METHODS OF REGULATING ADENO-ASSOCIATED VIRUS PRODUCTION
20240101972 ยท 2024-03-28
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C12N2710/10322
CHEMISTRY; METALLURGY
C12N2750/14152
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2750/14122
CHEMISTRY; METALLURGY
C07K2319/95
CHEMISTRY; METALLURGY
International classification
Abstract
The presently disclosed subject matter relates to compositions and methods for regulating recombinant adeno-associated virus (rAAV) production in cell culture. In particular, the presently disclosed subject matter relates to strategies to overcome AAV Rep protein-mediated cytotoxicity by reversible post-translational regulation of the expression of AAV Rep and helper proteins, resulting in regulated rAAV production.
Claims
1. A method of regulating the production of recombinant adeno-associated virus (rAAV) vector particles, the method comprising: a) introducing into a cell: a. an rAAV comprising a gene of interest; and b. a nucleic acid encoding a fusion protein, wherein the fusion protein comprises an AAV protein, and a degradation ligand-dependent degradation domain, b) culturing the cell under conditions suitable for producing the rAAV vector particles; and c) contacting the cell with a degradation ligand, wherein the degradation ligand binds to the degradation domain to regulate the expression of the AAV protein and thereby regulate the production of rAAV vector particles.
2. The method of claim 1, wherein the nucleic acid encodes a fusion protein, wherein the fusion protein comprises the AAV protein, a linker, and a degradation ligand-dependent degradation domain.
3. The method of claim 1 or 2, wherein the AAV protein is Cap.
4. The method of claim 1 or 2, wherein the AAV protein is a Helper protein.
5. The method of claim 4, wherein the Helper protein is E2.
6. The method of claim 1 or 2, wherein the AAV protein is Rep.
7. The method of claims 1-62, wherein the ligand-dependent degradation domain is derived from FKBP.
8. The method of claims 1-6, wherein the degradation ligand-dependent degradation domain is dihydrofolate reductase (DHFR).
9. The method of claims 1-6, wherein the degradation ligand-dependent degradation domain is an auxin induced degradation domain.
10. The method of any one of claims 1-9, wherein the degradation ligand is a small molecule ligand.
11. The method of claim 7, wherein the small molecule is Shield1.
12. The method of claim 8, wherein the small molecule is trimethoprim (TMP).
13. The method of claim 9, wherein the small molecule is auxin.
14. The method of any one of claims 1-13, wherein the cell is an E1a-expressing cell.
15. The method of claim 14, wherein the E1a-expressing cell is a HEK293 cell.
16. The method of any one of claims 6-15, wherein the Rep protein is Rep78, Rep68, Rep52, or Rep40 protein.
17. The method of any one of claims 6-16, wherein the degradation ligand-dependent degradation domain is fused to the C-terminal end of the Rep protein.
18. The method of any one of claims 6-16, wherein the degradation ligand-dependent degradation domain is fused to the N-terminal end of the Rep protein.
19. The method of claim 2, wherein the linker is a flexible linker.
20. The method of claim 2, wherein the linker is a rigid linker.
21. The method of any one of claims 1-20, comprising introducing into the cell a nucleic acid encoding a Cap protein.
22. The method of claim 21, wherein the nucleic acid encoding the fusion protein and the nucleic acid encoding a Cap protein, are introduced into the cell using at least one plasmid.
23. The method of claim 21, wherein the nucleic acid encoding the fusion protein and the nucleic acid encoding a Cap protein, are introduced into the cell using the same plasmid.
24. The method of claim 21, wherein the nucleic acid encoding the fusion protein and the nucleic acid encoding a Cap protein, are introduced into the cell using separate plasmids.
25. The method of any one of claims 1-24, wherein the rep, cap, or helper genes are under the control of a regulatory element.
26. The method of claim 25, wherein said regulatory element is a promoter.
27. The method of claim 25, wherein said regulatory element comprises a Tet response binding element.
28. The method of any one of claims 1-27, wherein the cell is a eukaryotic cell.
29. The method of claim 289, wherein the eukaryotic cell is an animal cell.
30. The method of claim 29, wherein the animal cell is a mammalian cell.
31. The method of claim 30, wherein the mammalian cell is a HEK cell.
32. The method of claim 30, wherein the mammalian cell is a Chinese Hamster Ovary cell.
33. A rAAV producing cell, wherein the cell comprises a nucleic acid encoding a fusion protein comprising an AAV protein, and a degradation ligand-dependent degradation domain.
34. The rAAV producing cell of claim 33, wherein the nucleic acid encoding a fusion protein comprising the AAV protein, a linker, and a degradation ligand-dependent degradation domain.
35. The rAAV producing cell of claim 33 or 34, wherein the AAV protein is selected from the group consisting of Rep, Cap, and Helper proteins.
36. The rAAV producing cell of claim 35, wherein the AAV protein is Cap.
37. The rAAV producing cell of claim 35, wherein the AAV protein is a Helper protein.
38. The rAAV producing cell of claim 35, wherein the AAV protein is Rep.
39. The rAAV producing cell of claims 33-38, wherein the degradation ligand is a small molecule ligand.
40. The rAAV producing cell of claims 33-39, wherein the degradation ligand-dependent degradation domain is derived from FKBP.
41. The rAAV producing cell of claims 33-39, wherein the degradation ligand-dependent degradation domain is dihydrofolate reductase (DHFR).
42. The rAAV producing cell of claims 33-39, wherein the degradation ligand-dependent degradation domain is an auxin induced degradation domain.
43. The rAAV producing cell of claim 40, wherein the small molecule is Shield1.
44. The rAAV producing cell of claim 41, wherein the small molecule is trimethoprim (TMP).
45. The rAAV producing cell of claim 42, wherein the small molecule is auxin.
46. The rAAV producing cell of any one of claims 33-45 wherein the cell is a eukaryotic cell.
47. The rAAV producing cell of 46, wherein the eukaryotic cell is an animal cell.
48. The rAAV producing cell of 47, wherein the animal cell is a mammalian cell.
49. The rAAV producing cell of 48, where the mammalian cell is a HEK cell.
50. The rAAV producing cell of 48, where the mammalian cell is a Chinese Hamster Ovary cell.
51. The rAAV producing cell of claim 33-45, wherein the cell is an E1a-expressing cell.
52. The rAAV producing cell of claim 51 wherein the E1a-expressing cell is a HEK293 cell.
53. The rAAV producing cell of any one of claims 38-45, wherein the ligand-dependent degradation domain is fused via the linker to the C-terminal end of the Rep protein.
54. The rAAV producing cell of any one of claims 38-45, wherein the cell is a mammalian cell and the ligand-dependent degradation domain is fused via the linker to the N-terminal end of the Rep protein.
55. The rAAV producing cell of claim 34, wherein the cell is a mammalian cell and the linker is a flexible linker.
56. The rAAV producing cell of claim 34, wherein the cell is a mammalian cell and the linker is a rigid linker.
57. The rAAV producing cell of claim 48-56, further comprising introducing into the cell a nucleic acid encoding a Cap protein.
58. The rAAV producing cell of claim 57, wherein the cell is a mammalian cell and the nucleic acid encoding the fusion protein and the nucleic acid encoding a Cap protein are introduced into the cell using at least one plasmid.
59. The rAAV producing cell of claim 57, wherein the cell is a mammalian cell and the nucleic acid encoding the fusion protein and the nucleic acid encoding a Cap protein, are introduced into the cell using the same plasmid.
60. The rAAV producing cell of claim 57, wherein the cell is a mammalian cell and the nucleic acid encoding the fusion protein and the nucleic acid encoding a Cap protein, are introduced into the cell using separate plasmids.
61. The rAAV producing cell of any one of claims 48-60, wherein the cell is a mammalian cell and the rep, cap, or helper genes are under the control of a regulatory element.
62. The rAAV producing cell of claim 61, wherein said regulatory element is a promoter.
63. The rAAV producing cell of claim 61, wherein said regulatory element comprises a Tet response binding element.
64. The method of any one of claims 1-32 or the rAAV producing cell of any one of claims 33-63 wherein two or more different AAV proteins are independently fused to degradation ligand-dependent degradation domains.
65. The method or rAAV producing cell of claim 64, wherein each different AAV protein is independently fused to a different degradation ligand-dependent degradation domain.
Description
4. BRIEF DESCRIPTION OF THE DRAWINGS
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
5. DETAILED DESCRIPTION
[0039] The presently disclosed subject matter relates to compositions and methods for the regulation of recombinant rAAV production in cell culture. In particular, the presently disclosed subject matter relates to compositions and methods to overcome AAV Rep protein-mediated cytotoxicity by reversible post-translational regulation of the expression of AAV Rep protein.
[0040] In one aspect, the subject matter of the present disclosure is directed to cell culture methods for the post-translational regulation of the expression of an rAAV. In certain embodiments, reversible post-translational regulation of AAV Rep protein expression in the cell culture is achieved by the fusion of a degradation domain to the AAV Rep protein. In certain embodiments, the fusion of a degradation domain to the AAV Rep protein allows for the regulated degradation of AAV Rep protein based on the presence or absence of a degradation ligand in the cell culture. In certain embodiments, the regulated degradation of AAV Rep protein based on the presence or absence of a degradation ligand results in post-translational regulation of the expression of an rAAV in the cell culture.
[0041] In another aspect, the subject matter of the present disclosure is directed to rAAV producing cells. For example, but not limitation, the present disclosure is directed to rAAV producing cells wherein the expression of the AAV Rep protein is regulated by the fusion of a degradation domain to the AAV Rep protein.
[0042] In another aspect, reversible post-translational regulation of AAV Helper protein expression in the cell culture is achieved by the fusion of a degradation domain to the AAV Helper protein. In certain embodiments, the fusion of a degradation domain to the AAV Helper protein allows for the regulated degradation of AAV Helper protein based on the presence or absence of a degradation ligand in the cell culture. In certain embodiments, the regulated degradation of AAV Helper protein based on the presence or absence of a degradation ligand results in post-translational regulation of the expression of an rAAV in the cell culture.
[0043] For clarity, but not by way of limitation, the detailed description of the presently disclosed subject matter is divided into the following subsections: [0044] 5.1. Definitions [0045] 5.2. Methods of Regulating Expression of AAV Using Degradation Domains [0046] 5.3. rAAV Producing Cells
[0047] 5.1. Definitions
[0048] The terms used in this specification generally have their ordinary meanings in the art, within the context of this disclosure and in the specific context where each term is used. Certain terms are discussed below, or elsewhere in the specification, to provide additional guidance to the practitioner in describing the compositions and methods of the present disclosure and how to make and use them.
[0049] As used herein, the use of the word a or an when used in conjunction with the term comprising in the claims and/or the specification can mean one, but it is also consistent with the meaning of one or more, at least one and one or more than one.
[0050] The terms comprise(s), include(s), having, has, can, contain(s) and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms or words that do not preclude the possibility of additional acts or structures. The present disclosure also contemplates other embodiments comprising, consisting of and consisting essentially of, the embodiments or elements presented herein, whether explicitly set forth or not.
[0051] The term about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, about can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
[0052] In certain embodiments, the cells of the present disclosure harbor a chromosomally integrated rep gene but require helper virus function in order to express Rep protein. Helper virus or helper virus function or AAV Helper as used herein refers to at least one of adenovirus (Ad) E1 (e.g., Ad E1a or Ad E1b), Ad E2A, Ad E4 and VA RNA, or to corresponding functions of other viruses, such as herpesviruses and poxviruses, which are able to impart helper function to support replication and packaging of AAV vector genomes. In particular embodiments, a hybrid virus made of adenovirus with an E1/E3 deletion, but containing Ad E2A, Ad E4 and VA RNA which provide helper virus function, as well as AAV ITRs flanking a heterologous nucleic acid. In other embodiments, hybrid viruses comprise helper virus functions from herpesvirus or poxvirus, along with AAV ITRs flanking a heterologous nucleic acid.
[0053] As used herein, the term helper virus function(s) refers to function(s) encoded in a helper virus genome which allow rAAV vector genome replication and packaging (in conjunction with Rep and Cap). As disclosed herein, helper virus function may be provided in a number of different ways. For example, helper virus function can be provided by a virus or, for example, provided by polynucleotide sequences encoding the requisite helper function(s) to a cell in trans. In another example, a plasmid or other expression vector comprising polynucleotide sequences encoding one or more viral (e.g., adenoviral) proteins provides helper function when after transfection into a cell line of the invention along with a rAAV vector genome allows rAAV vector genome replication and packaging into rAAV vector particles. In certain embodiments, a helper virus function is provided by a virus selected from adenovirus, herpesvirus, poxvirus, or a hybrid virus thereof. In certain embodiments, a helper virus function comprises one or more viruses, vectors or plasmids that provide the helper virus function. In certain embodiments, the helper virus function comprises at least one of Ad E1 protein (e.g., Ad E1a protein or Ad E1b protein), Ad E2A protein, Ad E4 protein and Ad VA RNA. In certain embodiments the degradation ligand-dependent degradation domain is fused to a Helper protein.
[0054] As used herein, the term AAV protein refers to any wild-type or modified protein that is derived from the AAV genome and required for AAV production. AAV protein includes any form of the Rep, Cap, or Helper proteins, whether wild-type or modified. Modifications of the wild-type AAV genes need not result in a change in amino acid sequence of the expressed protein. As used herein AAV fusion protein refers to a fusion protein comprising an AAV protein where the amino acid sequence of the AAV protein is fused, directly or via a linker, to another amino acid sequences, e.g., a degron sequence.
[0055] The term vector refers to small carrier nucleic acid molecule, e.g., a plasmid, a virus (e.g., AAV vector), or other vehicle, that can be manipulated by insertion or incorporation of a nucleic acid. Such vectors can be used for genetic manipulation (i.e., cloning vectors), to introduce/transfer polynucleotides into cells, and to transcribe or translate the inserted polynucleotide in cells. An expression vector is a specialized vector that contains a gene or nucleic acid sequence with the necessary regulatory regions needed for expression in a host cell.
[0056] A vector nucleic acid sequence generally contains at least an origin of replication for propagation in a cell and optionally additional elements, such as a heterologous polynucleotide sequence, expression control element (e.g., a promoter, enhancer), intron, an inverted terminal repeat (ITR), selectable marker (e.g., antibiotic resistance), polyadenylation signal.
[0057] A viral vector is derived from or based upon one or more nucleic acid elements that comprise a viral genome. A particular viral vector is an adeno-associated virus (AAV) vector.
[0058] The term recombinant, as a modifier of vector, such as recombinant AAV vector, as well as a modifier of sequences such as recombinant polynucleotides and polypeptides, means that the compositions have been manipulated (i.e., engineered) in a fashion that generally does not occur in nature. A particular example of a recombinant AAV vector would be where a click acid sequence that is not normally present in the wild-type AAV genome (e.g., a heterologous nucleic acid sequence) is inserted within the AAV genome. Although the term recombinant is not always used herein in reference to AAV vectors, as well as sequences such as polynucleotides, recombinant forms including polynucleotides, are expressly included in spite of any such omission.
[0059] A recombinant AAV vector or rAAV is derived from the wild type (wt or wild-type) genome of AAV by using molecular methods to remove the wild type genome from the AAV genome, and replacing with a non-native nucleic acid sequence, referred to as a heterologous nucleic acid. Typically, for AAV one or both inverted terminal repeat (ITR) sequences of AAV genome are retained in the AAV vector. rAAV is distinguished from an AAV genome, since all or a part of the AAV genome has been replaced with a non-native sequence with respect to the AAV genomic nucleic acid. Incorporation of a non-native sequence therefore defines the AAV vector as a recombinant vector, which can be referred to as a rAAV vector.
[0060] A rAAV sequence can be packagedreferred to herein as a particlefor subsequent infection (transduction) of a cell, ex vivo, in vitro or in vivo. Where a recombinant AAV vector sequence is encapsidated or packaged into an AAV particle, the particle can also be referred to as a rAAV vector or rAAV particle. Such rAAV particles include proteins that encapsidate or package the vector genome. In the case of AAV, they are referred to as capsid proteins.
[0061] A vector genome refers to the portion of the recombinant plasmid sequence that is ultimately packaged or encapsidated to form a viral (e.g., AAV) particle. In cases where recombinant plasmids are used to construct or manufacture recombinant vectors, the vector genome does not include the portion of the plasmid that does not correspond to the vector genome sequence of the recombinant plasmid. This non vector genome portion of the recombinant plasmid is referred to as the plasmid backbone, which is important for cloning and amplification of the plasmid, a process that is needed for propagation and recombinant virus production, but is not itself packaged or encapsidated into virus (e.g., AAV) particles. Thus, a vector genome refers to the nucleic acid that is packaged or encapsidated by virus (e.g., AAV).
[0062] The terms nucleic acid and polynucleotide are used interchangeably herein to refer to all forms of nucleic acid, oligonucleotides, including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA). Nucleic acids include genomic DNA, cDNA and antisense DNA, and spliced or unspliced mRNA, rRNA tRNA and inhibitory DNA or RNA (RNAi, e.g., small or short hairpin (sh)RNA, microRNA (miRNA), small or short interfering (si)RNA, trans-splicing RNA, or antisense RNA). Nucleic acids include naturally occurring, synthetic, and intentionally modified or altered polynucleotides (e.g., variant nucleic acid). The nucleic acids such as cDNA, genomic DNA, RNA, and fragments thereof which may be single- or double-stranded.
[0063] Polynucleotides can be single, double, or triplex, linear or circular, and can be of any length. In discussing polynucleotides, a sequence or structure of a particular polynucleotide may be described herein according to the convention of providing the sequence in the 5 to 3 direction.
[0064] A transgene is used herein to conveniently refer to a heterologous nucleic acid that is intended or has been introduced into a cell or organism. Transgenes include any heterologous nucleic acid, such as a gene that encodes a polypeptide or protein or encodes an inhibitory RNA.
[0065] A heterologous nucleic acid can be introduced/transferred by way of vector, such as AAV, transduction or transfection into a cell. The term transduce and grammatical variations thereof refer to introduction of a molecule such as an rAAV vector into a cell or host organism. The introduced heterologous nucleic acid may also exist in the recipient cell or host organism extrachromosomally, or only transiently.
[0066] A transduced cell is a cell into which the transgene has been introduced. Accordingly, a transduced cell (e.g., in a mammal, such as a cell or tissue or organ cell), means a genetic change in a cell following incorporation of an exogenous molecule, for example, a nucleic acid (e.g., a transgene) into the cell. Thus, a transduced cell is a cell into which, or a progeny thereof in which an exogenous nucleic acid has been introduced. The cell(s) can be propagated and the introduced protein expressed, or nucleic acid transcribed. For gene therapy uses and methods, a transduced cell can be in a subject.
[0067] An expression control element is a type of regulatory element and refers to nucleic acid sequence(s) that influence expression of an operably linked nucleic acid. Control elements, including expression control elements as set forth herein such as promoters and enhancers. Vector sequences including AAV vectors can include one or more expression control elements. Typically, such elements are included to facilitate proper heterologous polynucleotide transcription and if appropriate translation (e.g., a promoter, enhancer, splicing signal for introns, maintenance of the correct reading frame of the gene to permit in-frame translation of mRNA and, stop codons etc.). Such elements typically act in cis, referred to as a cis acting element, but may also act in trans.
[0068] Expression control can be effected at the level of transcription, translation, splicing, message stability, etc. Typically, an expression control element that modulates transcription is juxtaposed near the 5 end (i.e., upstream) of a transcribed nucleic acid. Expression control elements can also be located at the 3 end (i.e., downstream) of the transcribed sequence or within the transcript (e.g., in an intron).
[0069] Functionally, expression of operably linked nucleic acid is at least in part controllable by the element (e.g., promoter) such that the element modulates transcription of the nucleic acid and, as appropriate, translation of the transcript. A specific example of an expression control element is a promoter, which is usually located 5 of the transcribed nucleic acid sequence. A promoter typically increases an amount expressed from operably linked nucleic acid as compared to an amount expressed when no promoter exists.
[0070] Another type of regulatory element includes Tet. In Tet dependent induction, expression from a target transgene is dependent on the inducible promoter. Promoter can be regulated by the levels of the tetracycline or tetracycline derivatives such as doxycycline (Dox). The activation of Tet-On promoters depends on the presence of an additional activator protein that can bind to the promoters in the presence of Dox. On the contrary, the transcription is inactive in the presence of Dox for the Tet-Off system. Other examples of inducible systems include Cumate, abscisic acid (ABA), Rapamycin, tamoxifen inducible systems. The degradation ligand-dependent degradation domain disclosed herein can also be used with Cre-LoxP, CRISPR, riboswitch and light-switchable transgene systems as well. An enhancer as used herein can refer to a sequence that is located adjacent to the heterologous nucleic acid. Enhancer elements are typically located upstream of a promoter element but also function and can be located downstream of or within a sequence. Enhancer elements typically increase expressed of an operably linked nucleic acid above expression afforded by a promoter element.
[0071] Expression control elements herein, such as promoters, are typically positioned at a distance away from the transcribed sequence. In particular embodiments, an expression control element such as a promoter is positioned at least about 25 nucleotides 5 of the rep gene start codon, is positioned about 25-5,000 nucleotides 5 of the rep gene start codon, is positioned about 250-2,500 nucleotides 5 of the rep gene start codon, is positioned about 500-2,000 nucleotides 5 of the rep gene start codon, is positioned about 1,000-1,900 nucleotides 5 of the rep gene start codon, is positioned about 1,500-1,900 nucleotides 5 of the rep gene start codon, is positioned about 1,600-1,800 nucleotides 5 of the rep gene start codon, is positioned about 1,700-1,800 nucleotides 5 of the rep gene start codon, or is positioned about 1,750 nucleotides 5 of the rep gene start codon.
[0072] Expression control elements include ubiquitous or promiscuous promoters/enhancers which are capable of driving expression of a polynucleotide in many different cell types. Such elements include, but are not limited to the cytomegalovirus (CMV) immediate early promoter/enhancer sequences, the Rous sarcoma virus (RSV) promoter/enhancer sequences and the other viral promoters/enhancers active in a variety of mammalian cell types, or synthetic elements (see, e.g., Boshart et al., Cell, 41:521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the cytoplasmic ?-actin promoter and the phosphoglycerol kinase (PGK) promoter.
[0073] Expression control elements also include the native elements(s) for the heterologous polynucleotide. A native control element (e.g., promoter) may be used when it is desired that expression of the heterologous polynucleotide should mimic the native expression. Other native control elements, such as introns, polyadenylation sites or Kozak consensus sequences may also be used.
[0074] The term operably linked means that the regulatory sequences necessary for expression of a nucleic acid sequence are placed in the appropriate positions relative to the sequence so as to effect expression of the nucleic acid sequence. This same definition is sometimes applied to the arrangement of nucleic acid sequences and transcription control elements (e.g. promoters, enhancers, and termination elements) in an expression vector, e.g., rAAV vector.
[0075] In the example of an expression control element in operable linkage with a nucleic acid, the relationship is such that the control element modulates expression of the nucleic acid. More specifically, for example, two DNA sequences operably linked means that the two DNAs are arranged (cis or trans) in such a relationship that at least one of the DNA sequences is able to exert a physiological effect upon the other sequence.
[0076] As disclosed herein, a nucleic acid spacer sequence positioned between an expression control element and an AAV rep gene can substantially reduce or eliminate expression of the rep gene thereby in turn reducing or eliminating expression of the Rep protein and allowing cells to survive even while the cells also express adenovirus E1a protein. Addition of helper virus function to such cells, such as provided by a hybrid virus, adenovirus, poxvirus or herpesvirus, can overcome the attenuating effect of the spacer nucleic acid on rep gene expression and in turn drive expression of rep gene thereby providing Rep protein expression.
[0077] Additional elements for rAAV vectors include, without limitation, a transcription termination signal or stop codon, 5 or 3 untranslated regions (e.g., polyadenylation (polyA) sequences) which flank a sequence, such as one or more copies of an AAV ITR sequence, or an intron.
[0078] Further elements include, for example, filler or stuffer polynucleotide sequences, for example to improve packaging and reduce the presence of contaminating nucleic acid. AAV vectors typically accept inserts of DNA having a size range which is generally about 4 kb to about 5.2 kb, or slightly more. Thus, for shorter sequences, inclusion of a stuffer or filler in order to adjust the length to near or at the normal size of the virus genomic sequence acceptable for AAV vector packaging into virus particle. In various embodiments, a filler/stuffer nucleic acid sequence is an untranslated (non-protein encoding) segment of nucleic acid. For a nucleic acid sequence less than 4.7 kb, the filler or stuffer polynucleotide sequence has a length that when combined (e.g., inserted into a vector) with the sequence has a total length between about 3.0-5.5 kb, or between about 4.0-5.0 kb, or between about 4.3-4.8 kb.
[0079] Where a wild type heterologous nucleic acid or transgene is too large to be packaged within an AAV vector particle, the heterologous nucleic acid may be provided in modified, fragmented or truncated form for packaging in and delivery by an AAV vector, such that a functional protein or nucleic acid product, such as a therapeutic protein or nucleic acid product, is ultimately provided.
[0080] In some embodiments, the heterologous nucleic acid that encodes a protein (e.g., therapeutic protein) is provided in modified or truncated forms or the heterologous nucleic acid is provided in multiple constructs, delivered by separate and multiple AAV vectors.
[0081] In certain aspects, the heterologous nucleic acid is provided as a truncated variant that maintains functionality of the encoded protein (e.g., therapeutic protein), including removal of portions unnecessary for function, such that the encoding heterologous polynucleotide is reduced in size for packaging in an AAV vector.
[0082] In certain aspects the heterologous nucleic acid is provided in split AAV vectors, each providing nucleic acid encoding different portions of a protein (e.g., therapeutic protein), thus delivering multiple portions of a protein (e.g., therapeutic protein) which assemble and function in the cell.
[0083] In other aspects, the heterologous nucleic acid is provided by dual AAV vectors using overlapping, trans-splicing or hybrid trans-splicing dual vector technology. In certain embodiments, two overlapping AAV vectors are used which combine in the cell to generate a full expression cassette, from which a full-length protein (e.g., therapeutic protein) is expressed.
[0084] A hemostasis related disorder refers to bleeding disorders such as hemophilia A, hemophilia A with inhibitory antibodies, hemophilia B, hemophilia B with inhibitory antibodies, a deficiency in any coagulation Factor: VII, VIII, IX, X, XI, V, XII, II, von Willebrand factor, combined FV/FVIII deficiency, thalassemia, vitamin K epoxide reductase C1 deficiency, or gamma-carboxylase deficiency; bleeding associated with trauma, injury, thrombosis, thrombocytopenia, stroke, coagulopathy, or disseminated intravascular coagulation (DIC); over-anticoagulation associated with heparin, low molecular weight heparin, pentasaccharide, warfarin, or small molecule antithrombotics (i.e., FXa inhibitors); and platelet disorders such as, Bernard Soulier syndrome, Glanzmann thrombasthenia, and storage pool deficiency.
[0085] The term isolated, when used as a modifier of a composition, means that the compositions are made by the hand of man or are separated, completely or at least in part, from their naturally occurring in vivo environment. Generally, isolated compositions are substantially free of one or more materials with which they normally associate with in nature, for example, one or more protein, nucleic acid, lipid, carbohydrate, cell membrane.
[0086] The term isolated does not exclude combinations produced by the hand of man, for example, a rAAV sequence, or rAAV particle that packages or encapsidates an AAV vector genome and a pharmaceutical formulation. The term isolated also does not exclude alternative physical forms of the composition, such as hybrids/chimeras, multimers/oligomers, modifications (e.g., phosphorylation, glycosylation, lipidation) or derivatized forms, or forms expressed in host cells produced by the hand of man.
[0087] The term substantially pure refers to a preparation comprising at least 50-60% by weight the compound of interest (e.g., nucleic acid, oligonucleotide, protein, etc.). The preparation can comprise at least 75% by weight, or at least 85% by weight, or about 90-99% by weight, of the compound of interest. Purity is measured by methods appropriate for the compound of interest (e.g., chromatographic methods, agarose or polyacrylamide gel electrophoresis, HPLC analysis, and the like).
[0088] The phrase consisting essentially of when referring to a particular nucleotide sequence or amino acid sequence means a sequence having the properties of a given SEQ ID NO. For example, when used in reference to an amino acid sequence, the phrase includes the sequence per se and molecular modifications that would not affect the basic and novel characteristics of the sequence.
[0089] The term identity, homology and grammatical variations thereof, mean that two or more referenced entities are the same, when they are aligned sequences. Thus, by way of example, when two protein sequences are identical, they have the same amino acid sequence, at least within the referenced region or portion. Where two nucleic acid sequences are identical, they have the same nucleic acid sequence, at least within the referenced region or portion. The identity can be over a defined area (region or domain) of the sequence.
[0090] An area or region of identity refers to a portion of two or more referenced entities that are the same. Thus, where two protein or nucleic acid sequences are identical over one or more sequence areas or regions they share identity within that region. An aligned sequence refers to multiple protein (amino acid) or nucleic acid sequences, often containing corrections for missing or additional bases or amino acids (gaps) as compared to a reference sequence.
[0091] The identity can extend over the entire length or a portion of the sequence. In certain embodiments, the length of the sequence sharing the percent identity is 2, 3, 4, 5 or more contiguous amino acids or nucleic acids, e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, etc. contiguous nucleic acids or amino acids. In additional embodiments, the length of the sequence sharing identity is 21 or more contiguous amino acids or nucleic acids, e.g., 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, etc. contiguous amino acids or nucleic acids. In further embodiments, the length of the sequence sharing identity is 41 or more contiguous amino acids or nucleic acids, e.g., 42, 43, 44, 45, 45, 47, 48, 49, 50, etc., contiguous amino acids or nucleic acids. In yet further embodiments, the length of the sequence sharing identity is 50 or more contiguous amino acids or nucleic acids, e.g., 50-55, 55-60, 60-65, 65-70, 70-75, 75-80, 80-85, 85-90, 90-95, 95-100, 100-150, 150-200, 200-250, 250-300, 300-500, 500-1,000, etc. contiguous amino acids or nucleic acids.
[0092] The extent of identity (homology) or percent identity between two sequences can be ascertained using a computer program and/or mathematical algorithm. For purposes of this invention comparisons of nucleic acid sequences are performed using the GCG Wisconsin Package version 9.1, available from the Genetics Computer Group in Madison, Wisconsin. For convenience, the default parameters (gap creation penalty=12, gap extension penalty=4) specified by that program are intended for use herein to compare sequence identity. Alternately, the Blastn 2.0 program provided by the National Center for Biotechnology Information (found on the world wide web at ncbi.nlm.nih.gov/blast/; Altschul et al., 1990, J Mol Biol 215:403-410) using a gapped alignment with default parameters, may be used to determine the level of identity and similarity between nucleic acid sequences and amino acid sequences. For polypeptide sequence comparisons, a BLASTP algorithm is typically used in combination with a scoring matrix, such as PAM100, PAM 250, BLOSUM 62 or BLOSUM 50. FASTA (e.g., FASTA2 and FASTA3) and SSEARCH sequence comparison programs are also used to quantitate extent of identity (Pearson et al., Proc. Natl. Acad. Sci. USA 85:2444 (1988); Pearson, Methods Mol Biol. 132:185 (2000); and Smith et al., J. Mol. Biol. 147:195 (1981)). Programs for quantitating protein structural similarity using Delaunay-based topological mapping have also been developed (Bostick et al., Biochem Biophys Res Commun. 304:320 (2003)).
[0093] Nucleic acid molecules, expression vectors (e.g., AAV vector genomes), plasmids, including nucleic acid encoding modified/variant AAV capsids of the invention and heterologous nucleic acids may be prepared by using recombinant DNA technology methods. The availability of nucleotide sequence information enables preparation of isolated nucleic acid molecules of the invention by a variety of means. For example, nucleic acid sequences can be made using various standard cloning, recombinant DNA technology, via cell expression or in vitro translation and chemical synthesis techniques. Purity of polynucleotides can be determined through sequencing, gel electrophoresis and the like. For example, nucleic acids can be isolated using hybridization or computer-based database screening techniques. Such techniques include, but are not limited to: (1) hybridization of genomic DNA or cDNA libraries with probes to detect homologous nucleotide sequences; (2) antibody screening to detect polypeptides having shared structural features, for example, using an expression library; (3) polymerase chain reaction (PCR) on genomic DNA or cDNA using primers capable of annealing to a nucleic acid sequence of interest; (4) computer searches of sequence databases for related sequences; and (5) differential screening of a subtracted nucleic acid library.
[0094] 5.2. Methods of Regulating AAV Production Using Degradation Domains
[0095] In one aspect, the subject matter of the present disclosure is directed to cell culture methods for the post-translational regulation of the expression of an rAAV. In certain embodiments, reversible post-translational regulation of AAV Rep protein expression in the cell culture is achieved by the fusion of a degradation domain (degron) to the AAV Rep protein. In certain embodiments, the fusion of a degradation domain to the AAV Rep protein allows for the regulated degradation of AAV Rep protein based on the presence or absence of a degradation ligand or other inhibitor, e.g., a small molecule ligand that binds to the degron to modify its rate of degradation or an inhibitor such as light or temperature, that modifies the rate of degradation of the degron. In certain embodiments, the regulated degradation of AAV Rep protein based on the presence or absence of a degradation ligand or other inhibitor results in post-translational regulation of the expression of an rAAV in the cell culture. As used herein, the term degradation ligand-dependent degradation domain refers to a degron domain that binds a degradation ligand. As used herein, the term degradation ligand refers to a ligand that binds the degradation domain. Any suitable degron can be used in connection with the methods of the present disclosure. For example, but not limitation, the degron is modified from a human gene encoding a protein referred to as FK506-binding protein 12 (FKBP). In certain embodiments, the degron is derived from FKBP. In certain embodiments, the FKBP variant protein from which the FKBP degron is derived comprises an F36V amino acid substitution. In certain embodiments, the FKBP variant protein from which the FKBP degron is derived comprises an L106P amino acid substitution. In certain embodiments, the FKBP variant protein from which the FKBP degron is derived comprises both an F36V and an L106P amino acid substitution. In certain embodiments, the modifications of FKBP: a) deepen the binding pocket to improve its specificity to a degradation ligand, e.g., Shield1, over FK506; and/or b) make the protein more unstable in the absence of its degradation ligand. dTAG-13 is a small molecule that can target mutant FKBP12 (F36V) sequences for ubiquitin mediated degradation. It can function by linking the targeted protein sequence to a E3 ubiquitin ligase, cereblon. dTAG-13 can lead to degradation of FKBP12-F36V fusion proteins and proteins fused to it. As used herein, the FKBP12 domain is referred to as FKBP.
[0096] In certain embodiments the degron is a dihydrofolate reductase (DHFR) based degron; an auxin-induced degron (AID) domain; an ornithine decarboxylase (ODC) based degron; a split ubiquitin based degron system; a protease based degron system; a Proteolysis-Targeting Chimeric Molecules (PROTACs) based degron system; an antibody dependent protein degron system; a photosensitive degron (psd); a phosphorylation-dependent degron; or a temperature dependent degron.
[0097] In certain embodiments, the degron is regulated by the presence or absence of a degradation ligand or inhibitor. In certain embodiments the degradation ligand is a small molecule ligand. In certain embodiments, e.g., when the degron is a FKBP variant protein, the small molecule ligand is Shield1.
[0098] In certain embodiments, e.g., when the degron is a dihydrofolate reductase (DHFR) based degron, the ligand is Trimethoprim (TMP). In certain embodiments, e.g., when the degron is an auxin-induced degron (AID) domain, the ligand is auxin. In certain embodiments, e.g., when the degron is an ornithine decarboxylase (ODC) based degron, the ligand is antizyme. In certain embodiments, e.g., when the degron is a split ubiquitin based degron system, the ligand is rapamycin. In certain embodiments, e.g., when the degron is a protease based degron system, the inhibitor can be an HCV protease inhibitor or TEV protease expression. In certain embodiments, e.g., when the degron is a Proteolysis-Targeting Chimeric Molecules (PROTACs) based degron system, the inhibitor is PROTAC expression. In certain embodiments, e.g., when the degron is an antibody dependent protein degron system, the ligand is a corresponding antibody. In certain embodiments, e.g., when the degron is a photosensitive degron (psd), the inhibitor is light. In certain embodiments, e.g., when the degron is a phosphorylation-dependent degron, the inhibitor is a corresponding kinase activator. In certain embodiments, e.g., when the degron is a temperature dependent degron, the inhibitor is a temperature change.
[0099] In certain embodiments, the degron sequence is linked to the C-terminus of an AAV Rep protein. In certain embodiments, the degron sequence is linked to the N-terminus of an AAV Rep protein. In certain embodiments, the degron and the AAV Rep protein are linked through a flexible linker. In certain embodiments, the degron and the AAV Rep protein are linked through a rigid linker. In certain non-limiting embodiments, the flexible linker has the amino acid sequence: GGGGSGGGGSGGGGS. In certain non-limiting embodiments, the rigid linker has the amino acid sequence:
TABLE-US-00001 AEAAAKEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKEAAAKA.
[0100] In certain embodiments, the methods of the present disclosure are directed to regulating the production of a recombinant adeno-associated (rAAV) virus, where the method comprises: introducing into a mammalian cell an rAAV comprising a gene of interest and a nucleic acid encoding a fusion protein, wherein the fusion protein comprises the Rep protein, a linker, and a degradation ligand-dependent degradation domain, culturing the cell under conditions suitable for producing the rAAV virus; and contacting the cell with a degradation ligand, wherein the degradation ligand binds to the degradation domain to regulate the expression of the Rep protein and thereby regulate the production of rAAV.
[0101] In certain embodiments, the cell is a E1a expressing cell. In certain embodiments, the cell is a human cell. In certain embodiments, the cell is a HEK293 cell. In certain embodiments, the cell is a HEK293F cell. In certain embodiments, the cell is a PERC6 cell.
[0102] In certain embodiments, the Rep protein is a Rep78, Rep68, Rep52, or Rep40 protein.
[0103] The methods of the present disclosure comprise the use of suitable regulatory elements, including promoters to drive the expression of Rep and Cap proteins. In certain embodiments, suitable promoters may be eukaryotic, prokaryotic, or viral promoters. Suitable promoters include non-inducible promoters and non-tissue specific promoters. In certain embodiments, the promoter is an AAV p5 promoter, which in its native state drives Rep protein expression from the rep gene. In certain embodiments, the promoter is the cytomegalovirus (CMV) immediate early promoter/enhancer. Additional nonlimiting examples of suitable promoters include ubiquitous or promiscuous promoters which are capable of driving expression of a polynucleotide in many different cell types. Such elements include, but are not limited to the Rous sarcoma virus (RSV) promoter sequences and the other viral promoters active in a variety of mammalian cell types, or synthetic elements (see, e.g., Boshart el al., Cell, 41:521-530 (1985)), the SV40 promoter, the dihydrofolate reductase promoter, the cytoplasmic b-actin promoter and the phosphoglycerol kinase (PGK) promoter. In certain embodiments, the promoter is selected from the human elongation factor-1?EF1 alpha promoter, the CAG promoter, the CBA promoter, the SFFV promoter, the p19 promoter, and the herpes simplex virus thymidine kinase (HSV-TK) promoter. In certain embodiments promoters may be located proximal or distal to the Rep and Cap genes. In certain embodiments regulatory elements, including promoters, may be in cis or trans to the Rep and Cap genes. In certain embodiments, the methods of the present disclosure are directed to expression of a nucleic acid encoding an AAV Rep protein, wherein the AAV Rep protein is an AAV1 Rep protein, an AAV2 Rep protein, an AAV3 Rep protein, anAAV4 Rep protein, an AAV5 Rep protein, an AAV6 Rep protein, an AAV7 Rep protein, an AAV8 Rep protein, an AAV9 Rep protein, an AAV 10 Rep protein, or an AAV 11 Rep protein. Because the methods of the present disclosure are applicable to any cell type that produces AAV, the AAV can be, e.g., human, avian, bovine, canine, equine, primate, non-primate, ovine, or any derivation thereof.
[0104] In certain embodiments, the rAAV produced by the methods of the present disclosure include any viral strain or serotype. In certain, non-limiting, embodiments, an rAAV can be based upon any AAV genome, including, but not limited to AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV9.47, AAV9(hul4), AAV10, AAV11, AAV12, Rh8, Rh10, Rh74, AAV3B, AAV-2i8, LK03, RHM4-1, DJ, DJ8, NP59, Anc-80 and variants thereof, including the variants of AAV capsids set forth in Pulicherla et al., Mol. Ther., 19(6) 1070-1078 (2011) (describing AAV9 variants including AAV9.47 among others), U.S. Pat. No. 7,906,111 (describing AAV9(hul4) among others), U.S. Pat. No. 10,532,111 (describing NP59 among others), U.S. Patent No. U.S. Ser. No. 10/738,087 (describing Anc-80 among others), WO2012/145601, WO2013/158879, WO2015/013313, WO2018/156654, US2013/0059732, U.S. Pat. Nos. 9,169,299 (describing LK03), 9,840,719 (describing RHM4-1), 7,749,492, 7,588,772 (describing DJ and DJ8), and 9,587,282, all of which are incorporated herein by reference in their entireties. rAAV vectors therefore include gene/protein sequences identical to gene/protein sequences characteristic for a particular serotype, as well as mixed serotypes.
[0105] In certain embodiments, the nucleic acid encoding AAV Rep and Cap proteins is arranged as in the native AAV genome. In certain embodiments, the nucleic acid encoding AAV Rep and Cap proteins is arranged as in the native AAV genome, except that the nucleic acid encodes a linker and/or a degron sequence at the N-terminus or C-terminus of the AAV Rep protein. In certain embodiments, the nucleic acids encoding AAV Rep and Cap proteins are not arranged, directly or indirectly, in a tandem configuration. In certain embodiments, the nucleic acids encoding AAV Rep and Cap proteins are not covalently linked. Additional suitable arrangements of the AAV Rep and Cap coding sequences can be employed, e.g., the order of the AAV Rep and Cap coding sequences can be reversed relative to their native AAV genomic order, one or both of the AAV Rep and Cap coding sequences can be preceded or followed by a sequence comprising an IRES, a self-cleaving protein (e.g., a 2A peptide) coding sequence, or stuffer region having no function. In certain embodiments, one or both of the AAV Rep and Cap coding sequences can be incorporated into a cell genome. In certain embodiments, one or both of the AAV Rep and Cap coding sequences can be combined with factors that increase DNA sequences that increase episomal plasmid maintenance.
[0106] In certain embodiments, a helper virus function is provided by a virus selected from adenovirus, herpesvirus, poxvirus, or a hybrid virus thereof. In certain embodiments, a helper virus function comprises one or more viruses, vectors or plasmids that provide the helper virus function. In certain embodiments, the helper virus function comprises at least one of adenovirus (Ad) E1 protein (e.g., Ad E1a or Ad E1b protein), Ad E2A protein, Ad E4 protein and Ad VA RNA.
[0107] The helper virus function can be provided in a number of different ways. In certain embodiments, the helper virus function can be provided by a virus or, for example, provided by polynucleotide sequences encoding the requisite helper function(s) to a cell in trans.
[0108] In certain embodiments, the degron sequence is linked to the C-terminus of an adenovirus (Ad) E1 protein (e.g., Ad E1a or Ad E1b protein), Ad E2A protein, or Ad E4 protein. In certain embodiments, the degron sequence is linked to the N-terminus of an Ad E1 protein (e.g., Ad E1a or Ad E1b protein), Ad E2A protein, or Ad E4 protein. In certain embodiments, the degron and the Ad E1 protein (e.g., Ad E1a or Ad E1b protein), Ad E2A protein, or Ad E4 protein are linked through a flexible linker. In certain embodiments, the degron and the Ad E1 protein (e.g., Ad E1a or Ad E1b protein), Ad E2A protein, or Ad E4 protein are linked through a rigid linker.
[0109] In certain embodiments, two or more AAV proteins, e.g., Rep, Cap, and/or Helper proteins, are independently linked to a degron sequence to generate two or more AAV protein-degron fusion proteins. In certain embodiments, each of the two or more AAV protein-degron fusion proteins comprise a degron at the AAV protein's C-terminus or N-terminus. In certain embodiments, each of the two or more AAV protein-degron fusion proteins comprise a different degron sequence. In certain embodiments, each the two or more AAV protein-degron fusion proteins comprise the same degron sequence. In certain embodiments, the linkage between the AAV protein and its respective degron is a flexible linker. In certain embodiments, the linkage between the AAV protein and its respective degron is a rigid linker.
[0110] In certain embodiments, the two or more AAV protein-fusion proteins can be encoded by sequences on the same vector, e.g., plasmid. In certain embodiments, the two or more AAV protein-degron fusion proteins can be encoded by sequences on separate vectors, e.g., a first plasmid comprises the coding sequence for the first AAV protein-degron fusion and a second plasmid comprises the coding sequence for the second AAV protein-degron fusion. In certain embodiments, the expression of at least one of the AAV protein-degron fusion proteins is under the control of a regulatory element. In certain embodiments, the expression of at least two of the AAV protein-degron fusion proteins is under the control of a regulatory element. In certain embodiments, the expression of multiple AAV protein-degron fusion proteins are each under the control of a different regulatory element. In certain embodiments, the expression of all of the AAV protein-degron fusion proteins is under the control of a regulatory element. In certain embodiments, the regulatory element is a promoter. In certain embodiments the regulatory element is a Tet response element
[0111] In certain embodiments, the cell of the present disclosure comprises acid sequence that is not normally present in the wild-type AAV genome, e.g., a heterologous nucleic acid sequence, also referred to herein as a gene of interest or (GOI). In certain non-limiting embodiments, the GOI comprises a nucleic acid sequence encoding a therapeutic protein or an inhibitory nucleic acid sequence. In certain embodiments, the GOI can be introduced/transferred by way of vector, such as AAV transduction or transfection into a cell. In certain embodiments, the introduced GOI can also exist in the recipient cell or host organism extrachromosomally, or only transiently.
[0112] In certain embodiments, the GOI encodes a protein (e.g., therapeutic protein) that is provided in modified or truncated forms or the GOI is provided in multiple constructs, delivered by separate and multiple AAV vectors.
[0113] In certain embodiments, the GOI is provided as a truncated variant that maintains functionality of the encoded protein (e.g., therapeutic protein), including removal of portions unnecessary for function, such that the GOI is reduced in size for packaging in an AAV vector.
[0114] In certain embodiments, the GOI is provided in split AAV vectors, each providing nucleic acid encoding different portions of a protein (e.g., therapeutic protein), thus delivering multiple portions of a protein (e.g., therapeutic protein) which assemble and function in the cell.
[0115] In certain embodiments, the GOI is provided by dual AAV vectors using overlapping, trans-splicing or hybrid trans-splicing dual vector technology. In certain embodiments, two overlapping AAV vectors are used which combine in the cell to generate a full expression cassette, from which a full-length protein (e.g., therapeutic protein) is expressed.
[0116] 5.3. AAV Producing Cells
[0117] In another aspect, the subject matter of the present disclosure is directed to rAAV producing cells. For example, but not limitation, the present disclosure is directed to rAAV producing cells wherein the expression of the AAV Rep protein is regulated by the fusion of a degradation domain to the AAV Rep protein.
[0118] The embodiments of the rAAV producing cells of the present disclosure include any cell type or system that can produce rAAV or AAV. Several examples of various systems have been previously described, e.g., Conlon and Mavilio, Mol. Therapy, 8:181-182 (2018), which is incorporated herein by reference in its entirety. Embodiments of the present disclosure include making rAAV through transient transfection of plasmids in mammalian cells, production of rAAV in stable cell lines, rAAV through herpes simplex virus in mammalian cells, and rAAV production through baculovirus in Sf9 cells.
[0119] In certain embodiments, the rAAV producing cells of the present disclosure are eukaryotic cells. In certain embodiments, the rAAV producing cells of the present disclosure are animal cells. In certain embodiments, the rAAV producing cells of the present disclosure are insect cells. In certain embodiments, the rAAV producing cells of the present disclosure mammalian cells. In certain embodiments, the rAAV producing cells of the present disclosure are human cells. In certain embodiments, the rAAV producing cells of the present disclosure human embryonic kidney (HEK) cells. In certain embodiments, the rAAV producing cells of the present disclosure are HEK293 cells, HEK293F cells, or Expi293 cells.
[0120] In certain embodiments, the rAAV producing cells of the present disclosure are Chinese hamster ovary (CHO) cells.
[0121] In certain embodiments, the rAAV producing cells of the present disclosure are insect (Sf9) cells.
[0122] In certain embodiments, the rAAV producing cells of the present disclosure do not express SV40 large T antigen.
[0123] In certain embodiments, the rAAV producing cells of the present disclosure are suspension cells. In certain embodiments, the rAAV producing cells of the present disclosure are adherent cells.
[0124] In certain embodiments, the rAAV producing cells of the present disclosure can be cultured at a cell density of at least about 1?10.sup.6, at least about 5?10.sup.6, at least about 1?10.sup.7 or at least about 2?10.sup.7 cells/mL. In certain embodiments, the rAAV producing cells of the present disclosure can be cultured at a cell density from about 1?10.sup.6?5?10.sup.6, from about 5?10.sup.6?1?10.sup.7, or from about 1?10.sup.7?2?10.sup.7 cells/mL.
[0125] In certain embodiments, the rAAV producing cells of the present disclosure are present in a culture or growth medium.
[0126] In certain embodiments, the rAAV producing cells of the present disclosure are in medium suitable for storage. In certain embodiments, the rAAV producing cells of the present disclosure are in a medium suitable for long-term storage at or below 0?, at or below ?30?, at or below ?80? or at or below ?160? C.
[0127] In certain embodiments, the present disclosure is directed to a mammalian rAAV producing cell, wherein the cell comprises a nucleic acid encoding a fusion protein comprising the Rep protein, a linker, and a degradation ligand-dependent degradation domain. In certain embodiments, the degradation ligand-dependent degradation domain is a FKBP variant protein. In certain embodiments, the degradation ligand is a small molecule ligand. In certain embodiments, the small molecule is Shield1.
[0128] In certain embodiments, the mammalian rAAV producing cell of the present disclosure is an E1a-expressing cell. In certain embodiments, the E1a-expressing cell is a HEK293 cell.
[0129] In certain embodiments, the ligand-dependent degradation domain of the mammalian rAAV producing cell of the present disclosure is fused via a linker to the C-terminal end of the Rep protein. In certain embodiments, the ligand-dependent degradation domain of the mammalian rAAV producing cell of the present disclosure is fused via a linker to the N-terminal end of the Rep protein. In certain embodiments, the linker is a flexible linker. In certain non-limiting embodiments, the flexible linker has the amino acid sequence: GGGGSGGGGSGGGGS. In certain embodiments, the linker is a rigid linker. In certain non-limiting embodiments, the rigid linker has the amino acid sequence:
TABLE-US-00002 AEAAAKEAAAKEAAAKEAAAKALEAEAAAKEAAAKEAAAKEAAAKA.
[0130] In certain embodiments, the mammalian rAAV producing cell of the present disclosure comprises a nucleic acid encoding AAV Rep and Cap proteins arranged as in the native AAV genome. In certain embodiments, the nucleic acid encoding AAV Rep and Cap proteins is arranged as in the native AAV genome, except that the nucleic acid encodes a linker and/or a degron sequence at the N-terminus or C-terminus of the AAV Rep protein. In certain embodiments, the nucleic acids encoding AAV Rep and Cap proteins are not arranged, directly or indirectly, in a tandem configuration. In certain embodiments, the nucleic acids encoding AAV Rep and Cap proteins are not covalently linked. Additional suitable arrangements of the AAV Rep and Cap coding sequences can be employed, e.g., the order of the AAV Rep and Cap coding sequences can be reversed relative to their native AAV genomic order, one or both of the AAV Rep and Cap coding sequences can be preceded or followed by a sequence comprising an IRES, a self-cleaving protein (e.g., a 2A peptide) coding sequence, or stuffer region having no function. In certain embodiments, one or both of the AAV Rep and Cap coding sequences can be incorporated into a cell genome. In certain embodiments, one or both of the AAV Rep and Cap coding sequences can be combined with factors that increase DNA sequences that increase episomal plasmid maintenance.
[0131] In certain embodiments, the mammalian rAAV producing cell of the present disclosure comprise a virus capable of helper virus function. In certain embodiments, the virus is selected from adenovirus, herpesvirus, poxvirus, or a hybrid virus thereof. In certain embodiments, the mammalian rAAV producing cell of the present disclosure comprises one or more viruses, vectors or plasmids that provide the helper virus function. In certain embodiments, the helper virus function comprises at least one of adenovirus (Ad) E1 protein (e.g., Ad E1a or Ad E1b protein), Ad E2A protein, Ad E4 protein and Ad VA RNA.
[0132] In certain embodiments, the mammalian rAAV producing cell of the present disclosure comprises a GOI. In certain non-limiting embodiments, the GOI comprises a nucleic acid sequence encoding a therapeutic protein or an inhibitory nucleic acid sequence. In certain embodiments, the GOI can be introduced/transferred by way of vector, such as AAV transduction or transfection into a cell. In certain embodiments, the introduced GOI can also exist in the recipient cell or host organism extrachromosomally, or only transiently.
[0133] In certain embodiments, the GOI encodes a protein (e.g., therapeutic protein) that is provided in modified or truncated forms or the GOI is provided in multiple constructs, delivered by separate and multiple AAV vectors.
[0134] In certain embodiments, the GOI is provided as a truncated variant that maintains functionality of the encoded protein (e.g., therapeutic protein), including removal of portions unnecessary for function, such that the GOI is reduced in size for packaging in an AAV vector.
[0135] In certain embodiments, the GOI is provided in split AAV vectors, each providing nucleic acid encoding different portions of a protein (e.g., therapeutic protein), thus delivering multiple portions of a protein (e.g., therapeutic protein) which assemble and function in the mammalian rAAV producing cell of the present disclosure.
[0136] In certain embodiments, the GOI is provided by dual AAV vectors using overlapping, trans-splicing or hybrid trans-splicing dual vector technology. In certain embodiments, two overlapping AAV vectors are used which combine in the mammalian rAAV producing cell of the present disclosure to generate a full expression cassette, from which a full-length protein (e.g., therapeutic protein) is expressed.
[0137] Non-limiting examples of heterologous nucleic acids encoding gene products (e.g., therapeutic proteins) which are useful in accordance with the invention include those that may be used in the treatment of a disease or disorder including, but not limited to, hemostasis or blood clotting disorders such as hemophilia A, hemophilia A patients with inhibitory antibodies, hemophilia B, deficiencies in coagulation Factors, VII, VIII, IX and X, XI, V, XII, II, von Willebrand factor, combined FV/FVIII deficiency, thalassemia, vitamin K epoxide reductase CI deficiency, gamma-carboxylase deficiency; anemia, bleeding associated with trauma, injury, thrombosis, thrombocytopenia, stroke, coagulopathy, disseminated intravascular coagulation (DIC); over-anticoagulation associated with heparin, low molecular weight heparin, pentasaccharide, warfarin, small molecule antithrombotics (i.e. FXa inhibitors); and platelet disorders such as, Bernard Soulier syndrome, Glanzman thromblastemia, and storage pool deficiency.
[0138] In certain embodiments, the disease or disorder affects or originates in the central nervous system (CNS). In certain embodiments, the disease is a neurodegenerative disease. In certain embodiments, the CNS or neurodegenerative disease is Alzheimer's disease, Huntington's disease, ALS, hereditary spastic hemiplegia, primary lateral sclerosis, spinal muscular atrophy, Kennedy's disease, a polyglutamine repeat disease, or Parkinson's disease. In certain embodiments, the CNS or neurodegenerative disease is a polyglutamine repeat disease. In certain embodiments, the polyglutamine repeat disease is a spinocerebellar ataxia (SCA1, SCA2, SCA3, SCA6, SCA7, or SCA17).
[0139] In certain embodiments, the AAV particles comprise a heterologous nucleic acid encoding a gene product selected from the group consisting of insulin, glucagon, growth hormone (GH), parathyroid hormone (PTH), growth hormone releasing factor (GRF), follicle stimulating hormone (FSH), luteinizing hormone (LH), human chorionic gonadotropin (hCG), vascular endothelial growth factor (VEGF), angiopoietins, angiostatin, granulocyte colony stimulating factor (GCSF), erythropoietin (EPO), connective tissue growth factor (CTGF), basic fibroblast growth factor (bFGF), acidic fibroblast growth factor (aFGF), epidermal growth factor (EGF), transforming growth factor a (TGFa), platelet-derived growth factor (PDGF), insulin growth factors I and II (IGF-I and IGF-II), TGFp, activins, inhibins, bone morphogenic protein (BMP), nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), neurotrophins NT-3 and NT4/5, ciliary neurotrophic factor (CNTF), glial cell line derived neurotrophic factor (GDNF), neurturin, agrin, netrin-1 and netrin-2, hepatocyte growth factor (HGF), ephrins, noggin, sonic hedgehog and tyrosine hydroxylase.
[0140] In certain embodiments, the AAV particles comprise a heterologous nucleic acid encoding a gene product selected from the group consisting of thrombopoietin (TPO), interleukins (IL1 through IL-17), monocyte chemoattractant protein, leukemia inhibitory factor, granulocyte-macrophage colony stimulating factor, Fas ligand, tumor necrosis factors ? and ?, interferons ?, ?, and ?, stem cell factor, flk-2/flt3 ligand, IgG, IgM, IgA, IgD and IgE, chimeric immunoglobulins, humanized antibodies, single chain antibodies, T cell receptors, chimeric T cell receptors, single chain T cell receptors, class I and class II MHC molecules.
[0141] In certain embodiments, the AAV particles comprise a heterologous nucleic acid encoding a gene product selected from the group consisting of carbamoyl synthetase I, ornithine transcarbamylase, arginosuccinate synthetase, arginosuccinate lyase, arginase, fumarylacetacetate hydrolase, phenylalanine hydroxylase, alpha-1 antitrypsin, glucose-6-phosphatase, porphobilinogen deaminase, factor V, factor VIII, factor IX, cystathione beta-synthase, branched chain ketoacid decarboxylase, albumin, isovaleryl-coA dehydrogenase, propionyl CoA carboxylase, methyl malonyl CoA mutase, glutaryl CoA dehydrogenase, insulin, beta-glucosidase, pyruvate carboxylate, hepatic phosphorylase, phosphorylase kinase, glycine decarboxylase, RPE65, H-protein, T-protein, a cystic fibrosis transmembrane regulator (CFTR) sequence, and a dystrophin cDNA sequence
[0142] In certain embodiments, the AAV particles comprise a heterologous nucleic acid encoding a polypeptide, a nucleic acid that encodes a protein or is transcribed into a transcript of interest, or nucleic acid, selected from the group consisting of a siRNA, an antisense molecule, miRNA a ribozyme and a shRNA.
[0143] In certain embodiments, the AAV particles comprise a heterologous nucleic that encodes a protein selected from the group consisting of GAA (acid alpha-glucosidase) for treatment of Pompe disease; ATP7B (copper transporting ATPase2) for treatment of Wilson's disease; alpha galactosidase for treatment of Fabry's disease; ASS1 (arginosuccinate synthase) for treatment of citrullinemia Type 1; beta-glucocerebrosidase for treatment of Gaucher disease Type 1; beta-hexosaminidase A for treatment of Tay Sachs disease; SERPING1 (C1 protease inhibitor or C1 esterase inhibitor) for treatment of hereditary angioedema (HAE), also known as C1 inhibitor deficiency type I and type II); and glucose-6-phosphatase for treatment of glycogen storage disease type I (GSDI).
[0144] In certain embodiments, a heterologous nucleic acid encodes CFTR (cystic fibrosis transmembrane regulator protein), a blood coagulation (clotting) factor (Factor XIII, Factor IX, Factor VIII, Factor X, Factor VII, Factor VIIa, protein C, etc.) a gain of function blood coagulation factor, an antibody, retinal pigment epithelium-specific 65 kDa protein (RPE65), erythropoietin, LDL receptor, lipoprotein lipase, ornithine transcarbamylase, ?-globin, ?-globin, spectrin, ?-antitrypsin, adenosine deaminase (ADA), a metal transporter (ATP7A or ATP7), sulfamidase, an enzyme involved in lysosomal storage disease (ARSA), hypoxanthine guanine phosphoribosyl transferase, ?-25 glucocerebrosidase, sphingomyelinase, lysosomal hexosaminidase, branched-chain keto acid dehydrogenase, a hormone, a growth factor, insulin-like growth factor 1 or 2, platelet derived growth factor, epidermal growth factor, nerve growth factor, neurotrophic factor ?3 and ?4, brain-derived neurotrophic factor, glial derived growth factor, transforming growth factor ? and ?, a cytokine, ?-interferon, ?-interferon, interferon-?, interleukin-2, interleukin-4, interleukin 12, granulocyte-macrophage colony stimulating factor, lymphotoxin, a suicide gene product, herpes simplex virus thymidine kinase, cytosine deaminase, diphtheria toxin, cytochrome P450, deoxycytidine kinase, tumor necrosis factor, a drug resistance protein, a tumor suppressor protein (e.g., p53, Rb, Wt-1, NF1, Von Hippel-Lindau (VHL), adenomatous polyposis coli (APC)), a peptide with immunomodulatory properties, a tolerogenic or immunogenic peptide or protein Tregitope or hCDR1, insulin, glucokinase, guanylate cyclase 2D (LCA-GUCY2D), Rab escort protein 1 (choroideremia), LCA 5 (LCA-Lebercilin), ornithine ketoacid aminotransferase (gyrate atrophy), retinoschisin 1 (X-linked retinoschisis), USH1C (Usher's Syndrome 1C), X-linked retinitis pigmentosa GTPase (XLRP), MERTK (AR forms of RP: retinitis pigmentosa), DFNB1 (connexin 26 deafness), ACHM 2, 3 and 4 (achromatopsia), PKD-1 or PKD-2 (polycystic kidney disease), TPP1, CLN2, a sulfatase, N-acetylglucosamine-1-phosphate transferase, cathepsin A, GM2-AP, NPC1, VPC2, a sphingolipid activator protein, one or more zinc finger nucleases for genome editing, or one or more donor sequences used as repair templates for genome editing.
[0145] Nucleic acid molecules, vectors such as cloning, expression vectors (e.g., vector genomes) and plasmids, may be prepared using recombinant DNA technology methods. The availability of nucleotide sequence information enables preparation of nucleic acid molecules by a variety of means. For example, a heterologous nucleic acid encoding Factor IX (FIX) comprising a vector or plasmid can be made using various standard cloning, recombinant DNA technology, via cell expression or in vitro translation and chemical synthesis techniques. Purity of polynucleotides can be determined through sequencing, gel electrophoresis and the like. For example, nucleic acids can be isolated using hybridization or computer-based database screening techniques. Such techniques include, but are not limited to: (1) hybridization of genomic DNA or cDNA libraries with probes to detect homologous nucleotide sequences; (2) antibody screening to detect polypeptides having shared structural features, for example, using an expression library; (3) polymerase chain reaction (PCR) on genomic DNA or cDNA using primers capable of annealing to a nucleic acid sequence of interest; (4) computer searches of sequence databases for related sequences; and (5) differential screening of a subtracted nucleic acid library.
EXAMPLES
[0146] The following examples are merely illustrative of the presently disclosed subject matter and should not be considered as limitations in any way.
Example 1: Rep-Degron Constructs and rAAV Production
[0147] Various constructs were designed for the development of mechanism for controllable Rep accumulation and higher rAAV production. Rep transgene was tagged at N-terminus or C-terminus with a destabilization domain (degron) to confer instability and target the translated Rep protein product to proteasome for degradation. The Rep protein degradation can be reversed by addition of the Shield1 ligand. The degron was modified from a human gene encoding FK506-binding protein 12 (FKBP12). It was previously shown that F36V modifications of the protein improves its specificity to Shield1 over FK506 (Clackson et al, PNAS 1998). Subsequent efforts to create a more unstable degron motif resulted in L107P mutation (Banaszynski et al, Cell 2006). The amino acid sequence of the degron that was used in the present example, referred to herein as FKBP, having a F36V and an L107P mutation, was:
TABLE-US-00003 MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKK VDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ RAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKPE
[0148] Production of rAAV: Recombinant AAV were produced by transfection of human embryonic kidney (HEK293) cells grown in 6-well plates. The cells at 70-90% confluency were transfected with 3 ?g of total DNA using jetOPTIMUS? DNA (PolyPlus)transfection reagent. The positive control rAAV produced with LK03 Rep/Cap plasmid were produced via triple transfection method. The plasmids were added in 1:1:1 ratio (1 helper: 1 ITR plasmid: 1 rep/cap plasmids). The rAAV plasmids produced with Split Rep/Cap plasmids were produced with quadruple plasmid transfection method where Rep and Cap plasmids were used in equal amounts to each other, but half of the helper and ITR plasmids (1 helper: 1 ITR plasmid: 0.5 Rep: 0.5 cap) unless stated otherwise. For the degron containing constructs, wt Rep or Rep/Cap plasmids were replaced with the degron containing Rep or Rep/Cap plasmids. Following transfection, cell culture media was replaced the next day. Small molecule Shield-1 (Takara) was added to the media of the corresponding samples after media change and cells were grown an additional 24-36 hours to allow for AAV production. The AAV in the crude cell lysate extract or in the media of the HEK293 cells were used to transduce the target cells.
[0149] For the use of rAAV in the crude extract, the cells were resuspended in the cell culture medium they were growing in and the suspension was transferred to 1.5 ml tubes. In lieu of detergent-based lyses, cells were lysed by four consecutive freeze and thaw cycles moving between dry ice and a 37? C. water bath. Samples were vortexed following each thaw cycle to enhance cell lysis and promoter viral particle release. Upon completion of lysis steps, the samples were spin down at 13,500?g for 10 minutes in an Eppendorf centrifuge set to 4? C. The supernatant containing rAAV particles was transferred to a fresh tube for use in transduction assays.
[0150] Transduction of cells: Huh7 cells were transduced with equivalent volume of cell lysate or the cell media containing the AAV vectors. Briefly, Huh7 cells were seeded into 24-well plates one day prior to transduction. Up to 50 ul of the unpurified viral preparations from HEK293 were added into culture medium of Huh7 cells at. Transduction efficiency was assessed in biological duplicates or triplicates. Culture media was replaced the following day, and samples were analyzed for transgene expression 48-72 hours after transduction. For detection of Luciferase expression, Huh7 cells were lysed in passive lysis buffer (Promega) and each biological sample was divided and plated to four wells of 96-well luminescence assay plate. Renilla Luciferase levels were determined using the Renilla Luciferase Assay Kit (Promega) and analyzed in a microplate luminometer (Spectramax) fitted with injectors.
[0151] Cloning of the plasmid constructs: The cloning of constructs having degron motifs were done using Gibson Assembly method. Briefly, the designed degron-linker sequences with desired homology regions were ordered as gBlocks fragments from Integrated DNA Technologies. The backbone containing Rep only plasmids or Rep/Cap plasmids and gblocks were joined using NEBuilder Hifi DNA Assembly Kit (New England Biolabs, #E5520). Upon plasmid purification and sequence verification, the plasmids with correct sequences were used for the rAAV production experiment.
[0152] As shown in
[0153] Transfection of cells with Transgene plasmid only, as shown in
Example 2: rAAV Produced by Transfection of Rep and Cap on Separate Plasmids
[0154] The methods of Example 1, except as specifically noted, were used to determine if rAAV can still be produced by transfection of Rep and Cap on separate plasmids. A Rep/Cap-plasmid without degron, a Rep-only plasmid without degron, and a Cap-only plasmid were tested. The Rep was under the control of a CMV promoter. For Cap, a CMV promoter (CMV-Cap (*), where the end of Rep is missing) and a P40 promoter (P40-Cap where the end of Rep is present) were used. As shown in
Example 3: Regulation of rAAV Production by the Addition of Shield1
[0155] The methods of Example 1, except as specifically noted, were used to determine whether addition of Shield1 can exert post-translational control over accumulation of Rep-Degron. Constructs were transfected to HEK293 cells with or without Cap plasmid (
Example 4: Regulation of Various Rep Constructs
[0156] The methods of Example 1, except as specifically noted, were used to determine whether the location of the degron (i.e., a C-terminally or N-terminally located degron) impacts the post-translational regulation of Rep expression. Huh7 cells were transduced with supernatant from HEK293 cells as described above. A P40-Cap plasmid was used to drive expression of Cap. As shown in
[0157] The methods of Example 1, except as specifically noted, were used to determine the effect of Shield1 on post-translational regulation of Rep expression in connection with constructs comprising both Rep and Cap coding sequences relative to constructs having Rep coding sequences only. P40-Cap plasmid was used to drive Cap expression where Cap Plasmid was provided (as noted by a +). As shown in
[0158] The methods of Example 1, except as specifically noted, were used to determine the effect on rAAV production of adding increasing amounts of plasmid encoding Rep with a C-terminally linked degron. As shown in
Example 5: Regulation of Rep Constructs with Rigid or Flexible Linkers
[0159] The methods of Example 1, except as specifically noted, were used to determine the effect of linker type between the C-terminus of Rep and the degron. Two types of linkers were tested; a rigid and a flexible linker
Example 6: Analyses of Rep Expression & AAV Production
[0160] A. Materials & Methods
[0161] a. Transfection
[0162] Expi293 cells were seeded 1.4E6 viable cells/mL in Expi293 media the day before transfection. Transfection was performed when the viable cells were between 2E6-3E6 cells/mL. PEI pro transfection reagent (Polyplus), OptiMEM (Gibco) were used. PEI:DNA ratio was 2 and 0.6 ?g DNA per million cells was used. Triple transfections were performed with RHM4-1 Rep Cap, Helper and Gaussia luciferase plasmids. Split Rep and Cap plasmids were used in a ratio of 1:4 (Rep:Cap). In some cases split Rep Cap plasmids and TIR1 or CMV-Tet were used in a ratio of 1:3:1 (Rep:Cap:TIR1 or CMV-Tet). 1.5 mM SAHA was added after the addition of DNA-PEI complexes. In some cases next day Shield1 or TMP or Auxin and/or Doxycycline was added. For Doxycycline treated samples another treatment of Dox was performed 24 hr later than first treatment. Cells harvested at 4,8,24 hr post-treatment and 44 hr or 68 hr or 72 hr post-transfection; centrifuged and washed with cold PBS. These cell pellets were kept at ?80 freezer. 1 mL of cells harvested 44 hr or 68 hr or 72 hr post-transfection for qPCR.
[0163] b. Western Blot
[0164] Cell pellets were lysed with RIPA buffer (Pierce) including protease and phosphatase inhibitors and EDTA on ice for 30 minutes. Lysates were centrifuged max speed for 15 minutes and supernatant was transferred to a new Eppendorf tube and used for Western. Protein concentrations were measured with BCA kit (Pierce). 30 lag protein per lane loaded for SDS-PAGE gels. These gels were transferred to either PVDF or Nitrocellulose membrane. Membranes were blocked with blocking buffer (Li-Cor) for 30 minutes at room temperature. Anti-AAV Rep clone 303.9 (ARP, cat #03-61069) purified mouse monoclonal antibody was diluted 500 times in either blocking buffer (Li-Cor) or antibody diluent (Li-Cor). Membranes were incubated overnight in cold room either rocking or non-rocking. Next day membranes were washed 3 times 10 minutes each with 1?TBST buffer (Invitrogen). Goat anti-mouse Alexa Flour 680 secondary antibody was diluted 1000 times in either blocking buffer (Li-Cor) or antibody diluent (Li-Cor). Membranes were incubated at room temperature rocking for 45 minutes. Then membranes were washed 6 times 10 minutes each with 1?TBST buffer. Membranes were scanned with Odyssey (Li-Cor). Anti-GAPDH rabbit antibody (Cell Signaling) was diluted 5000 times in either blocking buffer (Li-Cor) or antibody diluent (Li-Cor) as a loading control. Primary incubation was for 1 hour at room temperature rocking. Goat anti-rabbit Alexa Flour 800 secondary antibody was diluted 10000 times in either blocking buffer (Li-Cor) or antibody diluent (Li-Cor). c. qPCR
[0165] Frozen harvested cells were thawed and sonicated. 300 ?L sonicated cells were treated with Benzonase for 1 hour at 37? C. incubator on a rotator/shaker. Then DNaseI treatment was performed for 15 minutes. Reaction was stopped with stop reagent (0.2% SDS/5 mM EDTA/0.2M NaCl), heated at 95? C. for 10 minutes and centrifuged. Serial dilutions were performed to dilute 10000 or 100000 times. Taqman qPCR was performed with specific primers and probe using Quant Studio Real-Time PCR machine.
[0166] B. FKBP Degron Tagged Rep Protein Expression & AAV Production
[0167] In the instant study, the regulation of AAV production via Rep proteins with an FKBP derived degron was investigated. As a preliminary matter,
[0168] In this study, RHM4-1 was used as the AAV capsid in accordance with the Materials & Methods presented in Section 6A, above. As depicted in
[0169]
[0170]
[0171]
[0172]
[0173] C. ecDHFR Degron Tagged Rep Protein Expression & AAV Production
[0174] In the instant study, the regulation of AAV production via Rep proteins with an ecDHFR derived degron was investigated. The ecDHFR derived degron has the following amino acid sequence:
TABLE-US-00004 MISLIAALAVDYVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWES IGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGR VIEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQN SHSYCFEILERR.
[0175] The ecDHFR derived degron has the following DNA sequence:
TABLE-US-00005 ATGATCAGTCTGATTGCGGCGTTAGCGGTAGATTACGTTATCGGCATGG AAAACGCCATGCCGTGGAACCTGCCTGCCGATCTCGCCTGGTTTAAACG CAACACCTTAAATAAACCCGTGATTATGGGCCGCCATACCTGGGAATC AATCGGTCGTCCGTTGCCAGGACGCAAAAATATTATCCTCAGCAGTCA ACCGGGTACGGACGATCGCGTAACGTGGGTGAAGTCGGTGGATGAAGC CATCGCGGCGTGTGGTGACGTACCAGAAATCATGGTGATTGGCGGCGG TCGCGTTATTGAACAGTTCTTGCCAAAAGCGCAAAAACTGTATCTGACG CATATCGACGCAGAAGTGGAAGGCGACACCCATTTCCCGGATTACGAG CCGGATGACTGGGAATCGGTATTCAGCGAATTCCACGATGCTGATGCG CAGAACTCTCACAGCTATTGCTTTGAGATTCTGGAGCGGCGGTAA
In this study, RHM4-1 was used as the AAV capsid in accordance with the Materials & Methods presented in Section 6A, above.
[0176]
[0177]
[0178]
[0179] D. Auxin or ecDHFR Degron Tagged Rep Protein Expression & AAV Production
[0180] In the instant study, the regulation of AAV production via Rep proteins with either an auxin derived degron or ecDHFR derived degron was investigated. The auxin derived degron has the following amino acid sequence:
TABLE-US-00006 MGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANK EGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSC QKSSGGPEAAAFVKVSLDGAPYLRKIDLRLYKSYDELSNALSNLFSSFT.
[0181] The auxin derived degron has the following DNA sequence:
TABLE-US-00007 ATGGGCAGTGTCGAGCTGAATCTGAGGGAGACTGAGCTGTGTCTTGGT CTTCCCGGTGGAGATACAGTGGCTCCGGTAACCGGAAACAAGAGAGGG TTCTCAGAGACGGTTGATCTGAAGCTAAATCTGAATAATGAGCCTGCA AACAAGGAAGGATCTACGACTCATGACGTAGTGACTTTTGATTCCAAG GAGAAGAGTGCTTGTCCTAAAGATCCAGCCAAACCTCCGGCCAAGGCA CAAGTTGTGGGATGGCCACCGGTGAGATCATACCGGAAGAACGTGATG GTTTCCTGCCAAAAATCAAGCGGTGGCCCGGAGGCGGCGGCGTTCGTG AAGGTATCATTAGACGGAGCACCGTACTTGAGGAAAATCGATTTGAGG TTATATAAAAGCTACGATGAGCTTTCTAATGCTTTGTCCAACTTATTCA GCTCTTTTACCTGA
In this study, RHM4-1 was used as the AAV capsid in accordance with the Materials & Methods presented in Section 6A, above.
[0182]
[0183]
TABLE-US-00008 MQKRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVF IGNCYAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIE AMSSSYTWLEEIRLKRMVVTDDCLELIAKSFKNFKVLVLSSCEGFSTDG LAAIAATCRNLKELDLRESDVDDVSGHWLSHFPDTYTSLVSLNISCLAS EVSFSALERLVTRCPNLKSLKLNRAVPLEKLATLLQRAPQLEELGTGGY TAEVRPDVYSGLSVALSGCKELRCLSGFWDAVPAYLPAVYSVCSRLTTL NLSYATVQSYDLVKLLCQCPKLQRLWVLDYIEDAGLEVLASTCKDLREL RVFPSEPFVMEPNVALTEQGLVSVSMGCPKLESVLYFCRQMTNAALITI ARNRPNMTRFRLCIIEPKAPDYLTLEPLDIGFGAIVEHCKDLRRLSLSG LLTDKVFEYIGTYAKKMEMLSVAFAGDSDLGMHHVLSGCDSLRKLEIRD CPFGDKALLANASKLETMRSLWMSSCSVSFGACKLLGQKMPKLNVEVID ERGAPDSRPESCPVERVFIYRTVAGPRFDMPGFVWNMDQDSTMRFSRQI ITTNGL
Unlike FKBP and ecDHFR dependent degrons which prevent proteins degradation upon small molecule addition, Auxin Inducible degron leads to degradation of the protein it's tagged to. Auxin, TIR1 and degron needs to be present for Auxin Inducible Degron to be functional. The AAV production is undetectable for the sample with all the components (degron, auxin and TIR1) of Auxin mediated degron are present (Sample 4). This shows the functionality of this degron for AAV production regulation at the C-terminal of Rep protein. ecDHFR degron tagged Reps can produce AAV in the presence of TMP molecule (Sample 8) which was undetectable without TMP molecule (Sample 7).
[0184] E. Rep Protein Expression & AAV Production In the Presence of Shield1 or dTag13
[0185]
[0186] F. Rep Protein Expression & AAV Production Under Transcriptional Level Control System and/or Degron Level Control
[0187]
TABLE-US-00009 GAGTTTACTCCCTATCAGTGATAGAGAACGTATGAAGAGTTTACTCCCT ATCAGTGATAGAGAACGTATGCAGACTTTACTCCCTATCAGTGATAGA GAACGTATAAGGAGTTTACTCCCTATCAGTGATAGAGAACGTATGACC AGTTTACTCCCTATCAGTGATAGAGAACGTATCTACAGTTTACTCCCTA TCAGTGATAGAGAACGTATATCCAGTTTACTCCCTATCAGTGATAGAGA ACGTATAAGCTTTAGGCGTGTACGGTGGGCGCCTATAAAAGCAGAGCT CGTTTAGTGGGCGCGCCACCGTCAGATCGCCTGGAGCAATTCCACAAC ACTTTTGTCTTATACCAACTTTCCGTACCACTTCCTACCCTCGTAAA
In this study a Tet response element containing promoter (TRE3G) is cloned in front of the Rep gene as shown at
TABLE-US-00010 MSRLDKSKVINSALELLNGVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRA LLDALPIEMLDRHHTHSCPLEGESWQDFLRNNAKSYRCALLSHRDGAKVH LGTRPTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEEQE HQVAKEERETPTTDSMPPLLKQAIELFDROGAEPAFLFGLELIICGLEKQ LKCESGGPTDALDDFDLDMLPADALDDFDLDMLPADALDDFDLDMLPG
[0188] The DNA sequence of the CMV promoter is:
TABLE-US-00011 CGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTAT TAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGT TCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAA CGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACG CCAATAGGGACTTTCCATTGACGTCAATGGGTGGACTATTTACGGTAAA CTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCC TATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTAC ATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCA TCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGG ATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTC AATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTC GTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGT GGGAGGTCTATATAAGCAGAGCTCTCTGGCTAACTAGAGAACCCACTG CTTACTGGCTTATCGAAATT
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
Example 7: Degron Tagged Helper Genes for Regulated AAV Production
[0196] As illustrated in this example, degron tagged Helper genes can be used for regulating AAV production. The classical helper plasmid used for AAV production comprises E2A, E4 and VA genes. In this example, open reading frames from E2A, E4 and VA genes were cloned into separate plasmids. The selected open reading frames for E2A, E4 and VA are DBP, E4-E34K and VA2 respectively. The triple transfection method described in Examples 1-6 was modified to allow E2A-DBP, E4-E34K or VA2 genes to be supplied in separate plasmids instead of a single Helper plasmid for use in triple production.
[0197] A. Materials & Methods
[0198] For the instant degron studies utilizing helper genes, the DNA Binding Protein (DBP), E4-E34K gene and VA2 were selected respectively as the open reading frames for E2A, E4 and VA genes. These selected open reading frames from the E2A, E4 and VA genes were cloned into separate plasmids under the control of CMV promoter. An FKBP derived degron was cloned into the C-terminal of the E2A-DBP gene.
[0199] The triple transfection method was modified to allow E2A-DBP, E4-E34K and VA2 genes to be supplied in three separate plasmids instead of a single Helper plasmid. For transfection and cell lysis same reagents and methods were used as Rep-degron experiments described herein. The molar ratio for the plasmids used for quintuple transfection (ITR-GOI: Rep/Cap: DBP: E34K: VA2) with separate Helper plasmids was 2:2:1:1:1. The molar ratios for the plasmids used for triple transfection (ITR-GOI: Rep/Cap: Helper) with single Helper plasmid was 2:2:1. Negative control samples where AAV production was prevented was achieved by transfecting the cells with only with ITR-GOI plasmid (i.e., Helper and Rep/Cap plasmids were omitted). For DBP western blot analysis of the results of the experiments, an anti-DBP polyclonal antibody from CusaBio was used (CSB-PA365892ZA01HIL).
[0200] B. Experimental Results
[0201] As indicated in
[0202]
[0203] C. Sequences of Helper Genes Used
TABLE-US-00012 E2A-DBPnucleicacidsequence ATGGCCAGTCGGGAAGAGGAGCAGCGCGAAACCACCCCCGAGCGC GGACGCGGTGCGGCGCGACGTCCACCAACCATGGAGGACGTGTCGTCCCCGT CGCCGTCGCCGCCGCCTCCCCGCGCGCCCCCAAAAAAGCGGCTGAGGCGGCG TCTCGAGTCCGAGGACGAAGAAGACTCGTCACAAGATGCGCTGGTGCCGCGC ACACCCAGCCCGCGGCCATCGACCTCGACGGCGGATTTGGCCATTGCGTCCAA AAAGAAAAAGAAGCGCCCCTCTCCCAAGCCCGAGCGCCCGCCATCCCCAGAG GTGATCGTGGACAGCGAGGAAGAAAGAGAAGATGTGGCGCTACAAATGGTGG GTTTCAGCAACCCACCGGTGCTAATCAAGCACGGCAAGGGAGGTAAGCGCAC GGTGCGGCGGCTGAATGAAGACGACCCAGTGGCGCGGGGTATGCGGACGCAA GAGGAAAAGGAAGAGTCCAGTGAAGCGGAAAGTGAAAGCACGGTGATAAAC CCGCTGAGCCTGCCGATCGTGTCTGCGTGGGAGAAGGGCATGGAGGCTGCGC GCGCGTTGATGGACAAGTACCACGTGGATAACGATCTAAAGGCAAACTTCAA GCTACTGCCTGACCAAGTGGAAGCTCTGGCGGCCGTATGCAAGACCTGGCTAA ACGAGGAGCACCGCGGGTTGCAGCTGACCTTCACCAGCAACAAGACCTTTGTG ACGATGATGGGGCGATTCCTGCAGGCGTACCTGCAGTCGTTTGCAGAGGTAAC CTACAAGCACCACGAGCCCACGGGCTGCGCGTTGTGGCTGCACCGCTGCGCTG AGATCGAAGGCGAGCTTAAGTGTCTACACGGGAGCATTATGATAAATAAGGA GCACGTGATTGAAATGGATGTGACGAGCGAAAACGGGCAGCGCGCGCTGAAG GAGCAGTCTAGCAAGGCCAAGATCGTGAAGAACCGGTGGGGCCGAAATGTGG TGCAGATCTCCAACACCGACGCAAGGTGCTGCGTGCATGACGCGGCCTGTCCG GCCAATCAGTTTTCCGGCAAGTCTTGCGGCATGTTCTTCTCTGAAGGCGCAAA GGCTCAGGTGGCTTTTAAGCAGATCAAGGCTTTCATGCAGGCGCTGTATCCTA ACGCCCAGACCGGGCACGGTCACCTTCTGATGCCACTACGGTGCGAGTGCAAC TCAAAGCCTGGGCATGCACCCTTTTTGGGAAGGCAGCTACCAAAGTTGACTCC GTTCGCCCTGAGCAACGCGGAGGACCTGGACGCGGATCTGATCTCCGACAAG AGCGTGCTGGCCAGCGTGCACCACCCGGCGCTGATAGTGTTCCAGTGCTGCAA CCCTGTGTATCGCAACTCGCGCGCGCAGGGCGGAGGCCCCAACTGCGACTTCA AGATATCGGCGCCCGACCTGCTAAACGCGTTGGTGATGGTGCGCAGCCTGTGG AGTGAAAACTTCACCGAGCTGCCGCGGATGGTTGTGCCTGAGTTTAAGTGGAG CACTAAACACCAGTATCGCAACGTGTCCCTGCCAGTGGCGCATAGCGATGCGC GGCAGAACCCCTTTGATTTTTAA E2A-DBPaminoacidSequence MASREEEQRETTPERGRGAARRPPTMEDVSSPSPSPPPPRAPPKKRLRR RLESEDEEDSSQDALVPRTPSPRPSTSTADLAIASKKKKKRPSPKPERPPSPEVIVDS EEEREDVALQMVGFSNPPVLIKHGKGGKRTVRRLNEDDPVARGMRTQEEKEESS EAESESTVINPLSLPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEAL AAVCKTWLNEEHRGLQLTFTSNKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCA LWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRW GRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQA LYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISD KSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWS ENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF* E4-34K(ORF6)NucleicAcidSequence ATGACTACGTCCGGCGTTCCATTTGGCATGACACTACGACCAACAC GATCTCGGTTGTCTCGGCGCACTCCGTACAGTAGGGATCGCCTACCTCCTTTTG AGACAGAGACCCGCGCTACCATACTGGAGGATCATCCGCTGCTGCCCGAATGT AACACTTTGACAATGCACAACGTGAGTTACGTGCGAGGTCTTCCCTGCAGTGT GGGATTTACGCTGATTCAGGAATGGGTTGTTCCCTGGGATATGGTTCTGACGC GGGAGGAGCTTGTAATCCTGAGGAAGTGTATGCACGTGTGCCTGTGTTGTGCC AACATTGATATCATGACGAGCATGATGATCCATGGTTACGAGTCCTGGGCTCT CCACTGTCATTGTTCCAGTCCCGGTTCCCTGCAGTGCATAGCCGGCGGGCAGG TTTTGGCCAGCTGGTTTAGGATGGTGGTGGATGGCGCCATGTTTAATCAGAGG TTTATATGGTACCGGGAGGTGGTGAATTACAACATGCCAAAAGAGGTAATGTT TATGTCCAGCGTGTTTATGAGGGGTCGCCACTTAATCTACCTGCGCTTGTGGTA TGATGGCCACGTGGGTTCTGTGGTCCCCGCCATGAGCTTTGGATACAGCGCCT TGCACTGTGGGATTTTGAACAATATTGTGGTGCTGTGCTGCAGTTACTGTGCTG ATTTAAGTGAGATCAGGGTGCGCTGCTGTGCCCGGAGGACAAGGCGTCTCATG CTGCGGGCGGTGCGAATCATCGCTGAGGAGACCACTGCCATGTTGTATTCCTG CAGGACGGAGCGGCGGCGGCAGCAGTTTATTCGCGCGCTGCTGCAGCACCAC CGCCCTATCCTGATGCACGATTATGACTCTACCCCCATGTAG E4-34K(ORF6)AminoAcidSequence MTTSGVPFGMTLRPTRSRLSRRTPYSRDRLPPFETETRATILEDHPLLPE CNTLTMHNVSYVRGLPCSVGFTLIQEWVVPWDMVLTREELVILRKCMHVCLCCA NIDIMTSMMIHGYESWALHCHCSSPGSLQCIAGGQVLASWFRMVVDGAMFNQRF IWYREVVNYNMPKEVMFMSSVFMRGRHLIYLRLWYDGHVGSVVPAMSFGYSAL HCGILNNIVVLCCSYCADLSEIRVRCCARRTRRLMLRAVRIIAEETTAMLYSCRTE RRRQQFIRALLQHHRPILMHDYDSTPMCIFEQGGGGSGGGGSGGGGSMGVQVETI SPGDGRTFPKRGQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEE GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKPE* VA2nucleicacidsequence: ATGCTGTTTCCGGAGGAATTTGCAAGCGGGGTCTTGCATGACGGGG AGGCAAACCCCCGTTCGCCGCAGTCCGGCCGGCCCGAGACTCGAACCGGGGG TCCTGCGACTCAACCCTTGGAAAATAACCCTCCGGCTACAGGGAGCGAGCCAC TTAATGCTTTCGCTTTCCAGCCTAACCGCTTACGCCGCGCGCGGCCAGTGGCC AAAAAAGCTAGCGCAGCAGCCGCCGCGCCTGGAAGGAAGCCAAAAGGAGCG CTCCCCCGTTGTCTGACGTCGCACACCTGGGTTCGACACGCGGGCGGTAACCG CATGGATCACGGCGGACGGCCGGATCCGGGGTTCGAACCCCGGTCGTCCGCC ATGATACCCTTGCGAATTTATCCACCAGACCACGGAAGAGTGCCCGCTTACAG GCTCTCCTTTTGCACGGTCTAG VA2aminoacidsequence: MLFPEEFASGVLHDGEANPRSPQSGRPETRTGGPATQPLENNPPATGS EPLNAFAFQPNRLRRARPVAKKASAAAAAPGRKPKGALPRCLTSHTWVRHAGGN RMDHGGRPDPGFEPRSSAMIPLRIYPPDHGRVPAYRLSFCTV* ***
[0204] All publications, patents and other references cited herein are incorporated by reference in their entirety into the present disclosure