenceforEpitope7 QQPYPQS SEQIDNO:28 AminoAcidSequenceforEpitope8 QLPYPQS SEQIDNO:29 AminoAcidSequenceforEpitope9 PQ(Q/L)PYPQ SEQIDNO:30 AminoAcidSequenceforEpitope10 PQQPYPQ SEQIDNO:31 AminoAcidSequenceforEpitope11 PQLPYPQ SEQIDNO:33 33-merAminoAcidSequenceDerivedfrom?-2gliadin LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF