ANTI-PTCRA ANTIBODY-DRUG CONJUGATES AND USES THEREOF
20240101672 ยท 2024-03-28
Inventors
- Frank Kuhnert (Cortlandt Manor, NY, US)
- Michael Van Meter (White Plains, NY, US)
- Thomas Nittoli (Orangeburg, NY, US)
Cpc classification
A61K47/6897
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
C07K16/2809
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
Abstract
The present disclosure provides antibody-drug conjugates comprising anti-PTCRA antibodies and methods of using the same. The ADCs of the disclosure are useful for the treatment of T-ALL and other disorders related to elevated expression of PTCRA.
Claims
1. An antibody-drug conjugate (ADC) comprising an antibody or antigen-binding fragment thereof that specifically binds human pre-T cell antigen receptor alpha (PTCRA), wherein the antibody or antigen-binding fragment thereof is conjugated to a therapeutic moiety through an optional linker, wherein the therapeutic moiety is selected from the group consisting of a cytotoxic agent, a chemotherapeutic drug, and a radioisotope.
2. The ADC of claim 1, wherein the cytotoxic agent is a maytansinoid, an auristatin, or a pharmaceutically acceptable salt thereof.
3. The ADC of claim 2, wherein the auristatin is monomethyl auristatin E (MMAE) or a derivative thereof.
4. The ADC of claim 2, wherein the maytansinoid is ##STR00027## or a pharmaceutically acceptable salt thereof.
5. The ADC of claim 4, wherein the maytansinoid is conjugated to the antibody or antigen-binding fragment thereof through a linker.
6. The ADC of claim 1, wherein the antibody or antigen-binding fragment thereof is conjugated to the therapeutic moiety through a non-cleavable linker.
7. The ADC of claim 1, wherein the antibody or antigen-binding fragment thereof is conjugated to the therapeutic moiety through an enzyme-labile linker cleavable once the ADC is administered to a patient in need thereof.
8. The ADC of claim 1, wherein the antibody or antigen-binding fragment thereof is conjugated to: ##STR00028## wherein represents the connecting point to the antibody or antigen-binding fragement thereof.
9. The ADC of claim 1, wherein the antibody or antigen-binding fragment thereof is conjugated to the therapeutic moiety through a linker, wherein the linker is bonded to a lysine residue of the antibody or antigen-binding fragment thereof.
10. The ADC of claim 1, wherein the antibody or antigen-binding fragment thereof is conjugated to the therapeutic moiety through a linker, wherein the linker is bonded to a cysteine residue of the antibody or antigen-binding fragment thereof.
11. The ADC of claim 1, wherein the ADC kills cells that express human PTCRA.
12. The ADC of claim 1, wherein the ADC kills human T-cell acute lymphoblastic leukemia (T-ALL) cells.
13. A pharmaceutical composition comprising the ADC of claim 1 and one or more pharmaceutically acceptable carriers, diluents, or excipients.
14. The pharmaceutical composition of claim 13, wherein the composition is useful for inhibiting or reducing tumor growth in a tumor-bearing subject, wherein tumors of the subject over-express pre-T cell antigen receptor alpha (PTCRA).
15. The pharmaceutical composition of claim 13, wherein the composition is useful for treating T-cell acute lymphoblastic leukemia (T-ALL) in a subject, wherein tumors of the subject over-express pre-T cell antigen receptor alpha (PTCRA).
16. A kit comprising the ADC of claim 1 and instructions for use.
17. A kit comprising the pharmaceutical composition of claim 13 and instructions for use.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
DEFINITIONS
[0032] The expression Pre T-Cell Antigen Receptor Alpha (PTCRA) and the like, as used herein, refers to human Pre T-Cell Antigen Receptor Alpha, comprising the amino acid sequence, for example, as set forth in SEQ ID NOs:1 and 2. The expression PTCRA includes both monomeric and multimeric PTCRA molecules. As used herein, the expression monomeric human PTCRA means a PTCRA protein or portion thereof that does not contain or possess any multimerizing domains and that exists under normal conditions as a single PTCRA molecule without a direct physical connection to another PTCRA molecule. As used herein, the expression dimeric human PTCRA means a construct comprising two PTCRA molecules connected to one another through a linker, covalent bond, non-covalent bond, or through a multimerizing domain such as an antibody Fc domain.
[0033] The amino acid sequence of human PCTRA isoform X1 (NCBI XP_024302110.1) is the following:
TABLE-US-00001 (SEQIDNO:1) 1 mllvdgkqqmvvvclvldvappgldspiwfsagngsalda ftygpspatdgtwtnlahls 61 lpseelasweplvchtgpgaeghsrstqpmhlsgeastar tcpqeplrgtpggalwlgvl 121 rlllfklllfdllltcsclcdpagplpspatttrlralgs hrlhpatetggreatssprp 181 qprdrrwgdtppgrkpgspvwgegsylssyptcpaqawcs rsalrapssslgaffagdlp 241 pplqagaa.
[0034] The amino acid sequence of human PCTRA isoform 2 precursor (NCBI NP_612153.2) is as follows:
TABLE-US-00002 (SEQIDNO:2) 1 magtwlllllalgcpalptgvggtpfpslappimllvdgk qqmvvvclvldvappgldsp 61 iwfsagngsaldaftygpspatdgtwtnlahlslpseela sweplvchtgpgaeghsrst 121 qpmhlsgeastartcpqeplrgtpggalwlgvlrlllfkl llfdllltcsclcdpagplp 181 spatttrlralgshrlhpatetggreatssprpqprdrrw gdtppgrkpgspvwgegsyl 241 ssyptcpaqawcsrsalrapssslgaffagdlppplqagaa.
[0035] The shorter isoform lacks most of the extracellular domain.
[0036] All references to proteins, polypeptides and protein fragments herein are intended to refer to the human version of the respective protein, polypeptide or protein fragment unless explicitly specified as being from a non-human species. Thus, the expression PTCRA means human PTCRA, unless specified as being from a non-human species, e.g., mouse PTCRA, monkey PTCRA, etc.
[0037] As used herein, the expression cell surface-expressed PTCRA means one or more PTCRA protein(s), or the extracellular domain thereof, that is/are expressed on the surface of a cell in vitro or in vivo, such that at least a portion of a PTCRA protein is exposed to the extracellular side of the cell membrane and is accessible to an antigen-binding portion of an antibody. A cell surface-expressed PTCRA can comprise or consist of a PTCRA protein expressed on the surface of a cell that normally expresses PTCRA protein. Alternatively, cell surface-expressed PTCRA can comprise or consist of PTCRA protein expressed on the surface of a cell that normally does not express human PTCRA on its surface but has been artificially engineered to express PTCRA on its surface.
[0038] As used herein, the expression anti-PTCRA antibody includes both monovalent antibodies with a single specificity, as well as bispecific antibodies comprising a first arm that binds PTCRA and a second arm that binds a second (target) antigen. The expression anti-PTCRA antibody includes antibody-drug conjugates (ADCs) comprising an anti-PTCRA antibody or antigen-binding portion thereof conjugated to a therapeutic agent (for example, a drug or toxin, i.e., a cytotoxic agent). The expression anti-PTCRA antibody also includes antibody-radionuclide conjugates (ARCs) comprising an anti-PTCRA antibody or antigen-binding portion thereof conjugated to a radionuclide.
[0039] The term antibody, as used herein, means any antigen-binding molecule or molecular complex comprising at least one complementarity determining region (CDR) that specifically binds to or interacts with a particular antigen (e.g., PTCRA). The term antibody includes immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, as well as multimers thereof (e.g., IgM). Each heavy chain comprises a heavy chain variable region (abbreviated herein as HCVR or VH) and a heavy chain constant region. The heavy chain constant region comprises three domains, CH1, CH2 and CH3. Each light chain comprises a light chain variable region (abbreviated herein as LCVR or VL) and a light chain constant region. The light chain constant region comprises one domain (CL1). The VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR). Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. In different embodiments of the disclosure, the FRs of the anti-PTCRA antibody (or antigen-binding portion thereof) may be identical to the human germline sequences, or may be naturally or artificially modified. An amino acid consensus sequence may be defined based on a side-by-side analysis of two or more CDRs.
[0040] The term antibody, as used herein, also includes antigen-binding fragments of full antibody molecules. The terms antigen-binding portion of an antibody, antigen-binding fragment of an antibody, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. Antigen-binding fragments of an antibody may be derived, e.g., from full antibody molecules using any suitable standard techniques such as proteolytic digestion or recombinant genetic engineering techniques involving the manipulation and expression of DNA encoding antibody variable and optionally constant domains. Such DNA is known and/or is readily available from, e.g., commercial sources, DNA libraries (including, e.g., phage-antibody libraries), or can be synthesized. The DNA may be sequenced and manipulated chemically or by using molecular biology techniques, for example, to arrange one or more variable and/or constant domains into a suitable configuration, or to introduce codons, create cysteine residues, modify, add or delete amino acids, etc.
[0041] Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab)2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide. Other engineered molecules, such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g. monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression antigen-binding fragment, as used herein.
[0042] An antigen-binding fragment of an antibody will typically comprise at least one variable domain. The variable domain may be of any size or amino acid composition and will generally comprise at least one CDR that is adjacent to or in frame with one or more framework sequences. In antigen-binding fragments having a V.sub.H domain associated with a V.sub.L domain, the V.sub.H and V.sub.L domains may be situated relative to one another in any suitable arrangement. For example, the variable region may be dimeric and contain V.sub.H-V.sub.H, V.sub.H-V.sub.L or V.sub.L-V.sub.L dimers. Alternatively, the antigen-binding fragment of an antibody may contain a monomeric V.sub.H or V.sub.L domain.
[0043] In certain embodiments, an antigen-binding fragment of an antibody may contain at least one variable domain covalently linked to at least one constant domain. Non-limiting, exemplary configurations of variable and constant domains that may be found within an antigen-binding fragment of an antibody described in the present disclosure include: (i) V.sub.H-C.sub.H1; (ii) V.sub.H-C.sub.H2; (iii) V.sub.H-C.sub.H3; (iv) V.sub.H-C.sub.H1-C.sub.H2; (v) V.sub.H-C.sub.H1-C.sub.H2-C.sub.H3; (vi) V.sub.H-C.sub.H2-C.sub.H3; (vii) V.sub.H-C.sub.L; (viii) V.sub.L-C.sub.H1; (ix) V.sub.L-C.sub.H2; (x) V.sub.L-C.sub.H3; (xi) V.sub.L-C.sub.H1-C.sub.H2; (xii) V.sub.L-C.sub.H1-CH2-C.sub.H3; (xiii) V.sub.L-C.sub.H2-C.sub.H3; and (xiv) V.sub.L-C.sub.L.
[0044] In any configuration of variable and constant domains, including any of the exemplary configurations listed above, the variable and constant domains may be either directly linked to one another or may be linked by a full or partial hinge or linker region. A hinge region may consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60 or more) amino acids which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule. Moreover, an antigen-binding fragment of an antibody described in the present disclosure may comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non-covalent association with one another and/or with one or more monomeric V.sub.H or V.sub.L domain (e.g., by disulfide bond(s)).
[0045] As with full antibody molecules, antigen-binding fragments may be monospecific or multispecific (e.g., bispecific). A multispecific antigen-binding fragment of an antibody will typically comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope on the same antigen. Any multispecific antibody format, including the bispecific antibody formats described herein, may be adapted for use in the context of an antigen-binding fragment of an antibody in the present disclosure using routine techniques available in the art.
[0046] The antibodies mentioned herein may function through complement-dependent cytotoxicity (CDC) or antibody-dependent cell-mediated cytotoxicity (ADCC). Complement-dependent cytotoxicity (CDC) refers to lysis of antigen-expressing cells by an antibody of the disclosure in the presence of complement. Antibody-dependent cell-mediated cytotoxicity (ADCC) refers to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g., Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and thereby lead to lysis of the target cell. CDC and ADCC can be measured using assays that are well known and available in the art. (See, e.g., U.S. Pat. Nos. 5,500,362 and 5,821,337, and Clynes et al. (1998) Proc. Natl. Acad. Sci. (USA) 95:652-656). The constant region of an antibody is important in the ability of an antibody to fix complement and mediate cell-dependent cytotoxicity. Thus, the isotype of an antibody may be selected on the basis of whether it is desirable for the antibody to mediate cytotoxicity.
[0047] In certain embodiments, the anti-PTCRA antibodies of the ADCs are human antibodies. The term human antibody, as used herein, is intended to include antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The human antibodies of the ADCs of the disclosure may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and in particular CDR3. However, the term human antibody, as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences.
[0048] The antibodies of the ADCs of the disclosure may, in some embodiments, be recombinant human antibodies. The term recombinant human antibody, as used herein, is intended to include all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as antibodies expressed using a recombinant expression vector transfected into a host cell (described further below), antibodies isolated from a recombinant, combinatorial human antibody library (described further below), antibodies isolated from an animal (e.g., a mouse) that is transgenic for human immunoglobulin genes (see e.g., Taylor et al. (1992) Nucl. Acids Res. 20:6287-6295) or antibodies prepared, expressed, created or isolated by any other means that involves splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant human antibodies have variable and constant regions derived from human germline immunoglobulin sequences. In certain embodiments, however, such recombinant human antibodies are subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the V.sub.H and V.sub.L regions of the recombinant antibodies are sequences that, while derived from and related to human germline V.sub.H and V.sub.L sequences, may not naturally exist within the human antibody germline repertoire in vivo.
[0049] Human antibodies can exist in two forms that are associated with hinge heterogeneity. In one form, an immunoglobulin molecule comprises a stable four-chain construct of approximately 150-160 kDa in which the dimers are held together by an interchain heavy chain disulfide bond. In a second form, the dimers are not linked via inter-chain disulfide bonds and a molecule of about 75-80 kDa is formed composed of a covalently coupled light and heavy chain (half-antibody). These forms have been extremely difficult to separate, even after affinity purification.
[0050] The frequency of appearance of the second form in various intact IgG isotypes is due to, but not limited to, structural differences associated with the hinge region isotype of the antibody. A single amino acid substitution in the hinge region of the human IgG4 hinge can significantly reduce the appearance of the second form (Angal et al. (1993) Molecular Immunology 30:105) to levels typically observed using a human IgG1 hinge. The instant disclosure encompasses antibodies having one or more mutations in the hinge, C.sub.H2 or C.sub.H3 region that may be desirable, for example, in production, to improve the yield of the desired antibody form.
[0051] The antibodies of the ADCs disclosed herein may be isolated antibodies. An isolated antibody, as used herein, means an antibody that has been identified and separated and/or recovered from at least one component of its natural environment. For example, an antibody that has been separated or removed from at least one component of an organism, or from a tissue or cell in which the antibody naturally exists or is naturally produced, is an isolated antibody for purposes of the present disclosure. An isolated antibody also includes an antibody in situ within a recombinant cell. Isolated antibodies are antibodies that have been subjected to at least one purification or isolation step. According to certain embodiments, an isolated antibody may be substantially free of other cellular material and/or chemicals.
[0052] The anti-PTCRA antibodies of the ADCs disclosed herein may comprise one or more amino acid substitutions, insertions, and/or deletions in the framework and/or CDR regions of the heavy and light chain variable domains as compared to the corresponding germline sequences from which the antibodies were derived. Such mutations can be readily ascertained by comparing the amino acid sequences disclosed herein to germline sequences available from, for example, public antibody sequence databases. The ADCs of the present disclosure include antibodies, and antigen-binding fragments thereof, which are derived from any of the amino acid sequences of antibodies described herein, wherein one or more amino acids within one or more framework and/or CDR regions are mutated to the corresponding residue(s) of the germline sequence from which the antibody was derived, or to the corresponding residue(s) of another human germline sequence, or to a conservative amino acid substitution of the corresponding germline residue(s) (such sequence changes are referred to herein collectively as germline mutations). A person of ordinary skill in the art, starting with the heavy and light chain variable region sequences of antibodies employed herein, can easily produce numerous antibodies and antigen-binding fragments that comprise one or more individual germline mutations or combinations thereof. In certain embodiments, all of the framework and/or CDR residues within the V.sub.H and/or V.sub.L domains are mutated back to the residues found in the original germline sequence from which the antibody was derived. In other embodiments, only certain residues are mutated back to the original germline sequence, e.g., only the mutated residues found within the first 8 amino acids of FR1 or within the last 8 amino acids of FR4, or only the mutated residues found within CDR1, CDR2 or CDR3. In other embodiments, one or more of the framework and/or CDR residue(s) are mutated to the corresponding residue(s) of a different germline sequence (i.e., a germline sequence that is different from the germline sequence from which the antibody was originally derived). Furthermore, the antibodies of the ADCs of the present disclosure may contain any combination of two or more germline mutations within the framework and/or CDR regions, e.g., wherein certain individual residues are mutated to the corresponding residue of a particular germline sequence while certain other residues that differ from the original germline sequence are maintained or are mutated to the corresponding residue of a different germline sequence. Once obtained, antibodies and antigen-binding fragments that contain one or more germline mutations can be easily tested for one or more desired property such as, improved binding specificity, increased binding affinity, improved or enhanced antagonistic or agonistic biological properties (as the case may be), reduced immunogenicity, etc. Antibodies and antigen-binding fragments obtained in this general manner are employed within the present disclosure.
[0053] The present disclosure also includes ADCs comprising anti-PTCRA antibodies comprising variants of any of the full, HCVR, LCVR, and/or CDR amino acid sequences of the antibodies mentioned herein having one or more conservative substitutions. For example, the present disclosure includes ADCs comprising anti-PTCRA antibodies having HCVR, LCVR, and/or CDR amino acid sequences with, e.g., 10 or fewer, 8 or fewer, 6 or fewer, 4 or fewer, etc. conservative amino acid substitutions relative to any of the HCVR, LCVR, and/or CDR amino acid sequences of the antibodies mentioned herein.
[0054] The term epitope refers to an antigenic determinant that interacts with a specific antigen binding site in the variable region of an antibody molecule known as a paratope. A single antigen may have more than one epitope. Thus, different antibodies may bind to different areas on an antigen and may have different biological effects. Epitopes may be either conformational or linear. A conformational epitope is produced by spatially juxtaposed amino acids from different segments of the linear polypeptide chain. A linear epitope is one produced by adjacent amino acid residues in a polypeptide chain. In certain circumstance, an epitope may include moieties of saccharides, phosphoryl groups, or sulfonyl groups on the antigen.
[0055] The term substantial identity or substantially identical, when referring to a nucleic acid or fragment thereof, indicates that, when optimally aligned with appropriate nucleotide insertions or deletions with another nucleic acid (or its complementary strand), there is nucleotide sequence identity in at least about 95%, and more preferably at least about 96%, 97%, 98% or 99% of the nucleotide bases, as measured by any well-known algorithm of sequence identity, such as FASTA, BLAST or Gap, as discussed below. A nucleic acid molecule having substantial identity to a reference nucleic acid molecule may, in certain instances, encode a polypeptide having the same or substantially similar amino acid sequence as the polypeptide encoded by the reference nucleic acid molecule.
[0056] As applied to polypeptides, the term substantial similarity or substantially similar means that two peptide sequences, when optimally aligned, such as by the programs GAP or BESTFIT using default gap weights, share at least 95% sequence identity, even more preferably at least 98% or 99% sequence identity. Preferably, residue positions that are not identical differ by conservative amino acid substitutions. A conservative amino acid substitution is one in which an amino acid residue is substituted by another amino acid residue having a side chain (R group) with similar chemical properties (e.g., charge or hydrophobicity). In general, a conservative amino acid substitution will not substantially change the functional properties of a protein. In cases where two or more amino acid sequences differ from each other by conservative substitutions, the percent sequence identity or degree of similarity may be adjusted upwards to correct for the conservative nature of the substitution. Means for making this adjustment are well-known to those of skill in the art. See, e.g., Pearson (1994) Methods Mol. Biol. 24: 307-331, herein incorporated by reference. Examples of groups of amino acids that have side chains with similar chemical properties include (1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; (2) aliphatic-hydroxyl side chains: serine and threonine; (3) amide-containing side chains: asparagine and glutamine; (4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; (5) basic side chains: lysine, arginine, and histidine; (6) acidic side chains: aspartate and glutamate, and (7) sulfur-containing side chains are cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine. Alternatively, a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443-1445, herein incorporated by reference. A moderately conservative replacement is any change having a nonnegative value in the PAM250 log-likelihood matrix.
[0057] Sequence similarity for polypeptides, which is also referred to as sequence identity, is typically measured using sequence analysis software. Protein analysis software matches similar sequences using measures of similarity assigned to various substitutions, deletions and other modifications, including conservative amino acid substitutions. For instance, GCG software contains programs such as Gap and Bestfit, which can be used with default parameters to determine sequence homology or sequence identity between closely related polypeptides, such as homologous polypeptides from different species of organisms or between a wild type protein and a mutein thereof. See, e.g., GCG Version 6.1. Polypeptide sequences also can be compared using FASTA using default or recommended parameters, a program in GCG Version 6.1. FASTA (e.g., FASTA2 and FASTA3) provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences (Pearson (2000) supra). Another preferred algorithm when comparing a sequence of the disclosure to a database containing a large number of sequences from different organisms is the computer program BLAST, especially BLASTP or TBLASTN, using default parameters. See, e.g., Altschul et al. (1990) J. Mol. Biol. 215:403-410 and Altschul et al. (1997) Nucleic Acids Res. 25:3389-402, each herein incorporated by reference.
Anti-PTCRA Antibody-Drug Conjugates
[0058] Provided herein are antibody-drug conjugates (ADCs) comprising an antibody or antigen-binding fragment thereof that specifically binds pre-T-cell antigen receptor alpha (PTCRA), wherein the antibody or antigen binding fragment thereof is conjugated to a therapeutic moiety, such as, without limitation, a cytotoxic agent, a chemotherapeutic drug, an immunomodulatory drug, or a radioisotope.
[0059] In some embodiments, the antibody-drug-conjugates have the following structure:
Ab[L-Pay].sub.b
wherein: [0060] Ab is an anti-PTCRA antibody or antigen-binding fragment thereof; [0061] L is a linker; [0062] Pay (or, payload) is a therapeutic moiety; and [0063] n is an integer from 1-10.
Antibodies
[0064] The antibody-drug conjugates provided herein comprise an anti-PTCRA antibody or antigen-binding fragment thereof.
[0065] The anti-PTCRA antibodies can, in some embodiments, be fully human antibodies. Methods for generating monoclonal antibodies, including fully human monoclonal antibodies are known in the art. Any such known methods can be used in the context of the present disclosure to make human antibodies that specifically bind to human PTCRA.
[0066] The antibodies comprised in the ADCs disclosed herein can be full-length (for example, an IgG1 or IgG4 antibody) or may comprise only an antigen-binding portion (for example, a Fab, F(ab)2 or scFv fragment), and may be modified to affect functionality, e.g., to eliminate residual effector functions (Reddy, et al. 200, J. Immunol. 164:1925-1933).
[0067] Antibodies employed in the ADCs disclosed herein target PTCRA.
[0068] In some embodiments, the anti-PTCRA antibody included in the ADCs disclosed herein is 2F5 (BD Biosciences, catalog item no. 552407).
[0069] Public databases are also available for identifying CDR sequences within an antibody.
[0070] The present disclosure includes antibody-drug conjugates comprising anti-PTCRA antibodies having a modified glycosylation pattern. In some embodiments, modification to remove undesirable glycosylation sites may be useful, or an antibody lacking a fucose moiety present on the oligosaccharide chain, for example, to increase antibody dependent cellular cytotoxicity (ADCC) function (see Shield, et al. 2002 JBC 277:26733). In other applications, modification of galactosylation can be made in order to modify complement dependent cytotoxicity (CDC).
PH-Dependent Binding
[0071] The antibody-drug conjugates disclosed herein may employ anti-PTCRA antibodies with pH-dependent binding characteristics. Antibodies with pH-dependent binding characteristics may be obtained, e.g., by screening a population of antibodies for reduced (or enhanced) binding to a particular antigen at acidic pH as compared to neutral pH. Additionally, modifications of the antigen-binding domain at the amino acid level may yield antibodies with pH-dependent characteristics. For example, by substituting one or more amino acids of an antigen-binding domain (e.g., within a CDR) with a histidine residue, an antibody with reduced antigen binding at acidic pH relative to neutral pH may be obtained.
Anti-PTCRA Antibodies Comprising Fc Variants
[0072] According to certain embodiments, the anti-PTCRA antibodies included in the ADCs disclosed herein comprise an Fc domain comprising one or more mutations that enhance or diminish antibody binding to the FcRn receptor, e.g., at acidic pH as compared to neutral pH. For example, the present disclosure includes anti-PTCRA antibodies comprising a mutation in the C.sub.H2 or a C.sub.H3 region of the Fc domain, wherein the mutation(s) increases the affinity of the Fc domain to FcRn in an acidic environment (e.g., in an endosome where pH ranges from about 5.5 to about 6.0). Such mutations may result in an increase in serum half-life of the antibody when administered to an animal. Non-limiting examples of such Fc modifications include, e.g., a modification at position 250 (e.g., E or Q); 250 and 428 (e.g., L or F); 252 (e.g., L/Y/F/W or T), 254 (e.g., S or T), and 256 (e.g., S/R/Q/E/D or T); or a modification at position 428 and/or 433 (e.g., H/L/R/S/P/Q or K) and/or 434 (e.g., H/F or Y); or a modification at position 250 and/or 428; or a modification at position 307 or 308 (e.g., 308F, V308F), and 434. In one embodiment, the modification comprises a 428L (e.g., M428L) and 434S (e.g., N434S) modification; a 428L, 259I (e.g., V259I), and 308F (e.g., V308F) modification; a 433K (e.g., H433K) and a 434 (e.g., 434Y) modification; a 252, 254, and 256 (e.g., 252Y, 254T, and 256E) modification; a 250Q and 428L modification (e.g., T250Q and M428L); and a 307 and/or 308 modification (e.g., 308F or 308P).
[0073] For example, the present disclosure includes anti-PTCRA antibodies comprising an Fc domain comprising one or more pairs or groups of mutations selected from the group consisting of: 250Q and 248L (e.g., T250Q and M248L); 252Y, 254T and 256E (e.g., M252Y, S254T and T256E); 428L and 434S (e.g., M428L and N434S); and 433K and 434F (e.g., H433K and N434F). All possible combinations of the foregoing Fc domain mutations, and other mutations within the antibody variable domains disclosed herein, are contemplated within the scope of the present disclosure.
Biological Characteristics of the Antibodies
[0074] The present disclosure includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that specifically bind human PTCRA. Binding can be measured by surface plasmon resonance or a substantially similar assay.
[0075] The present disclosure includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that bind monomeric human PTCRA with high affinity. The present disclosure also includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that bind dimeric/multimeric human PTCRA with high affinity.
[0076] The present disclosure further includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that bind PTCRA and block Notch signaling in cells expressing human PTCRA. For example, the present disclosure includes antibody-drug conjugates (ADCs) comprising anti-PTCRA antibodies that block Notch signaling in cells that express human PTCRA, as measured using a Notch signaling blocking assay. Thus, the present disclosure includes antibody-drug conjugates (ADCs) that block Notch signaling in cells that express human PTCRA.
[0077] The present disclosure includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that bind PTCRA but do not block Notch signaling in cells expressing human PTCRA. As used herein, an antibody or antigen-binding fragment thereof does not block Notch signaling if, when tested in a Notch signaling blocking assay or a substantially similar assay, the antibody exhibits no or only negligible blocking activity. According to certain embodiments, an antibody or antigen-binding fragment does not block Notch signaling, if the antibody exhibits an IC50 value of greater than about 10 nM, or greater than about 100 nM, when tested in a Notch signaling blocking assay. Thus, in some embodiments, the present disclosure includes antibody-drug conjugates (ADCs) do not block Notch signaling in cells expressing human PTCRA.
[0078] The present disclosure includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that bind PTCRA and block pre-TCR signaling in cells expressing human PTCRA. For example, the present disclosure includes antibody-drug conjugates (ADCs) comprising anti-PTCRA antibodies that block pre-TCR signaling in cells that express human PTCRA, as measured using a pre-TCR signaling blocking assay. Thus, the present disclosure includes antibody-drug conjugates (ADCs) that block pre-TCR signaling in cells that express human PTCRA.
[0079] The present disclosure also includes antibody-drug conjugates (ADCs) comprising antibodies and antigen-binding fragments thereof that bind PTCRA but do not block pre-TCR signaling in cells expressing human PTCRA. As used herein, an antibody or antigen-binding fragment thereof does not block pre-TCR signaling if, when tested in a pre-TCR signaling blocking assay or a substantially similar assay, the antibody exhibits no or only negligible blocking activity. According to certain embodiments, an antibody or antigen-binding fragment does not block pre-TCR signaling, if the antibody exhibits an IC50 value of greater than about 10 nM, or greater than about 100 nM, when tested in a pre-TCR signaling blocking assay. Thus, in some embodiments, the present disclosure includes antibody-drug conjugates (ADCs) do not block pre-TCR signaling in cells expressing human PTCRA.
[0080] The antibodies comprised in the ADCs disclosed herein may possess one or more of the aforementioned biological characteristics, or any combination thereof. Thus, the ADCs disclosed herein may possess one or more of the aforementioned biological characteristics, or any combination thereof. The foregoing list of biological characteristics of the antibodies is not intended to be exhaustive. Other biological characteristics of the antibodies will be evident to a person of ordinary skill in the art from a review of the present disclosure including the working Examples herein.
Epitope Mapping and Related Technologies
[0081] The epitope to which the antibodies of the ADCs of the present disclosure bind may consist of a single contiguous sequence of 3 or more (e.g., 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more) amino acids of a PTCRA protein. Alternatively, the epitope may consist of a plurality of non-contiguous amino acids (or amino acid sequences) of PTCRA.
[0082] Various techniques known to persons of ordinary skill in the art can be used to determine whether an antibody interacts with one or more amino acids within a polypeptide or protein. Exemplary techniques include, e.g., routine cross-blocking assay such as that described Antibodies, Harlow and Lane (Cold Spring Harbor Press, Cold Spring Harb., NY), alanine scanning mutational analysis, peptide blots analysis (Reineke, 2004, Methods Mol Biol 248:443-463), and peptide cleavage analysis. In addition, methods such as epitope excision, epitope extraction and chemical modification of antigens can be employed (Tomer, 2000, Protein Science 9:487-496). Another method that can be used to identify the amino acids within a polypeptide with which an antibody interacts is hydrogen/deuterium exchange detected by mass spectrometry. In general terms, the hydrogen/deuterium exchange method involves deuterium-labeling the protein of interest, followed by binding the antibody to the deuterium-labeled protein. Next, the protein/antibody complex is transferred to water to allow hydrogen-deuterium exchange to occur at all residues except for the residues protected by the antibody (which remain deuterium-labeled). After dissociation of the antibody, the target protein is subjected to protease cleavage and mass spectrometry analysis, thereby revealing the deuterium-labeled residues, which correspond to the specific amino acids with which the antibody interacts. See, e.g., Ehring (1999) Analytical Biochemistry 267(2):252-259; Engen and Smith (2001) Anal. Chem. 73:256A-265A.
[0083] The present disclosure further includes ADCs comprising anti-PTCRA antibodies that bind to the same epitope as any of the specific exemplary antibodies described herein. Likewise, the present disclosure also includes ADCs comprising anti-PTCRA antibodies that compete for binding to PTCRA with any of the specific exemplary antibodies described herein.
[0084] One can easily determine whether an antibody binds to the same epitope as, or competes for binding with, a reference anti-PTCRA antibody by using routine methods known in the art and exemplified herein. For example, to determine if a test antibody binds to the same epitope as a reference anti-PTCRA antibody described herein, the reference antibody is allowed to bind to a PTCRA protein. Next, the ability of the test antibody to bind to the PTCRA molecule is assessed. If the test antibody is able to bind to PTCRA following saturation binding with the reference anti-PTCRA antibody, it can be concluded that the test antibody binds to a different epitope than the reference anti-PTCRA antibody. On the other hand, if a test antibody is not able to bind to a PTCRA molecule following saturation binding with a reference anti-PTCRA antibody, then the test antibody may bind to the same epitope as the epitope bound by the reference anti-PTCRA antibody described herein. Additional routine experimentation (e.g., peptide mutation and binding analyses) can then be carried out to confirm whether the observed lack of binding of the test antibody is in fact due to binding to the same epitope as the reference antibody or if steric blocking (or another phenomenon) is responsible for the lack of observed binding. Experiments of this sort can be performed using ELISA, RIA, Biacore, flow cytometry or any other quantitative or qualitative antibody-binding assay available in the art. In accordance with certain embodiments of the present disclosure, two antibodies bind to the same (or overlapping) epitope if, e.g., a 1-, 5-, 10-, 20- or 100-fold excess of one antibody inhibits binding of the other by at least 50% but preferably 75%, 90% or even 99% as measured in a competitive binding assay (see, e.g., Junghans, et al., Cancer Res. 1990:50:1495-1502). Alternatively, two antibodies are deemed to bind to the same epitope if essentially all amino acid mutations in the antigen that reduce or eliminate binding of one antibody reduce or eliminate binding of the other. Two antibodies are deemed to have overlapping epitopes if only a subset of the amino acid mutations that reduce or eliminate binding of one antibody reduce or eliminate binding of the other.
[0085] To determine if an antibody competes for binding (or cross-competes for binding) with a reference anti-PTCRA antibody, the above-described binding methodology is performed in two orientations: In a first orientation, a reference antibody is allowed to bind to a PTCRA protein under saturating conditions followed by assessment of binding of a test antibody to the PTCRA molecule. In a second orientation, a test antibody is allowed to bind to a PTCRA molecule under saturating conditions followed by assessment of binding of a reference antibody to the PTCRA molecule. If, in both orientations, only the first (saturating) antibody is capable of binding to the PTCRA molecule, then it is concluded that the test antibody and the reference antibody compete for binding to PTCRA. As will be appreciated by a person of ordinary skill in the art, an antibody that competes for binding with a reference antibody may not necessarily bind to the same epitope as the reference antibody, but may sterically block binding of the reference antibody by binding an overlapping or adjacent epitope.
Bioequivalents
[0086] The antibody-drug conjugates comprise anti-PTCRA antibodies and antibody fragments that encompass proteins having amino acid sequences that vary from those of the described antibodies but that retain the ability to bind human PTCRA. Such variant antibodies and antibody fragments comprise one or more additions, deletions, or substitutions of amino acids when compared to parent sequence, but exhibit biological activity that is essentially equivalent to that of the described antibodies. Likewise, the anti-PTCRA antibody-encoding DNA sequences described herein encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to the disclosed sequence, but that encode an anti-PTCRA antibody or antibody fragment that is essentially bioequivalent to an anti-PTCRA antibody or antibody fragment included in an ADC disclosed herein. Such variant amino acid and DNA sequences are discussed above.
[0087] Bioequivalent variants of anti-PTCRA antibodies included in ADCs according to the disclosure may be constructed by, for example, making various substitutions of residues or sequences or deleting terminal or internal residues or sequences not needed for biological activity. For example, cysteine residues not essential for biological activity can be deleted or replaced with other amino acids to prevent formation of unnecessary or incorrect intramolecular disulfide bridges upon renaturation. In other contexts, bioequivalent antibodies may include anti-PTCRA antibody variants comprising amino acid changes that modify the glycosylation characteristics of the antibodies, e.g., mutations that eliminate or remove glycosylation.
Species Selectivity and Species Cross-Reactivity
[0088] The present disclosure, according to certain embodiments, provides antibody-drug conjugates comprising anti-PTCRA antibodies that bind to human PTCRA, but not to PTCRA from other species. The present disclosure also includes antibody-drug conjugates comprising anti-PTCRA antibodies that bind to human PTCRA and to PTCRA from one or more non-human species. For example, the ADCs disclosed herein may comprise anti-PTCRA antibodies that bind to human PTCRA and may bind or not bind, as the case may be, to one or more of mouse, rat, guinea pig, hamster, gerbil, pig, cat, dog, rabbit, goat, sheep, cow, horse, camel, cynomolgus, marmoset, rhesus or chimpanzee PTCRA. According to certain exemplary embodiments, the ADCs disclosed herein may comprise anti-PTCRA antibodies that specifically bind human PTCRA and cynomolgus monkey (e.g., Macaca fascicularis) PTCRA. Other ADCs disclosed herein may comprise anti-PTCRA antibodies that bind human PTCRA but do not bind, or bind only weakly, to cynomolgus monkey PTCRA.
Therapeutic Moieties
[0089] The antibody-drug conjugates (ADCs) provided herein comprise an anti-PTCRA antibody or antigen-binding fragment thereof conjugated to a therapeutic moiety. In some embodiments, the therapeutic moiety is a cytotoxic agent, a chemotherapeutic drug, an immunomodulatory drug, or a radioisotope.
[0090] Cytotoxic agents include any agent that is detrimental to the growth, viability or propagation of cells, including, but not limited to, tubulin-interacting agents and DNA-damaging agents. Examples of suitable cytotoxic agents and chemotherapeutic agents that can be conjugated to anti-PTCRA antibodies in accordance with this aspect of the disclosure include, e.g., 1-(2chloroethyl)-1,2-dimethanesulfonyl hydrazide, 1,8-dihydroxy-bicyclo[7.3.1]trideca-4,9-diene-2,6-diyne-13-one, 1-dehydrotestosterone, 5-fluorouracil, 6-mercaptopurine, 6-thioguanine, 9-amino camptothecin, actinomycin D, amanitins, aminopterin, anguidine, anthracycline, anthramycin (AMC), auristatins, bleomycin, busulfan, butyric acid, calicheamicins (e.g., calicheamicin ?1), camptothecin, carminomycins, carmustine, cemadotins, cisplatin, colchicin, combretastatins, cyclophosphamide, cytarabine, cytochalasin B, dactinomycin, daunorubicin, decarbazine, diacetoxypentyldoxorubicin, dibromomannitol, dihydroxy anthracin dione, disorazoles, dolastatin (e.g., dolastatin 10), doxorubicin, duocarmycin, echinomycins, eleutherobins, emetine, epothilones, esperamicin, estramustines, ethidium bromide, etoposide, fluorouracils, geldanamycins, gramicidin D, glucocorticoids, irinotecans, kinesin spindle protein (KSP) inhibitors, leptomycins, leurosines, lidocaine, lomustine (CCNU), maytansinoids, mechlorethamine, melphalan, mercatopurines, methopterins, methotrexate, mithramycin, mitomycin, mitoxantrone, N8-acetyl spermidine, podophyllotoxins, procaine, propranolol, pteridines, puromycin, pyrrolobenzodiazepines (PBDs), rhizoxins, streptozotocin, tallysomycins, taxol, tenoposide, tetracaine, thioepa chlorambucil, tomaymycins, topotecans, tubulysin, vinblastine, vincristine, vindesine, vinorelbines, and derivatives of any of the foregoing. According to certain embodiments, the cytotoxic agent that is conjugated to an anti-PTCRA antibody is a maytansinoid. According to further embodiments, the maytansinoid is DM1 or DM4, a tomaymycin derivative, or a dolastatin derivative. According to still further embodiments, the maytansinoid is DM1. According to certain embodiments, the cytotoxic agent that is conjugated to an anti-PTCRA antibody is an auristatin. According to further embodiments, the auristatin is MMAE, MMAF, or derivatives thereof. According to still further embodiments, the auristatin is MMAE. Other cytotoxic agents known in the art are contemplated within the scope of the present disclosure, including, e.g., protein toxins such ricin, C. difficile toxin, Pseudomonas exotoxin, ricin, diphtheria toxin, botulinum toxin, bryodin, saporin, pokeweed toxins (i.e., phytolaccatoxin and phytolaccigenin), and others such as those set forth in Sapra, et al., Pharmacol. & Therapeutics, 2013, 138:452-469. In another embodiment, the cytotoxic agent is a tubulysin. In another embodiment, the cytotoxic agent is a PBD.
[0091] In some embodiments, the cytotoxic agent is an auristatin.
[0092] In some embodiments, the cytotoxic agent is monomethyl auristatin E (MMAE).
[0093] In some embodiments, the cytotoxic agent is monomethyl auristatin F (MMAF).
[0094] In some embodiments, the cytotoxic agent is:
##STR00001##
[0095] In certain embodiments, the cytotoxic agent is a maytansinoid, e.g., derivative of maytansine. Suitable maytansinoids include DM1, DM4, or derivatives, stereoisomers, or isotopologues thereof. Suitable maytansinoids also include, but are not limited to, those disclosed in WO 2014/145090A1, WO 2015/031396A1, US 2016/0375147A1, and US 2017/0209591A1, incorporated herein by reference in their entireties.
[0096] In some embodiments the mavtansinoid has the following structure:
##STR00002##
wherein A is an optionally substituted arylene or heteroarylene.
[0097] In some embodiments, the maytansinoid has the following structure:
##STR00003##
wherein A is an optionally substituted arylene or heteroarylene.
[0098] In some embodiments, the maytansinoid has the following structure:
##STR00004##
wherein n is an integer from 1-12 and R.sup.1 is alkyl.
[0099] In some embodiments, the maytansinoid is:
##STR00005## ##STR00006## ##STR00007## ##STR00008## ##STR00009## ##STR00010## ##STR00011##
[0100] In some embodiments, the maytansinoid is
##STR00012##
[0101] In some embodiments, the maytansinoid is:
##STR00013##
[0102] In some embodiments, the maytansinoid is:
##STR00014##
Methods of preparing MAYT3 include those described in U.S. Pat. No. 10,570,151 B2.
[0103] In some embodiments, the maytansinoid is:
##STR00015##
[0104] The present disclosure also includes antibody-radionuclide conjugates (ARCs) comprising anti-PTCRA antibodies conjugated to one or more radionuclides. Exemplary radionuclides that can be used in the context of this aspect of the disclosure include, but are not limited to, e.g., .sup.225Ac, .sup.212Bi, .sup.213Bi, .sup.131I, .sup.186Re, .sup.227Th, .sup.222Rn, .sup.223Ra, .sup.224Ra, and .sup.90Y.
[0105] In some embodiments, the therapeutic moiety is <3000, <2000, <1000, or <900 daltons.
[0106] In certain embodiments, ADCs are provided herein comprising an anti-PTCRA antibody conjugated to a therapeutic moiety (e.g., any of the cytotoxic agents disclosed above) via a linker. Linkers are any group or moiety that links, connects, or bonds the antibody or antigen-binding proteins described herein with a therapeutic moiety, e.g. cytotoxic agent. Suitable linkers may be found, for example, in Antibody-Drug Conjugates and Immunotoxins; Phillips, G. L., Ed.; Springer Verlag: New York, 2013; Antibody-Drug Conjugates; Ducry, L., Ed.; Humana Press, 2013; Antibody-Drug Conjugates; Wang, J., Shen, W.-C., and Zaro, J. L., Eds.; Springer International Publishing, 2015, the contents of each incorporated herein in their entirety by reference. Generally, suitable linkers for the antibody conjugates described herein are those that are sufficiently stable to exploit the circulating half-life of the antibody and, at the same time, capable of releasing its payload after antigen-mediated internalization of the conjugate. Linkers can be cleavable or non-cleavable. Cleavable linkers include linkers that are cleaved by intracellular metabolism following internalization, e.g., cleavage via hydrolysis, reduction, or enzymatic reaction. Non-cleavable linkers include linkers that release an attached payload via lysosomal degradation of the antibody following internalization. Suitable linkers include, but are not limited to, acid-labile linkers, hydrolysis-labile linkers, enzymatically cleavable linkers, reduction labile linkers, self-immolative linkers, and non-cleavable linkers. Suitable linkers also include, but are not limited to, those that are or comprise peptides, glucuronides, succinimide-thioethers, polyethylene glycol (PEG) units, hydrazones, mal-caproyl units, dipeptide units, valine-citruline units, and para-aminobenzyl (PAB) units.
Linkers
[0107] Any linker or linker technology known in the art can be used to create or construct an ADC of the present disclosure. In certain embodiments, the linker is a cleavable linker. According to other embodiments, the linker is a non-cleavable linker. Exemplary linkers that can be used in the context of the present disclosure include, linkers that comprise or consist of e.g., MC (6-maleimidocaproyl), MP (maleimidopropanoyl), val-cit (valine-citrulline), val-ala (valine-alanine), dipeptide site in protease-cleavable linker, ala-phe (alanine-phenylalanine), dipeptide site in protease-cleavable linker, PAB (p-aminobenzyloxycarbonyl), SPP (N-Succinimidyl 4-(2-pyridylthio) pentanoate), SMCC (N-Succinimidyl 4-(N-maleimidomethyl)cyclohexane-1 carboxylate), STAB (N-Succinimidyl (4-iodo-acetyl)aminobenzoate), and variants and combinations thereof. Additional examples of linkers that can be used in the context of the present disclosure are provided, e.g., in U.S. Pat. No. 7,754,681 and in Ducry, Bioconjugate Chem., 2010, 21:5-13, and the references cited therein, the contents of which are incorporated by reference herein in their entireties. In certain embodiments, the linker is MC.
[0108] In certain embodiments, the linkers are stable in physiological conditions. In certain embodiments, the linkers are cleavable, for instance, able to release at least the payload portion in the presence of an enzyme or at a particular pH range or value. In some embodiments, a linker comprises an enzyme-cleavable moiety. Illustrative enzyme-cleavable moieties include, but are not limited to, peptide bonds, ester linkages, hydrazones, and disulfide linkages. In some embodiments, the linker comprises a cathepsin-cleavable linker.
[0109] In some embodiments, the linker comprises a non-cleavable moiety.
[0110] Suitable linkers also include, but are not limited to, those that are chemically bonded to two cysteine residues of a single binding agent, e.g., antibody. Such linkers can serve to mimic the antibody's disulfide bonds that are disrupted as a result of the conjugation process.
[0111] In some embodiments, the linker comprises one or more amino acids. Suitable amino acids include natural, non-natural, standard, non-standard, proteinogenic, non-proteinogenic, and L- or D-?-amino acids. In some embodiments, the linker comprises alanine, valine, glycine, leucine, isoleucine, methionine, tryptophan, phenylalanine, proline, serine, threonine, cysteine, tyrosine, asparagine, glutamine, aspartic acid, glutamic acid, lysine, arginine, histidine, or citrulline, a derivative thereof, or combination thereof. In certain embodiments, one or more side chains of the amino acids is linked to a side chain group, described below. In some embodiments, the linker comprises valine and citrulline. In some embodiments, the linker comprises lysine, valine, and citrulline. In some embodiments, the linker comprises lysine, valine, and alanine. In some embodiments, the linker comprises valine and alanine.
[0112] In some embodiments, the linker comprises a self-immolative group. The self-immolative group can be any such group known to those of skill. In particular embodiments, the self-immolative group is p-aminobenzyl (PAB), or a derivative thereof. Useful derivatives include p-aminobenzyloxycarbonyl (PABC). Those of skill will recognize that a self-immolative group is capable of carrying out a chemical reaction that releases the remaining atoms of a linker from a payload.
[0113] The present disclosure comprises ADCs in which a linker connects an anti-PTCRA antibody to a drug or cytotoxin through an attachment at a particular amino acid within the antibody or antigen-binding molecule. Exemplary amino acid attachments that can be used in the context of this aspect, e.g., lysine (see, e.g., U.S. Pat. No. 5,208,020; US 2010/0129314; Hollander et al., Bioconjugate Chem., 2008, 19:358-361; WO 2005/089808; U.S. Pat. No. 5,714,586; US 2013/0101546; and US 2012/0585592), cysteine (see, e.g., US 2007/0258987; WO 2013/055993; WO 2013/055990; WO 2013/053873; WO 2013/053872; WO 2011/130598; US 2013/0101546; and U.S. Pat. No. 7,750,116), selenocysteine (see, e.g., WO 2008/122039; and Hofer, et al., Proc. Natl. Acad. Sci., USA, 2008, 105:12451-12456), formyl glycine (see, e.g., Carrico, et al., Nat. Chem. Biol., 2007, 3:321-322; Agarwal, et al., Proc. Natl. Acad. Sci., USA, 2013, 110:46-51, and Rabuka, et al., Nat. Protocols, 2012, 10:1052-1067), non-natural amino acids (see, e.g., WO 2013/068874, and WO 2012/166559), and acidic amino acids (see, e.g., WO 2012/05982). Linkers can also be conjugated to an antigen-binding protein via attachment to carbohydrates (see, e.g., US 2008/0305497, WO 2014/065661, and Ryan, et al., Food & Agriculture Immunol., 2001, 13:127-130) and disulfide linkers (see, e.g., WO 2013/085925, WO 2010/010324, WO 2011/018611, and Shaunak, et al., Nat. Chem. Biol., 2006, 2:312-313). Site-specific conjugation techniques can also be employed to direct conjugation to particular residues of the antibody or antigen binding protein (see, e.g., Schumacher, et al. J Clin Immunol (2016) 36(Suppl 1): 100). Site-specific conjugation techniques, include, but are not limited to, glutamine conjugation via transglutaminase (see, e.g., Schibli, Angew Chemie Inter Ed. 2010, 49, 9995).
[0114] According to certain embodiments, the present disclosure provides ADCs, wherein an anti-PTCRA antibody as described herein is conjugated to a linker-drug composition as set forth in International Patent Publication WO2014/145090, (e.g., the compound depicted below), the disclosure of which is hereby incorporated by reference herein in its entirety:
##STR00016##
[0115] Thus, in some embodiments, the antibody-drug-conjugates have the following structure:
Ab[L-Pay].sub.n
wherein: [0116] Ab is an anti-PTCRA antibody; [0117] L is a linker; [0118] Pay is a therapeutic moiety; and [0119] n is an integer from 1-10.
[0120] In certain embodiments, Lisa non-cleavable linker.
[0121] In certain embodiments, Pay is a maytansinoid. In certain embodiments, Pay is DM1 or derivative thereof. In certain embodiments, Pay is:
##STR00017##
[0122] In certain embodiments, Pay is an auristatin. In certain embodiments, Pay is MMAE. In certain embodiments, Pay is MMAF.
[0123] In certain embodiments, the linker-payload (L-Pay) is:
##STR00018##
[0124] In some embodiment, the linker-payload (L-Pay) is:
##STR00019##
[0125] In some embodiments, the linker-payload (LPay) is:
##STR00020##
[0126] In some embodiments, n is 1-6. In some embodiments, n is 1-5. In some embodiments, n is 1. In some embodiments, n is 2. In some embodiments, n is 3. In some embodiments, n is 4. In some embodiments, n is 5.
[0127] In some embodiments, the antibody-drug conjugate comprising MAYT2LP is prepared by contacting an anti-PTCRA antibody or antigen binding fragment thereof to a compound having the following structure:
##STR00021##
[0128] In some embodiments, the antibody-drug conjugate comprising MAYT3LP is prepared by contacting an anti-PTCRA antibody or antigen binding fragment thereof to a compound having the following structure:
##STR00022##
(MAYT3LPINT), including, e.g., methods described in US Publication No. 2018/0134794 A1, which is incorporated herein by reference in its entirety.
[0129] In some embodiments, the antibody-drug conjugate comprising MAYT4LP is prepared by contacting an anti-PTCRA antibody or antigen binding fragment thereof to a compound having the following structure:
##STR00023##
[0130] The antibody-drug conjugates described herein can be prepared using conjugation conditions known to those of ordinary skill in the art, (see, e.g., Doronina, et al., Nature Biotechnology, 2003, 21, 7, 778, which is incorporated herein by reference in its entirety). In some embodiments, an ADC comprising an anti-PTCRA antibody is prepared by contacting an anti-PTCRA antibody with a compound comprising the desired linker and cytotoxic agent, wherein said linker possesses a moiety that is reactive with the antibody or antigen-binding protein, e.g., at the desired residue of the antibody or antigen-binding protein.
[0131] According to certain embodiments, the present disclosure provides ADCs, wherein an anti-PTCRA antibody as described herein is conjugated to a linker-drug composition as set forth in International Patent Application No. PCT/US14/29757, filed on Mar. 14, 2014 (e.g., compound 7,), the disclosure of which is hereby incorporated by reference herein in its entirety.
[0132] Any method known in the art for conjugating a chemical moiety to a peptide, polypeptide, or other macromolecule can be used in the context of the present disclosure to make an anti-PTCRA ADC as described herein. An exemplary method for antibody-drug conjugation via a linker is set forth in Example 7 herein. Variations on this exemplary method will be appreciated by persons of ordinary skill in the art and are contemplated within the scope of the present disclosure.
Characterization of Conjugates by Liquid Chromatography-Mass Spectrometry
[0133] Parameters that characterize an antibody-drug-conjugate (ADC) and determine its efficacy include, without limitation, its structure, stability, drug to antibody ratio (DAR), and payload distribution. DAR is a significant quality parameter of an ADC and is presented as the average number of drug molecules conjugated to an antibody. The DAR value affects the efficacy of the drug, as low drug loading reduces the potency, while high drug loading can negatively affect pharmacokinetics (PK)1 and toxicity. DAR can be determined, for example, using Ultraviolet-Visible (UV/Vis) spectroscopy, Hydrophobic interaction chromatography (HIC), Reversed phase high-performance liquid chromatography (RP-HPLC), Liquid chromatography coupled with electrospray ionization mass spectrometry (LC-ESI-MS), and LC-MS.
[0134] In certain embodiments, to determine the loading of the linker-payloads on the antibody, the conjugates are deglycosylated and analyzed by LC-MS.
[0135] For the assay, 50 ?g of the conjugate is diluted with milli-Q water to a final concentration of 1 mg/mL. Ten ?L of PNGase F solution [PNGase F solution is prepared by adding 150 ?L of PNGase F stock (New England Biolabs, Cat #P0704L) and 850 ?L of milli-Q water and mixed well] is added to the diluted conjugate solution and then incubated at 37? C. overnight. Injections of 5 ?L of each sample are made onto LC-MS (Waters Synat G2-Si) and eluted with 0.1 mL/minute of a gradient mobile phase 20-40% over 25 minutes (Mobile Phase A: 0.1%v/v FA in H2O; Mobile Phase B: 0.1% v/v FA in Acetonitrile). The LC separation is achieved on a Waters Acquity BEH C4 column (1.0?50 mM, 1.7 ?M) at 80? C.
[0136] The mass spectrometry spectra are deconvoluted using Masslynx software, and the drug to antibody ratio (DAR) is calculated using the following equations: [0137] 1. Relative percentage (%) of drug (Dn) by distribution peak intensity (PI):
Dn %=PIn/?(PI0+PI1+PI2 . . . +PIi)?100 (n=0,1,2,3, . . . ,i) [0138] 2. Average DAR calculation:
DAR=?(1?D1%+2?D2%+3?D3%+ . . . +i?Di %)
[0139] In certain embodiments, the drug-antibody ratio (DAR) of the ADCs of the disclosure is between about 1 and about 30. In another embodiment, the DAR of the ADCs of the disclosure is between about 1 and about 8. In another embodiment, the DAR of the ADCs of the disclosure is between about 1 and about 6. In another embodiment, the DAR of the ADCs of the disclosure is between about 1 and about 5. In another embodiment, the DAR of the ADCs of the disclosure is between about 1 and about 4. In another embodiment, the DAR of the ADCs of the disclosure is between about 2 and about 4. In another embodiment, the DAR of the ADCs of the disclosure is about 1 or about 2 or about 3 or about 4 or about 5 or about 6 or about 7 or about 8 or about 9 or about 10 or about 11 or about 12 or about 13 or about 14 or about 15 or about 16 or about 17 or about 18 or about 19 or about 20 or about 21 or about 22 or about 23 or about 24 or about 25 or about 26 or about 27 or about 28 or about 29 or about 30.
Targeting ADCs to Cells Expressing PTCRA
[0140] In some embodiments, ADCs comprising an anti-PTCRA antibody conjugated to a cytotoxic agent described herein are able to specifically target and kill cells that express PTCRA. Specifically, ADCs comprising an anti-PTCRA antibody conjugated to a cytotoxic agent are able to specifically target and kill T-ALL cells. In some embodiments, the ADC kills T-ALL cells with an IC50 of about 1 ?M to about 10 nM. In additional embodiments, the ADC kills T-ALL cells with an IC50 of about 1 nM to about 10 nM.
[0141] In some embodiments, PTCRA expression is detectable via flow cytometry on leukemic T cells. In additional embodiments, PTCRA expression is not detectable on normal, mature T-cells.
[0142] In Example 7, herein, it is shown that treatment of primary PTCRA+ murine T-ALL (mTALL) cells with i) a PTCRA-targeting mouse mAb, followed by treatment with anti-mouse IgG-Fc linked to the microtubule inhibitor monomethyl auristatin E (MMAE) via a non-cleavable linker, resulted in robust killing of mTALL cells, but no killing in control-treated cells (
[0143] In a highly-aggressive, disseminated T-ALL in vivo model, T-ALL-bearing mice treated with the PTCRA-ADC exhibited statistically significantly reduced tumor burden, both in peripheral blood and spleen relative to control-ADC controls (
[0144] A relatively low dose (about 1 nM to about 10 nM) of ADCs comprising an anti-PTCRA antibody conjugated to a cytotoxic agent was shown herein to be sufficient to specifically target and kill T-ALL cells (
[0145] Accordingly, the present disclosure provides antibody-drug conjugates (ADCs) comprising an antibody or antigen-binding fragment thereof that specifically binds human PTCRA conjugated to a cytotoxic agent, wherein the ADCs effectively kill T-ALL cells. The methods according to this aspect of the disclosure comprise contacting the cells with an antibody-drug conjugate (ADC) comprising an anti-PTCRA antibody conjugated to a cytotoxic agent. Contacting the cells can be carried out in vitro, or in vivo, e.g., by administering an anti-PTCRA ADC to a subject in need thereof, wherein the administration causes the ADC to come into contact with cells expressing PTCRA, specifically, T-ALL cells.
[0146] As used herein, effective killing means that the ADC exhibits an IC50 of less than about 20 nM, or less than or equal to about 10 nM (e.g., less than or equal to about 9 nM, less than or equal to about 8 nM, less than or equal to about 7 nM, less than or equal to about 6 nM, less than or equal to about 5 nM, or less than or equal to about 4 nM) in a tumor cell killing assay, such as the assay defined in Example 7 herein, or a substantially similar assay. According to this aspect of the disclosure, the anti-PTCRA antibody component of the ADC can be any anti-PTCRA antibody, including those described herein. Additionally, the cytotoxic agent component of the ADC can be any cytotoxic agent, such as DM1, or any other cytotoxic agent mentioned herein.
[0147] ADCs of the present disclosure are able to inhibit tumor growth and/or reduce tumor size in PTCRA+ tumor-bearing animals. For example, as shown in Example 7 herein, anti-PTCRA ADCs were shown to significantly reduce tumors in mice bearing T-ALL tumors. Thus, the present disclosure includes ADCs comprising such anti-PTCRA antibodies, wherein the ADCs, when administered to a PTCRA+ tumor-bearing animal, inhibit tumor growth and/or reduce tumor size (e.g., tumor growth inhibition of 100% or greater) by Day 12 post-administration or sooner.
Therapeutic Formulation and Administration
[0148] The disclosure provides pharmaceutical compositions comprising antibody-drug conjugates (ADCs) comprising anti-PTCRA antibodies or antigen-binding fragments thereof, as disclosed herein. The pharmaceutical compositions of the disclosure are formulated with suitable carriers, excipients, and other agents that provide improved transfer, delivery, tolerance, and the like. A multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences, Mack Publishing Company, Easton, PA. These formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LIPOFECTIN?, Life Technologies, Carlsbad, CA), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. See also Powell, et al. Compendium of excipients for parenteral formulations PDA (1998) J Pharm Sci Technol 52:238-311.
[0149] The dose of ADC administered to a patient may vary depending upon the age and the size of the patient, target disease, conditions, route of administration, and the like. The preferred dose is typically calculated according to body weight or body surface area. In an adult patient, it may be advantageous to intravenously administer the ADC of the present disclosure normally at a single dose of about 0.01 to about 20 mg/kg body weight, more preferably about 0.02 to about 7, about 0.03 to about 5, or about 0.05 to about 3 mg/kg body weight. Depending on the severity of the condition, the frequency and the duration of the treatment can be adjusted. Effective dosages and schedules for administering ADCs may be determined empirically; for example, patient progress can be monitored by periodic assessment, and the dose adjusted accordingly. Moreover, interspecies scaling of dosages can be performed using well-known methods in the art (e.g., Mordenti et al., 1991, Pharmaceut. Res. 8:1351).
[0150] Various delivery systems are known and can be used to administer the pharmaceutical composition of the disclosure, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the mutant viruses, receptor mediated endocytosis (see, e.g., Wu, et al., 1987, J. Biol. Chem. 262:4429-4432). Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The composition may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local.
[0151] An antibody-drug conjugate comprising an antibody of an antigen-binding fragment thereof or a pharmaceutical composition of the present disclosure may be contained in a container selected from the group consisting of, but not limited to, a syringe, a vial, a pen delivery device, an autoinjector, or a microinfusor. In certain embodiments, the syringe or the pen delivery device may be pre-filled. In other embodiments, the vial may be a glass vial. An ADC comprising an antibody of an antigen-binding fragment thereof or a pharmaceutical composition of the present disclosure can be delivered subcutaneously or intravenously with a standard needle and syringe. In addition, with respect to subcutaneous delivery, a pen delivery device readily has applications in delivering an ADC comprising an antibody of an antigen-binding fragment thereof or a pharmaceutical composition of the present disclosure. Such a pen delivery device can be reusable or disposable. A reusable pen delivery device generally utilizes a replaceable cartridge that contains a pharmaceutical composition. Once all of the pharmaceutical composition within the cartridge has been administered and the cartridge is empty, the empty cartridge can readily be discarded and replaced with a new cartridge that contains the pharmaceutical composition. The pen delivery device can then be reused. In a disposable pen delivery device, there is no replaceable cartridge. Rather, the disposable pen delivery device comes prefilled with the pharmaceutical composition held in a reservoir within the device. Once the reservoir is emptied of the pharmaceutical composition, the entire device is discarded.
[0152] Numerous reusable pen and autoinjector delivery devices have applications in the subcutaneous delivery of a pharmaceutical composition of the present disclosure. Examples include, but are not limited to AUTOPEN? (Owen Mumford, Inc., Woodstock, UK), DISETRONIC? pen (Disetronic Medical Systems, Bergdorf, Switzerland), HUMALOG MIX 75/25? pen, HUMALOG? pen, HUMALIN 70/30? pen (Eli Lilly and Co., Indianapolis, IN), NOVOPEN? I, II and III (Novo Nordisk, Copenhagen, Denmark), NOVOPEN JUNIOR? (Novo Nordisk, Copenhagen, Denmark), BD? pen (Becton Dickinson, Franklin Lakes, NJ), OPTIPEN?, OPTIPEN PRO?, OPTIPEN STARLET?, and OPTICLIK? (Sanofi-Aventis, Frankfurt, Germany), to name only a few. Examples of disposable pen delivery devices having applications in subcutaneous delivery of a pharmaceutical composition of the present disclosure include, but are not limited to the SOLOSTAR? pen (Sanofi-Aventis), the FLEXPEN? (Novo Nordisk), and the KWIKPEN? (Eli Lilly), the SURECLICK? Autoinjector (Amgen, Thousand Oaks, CA), the PENLET? (Haselmeier, Stuttgart, Germany), the EPIPEN (Dey, L. P.), and the HUMIRA? Pen (Abbott Labs, Abbott Park IL), to name only a few.
[0153] In certain situations, an ADC comprising an antibody of an antigen-binding fragment thereof or a pharmaceutical composition of the present disclosure can be delivered in a controlled release system. In one embodiment, a pump may be used (see Langer, supra; Sefton, 1987, CRC Crit. Ref. Biomed. Eng. 14:201). In another embodiment, polymeric materials can be used; see, Medical Applications of Controlled Release, Langer and Wise (eds.), 1974, CRC Pres., Boca Raton, Florida. In yet another embodiment, a controlled release system can be placed in proximity of the composition's target, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, 1984, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138). Other controlled release systems are discussed in the review by Langer, 1990, Science 249:1527-1533.
[0154] The injectable preparations may include dosage forms for intravenous, subcutaneous, intracutaneous and intramuscular injections, drip infusions, etc. These injectable preparations may be prepared by methods publicly known. For example, the injectable preparations may be prepared, e.g., by dissolving, suspending or emulsifying the antibody or its salt described above in a sterile aqueous medium or an oily medium conventionally used for injections. As the aqueous medium for injections, there are, for example, physiological saline, an isotonic solution containing glucose and other auxiliary agents, etc., which may be used in combination with an appropriate solubilizing agent such as an alcohol (e.g., ethanol), a polyalcohol (e.g., propylene glycol, polyethylene glycol), a nonionic surfactant [e.g., polysorbate 80, HCO-50 (polyoxyethylene (50 mol) adduct of hydrogenated castor oil)], etc. As the oily medium, there are employed, e.g., sesame oil, soybean oil, etc., which may be used in combination with a solubilizing agent such as benzyl benzoate, benzyl alcohol, etc. The injection thus prepared is preferably filled in an appropriate ampoule.
[0155] In some embodiments, the pharmaceutical compositions for oral or parenteral use described above are prepared into dosage forms in a unit dose suited to fit a dose of the active ingredients. Such dosage forms in a unit dose include, for example, tablets, pills, capsules, injections (ampoules), suppositories, etc. The amount of the aforesaid ADC contained is generally about 5 to about 500 mg per dosage form in a unit dose; especially in the form of injection, it is preferred that the aforesaid antibody is contained in about 5 to about 100 mg and in about 10 to about 250 mg for the other dosage forms.
Therapeutic Uses
[0156] The present disclosure includes methods comprising administering to a subject in need thereof a therapeutic composition comprising an antibody-drug conjugate comprising an anti-PTCRA antibody or antigen-binding fragment thereof. The therapeutic composition can comprise any of the ADCs disclosed herein and a pharmaceutically acceptable carrier or diluent.
[0157] The ADCs of the disclosure are useful, inter alia, for the treatment, prevention and/or amelioration of any disease or disorder associated with or mediated by PTCRA expression or activity, or treatable by blocking the interaction between PTCRA and another molecule or otherwise inhibiting PTCRA activity and/or signaling, and/or promoting receptor internalization and/or decreasing cell surface receptor number. In one embodiment, the ADCs of the disclosure are useful, inter alia, for the treatment, prevention and/or amelioration of T-ALL. For example, the ADCs of the present disclosure are useful for the treatment of tumors that express PTCRA and/or that respond to Notch- or pre-TCR-mediated signaling, e.g., T-ALL tumors. The ADCs of the present disclosure may also be used to treat primary and/or metastatic tumors arising in the brain and meninges, oropharynx, lung and bronchial tree, gastrointestinal tract, male and female reproductive tract, muscle, bone, skin and appendages, connective tissue, spleen, immune system, blood forming cells and bone marrow, liver and urinary tract, and special sensory organs such as the eye. In certain embodiments, the ADCs of the disclosure are used to treat one or more of the following cancers: renal cell carcinoma, pancreatic carcinoma, head and neck cancer, prostate cancer, malignant gliomas, osteosarcoma, colorectal cancer, gastric cancer, malignant mesothelioma, multiple myeloma, ovarian cancer, small cell lung cancer, non-small cell lung cancer, synovial sarcoma, thyroid cancer, breast cancer, or melanoma.
[0158] In the context of the methods of treatment described herein, the ADC comprising an anti-PTCRA antibody or antigen-binding fragment thereof may be administered as a monotherapy (i.e., as the only therapeutic agent) or in combination with one or more additional therapeutic agents (examples of which are described elsewhere herein).
[0159] The present disclosure includes methods for identifying patients who are treatable with an ADC disclosed herein by assaying for high levels of PTCRA expression in one or more tissues of the patient, such as a tumor tissue. In a related embodiment, the present disclosure includes methods for treating cancers characterized by high-level expression of PTCRA, e.g. T-ALL. For example, the present disclosure includes methods of treatment comprising administering an ADC comprising an anti-PTCRA antibody or antigen-binding fragment thereof, to a subject with a tumor, wherein the tumor has been identified as expressing PTCRA. In certain embodiments, the tumor is identified as expressing PTCRA by immunohistochemistry of a biopsy sample or other imaging techniques such as, e.g., immuno-PET imaging, etc. In certain embodiments, a combination of FACS (positive or negative) and RNA sequencing is used to determine whether or not PTCRA is expressed. In further embodiments, cells positive for expression show >5 RPKM.
Combination Therapies and Formulations
[0160] The present disclosure includes compositions and therapeutic formulations comprising any of the ADCs described herein in combination with one or more additional therapeutically active components, and methods of treatment comprising administering such combinations to subjects in need thereof.
[0161] The ADCs of the present disclosure may be co-formulated with and/or administered in combination with one or more additional therapeutically active component(s) selected from the group consisting of: an EGFR antagonist (e.g., an anti-EGFR antibody [e.g., cetuximab or panitumumab] or small molecule inhibitor of EGFR [e.g., gefitinib or erlotinib]), an antagonist of another EGFR family member such as Her2/ErbB2, ErbB3 or ErbB4 (e.g., anti-ErbB2 [e.g., trastuzumab or T-DM1 {KADCYLA?}], anti-ErbB3 or anti-ErbB4 antibody or small molecule inhibitor of ErbB2, ErbB3 or ErbB4 activity), an antagonist of EGFRvIII (e.g., an antibody that specifically binds EGFRvIII), a PTCRA antagonist (e.g., another anti-PTCRA antibody), an IGF1R antagonist (e.g., an anti-IGF1R antibody), a B-raf inhibitor (e.g., vemurafenib, sorafenib, GDC-0879, PLX-4720), a PDGFR-? inhibitor (e.g., an anti-PDGFR-? antibody), a PDGFR-? inhibitor (e.g., an anti-PDGFR-? antibody or small molecule kinase inhibitor such as, e.g., imatinib mesylate or sunitinib malate), a PDGF ligand inhibitor (e.g., anti-PDGF-A, -B, -C, or -D antibody, aptamer, siRNA, etc.), a VEGF antagonist (e.g., a VEGF-Trap such as aflibercept, see, e.g., U.S. Pat. No. 7,087,411 (also referred to herein as a VEGF-inhibiting fusion protein), anti-VEGF antibody (e.g., bevacizumab), a small molecule kinase inhibitor of VEGF receptor (e.g., sunitinib, sorafenib or pazopanib)), a DLL4 antagonist (e.g., an anti-DLL4 antibody disclosed in US 2009/0142354 such as REGN421), an Ang2 antagonist (e.g., an anti-Ang2 antibody disclosed in US 2011/0027286 such as H1H685P), a FOLH1 antagonist (e.g., an anti-FOLH1 antibody), a STEAP1 or STEAP2 antagonist (e.g., an anti-STEAP1 antibody or an anti-STEAP2 antibody), a TMPRSS2 antagonist (e.g., an anti-TMPRSS2 antibody), a MSLN antagonist (e.g., an anti-MSLN antibody), a CA9 antagonist (e.g., an anti-CA9 antibody), a uroplakin antagonist (e.g., an anti-uroplakin [e.g., anti-UPK3A] antibody), a MUC16 antagonist (e.g., an anti-MUC16 antibody), a Tn antigen antagonist (e.g., an anti-Tn antibody), a CLEC12A antagonist (e.g., an anti-CLEC12A antibody), a TNFRSF17 antagonist (e.g., an anti-TNFRSF17 antibody), a LGRS antagonist (e.g., an anti-LGRS antibody), a monovalent CD20 antagonist (e.g., a monovalent anti-CD20 antibody such as rituximab), etc. Other agents that may be beneficially administered in combination with ADCs of the disclosure include, e.g., tamoxifen, aromatase inhibitors, and cytokine inhibitors, including small-molecule cytokine inhibitors and antibodies that bind to cytokines such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-8, IL-9, IL-11, IL-12, IL-13, IL-17, IL-18, or to their respective receptors.
[0162] The present disclosure includes compositions and therapeutic formulations comprising any of the ADCs described herein in combination with one or more chemotherapeutic agents. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide (Cytoxan?); alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, calicheamicin, carabicin, carminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin, epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK?; razoxane; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); cyclophosphamide; thiotepa; taxanes, e.g., paclitaxel (Taxol?, Bristol-Myers Squibb Oncology, Princeton, N.J.) and docetaxel (Taxotere?; Aventis Antony, France); chlorambucil; gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitomycin C; mitoxantrone; vincristine; vinorelbine; navelbine; novantrone; teniposide; daunomycin; aminopterin; xeloda; ibandronate; CPT-11; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoic acid; esperamicins; capecitabine; and pharmaceutically acceptable salts, acids or derivatives of any of the above. Also included in this definition are anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens including for example tamoxifen, raloxifene, aromatase inhibiting 4(5)-imidazoles, 4-hydroxytamoxifen, trioxifene, keoxifene, LY 117018, onapristone, and toremifene (Fareston); and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
[0163] The ADCs of the disclosure may also be administered and/or co-formulated in combination with antivirals, antibiotics, analgesics, corticosteroids, steroids, oxygen, antioxidants, COX inhibitors, cardioprotectants, metal chelators, IFN-gamma, and/or NSAIDs.
[0164] The additional therapeutically active component(s), e.g., any of the agents listed above or derivatives thereof, may be administered just prior to, concurrent with, or shortly after the administration of an ADC of the present disclosure; (for purposes of the present disclosure, such administration regimens are considered the administration of an ADC comprising an anti-PTCRA antibody or antigen-binding fragment thereof in combination with an additional therapeutically active component). The present disclosure includes pharmaceutical compositions in which an ADC of the disclosure is co-formulated with one or more of the additional therapeutically active component(s) as described elsewhere herein.
Administration Regimens
[0165] According to certain embodiments of the present disclosure, multiple doses of an antibody-drug conjugate (ADC) comprising an anti-PTCRA antibody or antigen-binding fragment thereof (or a pharmaceutical composition comprising such an ADC) may be administered to a subject over a defined time course. The methods according to this aspect of the disclosure comprise sequentially administering to a subject multiple doses of an ADC or composition of the disclosure. As used herein, sequentially administering means that each dose of ADC or composition is administered to the subject at a different point in time, e.g., on different days separated by a predetermined interval (e.g., hours, days, weeks or months). The present disclosure includes methods that comprise sequentially administering to the patient a single initial dose of an ADC or composition, followed by one or more secondary doses of the ADC or composition, and optionally followed by one or more tertiary doses of the ADC or composition.
[0166] The terms initial dose, secondary doses, and tertiary doses, refer to the temporal sequence of administration of the ADC or composition of the disclosure. Thus, the initial dose is the dose that is administered at the beginning of the treatment regimen (also referred to as the baseline dose); the secondary doses are the doses that are administered after the initial dose; and the tertiary doses are the doses that are administered after the secondary doses. The initial, secondary, and tertiary doses may all contain the same amount of ADC or composition, but generally may differ from one another in terms of frequency of administration. In certain embodiments, however, the amount of ADC or composition contained in the initial, secondary and/or tertiary doses varies from one another (e.g., adjusted up or down as appropriate) during the course of treatment. In certain embodiments, two or more (e.g., 2, 3, 4, or 5) doses are administered at the beginning of the treatment regimen as loading doses followed by subsequent doses that are administered on a less frequent basis (e.g., maintenance doses).
[0167] In certain exemplary embodiments of the present disclosure, each secondary and/or tertiary dose is administered 1 to 26 (e.g., 1, 1?, 2, 2?, 3, 3?, 4, 4?, 5, 5?, 6, 6?, 7, 7?, 8, 8?, 9, 9?, 10, 10?, 11, 11?, 12, 12?, 13, 13?, 14, 14?, 15, 15?, 16, 16?, 17, 17?, 18, 18?, 19, 19?, 20, 20?, 21, 21?, 22, 22?, 23, 23?, 24, 24?, 25, 25?, 26, 26?, or more) weeks after the immediately preceding dose. The phrase the immediately preceding dose, as used herein, means, in a sequence of multiple administrations, the dose of ADC or composition that is administered to a patient prior to the administration of the very next dose in the sequence with no intervening doses.
[0168] The methods according to this aspect of the disclosure may comprise administering to a patient any number of secondary and/or tertiary doses of an ADC comprising an anti-PTCRA antibody or antigen-binding fragment thereof or a composition comprising such an ADC. For example, in certain embodiments, only a single secondary dose is administered to the patient. In other embodiments, two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) secondary doses are administered to the patient. Likewise, in certain embodiments, only a single tertiary dose is administered to the patient. In other embodiments, two or more (e.g., 2, 3, 4, 5, 6, 7, 8, or more) tertiary doses are administered to the patient. The administration regimen may be carried out indefinitely over the lifetime of a particular subject, or until such treatment is no longer therapeutically needed or advantageous.
[0169] In embodiments involving multiple secondary doses, each secondary dose may be administered at the same frequency as the other secondary doses. For example, each secondary dose may be administered to the patient 1 to 2 weeks or 1 to 2 months after the immediately preceding dose. Similarly, in embodiments involving multiple tertiary doses, each tertiary dose may be administered at the same frequency as the other tertiary doses. For example, each tertiary dose may be administered to the patient 2 to 12 weeks after the immediately preceding dose. In certain embodiments of the disclosure, the frequency at which the secondary and/or tertiary doses are administered to a patient can vary over the course of the treatment regimen. The frequency of administration may also be adjusted during the course of treatment by a physician depending on the needs of the individual patient following clinical examination.
[0170] The present disclosure includes administration regimens in which 2 to 6 loading doses are administered to a patient at a first frequency (e.g., once a week, once every two weeks, once every three weeks, once a month, once every two months, etc.), followed by administration of two or more maintenance doses to the patient on a less frequent basis. For example, according to this aspect of the disclosure, if the loading doses are administered at a frequency of once a month, then the maintenance doses may be administered to the patient once every six weeks, once every two months, once every three months, etc.
EXAMPLES
[0171] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the methods and compositions of the disclosure, and are not intended to limit the scope of what the inventors regard as their disclosure. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
Materials and Methods Employed in the Examples Are the Following
Thymus Transplantation Surgeries and Recipient Analysis
[0172] Single thymic lobes from newborn donor mice were surgically engrafted at the poles of the left kidney of host mice as previously described. Briefly, a small incision was made in the peritoneal cavity of the anesthetized host animal, exposing the left kidney. Using microdissection forceps and a stereo microscope, a single thymic lobe from the donor animal was positioned under the kidney capsule. The wound was then closed using surgical sutures and staples; the mice were routinely monitored for health status. All mouse experiments were performed with the approval of the Institutional Animal Care and Research Advisory Committee at Regeneron Pharmaceuticals.
Mice
[0173] Six- to eight-week-old Rag2.sup.?/? ?c.sup.?/? BALB/c (BRG) mice were purchased from Taconic and used as recipient hosts in thymic transplant experiments. Donor thymic lobes were isolated from C57BL6/6NTac mice purchased from Taconic or from Ptcra.sup.?/? or Notch3.sup.?/? mice generated at Regeneron using Velocigene? Technology.
Flow Cytometry Analysis
[0174] Tissues were harvested, and single cell suspensions were prepared in PBS with 3% fetal bovine serum. Antibody staining and FACS analysis was performed following standard protocols. The following monoclonal antibodies (mAbs) from Biolegend or BD Biosciences were used: anti-mCD45 (30-F11), anti-mCD4 (RM4-5), anti-mCD8a (53-6.7), anti-mCD44 (IM7), anti-mCD25 (PC61), anti-mPTCRA (2F5), anti-mNOTCH1 (mN1A and HMN1-12) and anti-mNOTCH3 (HMN3-133). Antibodies were directly coupled to FITC, PE, PerCPCy5.5, PECy7, APC, APC-Alexa Fluor 700, and Pacific blue. Data were acquired on BD Fortessa and analyzed by FlowJo.
Exome-Sequencing and Data Analysis
[0175] Whole exome capture was performed by using the Agilent Sure-Select Mouse All Exon 50 Mb kit, followed by 100 bp paired-end sequencing on the Illumina HiSeq 2000 platform. Read alignment and processing were performed using OSA aligner embedded in ArrayStudio. On average, around 80 million reads were generated for each sample, and over 65% are mapped on targets, which gives 80% of targets with more 20? read coverage depth. Mutation (including small insertion and deletion) calling cutoffs used were: at least 10% variant allele frequency and at least 5 variant reads from both strands. Complete details of the pipeline can be found online at www.arrayserver.com/wiki/. Somatic copy number variation patterns were estimated at the arm-level with whole exome sequencing (WES) data. Given DNA reads alignment input (BAM files) for a tumor sample and matched normal, the VarScan2 function embedded in ArrayStudio (www.omicsoft.com; www.arrayserver.com) was utilized to calculate read coverage depth ratio (log 2Ratio) and summarize the copy number status. The average log 2Ratio values for every 100 kb sliding window per chromosome were displayed with Segment Chromosome View in ArrayStudio. One normal sample from DKO spleen served as control for all tumors generated on DKO strain background.
Cell Lines and Growth Conditions
[0176] SupT1, HPB-ALL, and Jurkat are human T-ALL cell lines obtained from ATCC and DSMZ. Cells were cultured in a base RPMI-1640 media, formulated per the recommendations of the supplier. Cells were seeded at a density of 3?105 cells/mL and passaged regularly to maintain a density of less than 2?106 cells/mL. For CRISPR experiments, the cell lines were stably transduced with Cas9 using Cas9-expressing lentivirus (Sigma-Aldrich). The cells were then transduced with either control or PTCRA-targeting gRNAs (Sigma-Aldrich). Transduction was performed following the manufacturer's suggested protocol. Knockout was confirmed by Western blot.
RNA-Sequencing and Data Analysis
[0177] Total RNA was converted to mRNA libraries using KAPA Stranded mRNA-Seq kits from KAPA Biosystems following the manufacturer's protocols. Libraries were sequenced by 100 bp paired-end reads on the Illumina HiSeq 2000. Read mapping, gene expression quantitation, and identification of fusion transcripts are calculated in ArrayStudio software. 75 million reads were generated for each sample with a unique mapping rate of 85% on average.
Analysis of Public Datasets
[0178] Expression of PTCRA in human T-ALL was examined in two independent datasets, for which RNA expression data is publicly available. The first dataset, the St. Jude Pediatric Cancer hematopoietic malignancies dataset, is a genomic database comprised of RNA-sequencing of tumor cells and other molecular phenotypes from 2,224 pediatric and young adult patient samples from B-ALL, AML, T-ALL and MLL indications. The samples are derived from the St. JudeWashU Pediatric Cancer Genome Project, the Therapeutically Applicable Research to Generate Effective Treatments (TARGET) project and the Shanghai Children's Medical Center pediatric ALL project. It is part of an effort to apply a comprehensive genomic approach to determine molecular changes that drive childhood cancers. The data is accessed at: www.stjude.cloud/data.html. RNA-seq data from this dataset was processed through Omicsoft Array Studio Land data analysis pipeline, aligned with OSA (Omicsoft Aligner) to Human Genome Build B38 with Ensembl gene model, and then derived counts based with EM algorithm based on RSEM. Counts were converted to RPKM (Reads per Kilobase of transcript per Million mapped reads). Both gene-level and exon junction quantification were generated. Classification of T-ALL samples by subtype is per the hierarchal clustering of RNA-seq gene expression data, genomic alterations and expression of transcription factors described by Liu, et al. (2017 Nat Genet 49:1211-1218).
[0179] The second publicly available dataset used to examine the specificity of PTCRA expression in human T-ALL was an exploratory, retrospective stage I study which examined the whole-genome expression profiles of 2,096 patients pediatric and adult patients with leukemias and lymphomas by microarray analysis (Haferlach, et al. 2010 J Clin Oncol 28:2529-2537). Expression was quantified on a Human Genome U133 Plus 2.0 Array, measuring the expression of 19,574 genes across 54,675 reporters. Expression data for PTCRA (Reporter IS: 211252_x_at) was downloaded from Oncomine and processed and analyzed in Prism 7.
[0180] Expression of PTCRA in human cell lines was obtained from the Cancer Cell Line Encyclopedia, accessed at: portals.broadinstitute.org/ccle. The dataset is comprised of RNA-sequencing data for 1,457 cell lines across multiple tumor types. The sequencing was performed by the Broad Institute for the Cancer Cell Line Encyclopedia. Expression data for PTCRA across all cell liens in the data set was downloaded from CCLE and processed and analyzed in Prism 7.
Analysis of Patient Samples
[0181] Bone marrow and peripheral blood samples were prospectively collected from patients with acute leukemias through a contract research organization. All samples were obtained with the written, informed consent of each patient in accordance with the regulatory requirements set forth in the Good Clinical Practice guidelines of the International Council for Harmonization.
Example 1. Upregulation of 13-Selection Checkpoint Factors in a Spontaneous T-ALL Model
[0182] Murine T-ALL was generated by transplanting single thymic lobes derived from newborn wild type mice under the kidney capsule of immunodeficient, adult Rag2.sup.?/?IL2R?c.sup.?/? hosts. Mice developed tumors with high penetrance and a median time to neoplastic disease of approximately 25 weeks, consistent with published results (Martins, et al. 2014 Nature 509:465-470). Leukemic disease generated with this model broadly recapitulated key features of human T-ALL, including splenomegaly, infiltration of blast cells into the bone marrow and a high frequency of gain-of-function Notch1 mutations (Therapeutic targeting of Notch signaling and immune checkpoint blockade in a spontaneous, genetically-heterogeneous mouse model of T-cell acute lymphoblastic leukemia, Gao, et al., 2019 Disease Models and Mechanisms). Transcriptomes of these spontaneous tumors were analyzed by RNA-sequencing, comparing T-ALL tumors-infiltrated spleen to spleens of non-tumor bearing mice. Strong differential expression of multiple markers of thymocyte development was observed, including Dntt, Ragl and Rag2 in T-ALL cases compared to control splenic tissue or purified peripheral CD4+ and CD8+ T cells (
Example 2. Arrested Thymocyte Development in Ptcra KO Mice
[0183] Notch1 is a canonical T-ALL oncogene (Grabher, et al. 2006 Nat Rev Cancer 6:347-359); transgenic mouse models have also suggested a role for Ptcra and Notch3 in T-ALL (Bellavia, et al. 2002 PNAS 99:3788-3793; Bellavia, et al. 2000 EMBO J 19:3337-3348; dos Santos, et al. 2007 Blood 109:3972-3981). To elucidate whether these latter genes contribute to leukemogenesis in a more physiologically relevant model, Ptcra.sup.?/? and Notch3.sup.?/? gene-targeted mice were created, and thymic lobes from these animals were used in transplantation studies. Ptcra.sup.?/? and Notch3.sup.?/? mice were generated by inserting a ?-galactosidase gene in frame into the first coding exon of each gene. Neonatal Ptcra.sup.?/? mice developed thymic hypoplasia (
Example 3. Genetic Ablation of Ptcra Results in Markedly Impaired T-ALL Development
[0184] To assess the effects of loss of pre-T cell receptor signaling on leukemogenesis, thymi from newborn Ptcra.sup.?/? mice were transplanted. To account for the reduced thymic cellularity in Ptcra.sup.?/? neonates, two lobes were used in each transplant. Ptcra.sup.?/? thymi grafted efficiently in Rag2.sup.?/? IL2R?.sup.?/? hosts, as assessed by longitudinal monitoring of peripheral T cell levels (
[0185] The Ptcra.sup.?/? leukemic disease that occasionally did develop was immunophenotypically comparable to wild type tumors and exhibited a similar, but slightly less pronounced nature of acute onset (
TABLE-US-00003 TABLE 1 No. of Notch1 5 Notch1 PEST Additional mutated Sample ID mutations truncation mutation genes of interest Ptcra KO 1 12 + Fat1, Ddx3x Ptcra KO 2 16 + + Ikzf1 Ptcra KO 3 12 + Fat1, Ptpn11 Ptcra KO 4 40 + Ptcra KO 5 3 + Rit1 Ptcra KO 6 7
Additionally, a series of recurrent, but infrequently reported, mutations relevant to T-ALL was observed, including: Fat1, Ddx3x, Ptpn11 and Ikzf1 (Table 1) (Liu, et al. 2017 Nat Genet 49:1211-1218; Molteni, et al. 2010 Leukemia 24:232-235). Gene expression profiling of Ptcra-deficient tumors revealed 60 differentially expressed genes, relative to wild type T-ALL tumors. This gene expression signature was notable for strong down-regulation of genes implicated in the DN to DP transition and upregulation of multiple genes enriched in early T cell progenitor-like (ETP) ALL (Zhang, et al. 2012 Nature 481:157-163), including Ppbp, Cd93, Lyl1, Dhrs and Pim1, and early stages of thymocyte development, such as Ikzf2 and Id3, indicating a an earlier developmental phenotype for Ptcra-deficient tumors (
[0186] NOTCH3 mutations have been reported in the literature for human T-ALL (Martins, et al. 2014 Nature 509:465-470), and NOTCH3 is overexpressed in a large fraction of human T-ALL cases (
[0187] Thus, Ptcra deficiency resulted in a markedly reduced capacity to induce leukemogenesis, significantly decreased overall disease penetrance, and median time to neoplastic disease not reached during the course of the study.
Example 4. PTCRA Expression in Human T-ALL
[0188] Indicative of a possible role for pre-TCR signaling in human T-ALL, PTCRA was expressed in most human T-ALL cell lines, but not in cell lines representing other classes of leukemia or any other non-leukemic cancer cell lines within the Cancer Cell Line Encyclopedia (CCLE) (
[0189] In line with the characteristics of the murine T-ALL model, PTCRA is expressed at lower levels in ETP and ETP-like (LMO2/LYL1) human T-ALL samples (
Example 5. Deletion of PTCRA in T-ALL Cell Lines via CRISPR/Cas9 Impairs Tumor Growth In Vitro and In Vivo
[0190] To assess the function of the pre-TCR in human T-ALL, SupT1, HPB-ALL, and Jurkat cell lines stably expressing Cas9 were generated and transduced with either PTCRA-targeting or control gRNAs. Successful targeting of PTCRA and reduction of protein expression in these cell lines was confirmed by Western blot analysis (
[0191] The observation that PTCRA is required for proliferation in a subset of human T-ALL cell lines indicates that signaling through the pre-TCR is able to drive proliferation in these cells. Thymocyte pre-TCR signaling is mediated by SRC-family protein tyrosine kinases, with a pivotal role for lymphocyte-specific protein tyrosine kinase, LCK (Lin, et al. 2000 J Exp Med 191:703-716). Without being bound to a particular theory, but consistent with the idea that signaling, per se, through the pre-TCR is required for proliferation in PTCRA-dependent T-ALL cell lines, treating these cell lines with the SRC-family kinase inhibitor, PP1, induced a dose-dependent anti-proliferative response (
Example 6. Internalization Kinetics of the Pre-TCR
[0192] In certain embodiments, the ADC target is cell surface-expressed and gets internalized with the payload upon binding. As a result, there is less risk of bystander effect.
[0193] SupT1 cells, which endogenously express PTCRA, were stained with anti-PTCRA antibody at 4? C. for thirty minutes, whereupon the cells were temperature shifted to 37? C. and stained with a secondary antibody at the indicated time post-temperature shift. The cells were then fixed, and immunofluorescent confocal microscopy was used to visualize PTCRA localization. PTCRA was detected at the cell surface of SupT1 cells at 0 minutes, but rapidly and robustly internalizes over the time course being examined (
Example 7. Targeting PTCRA With Cytotoxic Antibody-Drug Conjugates Promotes Specific Killing of T-ALL Cells In Vitro and In Vivo
[0194] Given the selective expression of PTCRA in leukemic cells but not normal, mature T cells, and its rapid, constitutive internalization, it was reasoned that targeting the pre-TCR with a cytotoxic antibody-drug conjugate may represent a viable therapeutic strategy in T-ALL. To this end, primary PTCRA+ murine T-ALL (mTALL) cells, generated via thymic transplantation as described, were treated with either a PTCRA-targeting mouse mAb or an isotype control mAb, followed by treatment with anti-mouse IgG-Fc linked to the microtubule inhibitor monomethyl auristatin E (MMAE) via a non-cleavable linker. Robust killing of mTALL cells treated with PTCRA-targeting mAb was observed, but no killing in control-treated cells (
[0195] Since the PTCRA mAb clone used herein also binds to human PTCRA (
[0196] The biology of T-ALL is strongly influenced by its developmental origins. For example, mutations in NOTCH1, a critical regulator of thymocyte development, are found in approximately 60% of patient tumors. Less is known, however, about the extent to which other determinants of thymocyte development participate in the leukemogenesis of T-ALL. Thus, to elucidate a role for thymocyte development factors beyond Notch1 in the pathogenesis of T-ALL, a thymic transplantation-based model was used that spontaneously gives rise to genetically distinct T-ALL cases and recapitulates many of the key genetic and histopathologic features of the human disease (Martins, et al. 2014 Nature 509:465-470). RNA sequencing of tumors derived from this model revealed a strong upregulation of factors associated with progression through the ?-selection checkpoint, a key step in thymocyte development that selects against thymocytes that have unsuccessfully rearranged the TCR? locus. Thymocytes that successfully complete the DN3 to DN4 transition by passing this checkpoint initiate a rapid bout of proliferation and survival signaling. The ?-selection checkpoint is a key step in thymocyte development. It was hypothesized that upregulation of factors required for crossing the ?-selection checkpoint may contribute to leukemogenesis in this model. The role of the key DN3 to DN4 transition factor, the pre-TCR, in the leukemogenesis of T-ALL was validated using Ptcra KO thymic transplants, and a marked reduction in the efficiency of leukemogenesis was observed in this system. Further, it was demonstrated that human T-ALLs frequently express high levels of PTCRA and a subset of human T-ALL cell lines are sensitive to deletion of PTCRA or chemical inhibition of the SRC-family kinases that mediate pre-TCR signaling.
[0197] These results support the paradigm that the developmental biology of T-cell precursors informs the leukemogenesis and clinical course of T-ALL. This is best characterized by the pivotal role of oncogenic NOTCH1 signaling in T-ALL.
[0198] Several reports have described a possible role for the pre-TCR in the pathogenesis of T-ALL, suggesting that it cooperates with other leukemogenic genomic alterations including TEL-JAK2 fusions (dos Santos, et al. 2007 Blood 109:3972-3981), activating NOTCH mutations (Bellavia, et al. 2002 PNAS USA 99:3788-3793), and Ikaros deficiency (Winandy, et al. 1999 J Exp Med 190:1039-1048). This is the first report to describe a critical role for pre-TCR signaling in the leukemogenesis of T-ALL beyond the context of specific, genetically engineered driver mutations and is the first report to demonstrate a requirement for pre-TCR signaling in human T-ALL cell lines.
[0199] The pre-TCR regulates the proliferative burst that accompanies the DN3 to DN4 transition and helps cells avoid death by ?-selection (von Boehmer 2005 Nat Rev Immunol 5:571-577). The inability of Ptcra KO thymi to efficiently generate leukemias in the model described herein could be explained by signaling through the pre-TCR being required for the leukemogenesis of T-ALL, i.e., the signaling is actively contributing to the pathogenesis of T-ALL. First, Ptcra KO thymi do contain ??-lineage thymocytes and are able to support the generation of mature T-cells, indicating that progression beyond the DN3 phase is possible in the absence of Ptcra. Further, increasing the number of Ptcra thymic lobes transplanted did not increase the efficiency of leukemogenesis, suggesting that DN4 or beyond thymocytes were not a limiting factor for transformation. Finally, the observation that knocking out PTCRA in established human T-ALL cell lines resulted in a cell proliferation defect strongly points to signaling through the pre-TCR as important in the context of T-ALL.
[0200] The fact that PTCRA is a thymocyte-restricted Notch1 target implies that targeting PTCRA may afford a more favorable therapeutic window relative to the inhibition of Notch1, which results in gastrointestinal toxicity due to Notch1 function in intestinal progenitor cells (Takebe, et al. 2014 Pharmacol Ther 141:140-149; Wei, et al. 2010 Mol Cancer Ther 9:1618-1628). Additionally, the elevated expression of PTCRA in leukemic T cells but the absence thereof in normal adult T cells, consistent with its development functions, allows for selective targeting of T-ALL without affecting the normal T cell compartment. Importantly, impairment of normal T cell immunity has been a major impediment to the development of next-generation therapies targeting T cell-derived malignancies (Martin, et al. 2006 Clin Infect Dis 43:16-24).
[0201] Not all genetically engineered mouse models of T-ALL exhibit a requirement for pre-TCR signaling, including Trp53 or ATM deficient mice (Liao, et al. 1998 Mol Cell Biol 18:3495-3901; Petiniot, et al. 2000 PNAS USA. In these cases, it appears that malignancy is initiated before thymocytes begin to express the pre-TCR at DN3. Without being bound to a particular theory, this is consistent with human literature, as well, where the pre-TCR is upregulated in more than half of T-ALL cases, particularly those of cortical descent. It was additionally observed that PTCRA is expressed at low levels in ETP-ALL. Data for differential expression of PTCRA across cohorts in the St Jude's Pediatric Cancer dataset (
[0202] Cumulatively, an important role for pre-TCR signaling in the pathogenesis of T-ALL is highlighted herein. Given the dearth of targeted therapies for the disease, the pre-TCR may be a viable therapeutic target in this indication.
[0203] Using a thymus transplantation-based, spontaneous mouse model of T-ALL, it was found that multiple ?-selection checkpoint factors were upregulated in leukemic T cells, including Ptcra, a subunit of the pre-T cell receptor (pre-TCR) complex. Genetic ablation of Ptcra in the mouse model dramatically reduced the occurrence of T-ALL. In human T-ALL cell lines, CRISPR/Cas9 knockout of PTCRA reduced in vitro proliferative capacity and the ability to form tumors in vivo. Analysis of clinical T-ALL datasets and patient samples demonstrated that PTCRA is highly and specifically expressed in leukemic T cells but not in normal, mature T cells, supporting an appropriate therapeutic window for targeted (PTCRA-directed) therapy in T-ALL. Cumulatively, the Examples highlight an important role for pre-TCR signaling in driving and sustaining T-ALL.
Example 8. Synthesis of Additional Linker Payloads
[0204] Proton NMR spectra were acquired on a Varian Inova 300 or 500 MHz NMR instrument. Chromatographic purities were determined on an Agilent 1200 Series or 1100 Series LC/MS system with electrospray ionization source and triple-quad ion trap analyzer using a Merck Chromolith RP-18e analytical HPLC column (monolithic, 50?2 mm) and the following analytical HPLC method: injection volume 5 ?L; flow rate 1 mL/min; 5.fwdarw.95% acetonitrile in water with 0.05% AcOH over 5 mins; Agilent diode array detector at ?=254, 220 or 195 nm; room temperature. All starting materials and solvents were purchased commercially and used without purification, unless otherwise noted.
[0205] Linker payload 10 was synthesized from Compound 1 as described below.
##STR00024## ##STR00025##
Maytansin-N-methyl-L-alanine-3-methoxylbenzamide-4-amino-benzamidocarbamate-Ala-Val-Cap-NH2 (10)
Synthesis of Allyl 4-amino-3-methoxy benzoate (3)
[0206] Step 1: 3-Methoxy-4-nitrobenzoic acid 1 (500 mg, 2.53 mmol) was dissolved in 3.0 mL anhydrous DMF, at room temperature, under Argon atmosphere. Cs.sub.2CO.sub.3 (1.66 g, 5.10 mmol) and allyl bromide (330 ?L, 3.80 mmol) were added sequentially. The resulting mixture was left to stir at room temperature for 3 hours. The reaction mixture was then partitioned between water (10 mL) and DCM (10 mL); the layers were then separated; the organic layer was dried over Na.sub.2SO.sub.4, filtered, and evaporated under vacuum. The residue was dissolved in 1 mL of DMF and loaded on a 24 g silica gel column. Eluent: EtOAc and hexane (0% to 100% EtOAc over 25 min). The fractions containing product were combined and evaporated under vacuum. The product was obtained as a white solid (500 mg, 83% yield). MS (ESI, pos.): calc'd (calculated) for C.sub.11H.sub.12NO.sub.5, 238.1; found (M+H) 238.1.
[0207] Step 2: Compound 2 (142 mg, 0.60 mmol) was dissolved in 7 mL CH.sub.3CN/H.sub.2O 4:3. AcOH (1.30 mL, 24.0 mmol) and Zn dust (783 mg, 12.0 mmol) were added sequentially. The resulting mixture was left to stir at room temperature for 2 hours, when the reaction was determined to be complete by LC/MS. The reaction mixture was filtered through celite and partially evaporated under vacuum. The reaction mixture was then partitioned between water (10 mL) and DCM (10 mL); the layers were then separated. The organic layer was washed with sat. (aq) NaHCO.sub.3 (1?10 mL), then dried over Na.sub.2SO.sub.4, filtered, evaporated under vacuum. The crude product was obtained as a dark yellow oil (120 mg, 97% yield). It was used in the next step without purification. MS (ESI, pos.): calc'd for C.sub.11H.sub.14NO.sub.3 208.1 (M+H); found 208.1; MS (ESI, neg.) calc'd for C.sub.11H.sub.14NO.sub.3 206.1 (M-H); found 206.1.
Synthesis of Compound 5:
[0208] Compound 3 (250 mg, 1.21 mmol) was dissolved in 8.0 mL DCM, at room temperature, under an Argon atmosphere. The solution was cooled to 0? C. and Et.sub.3N (504 ?L, 3.62 mmol) and triphosgene (717 mg, 1.21 mmol) were added sequentially. The resulting mixture was left to stir at 0? C. for 30 min and at room temperature for 2 hours. The solvent was evaporated under vacuum. The residue was dried under vacuum for 1 hour. A solution of FmocValAlaPAB alcohol (622 mg, 1.21 mmol) in anhydrous DMF (1.0 mL) was added dropwise. The mixture was heated at 70? C. for 1 hour. The mixture was left to cool to room temperature. It was then loaded directly onto a 100 g C.sub.18 Aq Isco column. Eluent: CH.sub.3CN and H.sub.2O (0.05% AcOH in both) eluted with 10% to 90% CH.sub.3CN over 30 min. The fractions containing product were combined, partially evaporated under vacuum, frozen, lyophilized. The product was obtained as a white solid (180 mg, 20% yield). MS (ESI, pos.): calc'd for C.sub.42H.sub.44N.sub.4O.sub.9Na 771.3 (M+Na); found 771.2.
Synthesis of Compound 6:
[0209] Compound 5 (114 mg, 0.15 mmol) was dissolved in 2 mL anhydrous THF, at room temperature, under an Argon atmosphere. Morpholine (27.0 pL, 0.30 mmol) and Pd(PPh.sub.3)4 (176 mg, 0.15 mmol) were added sequentially. The resulting mixture was left to stir at room temperature for 2 hours, when the reaction was determined to be complete by LC/MS. The solvent was evaporated under vacuum. The residue was dissolved in 1 mL DMF and loaded onto a 30 g C.sub.18 Aq Isco column. Eluent: CH.sub.3CN and H.sub.2O (0.05% AcOH in both) 0% to 70% CH.sub.3CN over 30 min. The fractions containing product were combined, partially evaporated under vacuum, frozen, lyophilized. The product was obtained as a white solid (5.0 mg, 33% yield). MS (ESI, pos.): calc'd for C.sub.39H.sub.40N.sub.4O.sub.9Na, 731.3; found (M+Na) 731.3. MS (ESI, neg.) calc'd C.sub.39H.sub.39N.sub.4O.sub.9 707.3; found (M?H) 707.3.
Synthesis of Compound 7:
[0210] Compound 6 (50.0 mg, 0.07 mmol) was dissolved in 1.5 mL anhydrous DMF, at room temperature, under Argon atmosphere. Piperidine (27.0 ?L, 0.28 mmol) was added. The resulting mixture was left to stir at room temperature for 1 hour, when the reaction was determined to be complete by LC/MS. The solution was loaded directly onto a 30 g C.sub.18 Aq Isco column. Eluent: CH.sub.3CN and H.sub.2O (0.05% AcOH in both) 0% to 40% CH.sub.3CN over 25 min. The fractions containing product were combined, partially evaporated under vacuum, frozen, and lyophilized. The product was obtained as a white solid (25 mg, 73% yield). MS (ESI, pos.): calc'd for C.sub.24H.sub.31N.sub.4O.sub.7, 487.2; found (M+H), 487.2. MS (ESI, neg.) calc'd for C.sub.24H.sub.29N.sub.4O.sub.7, 485.2; found (M?H) 485.2.
Synthesis of Compound 8:
[0211] Compound 7 (22.0 mg, 0.04 mmol) was dissolved in 1.0 mL anhydrous DMF, at room temperature, under Argon atmosphere. FmocNHCapOSu (22.0 mg, 0.05 mmol) and DIPEA (15.0 ?L, 0.09 mmol) were added. The resulting mixture was left to stir at room temperature overnight. The solution was loaded directly onto a 50 g C.sub.18 Aq Isco column. Eluent: CH.sub.3CN and H.sub.2O (0% to 70% CH.sub.3CN over 25 min). The fractions containing product were combined, partially evaporated under vacuum, frozen, and lyophilized. The product was obtained as a white solid (27 mg, 73% yield). MS (ESI, pos.): calc'd for C.sub.45H.sub.51N.sub.5O.sub.10Na, 844.4; found (M+Na) 844.3. MS (ESI, neg.) calc'd for C.sub.45H.sub.50N.sub.5O.sub.10, 820.4; found (M?H) 820.3.
Synthesis of Compound 9:
[0212] Compound 8 (40.0 mg, 0.05 mmol) was dissolved in 1.5 mL anhydrous DMF, at room temperature, under Argon atmosphere. Maytan-NMA (38.0 mg, 0.06 mmol), HATU (0.08 mmol) and NMM (11.0 ?L, 0.10 mmol) were added. The resulting mixture was left to stir at room temperature overnight. The solution was directly loaded onto a 30 g C.sub.18 Aq Isco column. Eluent: CH.sub.3CN and H.sub.2O (0.05% AcOH in both) 0% to 40% CH.sub.3CN over 25 min. The fractions containing product were combined, partially evaporated under vacuum, frozen, and lyophilized. The product was obtained as a white solid (46 mg, 65% yield). MS (ESI, pos.): calc'd for C.sub.77H.sub.94ClN.sub.8O.sub.18, 1453.6; found (M+H) 1453.8.
Synthesis of Compound 10:
[0213] Compound 9 (40 mg, 0.03 mmol) was dissolved in 1.5 mL anhydrous DMF at room temperature, under Argon atmosphere. Piperidine (8.0 ?L, 0.08 mmol) was added. The resulting mixture was left to stir at room temperature. After 20 minutes, the reaction was determined to be complete by LC/MS. The mixture was loaded onto a 30 g C.sub.18 Aq Isco column. Eluent: CH.sub.3CN and H.sub.2O (0.05% AcOH in both) 0% to 50% CH.sub.3CN over 25 min. The fractions containing product were combined, partially evaporated under vacuum, frozen, and lyophilized. The product was obtained as a white solid (20.0 mg, 59% yield). MS (ESI, pos.): calc'd for C.sub.62H.sub.84ClN.sub.8O.sub.16, 1231.6; found (M+H) 1231.7. MS (ESI, neg.): calc'd for C.sub.62H.sub.82ClN.sub.8O.sub.16, 1229.6; found (M?H) 1229.5. 1H NMR (500 MHz): ? 9.93 (bs, 1H), 8.69-8.68 (m, 1H), 8.15 (d, J=7.0 Hz, 1H), 7.81 (d, J=8.5 Hz, 1H), 7.70-7.68 (m, 1H), 7.59-7.58 (m, 2H), 7.33 (d, J=9.0 Hz, 2H), 7.22-7.21 (m, 1H), 6.93-6.86 (m, 4H), 6.65-6.56 (m, 2H), 5.96 (bs, 1H), 5.65-5.60 (m, 1H), 5.46-5.42 (m, 1H), 5.05 (s, 2H), 4.60-4.58 (m, 1H), 4.38-4.36 (m, 1H), 4.17-4.14 (m, 1H), 4.12-4.07 (m, 1H), 3.94 (s, 3H), 3.56-3.50 (m, 3H), 3.44 (d, J=13.0 Hz, 1H), 3.24-3.26 (m, 6H), 2.89 (bs, 3H), 2.81-2.79 (m, 1H), 2.73 (bs, 3H), 2.63-2.62 (m, 2H), 2.36-2.35 (m, 1H), 2.16-2.11 (m, 3H), 1.98-1.94 (m, 1H), 1.72-1.71 (m, 1H), 1.61 (bs, 3H), 1.49-1.45 (m, 4H), 1.34-1.12 (m, 11H), 1.13 (d, J=6.0 Hz, 3H), 0.87-0.82 (m, 9H).
[0214] Linker payload 14 was synthesized from Compound 6 as described below.
##STR00026##
Maytansin-N-methyl-L-alanine-3-methoxybenzamide-4-aminobenzamidocarbamate-Ala-Val-Peg8-Prop-Mal (14)
Synthesis of Compound 11:
[0215] To a solution of May-NMA, contaminated with DIEA, (190 mg, 0.292 mmol), in anhydrous DMF (1.6 mL), was added compound 6 (85.2 mg, 0.120 mmol), HATU (112 mg, 0.295 mmol) and NMM (65 ?L, 0.591 mmol). The resulting reaction mixture was purged with Argon and allowed to stir at ambient temperature. After 20 h, additional compound 6 (27 mg, 0.0381 mmol) in DMF (1 mL) was added and the mixture was allowed to stir for an additional 8 h, when the full consumption of compound 6 was observed by LC/MS. The solution was then diluted with DMSO and loaded directly onto C.sub.18 Aq Isco column (150 g). Eluent: CH.sub.3CN and H.sub.2O, each containing 0.05% of AcOH (5% to 95% CH.sub.3CN). The fractions containing product were combined and lyophilized to afford compound 11 as a white solid (43.3 mg, 20% yield, based on compound 6). MS (ESI, pos.): calc'd for C.sub.71H.sub.82ClN.sub.7O.sub.17Na, 1362; found (M+Na) 1362.
Synthesis of Compound 12:
[0216] Compound 11 (40.2 mg, 0.0300 mmol) was dissolved in 20% diethylamine in DMF (v/v) (1.0 mL, 1.93 mmol DEA), then the resulting reaction mixture was allowed to stir at ambient temperature. After 20 min, the reaction was determined to be complete by LC/MS. The solution was then diluted with DMSO and loaded directly onto C.sub.18 Aq Isco column (30 g). Eluent: CH.sub.3CN and H.sub.2O, each containing 0.05% of AcOH (0% to 100% CH.sub.3CN). The fractions containing product were combined and lyophilized to afford compound 12 as a white solid (22.6 mg, 67% yield). MS (ESI, pos.): calc'd for C.sub.56H.sub.73ClN.sub.7O.sub.15, 1118; found (M+H) 1118; MS (ESI, neg.): calc'd for C.sub.56H.sub.71ClN.sub.7O.sub.15, 1116; found (M?H) 1116.
Synthesis of Compound 14:
[0217] To compound 12 (11.6 mg, 0.0104 mmol) was added MalPeg8N HS ester 13 (14.3 mg, 0.0207 mmol) in anhydrous DMF (0.1 mL) followed by additional DMF (0.1 mL) and DIEA (5.5 ?L, 0.311 mmol). The resulting reaction mixture was purged with Argon and allowed to stir at ambient temperature. After 50 min, the reaction was determined to be complete by LC/MS. The solution was then diluted with DMSO and loaded directly onto C.sub.18 Aq Isco column (15.5 g). Eluent: CH.sub.3CN and H.sub.2O, each containing 0.05% of AcOH (20% to 100% CH.sub.3CN). The fractions containing product were combined and lyophilized to afford compound 14 as a white solid (6.0 mg, 34% yield). MS (ESI, pos.): calc'd for C.sub.82H.sub.114ClN.sub.9O.sub.27Na, 1714; found (M+H) 1714. 1H NMR (500 MHz; CDCl3): ? 8.72 (bs, 1H), 8.04 (dtd, J=5.3, 2.0, 0.9 Hz, 1H), 7.75 (dd, J=7.8, 0.6 Hz, 2H), 7.37-7.34 (m, 3H), 6.99-6.95 (m, 3H), 6.84 (s, 1H), 6.75-6.71 (m, 3H), 6.50-6.40 (m, 2H), 6.25 (s, 1H), 5.83-5.77 (m, 1H), 5.50-5.46 (m, 1H), 5.14 (s, 2H), 4.94-4.91 (m, 1H), 4.69-4.66 (m, 1H), 4.34-4.30 (m, 1H), 4.22 (t, J=6.0 Hz, 1H), 4.01 (s, 3H), 3.86 (t, J=7.2 Hz, 3H), 3.75 (s, 3H), 3.66-3.61 (m, 32H), 3.54-3.53 (m, 4H), 3.44-3.41 (m, 3H), 3.38 (s, 3H), 3.13-3.05 (m, 5H), 2.93 (s, 3H), 2.76-2.67 (m, 2H), 2.55-2.50 (m, 3H), 2.31-2.22 (m, 2H), 1.74-1.64 (m, 5H), 1.52-1.45 (m, 7H), 1.33-1.27 (m, 4H), 1.02 (dd, J=11.6, 6.8 Hz, 6H), 0.88 (s, 3H).
Example 9. Targeting PTCRA with Cytotoxic Antibody-Drug Conjugates Promotes Specific Killing of T-ALL Cells In Vitro and In Vivo
[0218] Given the anti-leukemic effects of the PTCRA-ADC described in Example 7, it was explored whether additional linker payload formats would also have anti-leukemic activity. To this end, the PTCRA-targeting mAb was conjugated to additional linker payload MAYT3LP (structure provided herein), thereby linking the PTCRA-targeting mAb to the potent microtubule inhibitor (MAYT3) via a non-cleavable linker. Toward this end, the PTCRA-targeting mAb was reacted with MAYT3LPINT. The resulting drug-antibody ratio (DAR) was ?3.5, and the compound is hereafter referred to as PTCRA-MAYT3LP. Additionally, the PTCRA-targeting mAb was conjugated to additional linker payload MAYT4LP (structure provided herein), thereby linking the PTCRA-targeting mAb to the potent microtubule inhibitor (MAYT4) via a cleavable linker. To this end, the PTCRA-targeting mAb was reacted with compound 14 described in Example 8. The resulting drug-antibody ratio (DAR) was ?3.5, and the compound is hereafter referred to as PTCRA-MAYT4LP. The ADCs PTCRA-MAYT3LP and PTCRA-MAYT4LP, but not the appropriate control-ADCs, promoted dose-dependent killing of human PTCRA+leukemic cells with an IC50 in the low nanomolar range (
[0219] The activity of PTCRA-MAYT3LP and PTCRA-MAYT4LP was tested on a panel of human leukemia cell lines. The PTCRA-ADC selectively induced killing of human SupT1 T-ALL cells, but did not impact viability of B-ALL (NALM6) and AML (K562) cell lines (
[0220] The in vitro efficacy of these molecules prompted the evaluation of their anti-leukemic activity in various in vivo models of T-ALL. To this end, NSG mice were injected subcutaneously (s.c.) with 5,000,000 PTCRA+SupT1 cells and randomized to treatment with either a single dose of PTCRA-MAYT4LP or the Control-MAYT4LP, once the tumors became palpable. Tumor burden was quantified longitudinally throughout the study by measuring the tumor volume of the implanted tumor. T-ALL-bearing mice treated with the PTCRA-MAYT4LP exhibited statistically significantly reduced tumor burden relative to Control-2921 treated mice (
[0221] Collectively, these results confirm that targeting the pre-TCR in T-ALL with a cytotoxic ADC represents a promising approach to specifically eradicate tumor cells while sparing normal T cells and to support the further development of PTCRA-targeting agents for clinical translation.
[0222] The present disclosure is not to be limited in scope by the specific embodiments described herein. Indeed, various modifications of the disclosure in addition to those described herein will become apparent to those skilled in the art from the foregoing description and the accompanying figures. Such modifications are intended to fall within the scope of the appended claims.