Fusion proteins useful for modifying terpenes

11939618 ยท 2024-03-26

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides for a fusion protein comprising: (a) a terpene synthase (TS), or a homolog thereof, (b) a peptide linker, and (c) a P450 enzyme, or a homolog thereof.

Claims

1. A fusion protein comprising: (a) a terpene synthase (TS) comprising an amino acid sequence having (i) at least 90% identity with SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, or SEQ ID NO:16, and (ii) the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17) or the amino acid sequence Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), (b) a peptide linker, and (c) a P450 enzyme comprising (i) an amino acid sequence having at least 90% identity with SEQ ID NO:19 or SEQ ID NO:20, and (ii) a CXG motif or EXXR motif.

2. The fusion protein of claim 1, wherein the TS comprises an amino acid sequence having at least 95% identity with SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, or SEQ ID NO:16.

3. The fusion protein of claim 1, wherein the TS comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17).

4. The fusion protein of claim 1, wherein the TS comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18).

5. The fusion protein of claim 1, wherein the P450 enzyme comprises an amino acid sequence having at least 95% identity with SEQ ID NO:19 or SEQ ID NO:20.

6. The fusion protein of claim 1, wherein the P450 enzyme comprises the amino acid sequence FXXGXRXCXG (SEQ ID NO:21).

7. The fusion protein of claim 1, wherein the peptide linker comprises of 0-1000 amino acid residues.

8. The fusion protein of claim 7, wherein the peptide linker comprises of 1-5 repeats of the amino acid sequence GSG.

9. A genetically modified host cell capable of producing a modified terpenes, said genetically modified host cell comprising the fusion protein of claim 1.

10. A nucleic acid comprising a nucleotide sequence encoding the fusion protein of claim 1 operatively linked to a promoter.

11. A vector comprising the nucleic acid of claim 10.

12. A genetically modified host cell capable of producing a modified terpenes, said genetically modified host cell comprising the nucleic acid of claim 10 or a vector of claim 11.

13. The genetically modified host cell of claim 12, wherein the genetically modified host cell is a bacterium.

14. The genetically modified host cell of claim 13, wherein the bacterium is of the genus Escherichia, Enterobacter, Azotobacter, Erwinia, Bacillus, Pseudomonas, Klebsielia, Proteus, Salmonella, Serratia, Shigella, Rhizobia, Vitreoscilla, or Paracoccus.

15. The genetically modified host cell of claim 12, wherein the genetically modified host cell is a eukaryotic cell.

16. The genetically modified host cell of claim 15, wherein the eukaryotic cell is a yeast.

17. A method for producing a modified terpene comprising: (a) providing the genetically modified host cell of claim 1, or a culture thereof, (b) culturing or growing the genetically modified host cell to produce the modified terpene, (c) and/or extracting or separating the modified terpene from the culture, and (d) and/or introducing a fuel additive to the extracted or separated the modified terpene.

18. A fuel composition comprising: (a) a modified terpene produced by the fusion protein of claim 1; and (b) a fuel additive.

19. The fusion protein of claim 2, wherein the TS comprises an amino acid sequence having at least 99% identity with SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, or SEQ ID NO:16.

20. The fusion protein of claim 19, wherein the TS comprises an amino acid sequence comprising SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, or SEQ ID NO:16.

21. The fusion protein of claim 5, wherein the P450 enzyme comprises an amino acid sequence having at least 99% identity with SEQ ID NO:19 or SEQ ID NO:20.

22. The fusion protein of claim 21, wherein the P450 enzyme comprises an amino acid sequence comprising SEQ ID NO:19 or SEQ ID NO:20.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The foregoing aspects and others will be readily appreciated by the skilled artisan from the following description of illustrative embodiments when read in conjunction with the accompanying drawings.

(2) FIG. 1. Oxidation of (?)-limonene and 1,8-cineole.

(3) FIG. 2A. Biosynthetic pathway of carvolactone.

(4) FIG. 2B. Carvone yield vs. dehydrogenase variants.

(5) FIG. 2C. Dihydrocarvone yield vs. reductase variants.

(6) FIG. 2D. Mass spectra showing carvolactone peak.

(7) FIG. 3. A particular embodiment of the engineered fusion protein of the present invention.

(8) FIG. 4. Engineering enzyme fusions by linking terpene synthase and P450 enzyme for the production of oxidized terpenes. GPP, geranyl pyrophosphate; FPP, farnesyl pyrophosphate; CS, 1,8-cineole synthase; EizS, epi-isozizaene synthase; GPPS, geranyl pyrophosphate synthase.

(9) FIG. 5A. In vitro production of hydroxycineole. In vitro two-step reaction from GPP.

(10) FIG. 5B. In vitro production of hydroxycineole. SDS-PAGE gel of purified non-fusion and fusions for CS and P450.sub.cin. Fusions of 1,8-cineole synthase (CS) and P450.sub.cin are engineered with 1 to 5 repeats of the Gly-Ser-Gly (GSG) peptide linker. Size of purified proteins: CS, 40.71 KDa; P450.sub.cin (CinA), 48.25 KDa; G1, 86.16 KDa; G2, 86.37 KDa; G3, 86.57 KDa; G4, 86.77 KDa; G5, 86.97 KDa.

(11) FIG. 5C. In vitro production of hydroxycineole. In vitro time-course production of hydroxycineole and cineole with purified proteins. Error bars indicate one standard deviation (n=3).

(12) FIG. 5D. In vitro production of hydroxycineole. Hydroxylation ratio of in vitro reaction after 5 hours. Hydroxylation ratio is the molar ratio of hydroxycineole out of the total generated terpenes (1,8-cineole and hydroxycineole).

(13) FIG. 6A. In vivo production of hydroxycineole by E. coli DH1 strains with engineered enzyme fusions. Metabolic pathway of hydroxycineole production from glucose using enzyme fusions of 1,8-cineole synthase (CS) and P450.sub.cin, CS-(GSG).sub.n-P450.sub.cin (n=1-5).

(14) FIG. 6B. In vivo production of hydroxycineole by E. coli DH1 strains with engineered enzyme fusions. OD.sub.600 of production strains after 48 hours. Error bars indicate one standard deviation (n=3).

(15) FIG. 6C. In vivo production of hydroxycineole by E. coli DH1 strains with engineered enzyme fusions. Production of 1,8-cineole and hydroxycineole with and without using solvent overlay. Error bars indicate one standard deviation (n=3).

(16) FIG. 7A. Production of oxidized epi-isozizaene with engineered enzyme fusions in E. coli DH1. Metabolic pathway of oxidized epi-isozizaene production from glucose using enzyme fusions of epi-isozizaene synthase (EizS) and CYP170A1, EizS-(GSG).sub.n-CYP170A1 (n=1-5), FPP, farnesyl pyrophosphate.

(17) FIG. 7B. Production of oxidized epi-isozizaene with engineered enzyme fusions in E. coli DH1. OD.sub.600 of production strains after 72 hours. Error bars indicate one standard deviation (n=3).

(18) FIG. 7C. Production of oxidized epi-isozizaene with engineered enzyme fusions in E. coli DH1. Production of epi-isozizaene with and without using solvent overlay. Error bars indicate one standard deviation (n=3).

(19) FIG. 7D. Production of oxidized epi-isozizaene with engineered enzyme fusions in E. coli DH1. Production of oxidized epi-isozizaene (albaflavenol, albaflavenone) with and without using solvent overlay. Error bars indicate one standard deviation (n=3).

DETAILED DESCRIPTION OF THE INVENTION

(20) Before the invention is described in detail, it is to be understood that, unless otherwise indicated, this invention is not limited to particular sequences, expression vectors, enzymes, host microorganisms, or processes, as such may vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting.

(21) As used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to an expression vector includes a single expression vector as well as a plurality of expression vectors, either the same (e.g., the same operon) or different; reference to cell includes a single cell as well as a plurality of cells; and the like.

(22) In this specification and in the claims that follow, reference will be made to a number of terms that shall be defined to have the following meanings:

(23) The terms optional or optionally as used herein mean that the subsequently described feature or structure may or may not be present, or that the subsequently described event or circumstance may or may not occur, and that the description includes instances where a particular feature or structure is present and instances where the feature or structure is absent, or instances where the event or circumstance occurs and instances where it does not.

(24) The term about as used herein means a value that includes 10% less and 10% more than the value referred to.

(25) The terms host cell and host microorganism are used interchangeably herein to refer to a living biological cell, such as a microbe, that can be transformed via insertion of an expression vector. Thus, a host organism or cell as described herein may be a prokaryotic organism (e.g., an organism of the kingdom Eubacteria) or a eukaryotic cell. As will be appreciated by one of ordinary skill in the art, a prokaryotic cell lacks a membrane-bound nucleus, while a eukaryotic cell has a membrane-bound nucleus.

(26) The term heterologous DNA as used herein refers to a polymer of nucleic acids wherein at least one of the following is true: (a) the sequence of nucleic acids is foreign to (i.e., not naturally found in) a given host microorganism; (b) the sequence may be naturally found in a given host microorganism, but in an unnatural (e.g., greater than expected) amount; or (c) the sequence of nucleic acids comprises two or more subsequences that are not found in the same relationship to each other in nature. The term heterologous as used herein refers to a structure or molecule wherein at least one of the following is true: (a) the structure or molecule is foreign to (i.e., not naturally found in) a given host microorganism; or (b) the structure or molecule may be naturally found in a given host microorganism, but in an unnatural (e.g., greater than expected) amount. For example, regarding instance (c), a heterologous nucleic acid sequence that is recombinantly produced will have two or more sequences from unrelated genes arranged to make a new functional nucleic acid. Specifically, the present invention describes the introduction of an expression vector into a host microorganism, wherein the expression vector contains a nucleic acid sequence coding for an enzyme that is not normally found in a host microorganism. With reference to the host microorganism's genome, then, the nucleic acid sequence that codes for the enzyme is heterologous.

(27) The terms expression vector or vector refer to a compound and/or composition that transduces, transforms, or infects a host microorganism, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell, or in a manner not native to the cell. An expression vector contains a sequence of nucleic acids (ordinarily RNA or DNA) to be expressed by the host microorganism. Optionally, the expression vector also comprises materials to aid in achieving entry of the nucleic acid into the host microorganism, such as a virus, liposome, protein coating, or the like. The expression vectors contemplated for use in the present invention include those into which a nucleic acid sequence can be inserted, along with any preferred or required operational elements. Further, the expression vector must be one that can be transferred into a host microorganism and replicated therein. Preferred expression vectors are plasmids, particularly those with restriction sites that have been well documented and that contain the operational elements preferred or required for transcription of the nucleic acid sequence. Such plasmids, as well as other expression vectors, are well known to those of ordinary skill in the art.

(28) The term transduce as used herein refers to the transfer of a sequence of nucleic acids into a host microorganism or cell. Only when the sequence of nucleic acids becomes stably replicated by the cell does the host microorganism or cell become transformed. As will be appreciated by those of ordinary skill in the art, transformation may take place either by incorporation of the sequence of nucleic acids into the cellular genome, i.e., chromosomal integration, or by extrachromosomal integration. In contrast, an expression vector, e.g., a virus, is infective when it transduces a host microorganism, replicates, and (without the benefit of any complementary virus or vector) spreads progeny expression vectors, e.g., viruses, of the same type as the original transducing expression vector to other microorganisms, wherein the progeny expression vectors possess the same ability to reproduce.

(29) As used herein, the terms nucleic acid sequence, sequence of nucleic acids, and variations thereof shall be generic to polydeoxyribonucleotides (containing 2-deoxy-D-ribose), to polyribonucleotides (containing D-ribose), to any other type of polynucleotide that is an N-glycoside of a purine or pyrimidine base, and to other polymers containing nonnucleotidic backbones, provided that the polymers contain nucleobases in a configuration that allows for base pairing and base stacking, as found in DNA and RNA. Thus, these terms include known types of nucleic acid sequence modifications, for example, substitution of one or more of the naturally occurring nucleotides with an analog; internucleotide modifications, such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), with negatively charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), and with positively charged linkages (e.g., aminoalklyphosphoramidates, aminoalkylphosphotriesters); those containing pendant moieties, such as, for example, proteins (including nucleases, toxins, antibodies, signal peptides, poly-L-lysine, etc.); those with intercalators (e.g., acridine, psoralen, etc.); and those containing chelators (e.g., metals, radioactive metals, boron, oxidative metals, etc.). As used herein, the symbols for nucleotides and polynucleotides are those recommended by the IUPAC-IUB Commission of Biochemical Nomenclature (Biochem. 9:4022, 1970).

(30) The term operably linked refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.

(31) Terpenes are a large class of organic compounds, primarily produced by plants and constitute the main components of essential oils. Functionalization of the terpene carbon backbone using various downstream processing enzymes, such as cytochrome P450 enzymes, could derive many useful compounds that can be converted to higher value products. Production of terpenes and their functionalized products through microbial metabolic engineering are considered a favorable green strategy compared with isolation from the natural plants or chemical synthesis. However, as terpenes are usually hydrophobic and volatile compounds, the severe evaporation limits their availabilities surrounding downstream processing enzymes (such as cytochrome P450) toward adding functional groups. Particularly, when a solvent overlay is used to trap terpenes and prevent evaporation during the microbial production, it facilitates the isolation of terpenes from the cell and worsens the downstream processing reaction.

(32) One possible solution is to engineer a fusion protein between terpene synthase and downstream processing enzymes that could improve the spatial favorability for downstream processing enzymes and the terpene substrate, which in turn would improve the substrate availability for downstream conversion. In some embodiments, an enzyme fusion strategy is developed by linking a terpene synthase (or a terpene cyclase) and downstream processing enzyme, specifically cytochrome P450 enzymes. In some embodiments, a series of fusion proteins is engineered between 1,8-cineole synthase and P450cin (CYP176A1) with different lengths of peptide linker to investigate the hydroxylation of 1,8-cineole to produce hydroxycineole. The production of hydroxycineole from both in vitro and in vivo conditions is compared between the fusion and non-fusion proteins. Results show the engineered enzyme fusion is more efficient than non-fused individual enzymes, suggesting a feasible strategy for efficient production of functionalized terpenes as well as possible application during the production of terpene-based bioproducts. Compared with the non-fused enzymes, results show that hydroxycineole production under the in vitro conditions is increased up to 5.2 folds from the enzyme fusion and the production rate is up to 10.5 folds faster. The engineered enzyme fusion is also integrated into a 1,8-cineole overproducing E. coli strain using the mevalonate pathway to investigate the hydroxylation of 1,8-cineole at the in vivo conditions. Results show that the enzyme fusion produced up to 2.8-fold more hydroxycineole than the non-fused enzymes. Thus, the engineered fusion showed higher efficiency during the hydroxylation of 1,8-cineole from both in vitro and in vivo results. This suggests that engineering an enzyme fusion between terpene synthase (or terpene cyclase) and downstream processing enzyme (such as P450) presents a feasible strategy for efficient production of functionalized terpenes, as well as possible applications (i.e. epoxidation, cyclopropanation, and, nitration, and the like) during the production of terpene-based bioproducts (such as, limonene-1,2-epoxide, perillyl alcohol, artemisinic alcohol, and the like).

(33) In some embodiments, the modifying enzyme is a transaminase, N-oxygenase, or methyl-transferase. In some embodiments, the P450 or other modifying enzyme, or homolog thereof, is any enzyme listed in Table 1.

(34) TABLE-US-00001 TABLE 1 Suitable modifying enzymes and corresponding terpene substrate and products thereof. Potential Terpene reaction substrates Products Enzyme Oxidation Amorphadiene Artemsinic acid 1.14.14.114 Valencene Nootkatone 1.14.14.1 Limonene Perillyl alcohol 1.14.15.1 Limonene Carveol 1.14.14.51 Limonene Isopiperitenol 1.14.14.99 Limonene Limonene-1,2- 1.14.13.107 epoxide Terpineol Sobrerol (Mucolytic 1.14.14.1 agent) Pinene Verbenol (insect 1.14.15.1 pheromone) Amination Ketones Terpene amines transaminase Nitration Terpene amine Nitro terpenoids N-oxygenase Cyclopropanation Methyl transferase
Enzymes, and Nucleic Acids Encoding Thereof

(35) A homologous enzyme is an enzyme that has a polypeptide sequence that is at least 70%, 75%, 80%, 85%, 90%, 95% or 99% identical to any one of the enzymes described in this specification or in an incorporated reference. The homologous enzyme retains amino acids residues that are recognized as conserved for the enzyme. The homologous enzyme may have non-conserved amino acid residues replaced or found to be of a different amino acid, or amino acid(s) inserted or deleted, but which does not affect or has insignificant effect on the enzymatic activity of the homologous enzyme. The homologous enzyme has an enzymatic activity that is identical or essentially identical to the enzymatic activity any one of the enzymes described in this specification or in an incorporated reference. The homologous enzyme may be found in nature or be an engineered mutant thereof.

(36) The nucleic acid constructs of the present invention comprise nucleic acid sequences encoding one or more of the subject enzymes. The nucleic acid of the subject enzymes are operably linked to promoters and optionally control sequences such that the subject enzymes are expressed in a host cell cultured under suitable conditions. The promoters and control sequences are specific for each host cell species. In some embodiments, expression vectors comprise the nucleic acid constructs. Methods for designing and making nucleic acid constructs and expression vectors are well known to those skilled in the art.

(37) Sequences of nucleic acids encoding the subject enzymes are prepared by any suitable method known to those of ordinary skill in the art, including, for example, direct chemical synthesis or cloning. For direct chemical synthesis, formation of a polymer of nucleic acids typically involves sequential addition of 3-blocked and 5-blocked nucleotide monomers to the terminal 5-hydroxyl group of a growing nucleotide chain, wherein each addition is effected by nucleophilic attack of the terminal 5-hydroxyl group of the growing chain on the 3-position of the added monomer, which is typically a phosphorus derivative, such as a phosphotriester, phosphoramidite, or the like. Such methodology is known to those of ordinary skill in the art and is described in the pertinent texts and literature (e.g., in Matteuci et al. (1980) Tet. Lett. 521:719; U.S. Pat. Nos. 4,500,707; 5,436,327; and 5,700,637). In addition, the desired sequences may be isolated from natural sources by splitting DNA using appropriate restriction enzymes, separating the fragments using gel electrophoresis, and thereafter, recovering the desired nucleic acid sequence from the gel via techniques known to those of ordinary skill in the art, such as utilization of polymerase chain reactions (PCR; e.g., U.S. Pat. No. 4,683,195).

(38) Each nucleic acid sequence encoding the desired subject enzyme can be incorporated into an expression vector. Incorporation of the individual nucleic acid sequences may be accomplished through known methods that include, for example, the use of restriction enzymes (such as BamHI, EcoRI, HhaI, Xhol, XmaI, and so forth) to cleave specific sites in the expression vector, e.g., plasmid. The restriction enzyme produces single stranded ends that may be annealed to a nucleic acid sequence having, or synthesized to have, a terminus with a sequence complementary to the ends of the cleaved expression vector. Annealing is performed using an appropriate enzyme, e.g., DNA ligase. As will be appreciated by those of ordinary skill in the art, both the expression vector and the desired nucleic acid sequence are often cleaved with the same restriction enzyme, thereby assuring that the ends of the expression vector and the ends of the nucleic acid sequence are complementary to each other. In addition, DNA linkers may be used to facilitate linking of nucleic acids sequences into an expression vector.

(39) A series of individual nucleic acid sequences can also be combined by utilizing methods that are known to those having ordinary skill in the art (e.g., U.S. Pat. No. 4,683,195).

(40) For example, each of the desired nucleic acid sequences can be initially generated in a separate PCR. Thereafter, specific primers are designed such that the ends of the PCR products contain complementary sequences. When the PCR products are mixed, denatured, and reannealed, the strands having the matching sequences at their 3 ends overlap and can act as primers for each other Extension of this overlap by DNA polymerase produces a molecule in which the original sequences are spliced together. In this way, a series of individual nucleic acid sequences may be spliced together and subsequently transduced into a host microorganism simultaneously. Thus, expression of each of the plurality of nucleic acid sequences is effected.

(41) Individual nucleic acid sequences, or spliced nucleic acid sequences, are then incorporated into an expression vector. The invention is not limited with respect to the process by which the nucleic acid sequence is incorporated into the expression vector. Those of ordinary skill in the art are familiar with the necessary steps for incorporating a nucleic acid sequence into an expression vector. A typical expression vector contains the desired nucleic acid sequence preceded by one or more regulatory regions, along with a ribosome binding site, e.g., a nucleotide sequence that is 3-9 nucleotides in length and located 3-11 nucleotides upstream of the initiation codon in E. coli. See Shine et al. (1975) Nature 254:34 and Steitz, in Biological Regulation and Development: Gene Expression (ed. R. F. Goldberger), vol. 1, p. 349, 1979, Plenum Publishing, N.Y.

(42) Regulatory regions include, for example, those regions that contain a promoter and an operator. A promoter is operably linked to the desired nucleic acid sequence, thereby initiating transcription of the nucleic acid sequence via an RNA polymerase enzyme. An operator is a sequence of nucleic acids adjacent to the promoter, which contains a protein-binding domain where a repressor protein can bind. In the absence of a repressor protein, transcription initiates through the promoter. When present, the repressor protein specific to the protein-binding domain of the operator binds to the operator, thereby inhibiting transcription. In this way, control of transcription is accomplished, based upon the particular regulatory regions used and the presence or absence of the corresponding repressor protein. An example includes lactose promoters (LacI repressor protein changes conformation when contacted with lactose, thereby preventing the Lad repressor protein from binding to the operator). Another example is the tac promoter. (See deBoer et al. (1983) Proc. Natl. Acad. Sci. USA, 80:21-25.) As will be appreciated by those of ordinary skill in the art, these and other expression vectors may be used in the present invention, and the invention is not limited in this respect.

(43) Although any suitable expression vector may be used to incorporate the desired sequences, readily available expression vectors include, without limitation: plasmids, such as pSC101, pBR322, pBBR1MCS-3, pUR, pEX, pMR100, pCR4, pBAD24, pUC19; bacteriophages, such as M13 phage and ? phage. Of course, such expression vectors may only be suitable for particular host cells. One of ordinary skill in the art, however, can readily determine through routine experimentation whether any particular expression vector is suited for any given host cell. For example, the expression vector can be introduced into the host cell, which is then monitored for viability and expression of the sequences contained in the vector. In addition, reference may be made to the relevant texts and literature, which describe expression vectors and their suitability to any particular host cell.

(44) The expression vectors of the invention must be introduced or transferred into the host cell. Such methods for transferring the expression vectors into host cells are well known to those of ordinary skill in the art. For example, one method for transforming E. coli with an expression vector involves a calcium chloride treatment wherein the expression vector is introduced via a calcium precipitate. Other salts, e.g., calcium phosphate, may also be used following a similar procedure. In addition, electroporation (i.e., the application of current to increase the permeability of cells to nucleic acid sequences) may be used to transfect the host microorganism. Also, microinjection of the nucleic acid sequencers) provides the ability to transfect host microorganisms. Other means, such as lipid complexes, liposomes, and dendrimers, may also be employed. Those of ordinary skill in the art can transfect a host cell with a desired sequence using these or other methods.

(45) For identifying a transfected host cell, a variety of methods are available. For example, a culture of potentially transfected host cells may be separated, using a suitable dilution, into individual cells and thereafter individually grown and tested for expression of the desired nucleic acid sequence. In addition, when plasmids are used, an often-used practice involves the selection of cells based upon antimicrobial resistance that has been conferred by genes intentionally contained within the expression vector, such as the amp, gpt, neo, and hyg genes.

(46) The host cell is transformed with at least one expression vector. When only a single expression vector is used (without the addition of an intermediate), the vector will contain all of the nucleic acid sequences necessary.

(47) Once the host cell has been transformed with the expression vector, the host cell is allowed to grow. For microbial hosts, this process entails culturing the cells in a suitable medium. It is important that the culture medium contain an excess carbon source, such as a sugar (e.g., glucose) when an intermediate is not introduced. In this way, cellular production of the modified terpene ensured. When added, any intermediate is present in an excess amount in the culture medium.

(48) Any means for extracting or separating the modified terpene from the host cell may be used. For example, the host cell may be harvested and subjected to hypotonic conditions, thereby lysing the cells. The lysate may then be centrifuged and the supernatant subjected to high performance liquid chromatography (HPLC) or gas chromatography (GC).

(49) In some embodiments, the 1,8-cineole synthase (CS), or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Streptomyces clavuligerus 1,8-cineole synthase which is as follows:

(50) TABLE-US-00002 (SEQIDNO:1) 10203040 MPAGHEEFDIPFPSRVNPFHARAEDRHVAWMRAMGLITGD 50607080 AAEATYRRWSPAKVGARWFYLAQGEDLDLGCDIFGWFFAY 90100110120 DDHFDGPTGTDPRQTAAFVNRTVAMLDPRADPTGEHPLNI 130140150160 AFHDLWQRESAPMSPLWQRRAVDHWTQYLTAHITEATNRT 170180190200 RHTSPTIADYLELRHRTGFMPPLLDLIERVWRAEIPAPVY 210220230240 TTPEVQTLLHTTNQNINIVNDVLSLEKEEAHGDPHNLVLV 250260270280 IQHERQSTRQQALATARRMIDEWTDTFIRTEPRLPALCGR 290300310320 LGIPLADRTSLYTAVEGMRAAIRGNYDWCAETNRYAVHRP 330 TGTGRATTPW

(51) In some embodiments, the 1,8-cineole synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of 1,8-cineole synthase, presumably through binding to Mg.sup.2+.

(52) In some embodiments, the epi-isozizaene synthase (EIZS), or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Streptomyces coelicolor epi-isozizaene synthase which is as follows:

(53) TABLE-US-00003 (SEQIDNO:2) 10203040 MHAFPHGTTATPTAIAVPPSLRLPVIEAAFPRQLHPYWPK 50607080 LQETTRTWLLEKRLMPADKVEEYADGLCYTDLMAGYYLGA 90100110120 PDEVLQAIADYSAWFFVWDDRHDRDIVHGRAGAWRRLRGL 130140150160 LHTALDSPGDHLHHEDTLVAGFADSVRRLYAFLPATWNAR 170180190200 FARHFHTVIEAYDREFHNRTRGIVPGVEEYLELRRLTFAH 210220230240 WIWTDLLEPSSGCELPDAVRKHPAYRRAALLSQEFAAWYN 250260270280 DLCSLPKEIAGDEVHNLGISLITHHSLTLEEAIGEVRRRV 290300310320 EECITEFLAVERDALRFADELADGTVRGKENMRNWFSSVY 330340350360 LSGAVRANVGWFHHESGRYMVDSWDDRSTPPYVNNEAAGE K

(54) In some embodiments, the epi-isozizaene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of epi-isozizaene synthase, presumably through binding to Mg.sup.2+.

(55) In some embodiments, the (R)-limonene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Citrus limon (R)-limonene synthase which is as follows:

(56) TABLE-US-00004 (SEQIDNO:3) 10203040 MSSCINPSTLVTSVNAFKCLPLATNKAAIRIMAKYKPVQC 50607080 LISAKYDNLTVDRRSANYQPSIWDHDFLQSLNSNYTDEAY 90100110120 KRRAEELRGKVKIAIKDVIEPLDQLELIDNLQRLGLAHRF 130140150160 ETEIRNILNNIYNNNKDYNWRKENLYATSLEFRLLRQHGY 170180190200 PVSQEVENGFKDDQGGFICDDFKGILSLHEASYYSLEGES 210220230240 IMEEAWQFTSKHLKEVMISKNMEEDVEVAEQAKRALELPL 250260270280 HWKVPMLEARWFIHIYERREDKNHLLLELAKMEFNTLQAI 290300310320 YQEELKEISGWWKDTGLGEKLSFARNRLVASFLWSMGIAF 330340350360 EPQFAYCRRVLTISIALITVIDDIYDVYGTLDELEIFTDA 370380390400 VERWDINYALKHLPGYMKMCFLALYNFVNEFAYYVLKQQD 410420430440 FDLLLSIKNAWLGLIQAYLVEAKWYHSKYTPKLEEYLENG 450460470480 LVSITGPLIITISYLSGTNPIIKKELEFLESNPDIVHWSS 490500510520 KIFRLQDDLGTSSDEIQRGDVPKSIQCYMHETGASEEVAR 530540550560 QHIKDMMRQMWKKVNAYTADKDSPLIGTTTEFLLNLVRMS 570580590600 HFMYLHGDGHGVQNQETIDVGFTLLFQPIPLEDKHMAFTA SPGTKG

(57) In some embodiments, the (R)-limonene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of (R)-limonene synthase, presumably through binding to Mg.sup.2+.

(58) In some embodiments, the (S)-limonene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Cannabis sativa (S)-limonene synthase which is as follows:

(59) TABLE-US-00005 (SEQIDNO:4) 10203040 MQCIAFHQFASSSSLPIWSSIDNRFTPKTSITSISKPKPK 50607080 LKSKSNLKSRSRSSTCYSIQCTVVDNPSSTITNNSDRRSA 90100110120 NYGPPIWSFDFVQSLPIQYKGESYTSRLNKLEKDVKRMLI 130140150160 GVENSLAQLELIDTIQRLGISYRFENEIISILKEKFTNNN 170180190200 DNPNPNYDLYATALQFRLLRQYGFEVPQEIFNNFKNHKTG 210220230240 EFKANISNDIMGALGLYEASFHGKKGESILEEARIFTTKC 250260270280 LKKYKLMSSSNNNNMTLISLLVNHALEMPLQWRITRSEAK 290300310320 WFIEEIYERKQDMNPTLLEFAKLDENMLQSTYQEELKVLS 330340350360 RWWKDSKLGEKLPFVRDRLVECFLWQVGVRFEPQFSYFRI 370380390400 MDTKLYVLLTIIDDMHDIYGTLEELQLFTNALQRWDLKEL 410420430440 DKLPDYMKTAFYFTYNFTNELAFDVLQEHGFVHIEYFKKL 450460470480 MVELCKHHLQEAKWFYSGYKPTLQEYVENGWLSVGGQVIL 490500510520 MHAYFAFTNPVTKEALECLKDGHPNIVRHASIILRLADDL 530540550560 GTLSDELKRGDVPKSIQCYMHDTGASEDEAREHIKYLISE 570580590600 SWKEMNNEDGNINSFFSNEFVQVCQNLGRASQFIYQYGDG 610620 HASQNNLSKERVLGLIITPIPM

(60) In some embodiments, the (S)-limonene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of (S)-limonene synthase, presumably through binding to Mg.sup.2+.

(61) In some embodiments, the valencene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Vitis vinifera valencene synthase which is as follows:

(62) TABLE-US-00006 (SEQIDNO:5) 10203040 MSTQVSASSLAQIPQPKNRPVANFHPNIWGDQFITYTPED 50607080 KVTRACKEEQIEDLKKEVKRKLTAAAVANPSQLLNFIDAV 90100110120 QRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALG 130140150160 FRLLRQQGYTISCDIFNKFTDERGRFKEALISDVRGMLGL 170180190200 YEAAHLRVHGEDILAKALAFTTTHLKAMVESLGYHLAEQV 210220230240 AHALNRPIRKGLERLEARWYISVYQDEAFHDKTLLELAKL 250260270280 DENLVQSLHKEELSNLARWWKELDFATKLPFARDRLVEGY 290300310320 FWMHGVYFEPQYLRGRRILTKVIAMTSILDDIHDAYGTPE 330340350360 ELKLFIEAIERWDINSINQLPEYMKLCYVALLDVYKEIEE 370380390400 EMEKEGNQYRVHYAKEVMKNQVRAYFAEAKWLHEEHVPAF 410420430440 EEYMRVALASSGYCLLATTSFVGMGEIATKEAFDWVTSDP 450460470480 KIMSSSNFITRLMDDIKSHKFEQKRGHVTSAVECYMKQYG 490500510520 VSEEQVYSEFQKQIENAWLDINQECLKPTAVSMPLLARLL 530540550 NFTRTMDVIYKEQDSYTHVGKVMRDNIASV FINAVI

(63) In some embodiments, the valencene synthase comprises the amino acid sequence Asp-Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of valencene synthase, presumably through binding to Mg.sup.2+.

(64) In some embodiments, the (?)-alpha-terpineol synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Vitis vinifera (?)-alpha-terpineol synthase which is as follows:

(65) TABLE-US-00007 (SEQIDNO:6) 10203040 MALSMLSSIPNLITHTRLPIIIKSSSCKASPRGIKVKIGN 50607080 SNCEEIIVRRTANYHPTIWDYDYVQSLRSDYVGETYTRRL 90100110120 DKLKRDVKPMLGKVKKPLDQLELIDVLQRLGIYYHFKDEI 130140150160 KRILNGIYNQYNRHEEWQKDDLYATALEFRLLRQHGYDVP 170180190200 QDVFSRFKDDTGSFKACLCEDMKGMLCLYEASYLCVQGES 210220230240 TMEQARDFAHRHLGKGLEQNIDQNLAIEVKHALELPLHWR 250260270280 MPRLEARWFIDVYEKRQDMNPILLEFAKLDFNMVQATHQE 290300310320 DLRHMSSWWSSTRLGEKLNFARDRLMENFLWTVGVIFEPQ 330340350360 YGYCRRMSTKVNTLITIIDDVYDVYGTMDELELFTDVVDR 370380390400 WDINAMDPLPEYMKLCFLALYNSTNEMAYDALKEHGLHIV 410420430440 SYLRKAWSDLCKSYLLEAKWYYSRYTPSLQEYISNSWISI 450460470480 SGPVILVHAYFLVANPITKEALQSLERYHNIIRWSSMILR 490500510520 LSDDLGTSLDELKRGDVPKSIQCYMYETGASEEDARKHTS 530540550560 YLIGETWKKLNEDGAVESPFPETFIGIAMNLARMAQCMYQ 570580590 HGDGHGIEYGETEDRVLSLLVEPIPSLSSE

(66) In some embodiments, the (?)-alpha-terpineol synthase comprises the amino acid Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of (?)-alpha-terpineol synthase, presumably through binding to Mg.sup.2+.

(67) In some embodiments, the (+)-alpha-pinene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Pinus taeda (+)-alpha-pinene synthase which is as follows:

(68) TABLE-US-00008 (SEQIDNO:7) 10203040 MALVSAVPLNSKLCLRRTLFGFSHELKAIHSTVPNLGMCR 50607080 GGKSIAPSMSMSSTTSVSNEDGVPRRIAGHHSNLWDDDSI 90100110120 ASLSTSYEAPSYRKRADKLIGEVKNIFDLMSVEDGVFTSP 130140150160 LSDLHHRLWMVDSVERLGIDRHFKDEINSALDHVYSYWTE 170180190200 KGIGRGRESGVTDLNSTALGLRTLRLHGYTVSSHVLDHFK 210220230240 NEKGQFTCSAIQTEGEIRDVLNLFRASLIAFPGEKIMEAA 250260270280 EIFSTMYLKDALQKIPPSGLSQEIEYLLEFGWHTNLPRME 290300310320 TRMYIDVFGEDTTFETPYLIREKLLELAKLEFNIFHSLVK 330340350360 RELQSLSRWWKDYGFPEITFSRHRHVEYYTLAACIANDPK 370380390400 HSAFRLGFGKISHMITILDDIYDTFGTMEELKLLTAAFKR 410420430440 WDPSSIECLPDYMKGVYMAVYDNINEMAREAQKIQGWDTV 450460470480 SYARKSWEAFIGAYIQEAKWISSGYLPTFDEYLENGKVSF 490500510520 GSRITTLEPMLTLGFPLPPRILQEIDFPSKFNDLICAILR 530540550560 LKGDTQCYKADRARGEEASAVSCYMKDHPGITEEDAVNQV 570580590600 NAMVDNLTKELNWELLRPDSGVPISYKKVAFDICRVFHYG 610620 YKYRDGFSVASIEIKNLVTRTVVETVPL

(69) In some embodiments, the (+)-alpha-pinene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of (+)-alpha-pinene synthase, presumably through binding to Mg.sup.2+.

(70) In some embodiments, the (?)-alpha-pinene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Pinus taeda (?)-alpha-pinene synthase which is as follows:

(71) TABLE-US-00009 (SEQIDNO:8) 10203040 MSPVSVISLPSDLCLPTSFIDRSGRELIPLHITIPNVAMR 50607080 RQGKLMTRASMSMNLRTAVSDDAVIRRRGDFHSNLWDDDL 90100110120 IQSLSSPYGEPSYRERAERLIGEVKNSENSMSNEDGESIT 130140150160 PLDDLIQRLWMVDSVERLGIDRHFKKEIKSALDHVYRYWS 170180190200 EKGIGCGRESVVTDLNSTALGLRTLRLHGYDVSADVLNHE 210220230240 KNQSGQFACTLKQTEDQIRTVLNLYRASLIAFPGEKVMDE 250260270280 AESFSAKYLKEALQKIPVSSFSREIGDVLEYGWHTYLPRL 290300310320 EARNYIDVFGQDTENSKSYMKTEKLLELAKLEFNIFHALQ 330340350360 KRELEYLVRWWKGSGSPQMTFCRHRHVEYYTLASCIAFEP 370380390400 QHSGFRLGFAKACHIITVLDDMYDTFGTLDELELFTSAIK 410420430440 RWDPSATECLPEYMKGVYMIVYNTVNEMSQEADKAQGRDT 450460470480 LNYCRQAWEEYIDAYMQEAKWIASGEVPTFEEYYENGKVS 490500510520 SGHRVSALQPILTTDIPFPEHVLKEVDIPSQLNDLASAIL 530540550560 RLRGDTRCYQADRARGEEASCISCYMKDNPGTTEEDALNH 570580590600 LNAMISDVIKGLNWELLKPNSSVPISAKKHAFDISRAFHC 610620 GYKYRDGYSVANIETKSLVKRTVIDPVTL

(72) In some embodiments, the (?)-alpha-pinene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of (?)-alpha-pinene synthase, presumably through binding to Mg.sup.2+.

(73) In some embodiments, the (?)-beta-pinene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Artemisia annua (?)-beta-pinene synthase which is as follows:

(74) TABLE-US-00010 (SEQIDNO:9) 10203040 MASMCTESSPFLLCNSSISRTNIVACNKQTSTLQAQVKNV 50607080 ATIETTNRRSANYAPSLWSYDFVQSLSSKYKGDNYMARSR 90100110120 ALKGVVRTMILEANGIENPLSLLNLVDDLQRLGISYHFLD 130140150160 EISNVLEKIYLNFYKSPEKWTNMDLNLRSLGFRLLROHGY 170180190200 HIPQEIFKDFIDVNGNFKGDIISMLNLYEASYHSVEEESI 210220230240 LDDAREFTTKYLKETLENIEDQNIALFISHALVFPLHWMV 250260270280 PRVETSWFIEVYPKKVGMNPTVLEFAKLDFNILQAVHQED 290300310320 MKKASRWWKETCWEKFGFARDRLVENFMWTVAENYLPHFQ 330340350360 TGRGVLTKVNAMITTIDDVYDVYGTLPELELETNIVNSWD 370380390400 INAIDELPDYLKICFLACYNATNELSYNTLTNKGFFVHPY 410420430440 LKKAWQDLCNSYIIEAKWENDGYTPTFNEFIENAYMSIGI 450460470480 APIIRHAYLLTLTSVTEEALQHIERAESMIRNACLIVRLT 490500510520 NDMGTSSDELERGDIPKSIQCYMHESGATEMEARAYIKOF 530540550560 IVETWKKLNKERQEIGSEFPQEFVDCVINLPRMGHFMYTD 570580 GDKHGKPDMFKPYVESLEVNPI

(75) In some embodiments, the (?)-beta-pinene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of (?)-beta-pinene synthase, presumably through binding to Mg.sup.2+.

(76) In some embodiments, the vetispiradiene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Solanum tuberosum vetispiradiene synthase which is as follows:

(77) TABLE-US-00011 (SEQIDNO:10) 10203040 MTPAAVVMSNYGEEEIVRPIADFSPSLWGDRFHSFSLDNQ 50607080 IAGKYAQEIETLKEQSRIILSASSRRTLAEKLDLIDIVER 90100110120 LGIAYHFEKQIDDMLDQFYKADPNFEAHEYNDLQTLSVQF 130140150160 RLLROHGYNISPKLFIRFQDAKGKFKESLCNDIKGLLNLY 170180190200 EASHVRTHGEDILEEALAFSTAHLESAAPHLKSPLSKQVT 210220230240 HALEQSLHKSIPRVETRYFISIYEEEEQKNDVLLQFAKLD 250260270280 FNLLQMLHKQELSEVSRWWKDLDFVTTLPYARDRAVECYF 290300310320 WTMGVYAEPQYSQARVMLAKTIAMISIVDDTFDAYGIVKE 330340350360 LEIYTDAIQRWDISQIDRLPDYMKISYKALLDLYNDYEME 370380390400 LSKDGRSDVVHYAKERMKEIVRNYFVEAKWFIEGYMPPVS 410420430440 EYLSNALATSTYYLLTTTSYLGMKSANKQDFEWLAKNPKI 450460470480 LEANVTLCRVIDDIATYEVEKGRGQIATGIECYMRDYGVS 490500510520 TEKAMEKFQEMAETAWKDVNEGILRPTPVSTEILTRILNL 530540550 ARIIDVTYKHNODGYTHPEKVLKPHIIALLVDSIEI

(78) In some embodiments, the vetispiradiene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of vetispiradiene synthase, presumably through binding to Mg.sup.2+.

(79) In some embodiments, the amorphadiene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Artemisia annua amorphadiene synthase which is as follows:

(80) TABLE-US-00012 (SEQIDNO:11) 10203040 MSLTEEKPIRPIANFPPSIWGDQFLIYEKQVEQGVEQIVN 50607080 DLKKEVRQLLKEALDIPMKHANLLKLIDEIQRLGIPYHFE 90100110120 REIDHALQCIYETYGDNWNGDRSSLWFRLMRKOGYYVTCD 130140150160 VENNYKDKNGAFKQSLANDVEGLLELYEATSMRVPGEIIL 170180190200 EDALGFTRSRLSIMTKDAFSTNPALFTEIQRALKQPLWKR 210220230240 LPRIEAAQYIPFYQQQDSHNKTLLKLAKLEFNLLQSLHKE 250260270280 ELSHVCKWWKAFDIKKNAPCLRDRIVECYFWGLGSGYEPQ 290300310320 YSRARVFFTKAVAVITLIDDTYDAYGTYEELKIFTEAVER 330340350360 WSITCLDTLPEYMKPIYKLFMDTYTEMEEFLAKEGRTDLF 370380390400 NCGKEFVKEFVRNLMVEAKWANEGHIPTTEEHDPVVIITG 410420430440 GANLLTTTCYLGMSDIFTKESVEWAVSAPPLFRYSGILGR 450460470480 RLNDLMTHKAEQERKHSSSSLESYMKEYNVNEEYAQTLIY 490500510520 KEVEDVWKDINREYLTTKNIPRPLLMAVIYLCQFLEVQYA 530540 GKDNFTRMGDEYKHLIKSLLVYPMSI

(81) In some embodiments, the amorphadiene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of amorphadiene synthase, presumably through binding to Mg.sup.2+.

(82) In some embodiments, the curcumene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Pogostemon cablin curcumene synthase which is as follows:

(83) TABLE-US-00013 (SEQIDNO:12) 10203040 MAAFTANAVDMRPPVITIHPRSKDIFSQFSLDDKLOKQYA 50607080 QGIEALKEEARSMLMAAKSAKVMILIDTLERLGLGYHFEK 90100110120 EIEEKLEAIYKKEDGDDYDLFTTALRFRLLROHQRRVPCS 130140150160 VFDKFMNKEGKFEEEPLISDVEGLLSLYDAAYLQIHGEHI 170180190200 LQEALIFTTHHLTRIEPQLDDHSPLKLKLNRALEFPFYRE 210220230240 IPIIYAHFYISVYERDDSRDEVLLKMAKLSYNFLQNLYKK 250260270280 ELSQLSRWWNKLELIPNLPYIRDSVAGAYLWAVALYFEPQ 290300310320 YSDVRMAIAKLIQIAAAVDDTYDNYATIREAOLLTEALER 330340350360 LNVHEIDTLPDYMKIVYREVMSWSEDFERDATIKEQMLAT 370380390400 PYFKAEMKKLGRAYNQELKWVMERQLPSFEEYMKNSEITS 410420430440 GVYIMFTVISPYLNSATQKNIDWLLSQPRLASSTAIVMRC 450460470480 CNDLGSNQRESKGGEVMTSLDCYMKOHGASKQETISKFKL 490500510520 IIEDEWKNLNEEWAATTCLPKVMVEIFRNYARIAGFCYKN 530540 NGDAYTSPKIVQQCFDALFVNPLRI

(84) In some embodiments, the curcumene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of curcumene synthase, presumably through binding to Mg.sup.2+.

(85) In some embodiments, the bisabolene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Pogostemon cablin bisabolene synthase which is as follows:

(86) TABLE-US-00014 (SEQIDNO:13) 10203040 MDAFATSPTTALFETVNCNAHVAPMAGEDSSENRPASNYK 50607080 PSTWDYEFLQSLATTNNTVGEKHTRMADKLKEEVKSMMKG 90100110120 TMEPVAKLELINIVQRLGLKYRFESEIKEELFSLYKDGTD 130140150160 AWWVGNLHATALRFRLLRENGIFVPQDVFETFKDKSGEFK 170180190200 SQLCKDVRGLLSLYEASYLGWEGEELLDEAKKFSTTNLNN 210220230240 VKESISSNTLGRLVKHALNLPLHWSAARYEARWFIDEYER 250260270280 EENVIPNLLKYAKLDENVVQSIHQKELGNLARWWVETGLD 290300310320 KLGFVRNTLMQNFMWGCAMAFEPQYGKVRDAAVKLGSLIT 330340350360 MVDDVYDVYGTLEELEIFTDIVDRWDINGIDKLPRNISMI 370380390400 VLTMFNTANQISYDLLRDRGFNSIPHIAEAWATLCKTYLK 410420430440 EAKWYHSGYKPTLEEYLENGLVSISFVLSLVTAYLQTERL 450460470480 ENLTYESAAYVNSVPPLVRYSGLLNRLYNDLGTSSAEIAR 490500510520 GDTLKSIQCYMTQTGATEEVAREHIKGLVHEAWKGMNRCL 530540550560 FEQTPLAEPFVGFNVNTVRGSQFFYQHGDGYAVTESWTKD 570 LSLSVLIHPIPLNEED

(87) In some embodiments, the bisabolene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of bisabolene synthase, presumably through binding to Mg.sup.2+.

(88) In some embodiments, the farnesene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Zea mays farnesene synthase which is as follows:

(89) TABLE-US-00015 (SEQIDNO:14) 10203040 MDATAFHPSLWGDFFVKYKPPTAPKRGHMTERAELLKEEV 50607080 RKTLKAAANQITNALDLIITLORLGLDHHYENEISELLRF 90100110120 VYSSSDYDDKDLYVVSLRFYLLRKHGHCVSSDVFTSFKDE 130140150160 EGNFVVDDTKCLLSLYNAAYVRTHGEKVLDEAITFTRRQL 170180190200 EASLLDPLEPALADEVHLTLQTPLFRRLRILEAINYIPIY 210220230240 GKEAGRNEAILELAKLNFNLAQLIYCEELKEVTLWWKQLN 250260270280 VETNLSFIRDRIVECHFWMTGACCEPQYSLSRVIATKMTA 290300310320 LITVLDDMMDTYSTTEEAMLLAEAIYRWEENAAELLPRYM 330340350360 KDFYLYLLKTIDSCGDELGPNRSFRTFYLKEMLKVLVRGS 370380390400 SQEIKWRNENYVPKTISEHLEHSGPTVGAFQVACSSFVGM 410420430440 GDSITKESFEWLLTYPELAKSLMNISRLLNDTASTKREQN 450460470480 AGQHVSTVQCYMLKHGTTMDEACEKIKELTEDSWKDMMEL 490500510520 YLTPTEHPKLIAQTIVDFARTADYMYKETDGFTFSHTIKD 530 MIAKLFVDPISLF

(90) In some embodiments, the farnesene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of farnesene synthase, presumably through binding to Mg.sup.2+.

(91) In some embodiments, the cadinene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Ocimum basilicum cadinene synthase which is as follows:

(92) TABLE-US-00016 (SEQIDNO:15) 10203040 MDVSILRDVRPPVTSYAPNIWADTFSNISLDEEVQKKYAE 50607080 TIEALKQVVRGMLMAAATPIKQMIFIDTLERLGLAYHFET 90100110120 EIEHKLQKIYDDNVCGDDCDLFTTALRFRLLROHRHHVSC 130140150160 DVFDKFLYEEGKFKGDAEGLLSLYEASHVRFHNEKILEEA 170180190200 ERFTROELSCWIKLQSPLKDKVKRALERPLHREVPILYAR 210220230240 HFISIYEKDESMDEHLLKLAKFNFNFLQNLYKKELYDLSR 250260270280 WWNKFDLKTKLPYIRDRLAEAYLWGVGYHFEPQYSYVRKG 290300310320 VVLSIKIIGILDDTYDNYATVNEAQLFTEILDRWSMDEID 330340350360 RLPDYMKIVLHFVMSAYEEYERDAKIVYGKKFASPYFKET 370380390400 IQQLARGYNQELKWVMEKQMPPFKDYLKNSEITSCIYIMF 410420430440 ASIIPGLKSFTOEAIDWIKNEPNFAVKAGLIGRYWDDIGS 450460470480 HKRESKGGEMLTVMDCYMKQYSVSIQETISEFAKAVEDSW 490500510520 KEVNEGWVYTISMSKEITVQFLNYSRMCDASYNRNNGDGY 530540 TDPSFAKSNITALFVDPIII

(93) In some embodiments, the cadinene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of cadinene synthase, presumably through binding to Mg.sup.2+.

(94) In some embodiments, the aristolochene synthase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Penicillium roqueforti aristolochene synthase which is as follows:

(95) TABLE-US-00017 (SEQIDNO:16) 10203040 MATSTETISSLAQPFVHLENPINSPLVKETIRPRNDTTIT 50607080 PPPTQWSYLCHPRVKEVQDEVDGYFLENWKFPSFKAVRTF 90100110120 LDAKFSEVTCLYFPLALDDRIHFACRLLTVLFLIDDVLEH 130140150160 MSFADGEAYNNRLIPISRGDVLPDRTKPEEFILYDLWESM 170180190200 RAHDAELANEVLEPTFVFMRAQTDRARLSIHELGHYLEYR 210220230240 EKDVGKALLSALMRFSMGLRLSADELQDMKALEANCAKQL 250260270280 SVVNDIYSYDKEEEASRTGHKEGAFLCSAVKVLAEESKLG 290300310320 IPATKRVLWSMTREWETVHDEIVAEKIASPDGCSEAAKAY 330340 MKGLEYQMSGNEQWSKTTRRYN

(96) In some embodiments, the aristolochene synthase comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of aristolochene synthase, presumably through binding to Mg.sup.2+.

(97) In some embodiments, any of the synthase described herein comprises the amino acid sequence Asp-Asp-Xaa-Xaa-Asp (DDXXD) (SEQ ID NO:17), or Asp-Asp-Xaa-Xaa-Glu (DDXXE) (SEQ ID NO:18), which is important for the catalytic activity of the synthase, presumably through binding to Mg.sup.2+.

(98) In some embodiments, the 1,8-cineole 2-endo-monooxygenase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Citrobacter braakii 1,8-cineole 2-endo-monooxygenase which is as follows:

(99) TABLE-US-00018 (SEQIDNO:19) 10203040 MTATVASTSLFTTADHYHTPLGPDGTPHAFFEALRDEAET 50607080 TPIGWSEAYGGHWVVAGYKEIQAVIQNTKAFSNKGVTFPR 90100110120 YETGEFELMMAGQDDPVHKKYRQLVAKPFSPEATDLFTEQ 130140150160 LRQSTNDLIDARIELGEGDAATWLANEIPARLTAILLGLP 170180190200 PEDGDTYRRWVWAITHVENPEEGAEIFAELVAHARTLIAE 210220230240 RRTNPGNDIMSRVIMSKIDGESLSEDDLIGFFTILLLGGI 250260270280 DNTARFLSSVFWRLAWDIELRRRLIAHPELIPNAVDELLR 290300310320 FYGPAMVGRLVTQEVTVGDITMKPGQTAMLWFPIASRDRS 330340350360 AFDSPDNIVIERTPNRHLSLGHGIHRCLGAHLIRVEARVA 370380390400 ITEFLKRIPEFSLDPNKECEWLMGQVAGMLHVPIIFPKGK RLSE

(100) In some embodiments, the 1,8-cineole 2-endo-monooxygenase, or homolog thereof, comprises FXXGXRXCXG (SEQ ID NO:21), or CXG, motif and/or EXXR motif.

(101) In some embodiments, the epi-isozizaene 5-monooxygenase, or a homologous enzyme thereof, has an amino acid sequence having at least 70% identity to the amino acid sequence of Streptomyces coelicolor epi-isozizaene 5-monooxygenase which is as follows:

(102) TABLE-US-00019 (SEQIDNO:20) 10203040 MTVESVNPETRAPAAPGAPELREPPVAGGGVPLLGHGWRL 50607080 ARDPLAFMSQLRDHGDVVRIKLGPKTVYAVTNPELTGALA 90100110120 LNPDYHIAGPLWESLEGLLGKEGVATANGPLHRRORRTIQ 130140150160 PAFRLDAIPAYGPIMEEEAHALTERWQPGKTVDATSESFR 170180190200 VAVRVAARCLLRGQYMDERAERLCVALATVFRGMYRRMVV 210220230240 PLGPLYRLPLPANRRFNDALADLHLLVDEIIAERRASGOK 250260270280 PDDLLTALLEAKDDNGDPIGEQEIHDQVVAILTPGSETIA 290300310320 STIMWLLQALADHPEHADRIRDEVEAVTGGRPVAFEDVRK 330340350360 LRHTGNVIVEAMRLRPAVWVLTRRAVAESELGGYRIPAGA 370380390400 DIIYSPYAIQRDPKSYDDNLEFDPDRWLPERAANVPKYAM 410420430440 KPFSAGKRKCPSDHFSMAQLTLITAALATKYRFEQVAGSN 450460 DAVRVGITLRPHDLLVRPVAR

(103) In some embodiments, the epi-isozizaene 5-monooxygenase, or homolog thereof, comprises FXXGXRXCXG (SEQ ID NO:21), or CXG, motif and/or EXXR motif.

(104) Host Cells

(105) The host cells of the present invention are genetically modified in that heterologous nucleic acid have been introduced into the host cells, and as such the genetically modified host cells do not occur in nature. The suitable host cell is one capable of expressing a nucleic acid construct encoding one or more enzymes described herein. The gene(s) encoding the enzyme(s) may be heterologous to the host cell or the gene may be native to the host cell but is operatively linked to a heterologous promoter and one or more control regions which result in a higher expression of the gene in the host cell.

(106) The enzyme can be native or heterologous to the host cell. Where the enzyme is native to the host cell, the host cell is genetically modified to modulate expression of the enzyme. This modification can involve the modification of the chromosomal gene encoding the enzyme in the host cell or a nucleic acid construct encoding the gene of the enzyme is introduced into the host cell. One of the effects of the modification is the expression of the enzyme is modulated in the host cell, such as the increased expression of the enzyme in the host cell as compared to the expression of the enzyme in an unmodified host cell.

(107) Any prokaryotic or eukaryotic host cell may be used in the present method so long as it remains viable after being transformed with a sequence of nucleic acids. Generally, although not necessarily, the host cell is a yeast or a bacterium. In some embodiments, the host cell is a Gram negative bacterium. In some embodiments, the host cell is of the phylum Proteobactera. In some embodiments, the host cell is of the class Gammaproteobacteria. In some embodiments, the host cell is of the order Enterobacteriales. In some embodiments, the host cell is of the family Enterobacteriaceae. Examples of bacterial host cells include, without limitation, those species assigned to the Escherichia, Enterobacter, Azotobacter, Erwinia, Bacillus, Pseudomonas, Klebsielia, Proteus, Salmonella, Serratia, Shigella, Rhizobia, Vitreoscilla, and Paracoccus taxonomical classes. In some embodiments, the host cell is not adversely affected by the transduction of the necessary nucleic acid sequences, the subsequent expression of the proteins (i.e., enzymes), or the resulting intermediates required for carrying out the steps associated with the mevalonate pathway. For example, it is preferred that minimal cross-talk (i.e., interference) occur between the host cell's own metabolic processes and those processes involved with the mevalonate pathway. Suitable eukaryotic cells include, but are not limited to, fungal, insect or mammalian cells. Suitable fungal cells are yeast cells, such as yeast cells of the Saccharomyces genus.

(108) The genetically modified host cell can be any microbe capable of production of the modified terpenoid in accordance with the methods of the invention.

(109) In some embodiments, the host cell is a yeast. Yeast host cells suitable for the invention include, but are not limited to, Yarrowia, Candida, Bebaromyces, Saccharomyces, Schizosaccharomyces and Pichia cells. In one embodiment, Saccharomyces cerevisae is the host cell. In one embodiment, the yeast host cell is a species of Candida, including but not limited to C. tropicalis, C. maltosa, C. apicola, C. paratropicalis, C. albicans, C. cloacae, C. guillermondii, C. intermedia, C. lipolytica, C. panapsilosis and C. zeylenoides. In one embodiment, Candida tropicalis is the host cell. In some embodiments, the yeast host cell is a non-oleaginous yeast. In some embodiments, the non-oleaginous yeast is a Saccharomyces species. In some embodiments, the Saccharomyces species is Saccharomyces cerevisiae. In some embodiments, the yeast host cell is an oleaginous yeast. In some embodiments, the oleaginous yeast is a Rhodosporidium species. In some embodiments, the Rhodosporidium species is Rhodosporidium toruloides.

(110) In some embodiments the host cell is a bacteria. Bacterial host cells suitable for the invention include, but are not limited to, Escherichia, Corynebacterium, Pseudomonas, Streptomyces, and Bacillus. In some embodiments, the Escherichia cell is an E. coli, E. albertii, E. fergusonii, E. hermanii, E. marmotae, or E. vulneris. In some embodiments, the Corynebacterium cell is Corynebacterium glutamicum, Corynebacterium kroppenstedtii, Corynebacterium alimapuense, Corynebacterium amycolatum, Corynebacterium diphtherias, Corynebacterium efficiens, Corynebacterium jeikeium, Corynebacterium macginleyi, Corynebacterium matruchotii, Corynebacterium minutissimum, Corynebacterium renale, Corynebacterium striatum, Corynebacterium ulcerans, Corynebacterium urealyticum, or Corynebacterium uropygiale. In some embodiments, the Pseudomonas cell is a P. putida, P. aeruginosa, P. chlororaphis, P. fluorescens, P. pertucinogena, P. stutzeri, P. syringae, P. cremoricolorata, P. entomophila, P. fulva, P. monteilii, P. mosselii, P. oryzihabitans, P. parafluva, or P. plecoglossicida. In some embodiments, the Streptomyces cell is a S. coelicolor, S. lividans, S. venezuelae, S. ambofaciens, S. avermitilis, S. albus, or S. scabies. In some embodiments, the Bacillus cell is a B. subtilis, B. megaterium, B. licheniformis, B. anthracis, B. amyloliquefaciens, or B. pumilus.

REFERENCES CITED (WHICH ARE ALL EACH INCORPORATED HEREIN BY REFERENCE)

(111) (1) Aharoni, A.; Jongsma, M. A.; Bouwmeester, H. J. Volatile Science? Metabolic Engineering of Terpenoids in Plants. Trends Plant Sci. 2005, 10 (12), 594-602. (2) Chang, M. C. Y.; Eachus, R. A.; Trieu, W.; Ro, D.-K.; Keasling, J. D. Engineering Escherichia Coli for Production of Functionalized Terpenoids Using Plant P450s. Nat. Chem. Biol. 2007, 3,274. (3) Renault, H.; Bassard, J.-E.; Hamberger, B.; Werck-Reichhart, D. Cytochrome P450-Mediated Metabolic Engineering: Current Progress and Future Challenges. Curr. Opin. Plant Biol. 2014, 19, 27-34. (4) van Beilen, J. B.; Holtackers, R.; L?scher, D.; Bauer, U.; Witholt, B.; Duetz, W. A. Biocatalytic Production of Perillyl Alcohol from Limonene by Using a Novel Mycobacterium Sp. Cytochrome P450 Alkane Hydroxylase Expressed in Pseudomonas Putida. Appl. Environ. Microbiol. 2005, 71 (4), 1737 LP-1744. (5) Alonso-Gutierrez, J.; Chan, R.; Batth, T. S.; Adams, P. D.; Keasling, J. D.; Petzold, C. J.; Lee, T. S. Metabolic Engineering of Escherichia Coli for Limonene and Perillyl Alcohol Production. Metab. Eng. 2013, 19, 33-41. (6) Conrado, R. J.; Varner, J. D.; DeLisa, M. P. Engineering the Spatial Organization of Metabolic Enzymes: Mimicking Nature's Synergy. Curr. Opin. Biotechnol. 2008, 19 (5), 492-499. (7) Meynial Salles, I.; Forchhammer, N.; Croux, C.; Girbal, L.; Soucaille, P. Evolution of a Saccharomyces Cerevisiae Metabolic Pathway in Escherichia Coli. Metab. Eng. 2007, 9 (2), 152-159. (8) Kourtz, L.; Dillon, K.; Daughtry, S.; Madison, L. L.; Peoples, O.; Snell, K. D. A Novel Thiolase-Reductase Gene Fusion Promotes the Production of Polyhydroxybutyrate in Arabidopsis. Plant Biotechnol. J. 2005, 3 (4), 435-447. (9) Dueber, J. E.; Wu, G. C.; Malmirchegini, G. R.; Moon, T. S.; Petzold, C. J.; Ullal, A. V; Prather, K. L. J.; Keasling, J. D. Synthetic Protein Scaffolds Provide Modular Control over Metabolic Flux. Nat. Biotechnol. 2009, 27 (8), 753-759. (10) Avalos, J. L.; Fink, G. R.; Stephanopoulos, G. Compartmentalization of Metabolic Pathways in Yeast Mitochondria Improves the Production of Branched-Chain Alcohols. Nat. Biotechnol. 2013, 31, 335. (11) Yu, K.; Liu, C.; Kim, B.-G.; Lee, D.-Y. Synthetic Fusion Protein Design and Applications. Biotechnol. Adv. 2015, 33 (1), 155-164. (12) Sarria, S.; Wong, B.; Martin, H. G.; Keasling, J. D.; Peralta-Yahya, P. Microbial Synthesis of Pinene. ACS Synth. Biol. 2014, 3 (7), 466-475. (13) Gao, X.; Gao, F.; Liu, D.; Zhang, H.; Nie, X.; Yang, C. Engineering the Methylerythritol Phosphate Pathway in Cyanobacteria for Photosynthetic Isoprene Production from CO2. Energy Environ. Sci. 2016, 9 (4), 1400-1411. (14) Zuo, R.; Zhang, Y.; Jiang, C.; Hackett, J. C.; Loria, R.; Bruner, S. D.; Ding, Y. Engineered P450 Biocatalysts Show Improved Activity and Regio-Promiscuity in Aromatic Nitration. Sci. Rep. 2017, 7 (1), 842. (15) Girvan, H. M.; Munro, A. W. Applications of Microbial Cytochrome P450 Enzymes in Biotechnology and Synthetic Biology. Curr. Opin. Chem. Biol. 2016, 31, 136-145. (16) Munro, A. W.; Girvan, H. M.; Mason, A. E.; Dunford, A. J.; McLean, K. J. What Makes a P450 Tick? Trends Biochem. Sci. 2013, 38 (3), 140-150. (17) Shaw, J. J.; Berbasova, T.; Sasaki, T.; Jefferson-George, K.; Spakowicz, D. J.; Dunican, B. F.; Portero, C. E.; Narv?ez-Trujillo, A.; Strobel, S. A. Identification of a Fungal 1,8-Cineole Synthase from Hypoxylon Sp. with Specificity Determinants in Common with the Plant Synthases. J. Biol. Chem. 2015, 290 (13), 8511-8526. (18) Yang, X.; Li, T.; Tang, K.; Zhou, X.; Lu, M.; Ounkham, W. L.; Spain, S. M.; Frost, B. J.; Lin, H. Highly Efficient Conversion of Terpenoid Biomass to Jet-Fuel Range Cycloalkanes in a Biphasic Tandem Catalytic Process. Green Chem. 2017, 19 (15), 3566-3573. (19) Bergman, A.; Siewers, V. Chapter 7Metabolic Engineering Strategies to Convert Carbohydrates to Aviation Range Hydrocarbons; Chuck, C. J. B. T.-B. for A., Ed.; Academic Press, 2016; pp 151-190. (20) Mendez-Perez, D.; Alonso-Gutierrez, J.; Hu, Q.; Molinas, M.; Baidoo, E. E. K.; Wang, G.; Chan, L. J. G.; Adams, P. D.; Petzold, C. J.; Keasling, J. D.; et al. Production of Jet Fuel Precursor Monoterpenoids from Engineered Escherichia coli. Biotechnol. Bioeng. 2017, 114 (8), 1703-1712. (21) Leita, B. A.; Warden, A. C.; Burke, N.; O'Shea, M. S.; Trimm, D. Production of P-Cymene and Hydrogen from a Bio-Renewable Feedstock-1,8-Cineole (Eucalyptus Oil). Green Chem. 2010, 12 (1), 70-76. (22) Hawkes, D. B.; Adams, G. W.; Burlingame, A. L.; Ortiz de Montellano, P. R.; De Voss, J. J. Cytochrome P450cin (CYP176A), Isolation, Expression, and Characterization. J. Biol. Chem. 2002, 277 (31), 27725-27732. (23) Hawkes, D. B.; Slessor, K. E.; Bernhardt, P. V; De Voss, J. J. Cloning, Expression and Purification of Cindoxin, an Unusual Fmn-Containing Cytochrome P450 Redox Partner. ChemBioChem 2010, 11 (8), 1107-1114. (24) Guo, H.; Yang, Y.; Xue, F.; Zhang, H.; Huang, T.; Liu, W.; Liu, H.; Zhang, F.; Yang, M.; Liu, C.; et al. Effect of Flexible Linker Length on the Activity of Fusion Protein 4-Coumaroyl-CoA Ligase::Stilbene Synthase. Mol. Biosyst. 2017, 13 (3), 598-606. (25) Ljungcrantz, P.; Carlsson, H.; Mansson, M. O.; Buckel, P.; Mosbach, K.; Buelow, L. Construction of an Artificial Bifunctional Enzyme, .Beta.-Galactosidase/Galactose Dehydrogenase, Exhibiting Efficient Galactose Channeling. Biochemistry 1989, 28 (22), 8786-8792. (26) Hoffmann, S. M.; Weissenborn, M. J.; Gricman, ?.; Notonier, S.; Pleiss, J.; Hauer, B. The Impact of Linker Length on P450 Fusion Constructs: Activity, Stability and Coupling. ChemCatChem 2016, 8 (8), 1591-1597. (27) Belsare, K. D.; Ruff, A. J.; Martinez, R.; Shivange, A. V; Mundhada, H.; Holtmann, D.; Schrader, J.; Schwaneberg, U. P-LinK: A Method for Generating Multicomponent Cytochrome P450 Fusions with Variable Linker Length. Biotechniques 2014, 57 (1), 13-20. (28) Zhao, B.; Lin, X.; Lei, L.; Lamb, D. C.; Kelly, S. L.; Waterman, M. R.; Cane, D. E. Biosynthesis of the Sesquiterpene Antibiotic Albaflavenone in Streptomyces Coelicolor A3(2). J. Biol. Chem. 2008, 283 (13), 8183-8189. (29) Liu, C.-L.; Tian, T.; Alonso-Gutierrez, J.; Garabedian, B.; Wang, S.; Baidoo, E. E. K.; Benites, V.; Chen, Y.; Petzold, C. J.; Adams, P. D.; et al. Renewable Production of High Density Jet Fuel Precursor Sesquiterpenes from Escherichia coli. Biotechnol. Biofuels 2018, 11 (1), 285. (30) Kang, A.; George, K. W.; Wang, G.; Baidoo, E.; Keasling, J. D.; Lee, T. S. Isopentenyl Diphosphate (IPP)-Bypass Mevalonate Pathways for Isopentenol Production. Metab. Eng. 2016, 34, 25-35. (31) Redding-Johanson, A. M.; Batth, T. S.; Chan, R.; Krupa, R.; Szmidt, H. L.; Adams, P. D.; Keasling, J. D.; Soon Lee, T.; Mukhopadhyay, A.; Petzold, C. J. Targeted Proteomics for Metabolic Pathway Optimization: Application to Terpene Production. Metab. Eng. 2011, 13 (2), 194-203.

(112) It is to be understood that, while the invention has been described in conjunction with the preferred specific embodiments thereof, the foregoing description is intended to illustrate and not limit the scope of the invention. Other aspects, advantages, and modifications within the scope of the invention will be apparent to those skilled in the art to which the invention pertains.

(113) All patents, patent applications, and publications mentioned herein are hereby incorporated by reference in their entireties.

(114) The invention having been described, the following examples are offered to illustrate the subject invention by way of illustration, not by way of limitation.

Example 1

Production of Oxidized Terpenoids Using P450 Enzymes and their Engineered Enzymes Fusions

(115) Terpenes are a large class of organic compounds, primarily produced by plants and constitute the main components of essential oils. The functionalization of terpene hydrocarbons using cytochrome P450 enzymes can derive many useful compounds that can be converted to diverse valuable products. In this study, to expand the portfolio of bioproducts from biofuel pathways, cytochrome P450 enzymes are investigated for oxidizing monoterpene (e.g. limonene, 1,8-cineole), a few oxidized terpenes are produced, including carveol, isopiperitenol, (1R)-6-hydroxycineole. Based on those oxidized terpenes, possible biosynthetic pathways are explored toward making biological-derived functionalized terpenes, such as carvolactone, a monomer of thermoplastic polyester. On the other hand, terpenes are hydrophobic and volatile compounds that limit the accessibility of P450 enzymes. To optimize the production of oxidized terpenes, an enzyme fusion strategy is developed with linking terpene synthase and P450 enzyme. In an example of producing (1R)-6-hydroxycineole, the engineered fusion shows higher efficiency from both in vitro and in vivo production results. Thus, engineering a fusion between terpene synthase and P450 presents a feasible strategy for producing oxidized terpenes, suggesting broad application during the production of terpene-based bioproducts.

(116) Production of oxidized terpenes and derived bioproducts using P450 enzymes. The functionalization of terpene hydrocarbons using cytochrome P450 enzymes can derive many useful compounds that can be converted to diverse valuable products. See FIG. 1.

(117) Biosynthesis of carvolactone as a monomer. Biosynthetic pathway is explored based on oxidized terpenes and carvolactone is selected as a functionalized terpene target since it is a new monomer for making thermoplastic polymer. To build the biosynthetic pathway of carvolactone, optimal enzymes (dehydrogenase/reductase) are screened and selected. See FIGS. 2A to 2D.

(118) Engineering fusion between terpene synthase and P450 toward efficient production of oxidized terpene. Enzyme fusions are engineered to improve substrate availability as terpenes are hydrophobic and easily lost by phase separation. See FIG. 3. Enzyme fusions of cineole synthase and P450cin with different linker lengths are engineered. Fusions show up to 5-fold increase than non-fused enzymes during the in vitro hydroxycineole production. See FIGS. 5A to 5D.

(119) In vivo assessment of fusion enzymes toward hydroxycineole production. Fusions are engineered into 1,8-cineole overproducing strain to assess the in vivo production of hydroxycineole. Fusions increase up to 3 folds in hydroxycineole production than non-fused enzymes, a 9 amino-acid linker (G3) shows the highest production of hydroxycineole (56 mg/L). See FIGS. 6A to 6C.

(120) Conclusions. P450 enzymes are used to oxidize terpenes and several oxidized terpenes are produced. Carvolactone is selected and produced as a new monomer using P450 enzymes and limonene synthesis pathway. An enzyme fusion strategy is developed by linking terpene synthase and P450 enzyme toward optimizing oxidized terpene production. Fusion enzymes show higher efficiency during hydroxycineole production.

Example 2

Efficient Production of Oxidized Terpenoids Via Engineering Fusion Proteins of Terpene Synthase and P450

(121) The functionalization of terpene hydrocarbons using cytochrome P450 enzymes is a versatile route to produce useful derivatives that can be further converted to value-added products. As terpenes are generally hydrophobic and volatile, however, their availability as a substrate for the P450 enzymes is limited especially when a solvent overlay is used to trap terpenes and prevent evaporation during the microbial terpene biosynthesis. In this study, an enzyme fusion strategy is developed by directly linking terpene synthase and P450 enzyme together to improve the accessibility of terpene molecules as a substrate for P450 enzymes. Using the hydroxylation of a monoterpene 1,8-cineole as a model system, a series of fusion proteins between 1,8-cineole synthase and P450.sub.cin (CYP176A1) are engineered with different lengths of peptide linkers to investigate the hydroxylation of 1,8-cineole. Results show that the fusion enzyme increases 5.4 and 3.1 folds in hydroxycineole production than non-fused individual enzymes at the in vitro and in vivo conditions, respectively. The enzyme fusion strategy is also applied to the oxidation of a sesquiterpene epi-isozizaene, in which a 90-fold increase is observed by the fusion in albaflavenol production. Developing fusion enzymes for terpene synthase and P450 presents an efficient strategy toward oxidation of hydrophobic terpene compounds and this strategy will be widely applicable for the functionalization of hydrophobic biosynthetic intermediates.

(122) Given that the considerable loss of terpene molecules is a critical limitation for the subsequent P450 reaction during the microbial production.sup.5, engineering a fusion protein by linking terpene synthase and P450 to form a chimeric protein could improve the proximity of P450 and the terpene substrate, which in turn would improve the substrate availability for P450.

(123) In this study, hydroxylation of monoterpene 1,8 cineole is selected as a model system for this approach of terpene synthase-P450 fusion (FIG. 4). A series of fusion proteins are engineered between 1,8-cineole synthase and P450.sub.cin (CYP176A1) with different lengths of peptide linkers to investigate the hydroxylation of 1,8-cineole. The production of hydroxycineole from both in vitro and in vivo conditions is compared between the fusion and non-fused enzymes. This enzyme fusion strategy is also applied to the oxidization of a sesquiterpene epi-isozizaene (FIG. 4), and results from both examples showed the fused enzymes are more efficient than non-fused enzymes during the production of oxidized terpenes. This result suggests a feasible strategy for the efficient production of oxidized terpenes as well as possible applications for the production of terpene-based bioproducts.

(124) Results and Discussion

(125) While engineering of fusion proteins shows an easy approach for desirable enzymatic characteristics, it is still challenging to achieve the optimal activities, for example, it is difficult to precisely control the distance of enzymes in a fusion protein, the folding of a larger multidomain protein may be inefficient, etc.

(126) Engineering Fusion Enzymes of 1,8-Cineole Synthase and P450.sub.cin

(127) 1,8-Cineole, or eucalyptol, is a monoterpene (C10) that naturally found in essential oils.sup.17. 1,8-Cineole is also a potential precursor for high energy density molecules used as jet fuels.sup.18,19, and therefore E. coli is engineered to overproduce 1,8-cineole using the mevalonate (MVA) pathway.sup.20. Hydroxylation of 1,8-cineole introduces a functional group, which decorates this compound with possibilities to further derived valuable products, such as p-cymene.sup.21. P450.sub.cin (CYP176A1) from Citrobacter braakii is found showing a specific activity for 1,8-cineole hydroxylation to (1R)-6?-hydroxycineole (or hydroxycineole).sup.22,23.

(128) To investigate the hydroxylation of 1,8-cineole as a model system of the fusion of terpene synthase and P450, fusion proteins are prepared between 1,8-cineole synthase (CS) and P450.sub.cin using a widely studied flexible peptide linker (Gly-Ser-Gly).sub.n.sup.24. By adjusting the repeat number (n) of the Gly-Ser-Gly (GSG) linker, five CS-P450.sub.cin fusion proteins have been engineered with different linker lengths (n=1-5) and named as G1 to G5 according to their GSG linker repeats (FIG. 5A, FIG. 5B).

(129) In Vitro Production of Hydroxycineole with CS-P450.sub.cin Fusions from GPP

(130) To investigate the hydroxylation of 1,8-cineole by various engineered CS-P450.sub.cin fusions, equal moles of purified proteins are used for in vitro production of hydroxycineole from GPP (FIGS. 5A to 5D). In a 5-hour reaction, all CS-P450.sub.cin fusions show higher production of hydroxycineole than non-fuse individual CS and P450.sub.cin n except for G1, which does not show a significant difference from the non-fusion control (FIG. 5C). The highest production of hydroxycineole is observed from G4 fusion with a 4-repeat of GSG linker, which shows a 5.4-fold increase over non-fused CS and P450.sub.cin after 5 hours (FIG. 5C). The highest hydroxycineole production rate in G4 is reached after 2 hours at 0.051 ?M/min, which is 6.4-fold faster than that of the non-fusion enzymes (0.008 ?M/min). The overall hydroxylation ratio of G4 is 2.3% after 5 hours, which is 5.4-fold higher than that of the non-fusion enzymes (0.4%) (FIG. 5D). It is also noticed that all 5 fusion enzymes showed up to a 2.7-fold increase of 1,8-cineole over the non-fused enzymes during the first 3 hours (FIG. 5C), indicating more terpene substrate was available in the reaction with CS-P450.sub.cin fusions.

(131) According to the in vitro production results, the engineered CS-P450.sub.cin fusions show higher efficiencies than non-fused CS and P450.sub.cin during hydroxycineole production. The improved hydroxylation from fusions can be attributed to the proximity of P450.sub.cin to its hydrophobic substrate 1,8-cineole, which shows the feasibility of linking a P450 enzyme to a biosynthetic pathway enzyme, particularly when terpenes are used as substrates for P450 reactions. Additionally, the increased 1,8-cineole production in the first 3 hours might result from the local hydrophobic environment created by the fusion enzyme and thus facilitated the 1,8-cineole accumulation. It can also suggest that terpene synthase activity is increased in the fusion enzymes as previously reported in a fusion of E. coli beta-galactosidase (LacZ) and the dimeric galactose dehydrogenase (GalDH) from Pseudomonas fluorescens which shows improved enzyme activities when they are linked each other.sup.25.

(132) In Vivo Assessment of CS-P450.sub.cin Fusions for Hydroxycineole Production from Glucose

(133) The CS-P450.sub.cin fusions are further engineered into the 1,8-cineole overproducing E. coli strain.sup.20 to assess hydroxycineole production under the in vivo conditions. Informed from the previous report.sup.20, a 2-plasmid system is used for hydroxycineole production by inserting P450.sub.cin (CinA) and the reductase (CinC) at the downstream of CS on the plasmid JBEI-15065 (Table 2). For the non-fused expression of CS and P450.sub.cin, an RBS sequence (5-TTTAAGAAGGAGATATACC-3) is used for individual expression of both CS and P450.sub.cin (Table 2). For the CS-P450.sub.cin fusions, the same RBS is used for the entire fused protein sequence. As solvent overlay is usually used to enrich terpene molecules and prevent evaporation of the product during fermentation, an overly is used to evaluate the performance of fusion enzymes at the in vivo conditions. While dodecane is used as the overlay for 1,8-cineole production previously.sup.20, it has a similar molecular weight to hydroxycineole (MW=170), as well as a very close retention time in GC analysis. Therefore, nonane, instead of dodecane, is used as the overlay to obtain a better signal of hydroxycineole on GC.

(134) TABLE-US-00020 TABLE 2 Strains and plasmids used in this study. Description Reference Strains CS E. coli BL21 (DE3) with pSKB3-CS This study CinA E. coli BL21 (DE3) with pSKB3-CinA This study CinC E. coli BL21 (DE3) with pSKB3-CinC This study G1 E. coli BL21 (DE3) with pSKB3-CS-G1-CinA This study G2 E. coli BL21 (DE3) with pSKB3-CS-G2-CinA This study G3 E. coli BL21 (DE3) with pSKB3-CS-G3-CinA This study G4 E. coli BL21 (DE3) with pSKB3-CS-G4-CinA This study G5 E. coli BL21 (DE3) with pSKB3-CS-G5-CinA This study Fpr E. coli BL21 (DE3) with pSKB3-Fpr This study 2pCin_Non-fusion E. coli DH1 with JBEI-3122 + pTre99a-trGPPS-CS- This study RBS-CinAC 2pCin_G1 E. coli DH1 with JBEI-3122 + pTre99a-trGPPS-CS- This study G1-CinAC 2pCin_G2 E. coli DH1 with JBEI-3122 + pTre99a-trGPPS-CS- This study G2-CinAC 2pCin_G3 E. coli DH1 with JBEI-3122 + pTrc99a-trGPPS-CS- This study G3-CinAC 2pCin_G4 E. coli DH1 with JBEI-3122 + pTrc99a-trGPPS-CS- This study G4-CinAC 2pCin_G5 E. coli DH1 with JBEI-3122 + pTrc99a-trGPPS-CS- This study G5-CinAC 2pCin_G3 reverse E. coli DH1 with JBEI-3122 + pTrc99a-trGPPS- This study CinA-G3-CS-CinC 2pEiz E. coli DH1 with JBEI-2704 + JBEI-15862 This study 2pEizSC_Non- E. coli DH1 with JBEI-2704 + pTre99a-EizS-RBS- This study fusion CYP170A1-CinC 2pEizSC_EG1 E. coli DH1 with JBEI-2704 + pTre99a-EizS-G1- This study CYP170A1-CinC 2pEizSC_EG2 E. coli DH1 with JBEI-2704 + pTre99a-EizS-G2- This study CYP170A1-CinC 2pEizSC_EG3 E. coli DH1 with JBEI-2704 + pTre99a-EizS-G3- This study CYP170A1-CinC 2pEizSC_EG4 E. coli DH1 with JBEI-2704 + pTre998-EizS-G4- This study CYP170A1-CinC 2pEizSC_EG5 E. coli DH1 with JBEI-2704 + pTre99a-EizS-G5- This study CYP170A1-CinC Plasmids pSKB3 Modified pET-28a 30 JBEI-3122 pBbA5c-MTSA-T1-MBI 5 JBEI-15065 pTrc99a-GPPS-CS.sub.Str 20 JBEI-2704 pBbA5c-MevT-T1-MBIS 31 JBEI-15862 pTrc99a-coEizS 29 pSKB3-CS This study pSKB3-CinA This study pSKB3-CinC This study pSKB3-CS-G1-CinA This study pSKB3-CS-G2-CinA This study pSKB3-CS-G3-CinA This study pSKB3-CS-G4-CinA This study pSKB3-CS-G5-CinA This study pSKB3-Fpr This study pTrc99a-trGPPS-CS-RBS-CinAC This study pTrc99a-trGPPS-CS-G1-CinAC This study pTrc99a-trGPPS-CS-G2-CinAC This study pTrc99a-trGPPS-CS-G3-CinAC This study pTrc99a-trGPPS-CS-G4-CinAC This study pTrc99a-trGPPS-CS-G5-CinAC This study pTrc99a-trGPPS-CinA-G3-CS-CinC This study pTrc99a-EizS-RBS-CYP170A1-CinC This study pTrc99a-EizS-G1-CYP170A1-CinC This study pTrc99a-EizS-G2-CYP170A1-CinC This study pTrc99a-EizS-G3-CYP170A1-CinC This study pTrc99a-EizS-G4-CYP170A1-CinC This study pTrc99a-EizS-G5-CYP170A1-CinC This study

(135) As shown in FIGS. 6A to 6C, the use of solvent overlay generally facilitates 1,8-cineole production, but it does not help hydroxycineole production. For both non-fusion and fusion samples, hydroxycineole productions without using overlay are 1.7-3.4 folds higher than those with an overlay. When nonane overlay is used, all fusions except G4 produce more hydroxycineole than the non-fusion control strain does (FIG. 6C), while producing generally less amount of 1,8-cineole (except for G2), suggesting an inefficient hydroxylation in the non-fusion control strain. When overlay is not used during the production, all 5 strains with fusion protein produce more hydroxycineole than the non-fusion strain (FIG. 6C). The highest hydroxycineole titer is observed from G3 (56 mg/L), which is 3.1-fold higher than that of the non-fusion control (18 mg/L). Unlike the in vitro results, G4 does not show any significant advantage comparing with the other fusions with a different linker length. This indicates that the optimal linker length for a fusion protein may vary from the in vitro and in vivo conditions since the intracellular environment and cell culture medium usually introduces many factors other than the simplified conditions of in vitro reaction. The results also suggest an optimal linker length may play an important role in selecting the best activity of the fusion enzyme, and similar observations have also been reported previously. For example, a fusion of Marinobacter aquaeolei P450 (CYP153) and a CYP116B reductase shows 67% improvement of activity by adding two extra amino acids in the linker.sup.26, and in another example, a ten amino-acid linker is found to present the best activity in the fusion of P450.sub.cin with its native flavodoxin (CinC).sup.27.

(136) In addition to the linker length, the orientation of enzymes in a fusion protein is another important factor for the function of a fusion enzyme.sup.12. Given that G3 shows high production of hydroxycineole at both in vitro and in vivo conditions, GSG.sub.3 (3-repeat of Gly-Ser-Gly) is used as the linker length to construct a fusion enzyme with reversely ordered CS and P450.sub.cin (i.e. P450.sub.cin-GSG.sub.3-CS) to test hydroxycineole production. Compared with the regular CS-GSG.sub.3-P450.sub.cin fusion (G3), this reversed fusion produces 51% and 76% less 1,8-cineole and hydroxycineole, respectively when overlay is used (Table 3). These trends are also significant when the overlay is not used. In this case, the reversed fusion produces 80% and 63% less 1,8-cineole and hydroxycineole, respectively, than the fusion with the normal order (Table 3), indicating an inefficient fusion enzyme when CS and P450.sub.cin are linked in the reverse order.

(137) TABLE-US-00021 TABLE 3 Comparison between CS-P450.sub.cin and P450.sub.cin-CS (fusion with reverse order of enzymes). 1,8-Cineole Hydroxycineole With Without With Without overlay overlay overlay overlay CS-P450.sub.cin 86 ? 1 3 ? 1 32 ? 1 56 ? 1 (mg/L) P450.sub.cin-CS 42 ? 10 1 ? 0 8 ? 0 21 ? 1 (mg/L)
Production of Oxidized Epi-Isozizaene Using Enzyme Fusions.

(138) The enzyme fusion strategy is applied to the biosynthetic pathway for oxidized epi-isozizaene (FIGS. 7A to 7D) such as albaflavenol and the subsequently oxidized product albaflavenone, a sesquiterpene antibiotic found in Streptomyces coelicolor A3(2).sup.28. The P450 (CYP170A1) has been identified to catalyze the oxidation of epi-isozizaene in S. coelicolor A3(2). Recently, epi-isozizaene biosynthesis was successfully engineered in E. coli to produce a novel jet fuel precursor using the MVA pathway.sup.29. Following the fusion enzyme engineering strategy used in hydroxycineole biosynthesis, fusions for epi-isozizaene synthase (EizS) and CYP170A1 with 1 to 5 repeats of Gly-Ser-Gly (GSG) peptide linker are engineered. An RBS sequence (5-TTTCACACAGGAAACAGACC-3) (SEQ ID NO:22) is used for the expression of EizS and CYP170A1 individually in the non-fusion control strain as performed in the 1,8-cineole oxidation case (Table 2).

(139) Compared with the non-fusion control, epi-isozizaene production level is a little lower in the strains with engineered fusion enzymes. On the other hand, the total oxidized products (albaflavenol and albaflavonone) are notably increased in the fusions with shorter linkers (GSG.sub.1-3) for both conditions with and without overlay (FIGS. 7A to 7D). As expected, the difference is more significant when the overlay is used. The highest oxidized epi-isozizaene level (13 mg/L albaflavenol, 3 mg/L albaflavenone) is observed by the fusion with a GSG.sub.2 linker (EizS-GSG.sub.2-CYP170A1), which achieves 90- and 2.3-fold increase in albaflavenol and albaflavenone production, respectively.

Conclusions

(140) The functionalization of terpene molecules using cytochrome P450 enzymes presents opportunities for producing diverse bioproducts via the isoprenoid pathway. In this study, an enzyme fusion strategy is developed by directly linking terpene synthase and P450 enzyme together to facilitate the accessibility of terpene molecules to P450 enzymes.

(141) The hydroxylation of a monoterpene 1,8-cineole as a model system is selected and engineered a series of fusion proteins between 1,8-cineole synthase and P450.sub.cin (CYP176A1) with different lengths of peptide linker to investigate the hydroxylation of 1,8-cineole. Results show that fusion enzymes increase up to 5.4 and 3.1 folds in hydroxycineole production than non-fused individual enzymes at the in vitro and in vivo conditions, respectively. The enzyme fusion strategy is also applied to the oxidation of a sesquiterpene epi-isozizaene, in which a ?90-fold increase is observed by the fusion in albaflavenol production. Results suggest engineering fusion enzymes between terpene synthase and P450 shows a feasible strategy toward efficient production of oxidized terpenes, especially when a solvent overlay is used to trap terpene molecules and prevent their evaporation during the production.

(142) Methods

(143) Strains and Plasmid Construction

(144) All strains and plasmids used in this study are listed in Table 2. E. coli DH1 strain is used for terpene and oxidized terpene production, and E. coli DH5? is used for genetic cloning. Genes of CinA (P450.sub.cin, CYP176A1; GenBank ID: AF456128) and CinC (GenBank ID: AF456128) from Citrobacter braakii, and CYP170A1 (sco5223; GenBank ID: NC_003888) from Streptomyces coelicolor A3(2) are codon-optimized and synthesized by Integrated DNA Technologies, Inc. (San Diego, Calif.). Fpr (GenBank ID: CP032667) is cloned from E. coli genomic DNA. CS from Streptomyces clavuligerus is cloned from plasmid JBEI-15065 (Table 2).

(145) Protein Expression and Purification

(146) A plasmid pSKB3 encoding interested proteins with N-terminal His-tag is transformed into E. coli BL21 (DE3). BL21 (DE3) strains bearing pSKB3 plasmids are cultured in Lysogeny Broth (LB) medium containing 50 ?g/mL kanamycin at 37? C. until the optical density of the culture at 600 nm (OD.sub.600) reaches to 0.5-0.8. The culture is then supplemented with 0.4 mM isopropyl ?-D-1-thiogalactopyranoside (IPTG) for induction and transferred to 18? C. for culturing overnight. Cells are collected by centrifugation and resuspended in 25 mM Tris-HCl (pH 8.0) buffer containing 300 mM NaCl and 10 mM imidazole (pH 8.0). Cells are lysed by sonication and proteins were purified using QIAGEN Ni-NTA Agarose. All purified proteins are desalted in 25 mM Tris-HCl (pH 8.0) buffer containing 100 mM NaCl, and 10% glycerol, and stored at ?80? C.

(147) In Vitro Production of Hydroxycineole

(148) Equal mole of purified proteins, 5 ?M CS and 5 ?M CinA, or 5 ?M fusion protein (G1, G2, G3, G4, G5) with 40 ?M CinC and 10 ?M Fpr are used for the in vitro reaction in 50 mM Tris-HCl buffer (pH 7.4) containing 5 mM MgCl.sub.2.sup.17,23. NADPH (2 mM) and 1 mM geranyl pyrophosphate (GPP, Sigma-Aldrich 19533) are added to start the reaction. The reaction is conducted in a 1.7-mL microcentrifuge tube at 25? C. for 5 hours.

(149) In Vivo Production of Hydroxycineole

(150) E. coli DH1 bearing two plasmids is used for hydroxycineole production. Seed cultures of all production strains are prepared by growing single colonies in LB medium containing 30 ?g/mL chloramphenicol and 100 ?g/mL carbenicillin at 37? C. with 200-rpm shaking for overnight. The seed cultures are diluted in 5 mL EZ-Rich defined medium (Teknova, USA) containing 10 g/L glucose (1%, w/v), 30 ?g/mL chloramphenicol, 100 ?g/mL carbenicillin, and 0.5 mM IPTG in 50-mL test tubes. 0.5 mL nonane (10%, v/v) is added when required as a solvent overlay. The E. coli cell cultures are incubated in rotary shakers (200 rpm) at 30? C. for 48 h.

(151) In Vivo Production of Oxidized Epi-Isozizaene

(152) E. coli DH1 bearing two plasmids are used for oxidized epi-isozizaene production. Seed cultures of all production strains are prepared by growing single colonies in LB medium containing 30 ?g/mL chloramphenicol and 100 ?g/mL carbenicillin at 37? C. with 200-rpm shaking for overnight. The seed cultures are diluted in 5 mL EZ-Rich defined medium (Teknova, USA) containing 10 g/L glucose (1%, w/v), 30 ?g/mL chloramphenicol, 100 ?g/mL carbenicillin, and 65 mg/L ?-aminolevulinic acid, 0.5 mM IPTG in 50-mL culture tubes. 0.5 mL nonane (10%, v/v) is added when required as a solvent overlay. The E. coli cell cultures are incubated in rotary shakers (200 rpm) at 30? C. for 72 hours.

(153) GC-MS Analysis

(154) For 1,8-cineole and hydroxycineole, samples are extracted by an equal volume of ethyl acetate containing ?-pinene (5 mg/L) as an internal standard. For epi-isozizaene and oxidized products, samples are extracted by an equal volume of ethyl acetate containing guaiazulene (5 mg/L) as an internal standard. The mixture of ethyl acetate and cell culture is vigorously shaken for 15 min and subsequently centrifuged at 21,130 g for 3 min to separate ethyl acetate from the aqueous phase. The ethyl acetate layer is collected and 1 ?L was analyzed by Agilent GC-MS equipped with HP-5 column (Agilent, USA). The GC oven is programmed from 40? C. (held for 3 min) to 295? C. at 15? C./min. The solvent delay is set at 3.4 min. Samples are normalized using internal standard (?-pinene or guaiazulene). 1,8-cineole is quantified using an authentic standard. Hydroxycineole is estimated using total ion chromatogram (TIC) areas and 1,8-cineole standards. Epi-isozizaene and oxidized products (albaflavenol, albaflavenone) are estimated using total ion chromatogram (TIC) areas and caryophyllene standards.

(155) When nonane overlay is used during the production, the solvent delay is set at 6.8 min. Both the nonane overlay and the aqueous phase of the culture re sampled for the GC-MS measurement, respectively. The production titers are the sum of both measured values.

(156) While the present invention has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the invention. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present invention. All such modifications are intended to be within the scope of the claims appended hereto.