Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
11939596 ยท 2024-03-26
Assignee
Inventors
Cpc classification
A61K35/17
HUMAN NECESSITIES
C12N2506/30
CHEMISTRY; METALLURGY
A61K31/7076
HUMAN NECESSITIES
A61K2039/5154
HUMAN NECESSITIES
C12N2501/599
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
C12M45/22
CHEMISTRY; METALLURGY
A61K31/675
HUMAN NECESSITIES
A61K9/0019
HUMAN NECESSITIES
C12N5/0638
CHEMISTRY; METALLURGY
C12N2501/04
CHEMISTRY; METALLURGY
A01N1/0284
HUMAN NECESSITIES
C12N2501/51
CHEMISTRY; METALLURGY
International classification
A61K31/675
HUMAN NECESSITIES
A61K31/7076
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
A61K9/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention provides improved and/or shortened methods for expanding TILs and producing therapeutic populations of TILs, including novel methods for expanding TIL populations in a closed system that lead to improved efficacy, improved phenotype, and increased metabolic health of the TILs in a shorter time period, while allowing for reduced microbial contamination as well as decreased costs. Such TILs find use in therapeutic treatment regimens.
Claims
1. A method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs, the method comprising: (a) performing a first expansion by (i) thawing cryopreserved dissociated tumor materials comprising a first population of TILs from a tumor that was resected from a subject with cancer, dissociated after the resection, and cryopreserved after the dissociation, and (ii) culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3, to produce a second population of TILs, wherein the first expansion is performed in a closed system providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs; (b) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the second expansion is performed in the closed system providing a second gas-permeable surface area, and wherein the transition from step (a) to step (b) occurs without opening the closed system; and (c) harvesting the third population of TILs, wherein the harvested third population of TILs is a therapeutic population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the closed system.
2. The method of claim 1, wherein the dissociated tumor materials comprise a tumor digest.
3. The method of claim 1, wherein the dissociated tumor materials comprise one or more tumor fragments.
4. The method of claim 1, wherein obtaining the dissociated tumor materials comprises mechanically disrupting the tumor resected from the subject.
5. The method of claim 4, wherein obtaining the dissociated tumor materials further comprises purifying the disassociated tumor materials using a density gradient separation.
6. The method of claim 1, wherein obtaining the dissociated tumor materials comprises enzymatically disrupting the tumor resected from the subject.
7. The method of claim 6, wherein the enzymatic disruption is performed in an enzymatic media.
8. The method of claim 7, wherein the enzymatic media comprises a mixture of enzymes.
9. The method of claim 8, wherein the mixture of enzymes comprises a collagenase.
10. The method of claim 8, wherein the mixture of enzymes comprises a DNase.
11. The method of claim 8, wherein the mixture of enzymes comprised a collagenase and a DNase.
12. The method of claim 1, wherein the method further comprises performing the step of: (d) transferring the therapeutic population of TILs obtained from step (c) to an infusion bag, wherein the transition from step (c) to step (d) occurs without opening the closed system.
13. The method of claim 12, wherein the method further comprises performing the step of: (e) cryopreserving the infusion bag.
14. The method of claim 13, wherein the method further comprises performing the step of: (f) administering a therapeutically effective dosage of the therapeutic population of TILs from the cryopreserved infusion bag in step (e) to the subject.
15. The method of claim 14, wherein the third population of TILs harvested in step (c) comprises sufficient TILs for administering the therapeutically effective dosage of the TILs in step (f).
16. The method of claim 14, wherein the therapeutically effective dosage of the TILs in step (f) comprises from about 1?10.sup.9 to about 9?10.sup.10 TILs.
17. The method of claim 14, wherein the therapeutically effective dosage in step (f) comprises from about 1?10.sup.9 to about 5?10.sup.9 TILs.
18. The method of claim 14, wherein the therapeutically effective dosage in step (f) comprises from about 5?10.sup.9 to about 1?10.sup.10 TILs.
19. The method of claim 14, wherein the therapeutically effective dosage in step (f) comprises from about 1?10.sup.10 to about 5?10.sup.10 TILs.
20. The method of claim 1, wherein the first expansion is performed within a period of about 7 days.
21. The method of claim 1, wherein the second expansion is performed within a period of about 14 days.
22. The method of claim 1, wherein the first expansion is performed within a first period of about 7 days and the second expansion is performed within a second period of about 14 days.
23. The method of claim 1, wherein step (a) through step (b) are performed within a period of about 21 days.
24. The method of claim 1, wherein the first expansion is performed within a period of about 12 days.
25. The method of claim 1, wherein the second expansion is performed within a period of about 12 days.
26. The method of claim 1, wherein the first expansion is performed within a period of about 12 days and the second expansion is performed within a period of about 12 days.
27. The method of claim 1, wherein step (a) through step (b) are performed within a period of about 24 days.
28. The method of claim 1, wherein step (a) through step (b) are performed in a period of about 24 days.
29. The method of claim 1, wherein the cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma.
30. The method of claim 1, wherein the cancer is a melanoma.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41)
(42)
(43)
(44)
(45)
(46)
(47)
(48)
(49)
(50)
(51)
(52)
(53)
(54)
(55)
(56)
(57)
(58)
(59)
(60)
(61)
(62)
(63)
(64)
(65)
(66)
(67)
(68)
(69)
(70)
(71)
(72)
(73)
(74)
(75)
(76)
(77)
(78)
(79)
(80)
(81)
(82)
(83)
(84)
(85)
(86)
(87)
(88)
(89)
(90)
(91)
(92)
(93)
(94)
(95)
(96)
(97)
(98)
(99)
(100)
(101)
(102)
(103)
(104)
(105)
(106)
(107)
(108)
(109)
(110)
(111)
(112)
(113)
(114)
(115)
(116)
(117)
(118)
(119)
(120)
(121)
(122)
(123)
(124)
(125)
(126)
(127)
(128)
(129)
(130)
(131)
(132)
(133)
(134)
(135)
(136)
(137)
(138)
(139)
(140)
(141)
BRIEF DESCRIPTION OF THE SEQUENCE LISTING
(142) SEQ ID NO:1 is the amino acid sequence of the heavy chain of muromonab.
(143) SEQ ID NO:2 is the amino acid sequence of the light chain of muromonab.
(144) SEQ ID NO:3 is the amino acid sequence of a recombinant human IL-2 protein.
(145) SEQ ID NO:4 is the amino acid sequence of aldesleukin.
(146) SEQ ID NO:5 is the amino acid sequence of a recombinant human IL-4 protein.
(147) SEQ ID NO:6 is the amino acid sequence of a recombinant human IL-7 protein.
(148) SEQ ID NO:7 is the amino acid sequence of a recombinant human IL-15 protein.
(149) SEQ ID NO:8 is the amino acid sequence of a recombinant human IL-21 protein.
(150) SEQ ID NO:9 is the amino acid sequence of human 4-1BB.
(151) SEQ ID NO: 10 is the amino acid sequence of murine 4-1BB.
(152) SEQ ID NO:11 is the heavy chain for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(153) SEQ ID NO:12 is the light chain for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(154) SEQ ID NO:13 is the heavy chain variable region (V.sub.H) for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(155) SEQ ID NO:14 is the light chain variable region (V.sub.L) for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(156) SEQ ID NO:15 is the heavy chain CDR1 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(157) SEQ ID NO:16 is the heavy chain CDR2 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(158) SEQ ID NO:17 is the heavy chain CDR3 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(159) SEQ ID NO:18 is the light chain CDR1 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(160) SEQ ID NO:19 is the light chain CDR2 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(161) SEQ ID NO:20 is the light chain CDR3 for the 4-1BB agonist monoclonal antibody utomilumab (PF-05082566).
(162) SEQ ID NO:21 is the heavy chain for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(163) SEQ ID NO:22 is the light chain for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(164) SEQ ID NO:23 is the heavy chain variable region (V.sub.H) for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(165) SEQ ID NO:24 is the light chain variable region (V.sub.L) for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(166) SEQ ID NO:25 is the heavy chain CDR1 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(167) SEQ ID NO:26 is the heavy chain CDR2 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(168) SEQ ID NO:27 is the heavy chain CDR3 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(169) SEQ ID NO:28 is the light chain CDR1 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(170) SEQ ID NO:29 is the light chain CDR2 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(171) SEQ ID NO:30 is the light chain CDR3 for the 4-1BB agonist monoclonal antibody urelumab (BMS-663513).
(172) SEQ ID NO:46 is a 4-1BB ligand (4-1BBL) amino acid sequence.
(173) SEQ ID NO:47 is a soluble portion of 4-1BBL polypeptide.
(174) SEQ ID NO:48 is a heavy chain variable region (V.sub.H) for the 4-1BB agonist antibody 4B4-1-1 version 1.
(175) SEQ ID NO:49 is a light chain variable region (V.sub.L) for the 4-1BB agonist antibody 4B4-1-1 version 1.
(176) SEQ ID NO:50 is a heavy chain variable region (V.sub.H) for the 4-1BB agonist antibody 4B4-1-1 version 2.
(177) SEQ ID NO:51 is a light chain variable region (V.sub.L) for the 4-1BB agonist antibody 4B4-1-1 version 2.
(178) SEQ ID NO:52 is a heavy chain variable region (V.sub.H) for the 4-1BB agonist antibody H39E3-2.
(179) SEQ ID NO:53 is a light chain variable region (V.sub.L) for the 4-1BB agonist antibody H39E3-2.
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
(180) Adoptive cell therapy utilizing TILs cultured ex vivo by the Rapid Expansion Protocol (REP) has produced successful adoptive cell therapy following host immunosuppression in patients with melanoma. Current infusion acceptance parameters rely on readouts of the composition of TILs (e.g., CD28, CD8, or CD4 positivity) and on the numerical folds of expansion and viability of the REP product.
(181) Current REP protocols give little insight into the health of the TIL that will be infused into the patient. T cells undergo a profound metabolic shift during the course of their maturation from na?ve to effector T cells (see Chang, et al., Nat. Immunol. 2016, 17, 364, hereby expressly incorporated in its entirety, and in particular for the discussion and markers of anaerobic and aerobic metabolism). For example, na?ve T cells rely on mitochondrial respiration to produce ATP, while mature, healthy effector T cells such as TIL are highly glycolytic, relying on aerobic glycolysis to provide the bioenergetics substrates they require for proliferation, migration, activation, and anti-tumor efficacy.
(182) Previous papers report that limiting glycolysis and promoting mitochondrial metabolism in TILs prior to transfer is desirable as cells that are relying heavily on glycolysis will suffer nutrient deprivation upon adoptive transfer which results in a majority of the transferred cells dying. Thus, the art teaches that promoting mitochondrial metabolism might promote in vivo longevity and in fact suggests using inhibitors of glycolysis before induction of the immune response. See Chang et al. (Chang, et al., Nat. Immunol. 2016, 17(364).
(183) The present invention is further directed in some embodiments to methods for evaluating and quantifying this increase in metabolic health. Thus, the present invention provides methods of assaying the relative health of a TIL population using one or more general evaluations of metabolism, including, but not limited to, rates and amounts of glycolysis, oxidative phosphorylation, spare respiratory capacity (SRC), and glycolytic reserve.
(184) Furthermore, the present invention is further directed in some embodiments to methods for evaluating and quantifying this increase in metabolic health. Thus, the present invention provides methods of assaying the relative health of a TIL population using one or more general evaluations of metabolism, including, but not limited to, rates and amounts of glycolysis, oxidative phosphorylation, spare respiratory capacity (SRC), and glycolytic reserve.
(185) In addition, optional additional evaluations include, but are not limited to, ATP production, mitochondrial mass and glucose uptake.
II. Definitions
(186) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which this invention belongs. All patents and publications referred to herein are incorporated by reference in their entireties.
(187) The term in vivo refers to an event that takes place in a subject's body.
(188) The term in vitro refers to an event that takes places outside of a subject's body. In vitro assays encompass cell-based assays in which cells alive or dead are employed and may also encompass a cell-free assay in which no intact cells are employed.
(189) The term ex vivo refers to an event which involves treating or performing a procedure on a cell, tissue and/or organ which has been removed from a subject's body. Aptly, the cell, tissue and/or organ may be returned to the subject's body in a method of surgery or treatment.
(190) The term rapid expansion means an increase in the number of antigen-specific TILs of at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold) over a period of a week, more preferably at least about 10-fold (or 20-, 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold) over a period of a week, or most preferably at least about 100-fold over a period of a week. A number of rapid expansion protocols are outlined below.
(191) By tumor infiltrating lymphocytes or TILs herein is meant a population of cells originally obtained as white blood cells that have left the bloodstream of a subject and migrated into a tumor. TILs include, but are not limited to, CD8+ cytotoxic T cells (lymphocytes), Th1 and Th17 CD4+ T cells, natural killer cells, dendritic cells and M1 macrophages. TILs include both primary and secondary TILs. Primary TILs are those that are obtained from patient tissue samples as outlined herein (sometimes referred to as freshly harvested), and secondary TILs are any TIL cell populations that have been expanded or proliferated as discussed herein, including, but not limited to bulk TILs and expanded TILs (REP TILs or post-REP TILs). TIL cell populations can include genetically modified TILs.
(192) By population of cells (including TILs) herein is meant a number of cells that share common traits. In general, populations generally range from 1?10.sup.6 to 1?10.sup.10 in number, with different TIL populations comprising different numbers. For example, initial growth of primary TILs in the presence of IL-2 results in a population of bulk TILs of roughly 1?10.sup.8 cells. REP expansion is generally done to provide populations of 1.5?10.sup.9 to 1.5?10.sup.10 cells for infusion.
(193) By cryopreserved TILs herein is meant that TILs, either primary, bulk, or expanded (REP TILs), are treated and stored in the range of about ?150? C. to ?60? C. General methods for cryopreservation are also described elsewhere herein, including in the Examples. For clarity, cryopreserved TILs are distinguishable from frozen tissue samples which may be used as a source of primary TILs.
(194) By thawed cryopreserved TILs herein is meant a population of TILs that was previously cryopreserved and then treated to return to room temperature or higher, including but not limited to cell culture temperatures or temperatures wherein TILs may be administered to a patient.
(195) TILs can generally be defined either biochemically, using cell surface markers, or functionally, by their ability to infiltrate tumors and effect treatment. TILs can be generally categorized by expressing one or more of the following biomarkers: CD4, CD8, TCR ??, CD27, CD28, CD56, CCR7, CD45Ra, CD95, PD-1, and CD25. Additionally and alternatively, TILs can be functionally defined by their ability to infiltrate solid tumors upon reintroduction into a patient.
(196) The term cryopreservation media or cryopreservation medium refers to any medium that can be used for cryopreservation of cells. Such media can include media comprising 7% to 10% DMSO. Exemplary media include CryoStor CS10, Hyperthermasol, as well as combinations thereof. The term CS10 refers to a cryopreservation medium which is obtained from Stemcell Technologies or from Biolife Solutions. The CS10 medium may be referred to by the trade name CryoStor? CS10. The CS10 medium is a serum-free, animal component-free medium which comprises DMSO.
(197) The term central memory T cell refers to a subset of T cells that in the human are CD45R0+ and constitutively express CCR7 (CCR7.sup.hi) and CD62 L (CD62.sup.hi). The surface phenotype of central memory T cells also includes TCR, CD3, CD127 (IL-7R), and IL-15R. Transcription factors for central memory T cells include BCL-6, BCL-6B, MBD2, and BMI1. Central memory T cells primarily secret IL-2 and CD40L as effector molecules after TCR triggering. Central memory T cells are predominant in the CD4 compartment in blood, and in the human are proportionally enriched in lymph nodes and tonsils.
(198) The term effector memory T cell refers to a subset of human or mammalian T cells that, like central memory T cells, are CD45R0+, but have lost the constitutive expression of CCR7 (CCR7.sup.lo) and are heterogeneous or low for CD62 L expression (CD62L.sup.lo). The surface phenotype of central memory T cells also includes TCR, CD3, CD127 (IL-7R), and IL-15R. Transcription factors for central memory T cells include BLIMP1. Effector memory T cells rapidly secret high levels of inflammatory cytokines following antigenic stimulation, including interferon-?, IL-4, and IL-5. Effector memory T cells are predominant in the CD8 compartment in blood, and in the human are proportionally enriched in the lung, liver, and gut. CD8+ effector memory T cells carry large amounts of perform.
(199) The term closed system refers to a system that is closed to the outside environment. Any closed system appropriate for cell culture methods can be employed with the methods of the present invention. Closed systems include, for example, but are not limited to closed G-containers. Once a tumor segment is added to the closed system, the system is no opened to the outside environment until the TILs are ready to be administered to the patient.
(200) The terms fragmenting, fragment, and fragmented, as used herein to describe processes for disrupting a tumor, includes mechanical fragmentation methods such as crushing, slicing, dividing, and morcellating tumor tissue as well as any other method for disrupting the physical structure of tumor tissue.
(201) The terms peripheral blood mononuclear cells and PBMCs refers to a peripheral blood cell having a round nucleus, including lymphocytes (T cells, B cells, NK cells) and monocytes. Preferably, the peripheral blood mononuclear cells are irradiated allogeneic peripheral blood mononuclear cells. PBMCs are a type of antigen-presenting cell.
(202) The term anti-CD3 antibody refers to an antibody or variant thereof, e.g., a monoclonal antibody and including human, humanized, chimeric or murine antibodies which are directed against the CD3 receptor in the T cell antigen receptor of mature T cells. Anti-CD3 antibodies include OKT-3, also known as muromonab. Anti-CD3 antibodies also include the UHCT1 clone, also known as T3 and CD3?. Other anti-CD3 antibodies include, for example, otelixizumab, teplizumab, and visilizumab.
(203) The term OKT-3 (also referred to herein as OKT3) refers to a monoclonal antibody or biosimilar or variant thereof, including human, humanized, chimeric, or murine antibodies, directed against the CD3 receptor in the T cell antigen receptor of mature T cells, and includes commercially-available forms such as OKT-3 (30 ng/mL, MACS GMP CD3 pure, Miltenyi Biotech, Inc., San Diego, CA, USA) and muromonab or variants, conservative amino acid substitutions, glycoforms, or biosimilars thereof. The amino acid sequences of the heavy and light chains of muromonab are given in Table 1 (SEQ ID NO:1 and SEQ ID NO:2). A hybridoma capable of producing OKT-3 is deposited with the American Type Culture Collection and assigned the ATCC accession number CRL 8001. A hybridoma capable of producing OKT-3 is also deposited with European Collection of Authenticated Cell Cultures (ECACC) and assigned Catalogue No. 86022706.
(204) TABLE-US-00001 TABLE1 Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:1 QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY 60 Muromonab NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA 120 heavychain KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL 180 YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG 240 PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN 300 STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE 360 LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW 420 QQGNVFSVSVMHEALHNHYTQKSLSLSPGK 450 SEQIDNO:2 QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH 60 Muromonab FRGSGSGTSYSLTISGMEAEDAATYYCQOWSSNPFTFGSGTKLEINRADTAPTVSIFPPS 120 lightchain SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL 180 TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 213
(205) The term IL-2 (also referred to herein as IL2) refers to the T cell growth factor known as interleukin-2, and includes all forms of IL-2 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-2 is described, e.g., in Nelson, J. Immunol. 2004, 172, 3983-88 and Malek, Annu. Rev. Immunol. 2008, 26, 453-79, the disclosures of which are incorporated by reference herein. The amino acid sequence of recombinant human IL-2 suitable for use in the invention is given in Table 2 (SEQ ID NO:3). For example, the term IL-2 encompasses human, recombinant forms of IL-2 such as aldesleukin (PROLEUKIN, available commercially from multiple suppliers in 22 million IU per single use vials), as well as the form of recombinant IL-2 commercially supplied by CellGenix, Inc., Portsmouth, NH, USA (CELLGRO GMP) or ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-209-b) and other commercial equivalents from other vendors. Aldesleukin (des-alanyl-1, serine-125 human IL-2) is a nonglycosylated human recombinant form of IL-2 with a molecular weight of approximately 15 kDa. The amino acid sequence of aldesleukin suitable for use in the invention is given in Table 2 (SEQ ID NO:4). The term IL-2 also encompasses pegylated forms of IL-2, as described herein, including the pegylated IL2 prodrug NKTR-214, available from Nektar Therapeutics, South San Francisco, CA, USA. NKTR-214 and pegylated IL-2 suitable for use in the invention is described in U.S. Patent Application Publication No. US 2014/0328791 A1 and International Patent Application Publication No. WO 2012/065086 A1, the disclosures of which are incorporated by reference herein. Alternative forms of conjugated IL-2 suitable for use in the invention are described in U.S. Pat. Nos. 4,766,106, 5,206,344, 5,089,261 and 4902,502, the disclosures of which are incorporated by reference herein. Formulations of IL-2 suitable for use in the invention are described in U.S. Pat. No. 6,706,289, the disclosure of which is incorporated by reference herein.
(206) TABLE-US-00002 TABLE2 Aminoacidsequencesofinterleukins. Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:3 MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCL 60 recombinant EEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLN 120 humanIL-2 RWITFCQSIISTLT 134 (rhIL-2) SEQIDNO:4 PTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEE 60 Aldesleukin ELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRW 120 ITFSQSIISTLT 132 SEQIDNO:5 MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHH 60 recombinant EKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTI 120 humanIL-4 MREKYSKCSS 130 (rhIL-4) SEQIDNO:6 MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRA 60 recombinant ARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSL 120 humanIL-7 KEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH 153 (rhIL-7) SEQIDNO:7 MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCVLLELQVISLESGDASI 60 recombinant HDTVENLIILANNSLSSNGNVGESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 115 humanIL-15 (rhIL-15) SEQIDNO:8 MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTG 60 recombinant NNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQ 120 humanIL-21 HLSSRTHGSEDS 132 (rhIL-21)
(207) The term IL-4 (also referred to herein as IL4) refers to the cytokine known as interleukin 4, which is produced by Th2 T cells and by eosinophils, basophils, and mast cells. IL-4 regulates the differentiation of na?ve helper T cells (Th0 cells) to Th2 T cells. Steinke and Borish, Respir. Res. 2001, 2, 66-70. Upon activation by IL-4, Th2 T cells subsequently produce additional IL-4 in a positive feedback loop. IL-4 also stimulates B cell proliferation and class II MHC expression, and induces class switching to IgE and IgG.sub.1 expression from B cells. Recombinant human IL-4 suitable for use in the invention is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-211) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-15 recombinant protein, Cat. No. Gibco CTP0043). The amino acid sequence of recombinant human IL-4 suitable for use in the invention is given in Table 2 (SEQ ID NO:5).
(208) The term IL-7 (also referred to herein as IL7) refers to a glycosylated tissue-derived cytokine known as interleukin 7, which may be obtained from stromal and epithelial cells, as well as from dendritic cells. Fry and Mackall, Blood 2002, 99, 3892-904. IL-7 can stimulate the development of T cells. IL-7 binds to the IL-7 receptor, a heterodimer consisting of IL-7 receptor alpha and common gamma chain receptor, which in a series of signals important for T cell development within the thymus and survival within the periphery. Recombinant human IL-7 suitable for use in the invention is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-254) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-15 recombinant protein, Cat. No. Gibco PHC0071). The amino acid sequence of recombinant human IL-7 suitable for use in the invention is given in Table 2 (SEQ ID NO:6).
(209) The term IL-15 (also referred to herein as IL15) refers to the T cell growth factor known as interleukin-15, and includes all forms of IL-2 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-15 is described, e.g., in Fehniger and Caligiuri, Blood 2001, 97, 14-32, the disclosure of which is incorporated by reference herein. IL-15 shares ? and ? signaling receptor subunits with IL-2. Recombinant human IL-15 is a single, non-glycosylated polypeptide chain containing 114 amino acids (and an N-terminal methionine) with a molecular mass of 12.8 kDa. Recombinant human IL-15 is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-230-b) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-15 recombinant protein, Cat. No. 34-8159-82). The amino acid sequence of recombinant human IL-15 suitable for use in the invention is given in Table 2 (SEQ ID NO:7).
(210) The term IL-21 (also referred to herein as IL21) refers to the pleiotropic cytokine protein known as interleukin-21, and includes all forms of IL-21 including human and mammalian forms, conservative amino acid substitutions, glycoforms, biosimilars, and variants thereof. IL-21 is described, e.g., in Spolski and Leonard, Nat. Rev. Drug. Disc. 2014, 13, 379-95, the disclosure of which is incorporated by reference herein. IL-21 is primarily produced by natural killer T cells and activated human CD4+ T cells. Recombinant human IL-21 is a single, non-glycosylated polypeptide chain containing 132 amino acids with a molecular mass of 15.4 kDa. Recombinant human IL-21 is commercially available from multiple suppliers, including ProSpec-Tany TechnoGene Ltd., East Brunswick, NJ, USA (Cat. No. CYT-408-b) and ThermoFisher Scientific, Inc., Waltham, MA, USA (human IL-21 recombinant protein, Cat. No. 14-8219-80). The amino acid sequence of recombinant human IL-21 suitable for use in the invention is given in Table 2 (SEQ ID NO:8).
(211) When an anti-tumor effective amount, an tumor-inhibiting effective amount, or therapeutic amount is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the tumor infiltrating lymphocytes (e.g. secondary TILs or genetically modified cytotoxic lymphocytes) described herein may be administered at a dosage of 10.sup.4 to 10.sup.11 cells/kg body weight (e.g., 10.sup.5 to 10.sup.6, 105 to 10.sup.10, 10.sup.5 to 10.sup.11, 10.sup.6 to 10.sup.10, 10.sup.6 to 10.sup.11, 10.sup.7 to 10.sup.11, 107 to 10.sup.10, 10.sup.8 to 10.sup.11, 10.sup.8 to 10.sup.10, 10.sup.9 to 10.sup.11, or 10.sup.9 to 10.sup.10 cells/kg body weight), including all integer values within those ranges. Tumor infiltrating lymphocytes (including in some cases, genetically modified cytotoxic lymphocytes) compositions may also be administered multiple times at these dosages. The tumor infiltrating lymphocytes (including in some cases, genetically) can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319: 1676, 1988). The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.
(212) The term hematological malignancy refers to mammalian cancers and tumors of the hematopoietic and lymphoid tissues, including but not limited to tissues of the blood, bone marrow, lymph nodes, and lymphatic system. Hematological malignancies are also referred to as liquid tumors. Hematological malignancies include, but are not limited to, acute lymphoblastic leukemia (ALL), chronic lymphocytic lymphoma (CLL), small lymphocytic lymphoma (SLL), acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), acute monocytic leukemia (AMoL), Hodgkin's lymphoma, and non-Hodgkin's lymphomas. The term B cell hematological malignancy refers to hematological malignancies that affect B cells.
(213) The term solid tumor refers to an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors may be benign or malignant. The term solid tumor cancer refers to malignant, neoplastic, or cancerous solid tumors. Solid tumor cancers include, but are not limited to, sarcomas, carcinomas, and lymphomas, such as cancers of the lung, breast, prostate, colon, rectum, and bladder. The tissue structure of solid tumors includes interdependent tissue compartments including the parenchyma (cancer cells) and the supporting stromal cells in which the cancer cells are dispersed and which may provide a supporting microenvironment.
(214) The term liquid tumor refers to an abnormal mass of cells that is fluid in nature. Liquid tumor cancers include, but are not limited to, leukemias, myelomas, and lymphomas, as well as other hematological malignancies. TILs obtained from liquid tumors may also be referred to herein as marrow infiltrating lymphocytes (MILs).
(215) The term microenvironment, as used herein, may refer to the solid or hematological tumor microenvironment as a whole or to an individual subset of cells within the microenvironment. The tumor microenvironment, as used herein, refers to a complex mixture of cells, soluble factors, signaling molecules, extracellular matrices, and mechanical cues that promote neoplastic transformation, support tumor growth and invasion, protect the tumor from host immunity, foster therapeutic resistance, and provide niches for dominant metastases to thrive, as described in Swartz, et al., Cancer Res., 2012, 72, 2473. Although tumors express antigens that should be recognized by T cells, tumor clearance by the immune system is rare because of immune suppression by the microenvironment.
(216) In an embodiment, the invention includes a method of treating a cancer with a population of TILs, wherein a patient is pre-treated with non-myeloablative chemotherapy prior to an infusion of TILs according to the invention. In some embodiments, the population of TILs may be provided wherein a patient is pre-treated with nonmyeloablative chemotherapy prior to an infusion of TILs according to the present invention. In an embodiment, the non-myeloablative chemotherapy is cyclophosphamide 60 mg/kg/d for 2 days (days 27 and 26 prior to TIL infusion) and fludarabine 25 mg/m2/d for 5 days (days 27 to 23 prior to TIL infusion). In an embodiment, after non-myeloablative chemotherapy and TIL infusion (at day 0) according to the invention, the patient receives an intravenous infusion of IL-2 intravenously at 720,000 IU/kg every 8 hours to physiologic tolerance.
(217) Experimental findings indicate that lymphodepletion prior to adoptive transfer of tumor-specific T lymphocytes plays a key role in enhancing treatment efficacy by eliminating regulatory T cells and competing elements of the immune system (cytokine sinks). Accordingly, some embodiments of the invention utilize a lymphodepletion step (sometimes also referred to as immunosuppressive conditioning) on the patient prior to the introduction of the rTILs of the invention.
(218) The terms co-administration, co-administering, administered in combination with, administering in combination with, simultaneous, and concurrent, as used herein, encompass administration of two or more active pharmaceutical ingredients (in a preferred embodiment of the present invention, for example, at least one potassium channel agonist in combination with a plurality of TILs) to a subject so that both active pharmaceutical ingredients and/or their metabolites are present in the subject at the same time. Co-administration includes simultaneous administration in separate compositions, administration at different times in separate compositions, or administration in a composition in which two or more active pharmaceutical ingredients are present. Simultaneous administration in separate compositions and administration in a composition in which both agents are present are preferred.
(219) The term effective amount or therapeutically effective amount refers to that amount of a compound or combination of compounds as described herein that is sufficient to effect the intended application including, but not limited to, disease treatment. A therapeutically effective amount may vary depending upon the intended application (in vitro or in vivo), or the subject and disease condition being treated (e.g., the weight, age and gender of the subject), the severity of the disease condition, or the manner of administration. The term also applies to a dose that will induce a particular response in target cells (e.g., the reduction of platelet adhesion and/or cell migration). The specific dose will vary depending on the particular compounds chosen, the dosing regimen to be followed, whether the compound is administered in combination with other compounds, timing of administration, the tissue to which it is administered, and the physical delivery system in which the compound is carried.
(220) The terms treatment, treating, treat, and the like, refer to obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disease or symptom thereof and/or may be therapeutic in terms of a partial or complete cure for a disease and/or adverse effect attributable to the disease. Treatment, as used herein, covers any treatment of a disease in a mammal, particularly in a human, and includes: (a) preventing the disease from occurring in a subject which may be predisposed to the disease but has not yet been diagnosed as having it; (b) inhibiting the disease, i.e., arresting its development or progression; and (c) relieving the disease, i.e., causing regression of the disease and/or relieving one or more disease symptoms. Treatment is also meant to encompass delivery of an agent in order to provide for a pharmacologic effect, even in the absence of a disease or condition. For example, treatment encompasses delivery of a composition that can elicit an immune response or confer immunity in the absence of a disease condition, e.g., in the case of a vaccine.
(221) The term heterologous when used with reference to portions of a nucleic acid or protein indicates that the nucleic acid or protein comprises two or more subsequences that are not found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source, or coding regions from different sources. Similarly, a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
(222) The terms sequence identity, percent identity, and sequence percent identity (or synonyms thereof, e.g., 99% identical) in the context of two or more nucleic acids or polypeptides, refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity. The percent identity can be measured using sequence comparison software or algorithms or by visual inspection. Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences. Suitable programs to determine percent sequence identity include for example the BLAST suite of programs available from the U.S. Government's National Center for Biotechnology Information BLAST web site. Comparisons between two sequences can be carried using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. ALIGN, ALIGN-2 (Genentech, South San Francisco, California) or MegAlign, available from DNASTAR, are additional publicly available software programs that can be used to align sequences. One skilled in the art can determine appropriate parameters for maximal alignment by particular alignment software. In certain embodiments, the default parameters of the alignment software are used.
(223) As used herein, the term variant encompasses but is not limited to antibodies or fusion proteins which comprise an amino acid sequence which differs from the amino acid sequence of a reference antibody by way of one or more substitutions, deletions and/or additions at certain positions within or adjacent to the amino acid sequence of the reference antibody. The variant may comprise one or more conservative substitutions in its amino acid sequence as compared to the amino acid sequence of a reference antibody. Conservative substitutions may involve, e.g., the substitution of similarly charged or uncharged amino acids. The variant retains the ability to specifically bind to the antigen of the reference antibody. The term variant also includes pegylated antibodies or proteins.
(224) By tumor infiltrating lymphocytes or TILs herein is meant a population of cells originally obtained as white blood cells that have left the bloodstream of a subject and migrated into a tumor. TILs include, but are not limited to, CD8.sup.+ cytotoxic T cells (lymphocytes), Th1 and Th17 CD4.sup.+ T cells, natural killer cells, dendritic cells and M1 macrophages. TILs include both primary and secondary TILs. Primary TILs are those that are obtained from patient tissue samples as outlined herein (sometimes referred to as freshly harvested), and secondary TILs are any TIL cell populations that have been expanded or proliferated as discussed herein, including, but not limited to bulk TILs, expanded TILs (REP TILs) as well as reREP TILs as discussed herein. reREP TILs can include for example second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of
(225) TILs can generally be defined either biochemically, using cell surface markers, or functionally, by their ability to infiltrate tumors and effect treatment. TILs can be generally categorized by expressing one or more of the following biomarkers: CD4, CD8, TCR ??, CD27, CD28, CD56, CCR7, CD45Ra, CD95, PD-1, and CD25. Additionally, and alternatively, TILs can be functionally defined by their ability to infiltrate solid tumors upon reintroduction into a patient. TILS may further be characterized by potencyfor example, TILS may be considered potent if, for example, interferon (IFN) release is greater than about 50 pg/mL, greater than about 100 pg/mL, greater than about 150 pg/mL, or greater than about 200 pg/mL.
(226) The terms pharmaceutically acceptable carrier or pharmaceutically acceptable excipient are intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and inert ingredients. The use of such pharmaceutically acceptable carriers or pharmaceutically acceptable excipients for active pharmaceutical ingredients is well known in the art. Except insofar as any conventional pharmaceutically acceptable carrier or pharmaceutically acceptable excipient is incompatible with the active pharmaceutical ingredient, its use in the therapeutic compositions of the invention is contemplated. Additional active pharmaceutical ingredients, such as other drugs, can also be incorporated into the described compositions and methods.
(227) The terms about and approximately mean within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, more preferably still within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the terms about or approximately depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art. Moreover, as used herein, the terms about and approximately mean that dimensions, sizes, formulations, parameters, shapes and other quantities and characteristics are not and need not be exact, but may be approximate and/or larger or smaller, as desired, reflecting tolerances, conversion factors, rounding off, measurement error and the like, and other factors known to those of skill in the art. In general, a dimension, size, formulation, parameter, shape or other quantity or characteristic is about or approximate whether or not expressly stated to be such. It is noted that embodiments of very different sizes, shapes and dimensions may employ the described arrangements.
(228) The transitional terms comprising, consisting essentially of, and consisting of, when used in the appended claims, in original and amended form, define the claim scope with respect to what unrecited additional claim elements or steps, if any, are excluded from the scope of the claim(s). The term comprising is intended to be inclusive or open-ended and does not exclude any additional, unrecited element, method, step or material. The term consisting of excludes any element, step or material other than those specified in the claim and, in the latter instance, impurities ordinary associated with the specified material(s). The term consisting essentially of limits the scope of a claim to the specified elements, steps or material(s) and those that do not materially affect the basic and novel characteristic(s) of the claimed invention. All compositions, methods, and kits described herein that embody the present invention can, in alternate embodiments, be more specifically defined by any of the transitional terms comprising, consisting essentially of, and consisting of.
(229) 4-1BB (CD137) Agonists
(230) In an embodiment, the TNFRSF agonist is a 4-1BB (CD137) agonist. The 4-1BB agonist may be any 4-1BB binding molecule known in the art. The 4-1BB binding molecule may be a monoclonal antibody or fusion protein capable of binding to human or mammalian 4-1BB. The 4-1BB agonists or 4-1BB binding molecules may comprise an immunoglobulin heavy chain of any isotype (e.g., IgG, IgE, IgM, IgD, IgA, and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. The 4-1BB agonist or 4-1BB binding molecule may have both a heavy and a light chain. As used herein, the term binding molecule also includes antibodies (including full length antibodies), monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), human, humanized or chimeric antibodies, and antibody fragments, e.g., Fab fragments, F(ab) fragments, fragments produced by a Fab expression library, epitope-binding fragments of any of the above, and engineered forms of antibodies, e.g., scFv molecules, that bind to 4-1BB. In an embodiment, the 4-1BB agonist is an antigen binding protein that is a fully human antibody. In an embodiment, the 4-1BB agonist is an antigen binding protein that is a humanized antibody. In some embodiments, 4-1BB agonists for use in the presently disclosed methods and compositions include anti-4-1BB antibodies, human anti-4-1BB antibodies, mouse anti-4-1BB antibodies, mammalian anti-4-1BB antibodies, monoclonal anti-4-1BB antibodies, polyclonal anti-4-1BB antibodies, chimeric anti-4-1BB antibodies, anti-4-1BB adnectins, anti-4-1BB domain antibodies, single chain anti-4-1BB fragments, heavy chain anti-4-1BB fragments, light chain anti-4-1BB fragments, anti-4-1BB fusion proteins, and fragments, derivatives, conjugates, variants, or biosimilars thereof. Agonistic anti-4-1BB antibodies are known to induce strong immune responses. Lee, et al., PLOS One 2013, 8, e69677. In a preferred embodiment, the 4-1BB agonist is an agonistic, anti-4-1BB humanized or fully human monoclonal antibody (i.e., an antibody derived from a single cell line). In an embodiment, the 4-1BB agonist is EU-101 (Eutilex Co. Ltd.), utomilumab, or urelumab, or a fragment, derivative, conjugate, variant, or biosimilar thereof. In a preferred embodiment, the 4-1BB agonist is utomilumab or urelumab, or a fragment, derivative, conjugate, variant, or biosimilar thereof.
(231) In a preferred embodiment, the 4-1BB agonist or 4-1BB binding molecule may also be a fusion protein. In a preferred embodiment, a multimeric 4-1BB agonist, such as a trimeric or hexameric 4-1BB agonist (with three or six ligand binding domains), may induce superior receptor (4-1BBL) clustering and internal cellular signaling complex formation compared to an agonistic monoclonal antibody, which typically possesses two ligand binding domains. Trimeric (trivalent) or hexameric (or hexavalent) or greater fusion proteins comprising three TNFRSF binding domains and IgG1-Fc and optionally further linking two or more of these fusion proteins are described, e.g., in Gieffers, et al., Mol. Cancer Therapeutics 2013, 12, 2735-47.
(232) Agonistic 4-1BB antibodies and fusion proteins are known to induce strong immune responses. In a preferred embodiment, the 4-1BB agonist is a monoclonal antibody or fusion protein that binds specifically to 4-1BB antigen in a manner sufficient to reduce toxicity. In some embodiments, the 4-1BB agonist is an agonistic 4-1BB monoclonal antibody or fusion protein that abrogates antibody-dependent cellular toxicity (ADCC), for example NK cell cytotoxicity. In some embodiments, the 4-1BB agonist is an agonistic 4-1BB monoclonal antibody or fusion protein that abrogates antibody-dependent cell phagocytosis (ADCP). In some embodiments, the 4-1BB agonist is an agonistic 4-1BB monoclonal antibody or fusion protein that abrogates complement-dependent cytotoxicity (CDC). In some embodiments, the 4-1BB agonist is an agonistic 4-1BB monoclonal antibody or fusion protein which abrogates Fc region functionality.
(233) In some embodiments, the 4-1BB agonists are characterized by binding to human 4-1BB (SEQ ID NO:9) with high affinity and agonistic activity. In an embodiment, the 4-1BB agonist is a binding molecule that binds to human 4-1BB (SEQ ID NO:9). In an embodiment, the 4-1BB agonist is a binding molecule that binds to murine 4-1BB (SEQ ID NO:10). The amino acid sequences of 4-1BB antigen to which a 4-1BB agonist or binding molecule binds are summarized in Table 3.
(234) TABLE-US-00003 TABLE3 Aminoacidsequencesof4-1BBantigens. Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:9 MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR 60 human4-1BB, TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC 120 Tumornecrosis CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE 180 factorreceptor PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG 240 superfamily, CSCRFPEEEEGGCEL 255 member9 (Homosapiens) SEQIDNO:10 MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPN 60 murine4-1BB, CNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCS 120 Tumornecrosis LGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPG 180 factorreceptor GHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACS 240 superfamily, CRCPQEEEGGGGGYEL 256 member9 (Musmusculus)
(235) In some embodiments, the compositions, processes and methods described include a 4-1BB agonist that binds human or murine 4-1BB with a K.sub.D of about 100 pM or lower, binds human or murine 4-1BB with a K.sub.D of about 90 pM or lower, binds human or murine 4-1BB with a K.sub.D of about 80 pM or lower, binds human or murine 4-1BB with a K.sub.D of about 70 pM or lower, binds human or murine 4-1BB with a K.sub.D of about 60 pM or lower, binds human or murine 4-1BB with a K.sub.D of about 50 pM or lower, binds human or murine 4-1BB with a K.sub.D of about 40 pM or lower, or binds human or murine 4-1BB with a K.sub.D of about 30 pM or lower.
(236) In some embodiments, the compositions, processes and methods described include a 4-1BB agonist that binds to human or murine 4-1BB with a k.sub.assoc of about 7.5?10.sup.5 1/M.Math.s or faster, binds to human or murine 4-1BB with a k.sub.assoc of about 7.5?10.sup.5 1/M.Math.s or faster, binds to human or murine 4-1BB with a k.sub.assoc of about 8?10.sup.5 1/M.Math.s or faster, binds to human or murine 4-1BB with a k.sub.assoc of about 8.5?10.sup.5 1/M.Math.s or faster, binds to human or murine 4-1BB with a k.sub.assoc of about 9?10.sup.5 1/M.Math.s or faster, binds to human or murine 4-1BB with a k.sub.assoc of about 9.5?10.sup.5 1/M.Math.s or faster, or binds to human or murine 4-1BB with a k.sub.assoc of about 1?10.sup.6 1/M.Math.s or faster.
(237) In some embodiments, the compositions, processes and methods described include a 4-1BB agonist that binds to human or murine 4-1BB with a k.sub.dissoc of about 2?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.1?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.2?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.3?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.4?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.5?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.6?10.sup.?5 1/s or slower or binds to human or murine 4-1BB with a k.sub.dissoc of about 2.7?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.8?10.sup.?5 1/s or slower, binds to human or murine 4-1BB with a k.sub.dissoc of about 2.9?10.sup.?5 1/s or slower, or binds to human or murine 4-1BB with a k.sub.dissoc of about 3?10.sup.?5 1/s or slower.
(238) In some embodiments, the compositions, processes and methods described include a 4-1BB agonist that binds to human or murine 4-1BB with an IC.sub.50 of about 10 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 9 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 8 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 7 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 6 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 5 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 4 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 3 nM or lower, binds to human or murine 4-1BB with an IC.sub.50 of about 2 nM or lower, or binds to human or murine 4-1BB with an IC.sub.50 of about 1 nM or lower.
(239) In a preferred embodiment, the 4-1BB agonist is utomilumab, also known as PF-05082566 or MOR-7480, or a fragment, derivative, variant, or biosimilar thereof. Utomilumab is available from Pfizer, Inc. Utomilumab is an immunoglobulin G2-lambda, anti-[Homo sapiens TNFRSF9 (tumor necrosis factor receptor (TNFR) superfamily member 9, 4-1BB, T cell antigen ILA, CD137)], Homo sapiens (fully human) monoclonal antibody. The amino acid sequences of utomilumab are set forth in Table 4. Utomilumab comprises glycosylation sites at Asn59 and Asn292; heavy chain intrachain disulfide bridges at positions 22-96 (V.sub.H-V.sub.L), 143-199 (C.sub.H1-C.sub.L), 256-316 (C.sub.H2) and 362-420 (C.sub.H3); light chain intrachain disulfide bridges at positions 22-87 (V.sub.H-V.sub.L) and 136-195 (C.sub.H1-C.sub.L); interchain heavy chain-heavy chain disulfide bridges at IgG2A isoform positions 218-218, 219-219, 222-222, and 225-225, at IgG2A/B isoform positions 218-130, 219-219, 222-222, and 225-225, and at IgG2B isoform positions 219-130 (2), 222-222, and 225-225; and interchain heavy chain-light chain disulfide bridges at IgG2A isoform positions 130-213 (2), IgG2A/B isoform positions 218-213 and 130-213, and at IgG2B isoform positions 218-213 (2). The preparation and properties of utomilumab and its variants and fragments are described in U.S. Pat. Nos. 8,821,867; 8,337,850; and 9,468,678, and International Patent Application Publication No. WO 2012/032433 A1, the disclosures of each of which are incorporated by reference herein. Preclinical characteristics of utomilumab are described in Fisher, et al., Cancer Immunolog. & Immunother. 2012, 61, 1721-33. Current clinical trials of utomilumab in a variety of hematological and solid tumor indications include U.S. National Institutes of Health clinicaltrials.gov identifiers NCT02444793, NCT01307267, NCT02315066, and NCT02554812.
(240) In an embodiment, a 4-1BB agonist comprises a heavy chain given by SEQ ID NO:11 and a light chain given by SEQ ID NO:12. In an embodiment, a 4-1BB agonist comprises heavy and light chains having the sequences shown in SEQ ID NO:11 and SEQ ID NO:12, respectively, or antigen binding fragments, Fab fragments, single-chain variable fragments (scFv), variants, or conjugates thereof. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 99% identical to the sequences shown in SEQ ID NO:11 and SEQ ID NO:12, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 98% identical to the sequences shown in SEQ ID NO:11 and SEQ ID NO:12, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 97% identical to the sequences shown in SEQ ID NO:11 and SEQ ID NO:12, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 96% identical to the sequences shown in SEQ ID NO:11 and SEQ ID NO:12, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 95% identical to the sequences shown in SEQ ID NO:11 and SEQ ID NO:12, respectively.
(241) In an embodiment, the 4-1BB agonist comprises the heavy and light chain CDRs or variable regions (VRs) of utomilumab. In an embodiment, the 4-1BB agonist heavy chain variable region (V.sub.H) comprises the sequence shown in SEQ ID NO:13, and the 4-1BB agonist light chain variable region (V.sub.L) comprises the sequence shown in SEQ ID NO: 14, and conservative amino acid substitutions thereof. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 99% identical to the sequences shown in SEQ ID NO:13 and SEQ ID NO:14, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 98% identical to the sequences shown in SEQ ID NO:13 and SEQ ID NO:14, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 97% identical to the sequences shown in SEQ ID NO:13 and SEQ ID NO:14, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 96% identical to the sequences shown in SEQ ID NO:13 and SEQ ID NO:14, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 95% identical to the sequences shown in SEQ ID NO:13 and SEQ ID NO:14, respectively. In an embodiment, a 4-1BB agonist comprises an scFv antibody comprising V.sub.H and V.sub.L regions that are each at least 99% identical to the sequences shown in SEQ ID NO:13 and SEQ ID NO:14.
(242) In an embodiment, a 4-1BB agonist comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NO:15, SEQ ID NO: 16, and SEQ ID NO:17, respectively, and conservative amino acid substitutions thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NO:18, SEQ ID NO:19, and SEQ ID NO:20, respectively, and conservative amino acid substitutions thereof.
(243) In an embodiment, the 4-1BB agonist is a 4-1BB agonist biosimilar monoclonal antibody approved by drug regulatory authorities with reference to utomilumab. In an embodiment, the biosimilar monoclonal antibody comprises an 4-1BB antibody comprising an amino acid sequence which has at least 97% sequence identity, e.g., 97%, 98%, 99% or 100% sequence identity, to the amino acid sequence of a reference medicinal product or reference biological product and which comprises one or more post-translational modifications as compared to the reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is utomilumab. In some embodiments, the one or more post-translational modifications are selected from one or more of: glycosylation, oxidation, deamidation, and truncation. In some embodiments, the biosimilar is a 4-1BB agonist antibody authorized or submitted for authorization, wherein the 4-1BB agonist antibody is provided in a formulation which differs from the formulations of a reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is utomilumab. The 4-1BB agonist antibody may be authorized by a drug regulatory authority such as the U.S. FDA and/or the European Union's EMA. In some embodiments, the biosimilar is provided as a composition which further comprises one or more excipients, wherein the one or more excipients are the same or different to the excipients comprised in a reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is utomilumab. In some embodiments, the biosimilar is provided as a composition which further comprises one or more excipients, wherein the one or more excipients are the same or different to the excipients comprised in a reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is utomilumab.
(244) TABLE-US-00004 TABLE4 Aminoacidsequencesfor4-1BBagonistantibodiesrelatedtoutomilumab. Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:11 EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGKIYPGDSYTNY 60 heavychainfor SPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGYGIFDYWGQGTLVTVSSASTK 120 utomilumab GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS 180 LSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVFLFPP 240 KPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFRVVSV 300 LTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSL 360 TCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSC 420 SVMHEALHNHYTQKSLSLSPG 441 SEQIDNO:12 SYELTQPPSVSVSPGQTASITCSGDNIGDQYAHWYQQKPGQSPVLVIYQDKNRPSGIPER 60 lightchainfor FSGSNSGNTATLTISGTQAMDEADYYCATYTGFGSLAVFGGGTKLTVLGQPKAAPSVTLF 120 utomilumab PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL 180 SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS 214 SEQIDNO:13 EVQLVQSGAEVKKPGESLRISCKGSGYSFSTYWISWVRQMPGKGLEWMGKIYPGDSYTN 60 heavychain YSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARGYGIFDYWGQGTLVTVSS 118 variableregion forutomilumab SEQIDNO:14 SYELTQPPSVSVSPGQTASITCSGDNIGDQYAHWYQQKPGQSPVLVIYQDKNRPSGIPER 60 lightchain FSGSNSGNTATLTISGTQAMDEADYYCATYTGFGSLAVFGGGTKLTVL 108 variableregion forutomilumab SEQIDNO:15 STYWIS 6 heavychainCDR1 forutomilumab SEQIDNO:16 KIYPGDSYTNYSPSFQG 17 heavychainCDR2 forutomilumab SEQIDNO:17 RGYGIFDY 8 heavychainCDR3 forutomilumab SEQIDNO:18 SGDNIGDQYAH 11 lightchainCDR1 forutomilumab SEQIDNO:19 QDKNRPS 7 lightchainCDR2 forutomilumab SEQIDNO:20 ATYTGFGSLAV 11 lightchainCDR3 forutomilumab
(245) In a preferred embodiment, the 4-1BB agonist is the monoclonal antibody urelumab, also known as BMS-663513 and 20H4.9.h4a, or a fragment, derivative, variant, or biosimilar thereof. Urelumab is available from Bristol-Myers Squibb, Inc., and Creative Biolabs, Inc. Urelumab is an immunoglobulin G4-kappa, anti-[Homo sapiens TNFRSF9 (tumor necrosis factor receptor superfamily member 9, 4-1BB, T cell antigen ILA, CD137)], Homo sapiens (fully human) monoclonal antibody. The amino acid sequences of urelumab are set forth in Table 5. Urelumab comprises N-glycosylation sites at positions 298 (and 298); heavy chain intrachain disulfide bridges at positions 22-95 (V.sub.H-V.sub.L), 148-204 (C.sub.H1-C.sub.L), 262-322 (C.sub.H2) and 368-426 (C.sub.H3) (and at positions 22-95, 148-204, 262-322, and 368-426); light chain intrachain disulfide bridges at positions 23-88 (V.sub.H-V.sub.L) and 136-196 (C.sub.H1-C.sub.L) (and at positions 23-88 and 136-196); interchain heavy chain-heavy chain disulfide bridges at positions 227-227 and 230-230; and interchain heavy chain-light chain disulfide bridges at 135-216 and 135-216. The preparation and properties of urelumab and its variants and fragments are described in U.S. Pat. Nos. 7,288,638 and 8,962,804, the disclosures of which are incorporated by reference herein. The preclinical and clinical characteristics of urelumab are described in Segal, et al., Clin. Cancer Res. 2016, available at http:/dx.doi.org/10.1158/1078-0432.CCR-16-1272. Current clinical trials of urelumab in a variety of hematological and solid tumor indications include U.S. National Institutes of Health clinicaltrials.gov identifiers NCT01775631, NCT02110082, NCT02253992, and NCT01471210.
(246) In an embodiment, a 4-1BB agonist comprises a heavy chain given by SEQ ID NO:21 and a light chain given by SEQ ID NO:22. In an embodiment, a 4-1BB agonist comprises heavy and light chains having the sequences shown in SEQ ID NO:21 and SEQ ID NO:22, respectively, or antigen binding fragments, Fab fragments, single-chain variable fragments (scFv), variants, or conjugates thereof. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 99% identical to the sequences shown in SEQ ID NO:21 and SEQ ID NO:22, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 98% identical to the sequences shown in SEQ ID NO:21 and SEQ ID NO:22, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 97% identical to the sequences shown in SEQ ID NO:21 and SEQ ID NO:22, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 96% identical to the sequences shown in SEQ ID NO:21 and SEQ ID NO:22, respectively. In an embodiment, a 4-1BB agonist comprises heavy and light chains that are each at least 95% identical to the sequences shown in SEQ ID NO:21 and SEQ ID NO:22, respectively.
(247) In an embodiment, the 4-1BB agonist comprises the heavy and light chain CDRs or variable regions (VRs) of urelumab. In an embodiment, the 4-1BB agonist heavy chain variable region (V.sub.H) comprises the sequence shown in SEQ ID NO:23, and the 4-1BB agonist light chain variable region (V.sub.L) comprises the sequence shown in SEQ ID NO:24, and conservative amino acid substitutions thereof. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 99% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 98% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 97% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 96% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24, respectively. In an embodiment, a 4-1BB agonist comprises V.sub.H and V.sub.L regions that are each at least 95% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24, respectively. In an embodiment, a 4-1BB agonist comprises an scFv antibody comprising V.sub.H and V.sub.L regions that are each at least 99% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24.
(248) In an embodiment, a 4-1BB agonist comprises heavy chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NO:25, SEQ ID NO:26, and SEQ ID NO:27, respectively, and conservative amino acid substitutions thereof, and light chain CDR1, CDR2 and CDR3 domains having the sequences set forth in SEQ ID NO:28, SEQ ID NO:29, and SEQ ID NO:30, respectively, and conservative amino acid substitutions thereof.
(249) In an embodiment, the 4-1BB agonist is a 4-1BB agonist biosimilar monoclonal antibody approved by drug regulatory authorities with reference to urelumab. In an embodiment, the biosimilar monoclonal antibody comprises an 4-1BB antibody comprising an amino acid sequence which has at least 97% sequence identity, e.g., 97%, 98%, 99% or 100% sequence identity, to the amino acid sequence of a reference medicinal product or reference biological product and which comprises one or more post-translational modifications as compared to the reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is urelumab. In some embodiments, the one or more post-translational modifications are selected from one or more of: glycosylation, oxidation, deamidation, and truncation. In some embodiments, the biosimilar is a 4-1BB agonist antibody authorized or submitted for authorization, wherein the 4-1BB agonist antibody is provided in a formulation which differs from the formulations of a reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is urelumab. The 4-1BB agonist antibody may be authorized by a drug regulatory authority such as the U.S. FDA and/or the European Union's EMA. In some embodiments, the biosimilar is provided as a composition which further comprises one or more excipients, wherein the one or more excipients are the same or different to the excipients comprised in a reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is urelumab. In some embodiments, the biosimilar is provided as a composition which further comprises one or more excipients, wherein the one or more excipients are the same or different to the excipients comprised in a reference medicinal product or reference biological product, wherein the reference medicinal product or reference biological product is urelumab.
(250) TABLE-US-00005 TABLE5 Aminoacidsequencesfor4-1BBagonistantibodiesrelatedtourelumab. Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:21 QVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQSPEKGLEWIGEINHGGYVTYN 60 heavychainfor PSLESRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDYGPGNYDWYFDLWGRGTLVTVS 120 urelumab SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS 180 SGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPS 240 VFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNST 300 YRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMT 360 KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE 420 GNVFSCSVMHEALHNHYTQKSLSLSLGK 448 SEQIDNO:22 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA 60 lightchainfor RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPPALTFCGGTKVEIKRTVAAPSVFIF 120 urelumab PPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST 180 LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 216 SEQIDNO:23 MKHLWFFLLLVAAPRWVLSQVQLQQWGAGLLKPSETLSLTCAVYGGSFSGYYWSWIRQSP 60 variableheavy EKGLEWIGEINHGGYVTYNPSLESRVTISVDTSKNQFSLKLSSVTAADTAVYYCARDYGP 120 chainfor urelumab SEQIDNO:24 MEAPAQLLFLLLLWLPDTTGEIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKP 60 variablelight GQAPRLLIYDASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQ 110 chainfor urelumab SEQIDNO:25 GYYWS 5 heavychainCDR1 forurelumab SEQIDNO:26 EINHGGYVTYNPSLES 16 heavychainCDR2 forurelumab SEQIDNO:27 DYGPGNYDWYFDL 13 heavychainCDR3 forurelumab SEQIDNO:28 RASQSVSSYLA 11 lightchainCDR1 forurelumab SEQIDNO:29 DASNRAT 7 lightchainCDR2 forurelumab SEQIDNO:30 QQRSDWPPALT 11 lightchainCDR3 forurelumab
(251) In an embodiment, the 4-1BB agonist is selected from the group consisting of 1D8, 3Elor, 4B4 (BioLegend 309809), H4-1BB-M127 (BD Pharmingen 552532), BBK2 (Thermo Fisher MS621PABX), 145501 (Leinco Technologies B591), the antibody produced by cell line deposited as ATCC No. HB-11248 and disclosed in U.S. Pat. No. 6,974,863, 5F4 (BioLegend 31 1503), C65-485 (BD Pharmingen 559446), antibodies disclosed in U.S. Patent Application Publication No. US 2005/0095244, antibodies disclosed in U.S. Pat. No. 7,288,638 (such as 20H4.9-IgG1 (BMS-663031)), antibodies disclosed in U.S. Pat. No. 6,887,673 (such as 4E9 or BMS-554271), antibodies disclosed in U.S. Pat. No. 7,214,493, antibodies disclosed in U.S. Pat. No. 6,303,121, antibodies disclosed in U.S. Pat. No. 6,569,997, antibodies disclosed in U.S. Pat. No. 6,905,685 (such as 4E9 or BMS-554271), antibodies disclosed in U.S. Pat. No. 6,362,325 (such as 1D8 or BMS-469492; 3H3 or BMS-469497; or 3E1), antibodies disclosed in U.S. Pat. No. 6,974,863 (such as 53A2); antibodies disclosed in U.S. Pat. No. 6,210,669 (such as 1D8, 3B8, or 3E1), antibodies described in U.S. Pat. No. 5,928,893, antibodies disclosed in U.S. Pat. No. 6,303,121, antibodies disclosed in U.S. Pat. No. 6,569,997, antibodies disclosed in International Patent Application Publication Nos. WO 2012/177788, WO 2015/119923, and WO 2010/042433, and fragments, derivatives, conjugates, variants, or biosimilars thereof, wherein the disclosure of each of the foregoing patents or patent application publications is incorporated by reference here.
(252) In an embodiment, the 4-1BB agonist is a 4-1BB agonistic fusion protein described in International Patent Application Publication Nos. WO 2008/025516 A1, WO 2009/007120 A1, WO 2010/003766 A1, WO 2010/010051 A1, and WO 2010/078966 A1; U.S. Patent Application Publication Nos. US 2011/0027218 A1, US 2015/0126709 A1, US 2011/0111494 A1, US 2015/0110734 A1, and US 2015/0126710 A1; and U.S. Pat. Nos. 9,359,420, 9,340,599, 8,921,519, and 8,450,460, the disclosures of which are incorporated by reference herein.
(253) In an embodiment, the 4-1BB agonist is a 4-1BB agonistic fusion protein as depicted in Structure I-A (C-terminal Fc-antibody fragment fusion protein) or Structure I-B (N-terminal Fc-antibody fragment fusion protein), or a fragment, derivative, conjugate, variant, or biosimilar thereof:
(254) In structures I-A and I-B, the cylinders refer to individual polypeptide binding domains (see,
(255) Amino acid sequences for the other polypeptide domains of structure I-A are given in Table 6. The Fc domain preferably comprises a complete constant domain (amino acids 17-230 of SEQ ID NO:31) the complete hinge domain (amino acids 1-16 of SEQ ID NO:31) or a portion of the hinge domain (e.g, amino acids 4-16 of SEQ ID NO:31). Preferred linkers for connecting a C-terminal Fc-antibody may be selected from the embodiments given in SEQ ID NO:32 to SEQ ID NO:41, including linkers suitable for fusion of additional polypeptides.
(256) TABLE-US-00006 TABLE6 AminoacidsequencesforTNFRSFfusionproteins,including4-1BBfusionproteins, withC-terminalFc-antibodyfragmentfusionproteindesign(structureI-A). Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:31 KSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW 60 Fcdomain YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDLWNGKEYKCKVSNKALPAPIEKTIS 120 KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV 180 LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 230 SEQIDNO:32 GGPGSSKSCDKTHTCPPCPAPE 22 linker SEQIDNO:33 GGSGSSKSCDKTHTCPPCPAPE 22 linker SEQIDNO:34 GGPGSSSSSSSKSCDKTHTCPPCPAPE 27 linker SEQIDNO:35 GGSGSSSSSSSKSCDKTHTCPPCPAPE 27 linker SEQIDNO:36 GGPGSSSSSSSSSKSCDKTHTCPPCPAPE 29 linker SEQIDNO:37 GGSGSSSSSSSSSKSCDKTHTCPPCPAPE 29 linker SEQIDNO:38 GGPGSSGSGSSDKTHTCPPCPAPE 24 linker SEQIDNO:39 GGPGSSGSGSDKTHTCPPCPAPE 23 linker SEQIDNO:40 GGPSSSGSDKTHTCPPCPAPE 21 linker SEQIDNO:41 GGSSSSSSSSGSDKTHTCPPCPAPE 25 linker
(257) Amino acid sequences for the other polypeptide domains of structure I-B are given in Table 7. If an Fc antibody fragment is fused to the N-terminus of an TNRFSF fusion protein as in structure I-B, the sequence of the Fc module is preferably that shown in SEQ ID NO:42, and the linker sequences are preferably selected from those embodiments set forth in SEQ ID NO:43 to SEQ ID NO:45.
(258) TABLE-US-00007 TABLE7 AminoacidsequencesforTNFRSFfusionproteins,including4-1BBfusionprotiens, withN-terminalFc-antibodyfragmentfusionproteindesign(structureI-B). Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:42 METDTLLLWVLLLWVPAGNGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT 60 Fcdomain CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK 120 CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE 180 WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS 240 LSLSPG 246 SEQIDNO:43 SGSGSGSGSGS 11 linker SEQIDNO:44 SSSSSSGSGSGS 12 linker SEQIDNO:45 SSSSSSGSGSGSGSGS 16 linker
(259) In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains selected from the group consisting of a variable heavy chain and variable light chain of utomilumab, a variable heavy chain and variable light chain of urelumab, a variable heavy chain and variable light chain of utomilumab, a variable heavy chain and variable light chain selected from the variable heavy chains and variable light chains described in Table 8, any combination of a variable heavy chain and variable light chain of the foregoing, and fragments, derivatives, conjugates, variants, and biosimilars thereof.
(260) In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains comprising a 4-1BBL sequence. In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains comprising a sequence according to SEQ ID NO:46. In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains comprising a soluble 4-1BBL sequence. In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains comprising a sequence according to SEQ ID NO:47.
(261) In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains that is a scFv domain comprising V.sub.H and V.sub.L regions that are each at least 95% identical to the sequences shown in SEQ ID NO: 13 and SEQ ID NO:14, respectively, wherein the V.sub.H and V.sub.L domains are connected by a linker. In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains that is a scFv domain comprising V.sub.H and V.sub.L regions that are each at least 95% identical to the sequences shown in SEQ ID NO:23 and SEQ ID NO:24, respectively, wherein the V.sub.H and V.sub.L domains are connected by a linker. In an embodiment, a 4-1BB agonist fusion protein according to structures I-A or I-B comprises one or more 4-1BB binding domains that is a scFv domain comprising V.sub.H and V.sub.L regions that are each at least 95% identical to the V.sub.H and V.sub.L sequences given in Table 8, wherein the V.sub.H and V.sub.L domains are connected by a linker.
(262) TABLE-US-00008 TABLE8 Additionalpolypeptidedomainsusefulas4-1BBbindingdomainsinfusion proteinsorasscFv4-1BBagonistantibodies. Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:46 MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA 60 4-1BBL SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL 120 TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA 180 LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV 240 TPEIPAGLPSPRSE 254 SEQIDNO:47 LRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQ 60 4-1BBLsoluble LELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHL 120 domain SAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE 168 SEQIDNO:48 QVQLQQPGAELVKPGASVKLSCKASGYTFSSYWMHWVKQRPGQVLEWIGEINPGNGHTNY 60 variableheavy NEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARSFTTARGFAYWGQGTLVTVS 118 chainfor4B4-1-1 version1 SEQIDNO:49 DIVMTQSPATQSVTPGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIKYASQSISGIPS 60 variablelight RFSGSGSGSDFTLSINSVEPEDVGVYYCQDGHSFPPTFGGGTKLEIK 107 chainfor4B4-1-1 version1 SEQIDNO:50 QVQLQQPGAELVKPGASVKLSCKASGYTFSSYWMHWVKQRPGQVLEWIGEINPGNGHTNY 60 variableheavy NEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARSFTTARGFAYWGQGTLVTVSA 119 chainfor4B4-1-1 version2 SEQIDNO:51 DIVMTQSPATQSVTPGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIKYASQSISGIPS 60 variablelight RFSGSGSGSDFTLSINSVEPEDVGVYYCQDGHSFPPTFGGGTKLEIKR 108 chainfor4B4-1-1 version2 SEQIDNO:52 MDWTWRILFLVAAATGAHSEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMSWVRQAP 60 variableheavy GKGLEWVADIKNDGSYTNYAPSLTNRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARELT 120 chainforH39E3-2 SEQIDNO:53 MEAPAQLLFLLLLWLPDTTGDIVMTQSPDSLAVSLGERATINCKSSQSLLSSGNQKNYL 60 variablelight WYQQKPGQPPKLLIYYASTRQSGVPDRFSGSGSGTDFTLTISSLQAEDVA 110 chainforH39E3-2
(263) In an embodiment, the 4-1BB agonist is a 4-1BB agonistic single-chain fusion polypeptide comprising (i) a first soluble 4-1BB binding domain, (ii) a first peptide linker, (iii) a second soluble 4-1BB binding domain, (iv) a second peptide linker, and (v) a third soluble 4-1BB binding domain, further comprising an additional domain at the N-terminal and/or C-terminal end, and wherein the additional domain is a Fab or Fc fragment domain. In an embodiment, the 4-1BB agonist is a 4-1BB agonistic single-chain fusion polypeptide comprising (i) a first soluble 4-1BB binding domain, (ii) a first peptide linker, (iii) a second soluble 4-1BB binding domain, (iv) a second peptide linker, and (v) a third soluble 4-1BB binding domain, further comprising an additional domain at the N-terminal and/or C-terminal end, wherein the additional domain is a Fab or Fc fragment domain, wherein each of the soluble 4-1BB domains lacks a stalk region (which contributes to trimerisation and provides a certain distance to the cell membrane, but is not part of the 4-1BB binding domain) and the first and the second peptide linkers independently have a length of 3-8 amino acids.
(264) In an embodiment, the 4-1BB agonist is a 4-1BB agonistic single-chain fusion polypeptide comprising (i) a first soluble tumor necrosis factor (TNF) superfamily cytokine domain, (ii) a first peptide linker, (iii) a second soluble TNF superfamily cytokine domain, (iv) a second peptide linker, and (v) a third soluble TNF superfamily cytokine domain, wherein each of the soluble TNF superfamily cytokine domains lacks a stalk region and the first and the second peptide linkers independently have a length of 3-8 amino acids, and wherein each TNF superfamily cytokine domain is a 4-1BB binding domain.
(265) In an embodiment, the 4-1BB agonist is a 4-1BB agonistic scFv antibody comprising any of the foregoing V.sub.H domains linked to any of the foregoing V.sub.L domains.
(266) In an embodiment, the 4-1BB agonist agonist is BPS Bioscience 4-1BB agonist antibody catalog no. 79097-2, commercially available from BPS Bioscience, San Diego, CA, USA. In an embodiment, the 4-1BB agonist agonist is Creative Biolabs 4-1BB agonist antibody catalog no. MOM-18179, commercially available from Creative Biolabs, Shirley, NY, USA.
III. TIL Manufacturing Processes
(267) An exemplary TIL process known as process 2A containing some of these features is depicted in
(268) As discussed herein, the present invention can include a step relating to the restimulation of cryopreserved TILs to increase their metabolic activity and thus relative health prior to transplant into a patient, and methods of testing said metabolic health. As generally outlined herein, TILs are generally taken from a patient sample and manipulated to expand their number prior to transplant into a patient. In some embodiments, the TILs may be optionally genetically manipulated as discussed below.
(269) In some embodiments, the TILs may be cryopreserved. Once thawed, they may also be restimulated to increase their metabolism prior to infusion into a patient.
(270) In some embodiments, the first expansion (including processes referred to as the preREP as well as processes shown in
(271) The Step Designations A, B, C, etc., below are in reference to
(272) A. Step A: Obtain Patient Tumor Sample
(273) In general, TILs are initially obtained from a patient tumor sample (primary TILs) and then expanded into a larger population for further manipulation as described herein, optionally cryopreserved, restimulated as outlined herein and optionally evaluated for phenotype and metabolic parameters as an indication of TIL health.
(274) A patient tumor sample may be obtained using methods known in the art, generally via surgical resection, needle biopsy or other means for obtaining a sample that contains a mixture of tumor and TIL cells. In general, the tumor sample may be from any solid tumor, including primary tumors, invasive tumors or metastatic tumors. The tumor sample may also be a liquid tumor, such as a tumor obtained from a hematological malignancy. The solid tumor may be of any cancer type, including, but not limited to, breast, pancreatic, prostate, colorectal, lung, brain, renal, stomach, and skin (including but not limited to squamous cell carcinoma, basal cell carcinoma, and melanoma). In some embodiments, useful TILs are obtained from malignant melanoma tumors, as these have been reported to have particularly high levels of TILs.
(275) The term solid tumor refers to an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors may be benign or malignant. The term solid tumor cancer refers to malignant, neoplastic, or cancerous solid tumors. Solid tumor cancers include, but are not limited to, sarcomas, carcinomas, and lymphomas, such as cancers of the lung, breast, triple negative breast cancer, prostate, colon, rectum, and bladder. In some embodiments, the cancer is selected from cervical cancer, head and neck cancer (including, for example, head and neck squamous cell carcinoma (HNSCC)) glioblastoma, ovarian cancer, sarcoma, pancreatic cancer, bladder cancer, breast cancer, triple negative breast cancer, and non-small cell lung carcinoma. The tissue structure of solid tumors includes interdependent tissue compartments including the parenchyma (cancer cells) and the supporting stromal cells in which the cancer cells are dispersed and which may provide a supporting microenvironment.
(276) The term hematological malignancy refers to mammalian cancers and tumors of the hematopoietic and lymphoid tissues, including but not limited to tissues of the blood, bone marrow, lymph nodes, and lymphatic system. Hematological malignancies are also referred to as liquid tumors. Hematological malignancies include, but are not limited to, acute lymphoblastic leukemia (ALL), chronic lymphocytic lymphoma (CLL), small lymphocytic lymphoma (SLL), acute myelogenous leukemia (AML), chronic myelogenous leukemia (CML), acute monocytic leukemia (AMoL), Hodgkin's lymphoma, and non-Hodgkin's lymphomas. The term B cell hematological malignancy refers to hematological malignancies that affect B cells.
(277) Once obtained, the tumor sample is generally fragmented using sharp dissection into small pieces of between 1 to about 8 mm.sup.3, with from about 2-3 mm.sup.3 being particularly useful. The TILs are cultured from these fragments using enzymatic tumor digests. Such tumor digests may be produced by incubation in enzymatic media (e.g., Roswell Park Memorial Institute (RPMI) 1640 buffer, 2 mM glutamate, 10 mcg/mL gentamicine, 30 units/mL of DNase and 1.0 mg/mL of collagenase) followed by mechanical dissociation (e.g., using a tissue dissociator). Tumor digests may be produced by placing the tumor in enzymatic media and mechanically dissociating the tumor for approximately 1 minute, followed by incubation for 30 minutes at 37? C. in 5% CO.sub.2, followed by repeated cycles of mechanical dissociation and incubation under the foregoing conditions until only small tissue pieces are present. At the end of this process, if the cell suspension contains a large number of red blood cells or dead cells, a density gradient separation using FICOLL branched hydrophilic polysaccharide may be performed to remove these cells. Alternative methods known in the art may be used, such as those described in U.S. Patent Application Publication No. 2012/0244133 A1, the disclosure of which is incorporated by reference herein. Any of the foregoing methods may be used in any of the embodiments described herein for methods of expanding TILs or methods treating a cancer.
(278) In general, the harvested cell suspension is called a primary cell population or a freshly harvested cell population.
(279) In some embodiments, fragmentation includes physical fragmentation, including for example, dissection as well as digestion. In some embodiments, the fragmentation is physical fragmentation. In some embodiments, the fragmentation is dissection. In some embodiments, the fragmentation is by digestion. In some embodiments, TILs can be initially cultured from enzymatic tumor digests and tumor fragments obtained from patients. In an embodiment, TILs can be initially cultured from enzymatic tumor digests and tumor fragments obtained from patients.
(280) In some embodiments, where the tumor is a solid tumor, the tumor undergoes physical fragmentation after the tumor sample is obtained in, for example, Step A (as provided in
(281) In some embodiments, the TILs are obtained from tumor fragments. In some embodiments, the tumor fragment is obtained by sharp dissection. In some embodiments, the tumor fragment is between about 1 mm.sup.3 and 10 mm.sup.3. In some embodiments, the tumor fragment is between about 1 mm.sup.3 and 8 mm.sup.3. In some embodiments, the tumor fragment is about 1 mm.sup.3. In some embodiments, the tumor fragment is about 2 mm.sup.3. In some embodiments, the tumor fragment is about 3 mm.sup.3. In some embodiments, the tumor fragment is about 4 mm.sup.3. In some embodiments, the tumor fragment is about 5 mm.sup.3. In some embodiments, the tumor fragment is about 6 mm.sup.3. In some embodiments, the tumor fragment is about 7 mm.sup.3. In some embodiments, the tumor fragment is about 8 mm.sup.3. In some embodiments, the tumor fragment is about 9 mm.sup.3. In some embodiments, the tumor fragment is about 10 mm.sup.3. In some embodiments, the tumors are 1-4 mmx 1-4 mm?1-4 mm. In some embodiments, the tumors are 1 mm?1 mm?1 mm. In some embodiments, the tumors are 2 mmx 2 mm?2 mm. In some embodiments, the tumors are 3 mmx 3 mm?3 mm. In some embodiments, the tumors are 4 mmx 4 mm?4 mm.
(282) In some embodiments, the tumors are resected in order to minimize the amount of hemorrhagic, necrotic, and/or fatty tissues on each piece. In some embodiments, the tumors are resected in order to minimize the amount of hemorrhagic tissue on each piece. In some embodiments, the tumors are resected in order to minimize the amount of necrotic tissue on each piece. In some embodiments, the tumors are resected in order to minimize the amount of fatty tissue on each piece.
(283) In some embodiments, the tumor fragmentation is performed in order to maintain the tumor internal structure. In some embodiments, the tumor fragmentation is performed without preforming a sawing motion with a scapel. In some embodiments, the TILs are obtained from tumor digests. In some embodiments, tumor digests were generated by incubation in enzyme media, for example but not limited to RPMI 1640, 2 mM GlutaMAX, 10 mg/mL gentamicin, 30 U/mL DNase, and 1.0 mg/mL collagenase, followed by mechanical dissociation (GentleMACS, Miltenyi Biotec, Auburn, CA). After placing the tumor in enzyme media, the tumor can be mechanically dissociated for approximately 1 minute. The solution can then be incubated for 30 minutes at 37? C. in 5% CO.sub.2 and it then mechanically disrupted again for approximately 1 minute. After being incubated again for 30 minutes at 37? C. in 5% CO.sub.2, the tumor can be mechanically disrupted a third time for approximately 1 minute. In some embodiments, after the third mechanical disruption if large pieces of tissue were present, 1 or 2 additional mechanical dissociations were applied to the sample, with or without 30 additional minutes of incubation at 37? C. in 5% CO.sub.2. In some embodiments, at the end of the final incubation if the cell suspension contained a large number of red blood cells or dead cells, a density gradient separation using Ficoll can be performed to remove these cells.
(284) In some embodiments, the harvested cell suspension prior to the first expansion step is called a primary cell population or a freshly harvested cell population.
(285) In some embodiments, cells can be optionally frozen after sample harvest and stored frozen prior to entry into the expansion described in Step B, which is described in further detail below, as well as exemplified in
(286) B. Step B: First Expansion
(287) 1. Young TILs
(288) In some embodiments, the present methods provide for obtaining young TILs, which are capable of increased replication cycles upon administration to a subject/patient and as such may provide additional therapeutic benefits over older TILs (i.e., TILs which have further undergone more rounds of replication prior to administration to a subject/patient). Features of young TILs have been described in the literature, for example Donia, at al., Scandinavian Journal of Immunology, 75:157-167 (2012); Dudley et al., Clin Cancer Res, 16:6122-6131 (2010); Huang et al., J Immunother, 28(3):258-267 (2005); Besser et al., Clin Cancer Res, 19(17):OF1-OF9 (2013); Besser et al., J Immunother 32:415-423 (2009); Robbins, et al., J. Immunol 2004; 173:7125-7130; Shen et al., J Immunother, 30:123-129 (2007); Zhou, et al., J Immunother, 28:53-62 (2005); and Tran, et al., J Immunother, 31:742-751 (2008), all of which are incorporated herein by reference in their entireties.
(289) The diverse antigen receptors of T and B lymphocytes are produced by somatic recombination of a limited, but large number of gene segments. These gene segments: V (variable), D (diversity), J (joining), and C (constant), determine the binding specificity and downstream applications of immunoglobulins and T-cell receptors (TCRs). The present invention provides a method for generating TILs which exhibit and increase the T-cell repertoire diversity. In some embodiments, the TILs obtained by the present method exhibit an increase in the T-cell repertoire diversity. In some embodiments, the TILs obtained by the present method exhibit an increase in the T-cell repertoire diversity as compared to freshly harvested TILs and/or TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(290) After dissection or digestion of tumor fragments, for example such as described in Step A of
(291) In a preferred embodiment, expansion of TILs may be performed using an initial bulk TIL expansion step (for example such as those described in Step B of
(292) In embodiments where TIL cultures are initiated in 24-well plates, for example, using Costar 24-well cell culture cluster, flat bottom (Corning Incorporated, Corning, NY, each well can be seeded with 1?10.sup.6 tumor digest cells or one tumor fragment in 2 mL of complete medium (CM) with IL-2 (6000 IU/mL; Chiron Corp., Emeryville, CA). In some embodiments, the tumor fragment is between about 1 mm.sup.3 and 10 mm.sup.3.
(293) In some embodiments, the first expansion culture medium is referred to as CM, an abbreviation for culture media. In some embodiments, CM for Step B consists of RPMI 1640 with GlutaMAX, supplemented with 10% human AB serum, 25 mM Hepes, and 10 mg/mL gentamicin. In embodiments where cultures are initiated in gas-permeable flasks with a 40 mL capacity and a 10 cm.sup.2 gas-permeable silicon bottom (for example, G-Rex10; Wilson Wolf Manufacturing, New Brighton, MN) (
(294) After preparation of the tumor fragments, the resulting cells (i.e., fragments) are cultured in serum containing IL-2 under conditions that favor the growth of TILs over tumor and other cells. In some embodiments, the tumor digests are incubated in 2 mL wells in media comprising inactivated human AB serum (or, in some cases, as outlined herein, in the presence of aAPC cell population) with 6000 IU/mL of IL-2. This primary cell population is cultured for a period of days, generally from 10 to 14 days, resulting in a bulk TIL population, generally about 1?10.sup.8 bulk TIL cells. In some embodiments, the growth media during the first expansion comprises IL-2 or a variant thereof. In some embodiments, the IL is recombinant human IL-2 (rhIL-2). In some embodiments the IL-2 stock solution has a specific activity of 20-30?10.sup.6 IU/mg for a 1 mg vial. In some embodiments the IL-2 stock solution has a specific activity of 20?10.sup.6 IU/mg for a 1 mg vial. In some embodiments the IL-2 stock solution has a specific activity of 25?10.sup.6 IU/mg for a 1 mg vial. In some embodiments the IL-2 stock solution has a specific activity of 30?10.sup.6 IU/mg for a 1 mg vial. In some embodiments, the IL-2 stock solution has a final concentration of 4-8?10.sup.6 IU/mg of IL-2. In some embodiments, the IL-2 stock solution has a final concentration of 5-7?10.sup.6 IU/mg of IL-2. In some embodiments, the IL-2 stock solution has a final concentration of 6?10.sup.6 IU/mg of IL-2. In some embodiments, the IL-2 stock solution is prepare as described in Example 4. In some embodiments, the first expansion culture media comprises about 10,000 IU/mL of IL-2, about 9,000 IU/mL of IL-2, about 8,000 IU/mL of IL-2, about 7,000 IU/mL of IL-2, about 6000 IU/mL of IL-2 or about 5,000 IU/mL of IL-2. In some embodiments, the first expansion culture media comprises about 9,000 IU/mL of IL-2 to about 5,000 IU/mL of IL-2. In some embodiments, the first expansion culture media comprises about 8,000 IU/mL of IL-2 to about 6,000 IU/mL of IL-2. In some embodiments, the first expansion culture media comprises about 7,000 IU/mL of IL-2 to about 6,000 IU/mL of IL-2. In some embodiments, the first expansion culture media comprises about 6,000 IU/mL of IL-2. In an embodiment, the cell culture medium further comprises IL-2. In some embodiments, the cell culture medium comprises about 3000 IU/mL of IL-2. In an embodiment, the cell culture medium further comprises IL-2. In a preferred embodiment, the cell culture medium comprises about 3000 IU/mL of IL-2. In an embodiment, the cell culture medium comprises about 1000 IU/mL, about 1500 IU/mL, about 2000 IU/mL, about 2500 IU/mL, about 3000 IU/mL, about 3500 IU/mL, about 4000 IU/mL, about 4500 IU/mL, about 5000 IU/mL, about 5500 IU/mL, about 6000 IU/mL, about 6500 IU/mL, about 7000 IU/mL, about 7500 IU/mL, or about 8000 IU/mL of IL-2. In an embodiment, the cell culture medium comprises between 1000 and 2000 IU/mL, between 2000 and 3000 IU/mL, between 3000 and 4000 IU/mL, between 4000 and 5000 IU/mL, between 5000 and 6000 IU/mL, between 6000 and 7000 IU/mL, between 7000 and 8000 IU/mL, or about 8000 IU/mL of IL-2.
(295) In some embodiments, first expansion culture media comprises about 500 IU/mL of IL-15, about 400 IU/mL of IL-15, about 300 IU/mL of IL-15, about 200 IU/mL of IL-15, about 180 IU/mL of IL-15, about 160 IU/mL of IL-15, about 140 IU/mL of IL-15, about 120 IU/mL of IL-15, or about 100 IU/mL of IL-15. In some embodiments, the first expansion culture media comprises about 500 IU/mL of IL-15 to about 100 IU/mL of IL-15. In some embodiments, the first expansion culture media comprises about 400 IU/mL of IL-15 to about 100 IU/mL of IL-15. In some embodiments, the first expansion culture media comprises about 300 IU/mL of IL-15 to about 100 IU/mL of IL-15. In some embodiments, the first expansion culture media comprises about 200 IU/mL of IL-15. In some embodiments, the cell culture medium comprises about 180 IU/mL of IL-15. In an embodiment, the cell culture medium further comprises IL-15. In a preferred embodiment, the cell culture medium comprises about 180 IU/mL of IL-15.
(296) In some embodiments, first expansion culture media comprises about 20 IU/mL of IL-21, about 15 IU/mL of IL-21, about 12 IU/mL of IL-21, about 10 IU/mL of IL-21, about 5 IU/mL of IL-21, about 4 IU/mL of IL-21, about 3 IU/mL of IL-21, about 2 IU/mL of IL-21, about 1 IU/mL of IL-21, or about 0.5 IU/mL of IL-21. In some embodiments, the first expansion culture media comprises about 20 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the first expansion culture media comprises about 15 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the first expansion culture media comprises about 12 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the first expansion culture media comprises about 10 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the first expansion culture media comprises about 5 IU/mL of IL-21 to about 1 IU/mL of IL-21. In some embodiments, the first expansion culture media comprises about 2 IU/mL of IL-21. In some embodiments, the cell culture medium comprises about 1 IU/mL of IL-21. In some embodiments, the cell culture medium comprises about 0.5 IU/mL of IL-21. In an embodiment, the cell culture medium further comprises IL-21. In a preferred embodiment, the cell culture medium comprises about 1 IU/mL of IL-21.
(297) In an embodiment, the cell culture medium comprises OKT-3 antibody. In some embodiments, the cell culture medium comprises about 30 ng/mL of OKT-3 antibody. In an embodiment, the cell culture medium comprises about 0.1 ng/mL, about 0.5 ng/mL, about 1 ng/mL, about 2.5 ng/mL, about 5 ng/mL, about 7.5 ng/mL, about 10 ng/mL, about 15 ng/mL, about 20 ng/mL, about 25 ng/mL, about 30 ng/mL, about 35 ng/mL, about 40 ng/mL, about 50 ng/mL, about 60 ng/mL, about 70 ng/mL, about 80 ng/mL, about 90 ng/mL, about 100 ng/mL, about 200 ng/mL, about 500 ng/mL, and about 1 ?g/mL of OKT-3 antibody. In an embodiment, the cell culture medium comprises between 0.1 ng/mL and 1 ng/mL, between 1 ng/mL and 5 ng/mL, between 5 ng/mL and 10 ng/mL, between 10 ng/mL and 20 ng/mL, between 20 ng/mL and 30 ng/mL, between 30 ng/mL and 40 ng/mL, between 40 ng/mL and 50 ng/mL, and between 50 ng/mL and 100 ng/mL of OKT-3 antibody. In some embodiments, the cell culture medium does not comprise OKT-3 antibody.
(298) In some embodiments, the cell culture medium comprises one or more TNFRSF agonists in a cell culture medium. In some embodiments, the TNFRSF agonist comprises a 4-1BB agonist. In some embodiments, the TNFRSF agonist is a 4-1BB agonist, and the 4-1BB agonist is selected from the group consisting of urelumab, utomilumab, EU-101, a fusion protein, and fragments, derivatives, variants, biosimilars, and combinations thereof. In some embodiments, the TNFRSF agonist is added at a concentration sufficient to achieve a concentration in the cell culture medium of between 0.1 ?g/mL and 100 ?g/mL. In some embodiments, the TNFRSF agonist is added at a concentration sufficient to achieve a concentration in the cell culture medium of between 20 ?g/mL and 40 ?g/mL.
(299) In some embodiments, in addition to one or more TNFRSF agonists, the cell culture medium further comprises IL-2 at an initial concentration of about 3000 IU/mL and OKT-3 antibody at an initial concentration of about 30 ng/mL, and wherein the one or more TNFRSF agonists comprises a 4-1BB agonist.
(300) In some embodiments, the first expansion culture medium is referred to as CM, an abbreviation for culture media. In some embodiments, it is referred to as CM1 (culture medium 1). In some embodiments, CM consists of RPMI 1640 with GlutaMAX, supplemented with 10% human AB serum, 25 mM Hepes, and 10 mg/mL gentamicin. In embodiments where cultures are initiated in gas-permeable flasks with a 40 mL capacity and a 10 cm.sup.2 gas-permeable silicon bottom (for example, G-Rex10; Wilson Wolf Manufacturing, New Brighton, MN) (
(301) In some embodiments, the first expansion (including processes such as for example those described in Step B of
(302) In some embodiments, the first TIL expansion can proceed for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, or 14 days. In some embodiments, the first TIL expansion can proceed for 1 day to 14 days. In some embodiments, the first TIL expansion can proceed for 2 days to 14 days. In some embodiments, the first TIL expansion can proceed for 3 days to 14 days. In some embodiments, the first TIL expansion can proceed for 4 days to 14 days. In some embodiments, the first TIL expansion can proceed for 5 days to 14 days. In some embodiments, the first TIL expansion can proceed for 6 days to 14 days. In some embodiments, the first TIL expansion can proceed for 7 days to 14 days. In some embodiments, the first TIL expansion can proceed for 8 days to 14 days. In some embodiments, the first TIL expansion can proceed for 9 days to 14 days. In some embodiments, the first TIL expansion can proceed for 10 days to 14 days. In some embodiments, the first TIL expansion can proceed for 11 days to 14 days. In some embodiments, the first TIL expansion can proceed for 12 days to 14 days. In some embodiments, the first TIL expansion can proceed for 13 days to 14 days. In some embodiments, the first TIL expansion can proceed for 14 days. In some embodiments, the first TIL expansion can proceed for 1 day to 11 days. In some embodiments, the first TIL expansion can proceed for 2 days to 11 days. In some embodiments, the first TIL expansion can proceed for 3 days to 11 days. In some embodiments, the first TIL expansion can proceed for 4 days to 11 days. In some embodiments, the first TIL expansion can proceed for 5 days to 11 days. In some embodiments, the first TIL expansion can proceed for 6 days to 11 days. In some embodiments, the first TIL expansion can proceed for 7 days to 11 days. In some embodiments, the first TIL expansion can proceed for 8 days to 11 days. In some embodiments, the first TIL expansion can proceed for 9 days to 11 days. In some embodiments, the first TIL expansion can proceed for 10 days to 11 days. In some embodiments, the first TIL expansion can proceed for 11 days.
(303) In some embodiments, a combination of IL-2, IL-7, IL-15, and/or IL-21 are employed as a combination during the first expansion. In some embodiments, IL-2, IL-7, IL-15, and/or IL-21 as well as any combinations thereof can be included during the first expansion, including for example during a Step B processes according to
(304) In some embodiments, the first expansion (including processes referred to as the pre-REP; for example, Step B according to
(305) In some embodiments, the first expansion, for example, Step B according to
(306) C. Step C: First Expansion to Second Expansion Transition
(307) In some cases, the bulk TIL population obtained from the first expansion, including for example the TIL population obtained from for example, Step B as indicated in
(308) In some embodiments, the TILs obtained from the first expansion (for example, from Step B as indicated in
(309) In some embodiments, the transition from the first expansion to the second expansion occurs at 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, or 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 1 day to 14 days from when fragmentation occurs. In some embodiments, the first TIL expansion can proceed for 2 days to 14 days. In some embodiments, the transition from the first expansion to the second expansion occurs 3 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 4 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 5 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 6 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 7 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 8 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 9 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 10 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 11 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 12 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 13 days to 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 14 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 1 day to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 2 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 3 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 4 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 5 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 6 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 7 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 8 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 9 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 10 days to 11 days from when fragmentation occurs. In some embodiments, the transition from the first expansion to the second expansion occurs 11 days from when fragmentation occurs.
(310) In some embodiments, the TILs are not stored after the first expansion and prior to the second expansion, and the TILs proceed directly to the second expansion (for example, in some embodiments, there is no storage during the transition from Step B to Step D as shown in
(311) In some embodiments, the transition from the first expansion to the second expansion, for example, Step C according to
(312) D. Step D: Second Expansion
(313) In some embodiments, the TIL cell population is expanded in number after harvest and initial bulk processing for example, after Step A and Step B, and the transition referred to as Step C, as indicated in
(314) In some embodiments, the second expansion or second TIL expansion (which can include expansions sometimes referred to as REP; as well as processes as indicated in Step D of
(315) In an embodiment, the second expansion can be performed in a gas permeable container using the methods of the present disclosure (including for example, expansions referred to as REP; as well as processes as indicated in Step D of
(316) In an embodiment, the cell culture medium further comprises IL-2. In some embodiments, the cell culture medium comprises about 3000 IU/mL of IL-2. In an embodiment, the cell culture medium comprises about 1000 IU/mL, about 1500 IU/mL, about 2000 IU/mL, about 2500 IU/mL, about 3000 IU/mL, about 3500 IU/mL, about 4000 IU/mL, about 4500 IU/mL, about 5000 IU/mL, about 5500 IU/mL, about 6000 IU/mL, about 6500 IU/mL, about 7000 IU/mL, about 7500 IU/mL, or about 8000 IU/mL of IL-2. In an embodiment, the cell culture medium comprises between 1000 and 2000 IU/mL, between 2000 and 3000 IU/mL, between 3000 and 4000 IU/mL, between 4000 and 5000 IU/mL, between 5000 and 6000 IU/mL, between 6000 and 7000 IU/mL, between 7000 and 8000 IU/mL, or between 8000 IU/mL of IL-2.
(317) In an embodiment, the cell culture medium comprises OKT-3 antibody. In some embodiments, the cell culture medium comprises about 30 ng/mL of OKT-3 antibody. In an embodiment, the cell culture medium comprises about 0.1 ng/mL, about 0.5 ng/mL, about 1 ng/mL, about 2.5 ng/mL, about 5 ng/mL, about 7.5 ng/mL, about 10 ng/mL, about 15 ng/mL, about 20 ng/mL, about 25 ng/mL, about 30 ng/mL, about 35 ng/mL, about 40 ng/mL, about 50 ng/mL, about 60 ng/mL, about 70 ng/mL, about 80 ng/mL, about 90 ng/mL, about 100 ng/mL, about 200 ng/mL, about 500 ng/mL, and about 1 ?g/mL of OKT-3 antibody. In an embodiment, the cell culture medium comprises between 0.1 ng/mL and 1 ng/mL, between 1 ng/mL and 5 ng/mL, between 5 ng/mL and 10 ng/mL, between 10 ng/mL and 20 ng/mL, between 20 ng/mL and 30 ng/mL, between 30 ng/mL and 40 ng/mL, between 40 ng/mL and 50 ng/mL, and between 50 ng/mL and 100 ng/mL of OKT-3 antibody. In some embodiments, the cell culture medium does not comprise OKT-3 antibody.
(318) In some embodiments, the cell culture medium comprises one or more TNFRSF agonists in a cell culture medium. In some embodiments, the TNFRSF agonist comprises a 4-1BB agonist. In some embodiments, the TNFRSF agonist is a 4-1BB agonist, and the 4-1BB agonist is selected from the group consisting of urelumab, utomilumab, EU-101, a fusion protein, and fragments, derivatives, variants, biosimilars, and combinations thereof. In some embodiments, the TNFRSF agonist is added at a concentration sufficient to achieve a concentration in the cell culture medium of between 0.1 ?g/mL and 100 ?g/mL. In some embodiments, the TNFRSF agonist is added at a concentration sufficient to achieve a concentration in the cell culture medium of between 20 ?g/mL and 40 ?g/mL.
(319) In some embodiments, in addition to one or more TNFRSF agonists, the cell culture medium further comprises IL-2 at an initial concentration of about 3000 IU/mL and OKT-3 antibody at an initial concentration of about 30 ng/mL, and wherein the one or more TNFRSF agonists comprises a 4-1BB agonist.
(320) In some embodiments, a combination of IL-2, IL-7, IL-15, and/or IL-21 are employed as a combination during the second expansion. In some embodiments, IL-2, IL-7, IL-15, and/or IL-21 as well as any combinations thereof can be included during the second expansion, including for example during a Step D processes according to
(321) In some embodiments, the second expansion can be conducted in a supplemented cell culture medium comprising IL-2, OKT-3, antigen-presenting feeder cells, and optionally a TNFRSF agonist. In some embodiments, the second expansion occurs in a supplemented cell culture medium. In some embodiments, the supplemented cell culture medium comprises IL-2, OKT-3, and antigen-presenting feeder cells. In some embodiments, the second cell culture medium comprises IL-2, OKT-3, and antigen-presenting cells (APCs; also referred to as antigen-presenting feeder cells). In some embodiments, the second expansion occurs in a cell culture medium comprising IL-2, OKT-3, and antigen-presenting feeder cells (i.e., antigen presenting cells).
(322) In some embodiments, the second expansion culture media comprises about 500 IU/mL of IL-15, about 400 IU/mL of IL-15, about 300 IU/mL of IL-15, about 200 IU/mL of IL-15, about 180 IU/mL of IL-15, about 160 IU/mL of IL-15, about 140 IU/mL of IL-15, about 120 IU/mL of IL-15, or about 100 IU/mL of IL-15. In some embodiments, the second expansion culture media comprises about 500 IU/mL of IL-15 to about 100 IU/mL of IL-15. In some embodiments, the second expansion culture media comprises about 400 IU/mL of IL-15 to about 100 IU/mL of IL-15. In some embodiments, the second expansion culture media comprises about 300 IU/mL of IL-15 to about 100 IU/mL of IL-15. In some embodiments, the second expansion culture media comprises about 200 IU/mL of IL-15. In some embodiments, the cell culture medium comprises about 180 IU/mL of IL-15. In an embodiment, the cell culture medium further comprises IL-15. In a preferred embodiment, the cell culture medium comprises about 180 IU/mL of IL-15.
(323) In some embodiments, the second expansion culture media comprises about 20 IU/mL of IL-21, about 15 IU/mL of IL-21, about 12 IU/mL of IL-21, about 10 IU/mL of IL-21, about 5 IU/mL of IL-21, about 4 IU/mL of IL-21, about 3 IU/mL of IL-21, about 2 IU/mL of IL-21, about 1 IU/mL of IL-21, or about 0.5 IU/mL of IL-21. In some embodiments, the second expansion culture media comprises about 20 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the second expansion culture media comprises about 15 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the second expansion culture media comprises about 12 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the second expansion culture media comprises about 10 IU/mL of IL-21 to about 0.5 IU/mL of IL-21. In some embodiments, the second expansion culture media comprises about 5 IU/mL of IL-21 to about 1 IU/mL of IL-21. In some embodiments, the second expansion culture media comprises about 2 IU/mL of IL-21. In some embodiments, the cell culture medium comprises about 1 IU/mL of IL-21. In some embodiments, the cell culture medium comprises about 0.5 IU/mL of IL-21. In an embodiment, the cell culture medium further comprises IL-21. In a preferred embodiment, the cell culture medium comprises about 1 IU/mL of IL-21.
(324) In some embodiments the antigen-presenting feeder cells (APCs) are PBMCs. In an embodiment, the ratio of TILs to PBMCs and/or antigen-presenting cells in the rapid expansion and/or the second expansion is about 1 to 25, about 1 to 50, about 1 to 100, about 1 to 125, about 1 to 150, about 1 to 175, about 1 to 200, about 1 to 225, about 1 to 250, about 1 to 275, about 1 to 300, about 1 to 325, about 1 to 350, about 1 to 375, about 1 to 400, or about 1 to 500. In an embodiment, the ratio of TILs to PBMCs in the rapid expansion and/or the second expansion is between 1 to 50 and 1 to 300. In an embodiment, the ratio of TILs to PBMCs in the rapid expansion and/or the second expansion is between 1 to 100 and 1 to 200.
(325) In an embodiment, REP and/or the second expansion is performed in flasks with the bulk TILs being mixed with a 100- or 200-fold excess of inactivated feeder cells, 30 mg/mL OKT3 anti-CD3 antibody and 3000 IU/mL IL-2 in 150 ml media. Media replacement is done (generally 2/3 media replacement via respiration with fresh media) until the cells are transferred to an alternative growth chamber. Alternative growth chambers include G-REX flasks and gas permeable containers as more fully discussed below.
(326) In some embodiments, the second expansion (which can include processes referred to as the REP process) is shortened to 7-14 days, as discussed in the examples and figures. In some embodiments, the second expansion is shortened to 11 days.
(327) In an embodiment, REP and/or the second expansion may be performed using T-175 flasks and gas permeable bags as previously described (Tran, et al., J. Immunother. 2008, 31, 742-51; Dudley, et al., J Immunother. 2003, 26, 332-42) or gas permeable cultureware (G-Rex flasks). In some embodiments, the second expansion (including expansions referred to as rapid expansions) is performed in T-175 flasks, and about 1?10.sup.6 TILs suspended in 150 mL of media may be added to each T-175 flask. The TILs may be cultured in a 1 to 1 mixture of CM and AIM-V medium, supplemented with 3000 IU per mL of IL-2 and 30 ng per ml of anti-CD3. The T-175 flasks may be incubated at 37? C. in 5% CO.sub.2. Half the media may be exchanged on day 5 using 50/50 medium with 3000 IU per mL of IL-2. In some embodiments, on day 7 cells from two T-175 flasks may be combined in a 3 L bag and 300 mL of AIM V with 5% human AB serum and 3000 IU per mL of IL-2 was added to the 300 ml of TIL suspension. The number of cells in each bag was counted every day or two and fresh media was added to keep the cell count between 0.5 and 2.0?10.sup.6 cells/mL.
(328) In an embodiment, the second expansion (which can include expansions referred to as REP, as well as those referred to in Step D of
(329) In an embodiment, the second expansion (including expansions referred to as REP) is performed in flasks with the bulk TILs being mixed with a 100- or 200-fold excess of inactivated feeder cells, 30 mg/mL OKT3 anti-CD3 antibody and 3000 IU/mL IL-2 in 150 ml media. In some embodiments, media replacement is done until the cells are transferred to an alternative growth chamber. In some embodiments, ? of the media is replaced by respiration with fresh media. In some embodiments, alternative growth chambers include G-REX flasks and gas permeable containers as more fully discussed below.
(330) In an embodiment, the second expansion (including expansions referred to as REP) is performed and further comprises a step wherein TILs are selected for superior tumor reactivity. Any selection method known in the art may be used. For example, the methods described in U.S. Patent Application Publication No. 2016/0010058 A1, the disclosures of which are incorporated herein by reference, may be used for selection of TILs for superior tumor reactivity.
(331) Optionally, a cell viability assay can be performed after the second expansion (including expansions referred to as the REP expansion), using standard assays known in the art. For example, a trypan blue exclusion assay can be done on a sample of the bulk TILs, which selectively labels dead cells and allows a viability assessment. In some embodiments, TIL samples can be counted and viability determined using a Cellometer K2 automated cell counter (Nexcelom Bioscience, Lawrence, MA). In some embodiments, viability is determined according to the Cellometer K2 Image Cytometer Automatic Cell Counter protocol described, for example, in Example 15.
(332) In some embodiments, the second expansion (including expansions referred to as REP) of TIL can be performed using T-175 flasks and gas-permeable bags as previously described (Tran K Q, Zhou J, Durflinger K H, et al., 2008, J Immunother., 31:742-751, and Dudley M E, Wunderlich J R, Shelton T E, et al. 2003, J Immunother., 26:332-342) or gas-permeable G-Rex flasks. In some embodiments, the second expansion is performed using flasks. In some embodiments, the second expansion is performed using gas-permeable G-Rex flasks. In some embodiments, the second expansion is performed in T-175 flasks, and about 1?10.sup.6 TIL are suspended in about 150 mL of media and this is added to each T-175 flask. The TIL are cultured with irradiated (50 Gy) allogeneic PBMC as feeder cells at a ratio of 1 to 100 and the cells were cultured in a 1 to 1 mixture of CM and AIM-V medium (50/50 medium), supplemented with 3000 IU/mL of IL-2 and 30 ng/mL of anti-CD3. The T-175 flasks are incubated at 37? C. in 5% CO.sub.2. In some embodiments, half the media is changed on day 5 using 50/50 medium with 3000 IU/mL of IL-2. In some embodiments, on day 7, cells from 2 T-175 flasks are combined in a 3 L bag and 300 mL of AIM-V with 5% human AB serum and 3000 IU/mL of IL-2 is added to the 300 mL of TIL suspension. The number of cells in each bag can be counted every day or two and fresh media can be added to keep the cell count between about 0.5 and about 2.0?10.sup.6 cells/mL.
(333) In some embodiments, the second expansion (including expansions referred to as REP) are performed in 500 mL capacity flasks with 100 cm.sup.2 gas-permeable silicon bottoms (G-Rex 100, Wilson Wolf) (
(334) The diverse antigen receptors of T and B lymphocytes are produced by somatic recombination of a limited, but large number of gene segments. These gene segments: V (variable), D (diversity), J (joining), and C (constant), determine the binding specificity and downstream applications of immunoglobulins and T-cell receptors (TCRs). The present invention provides a method for generating TILs which exhibit and increase the T-cell repertoire diversity. In some embodiments, the TILs obtained by the present method exhibit an increase in the T-cell repertoire diversity. In some embodiments, the TILs obtained in the second expansion exhibit an increase in the T-cell repertoire diversity. In some embodiments, the increase in diversity is an increase in the immunoglobulin diversity and/or the T-cell receptor diversity. In some embodiments, the diversity is in the immunoglobulin is in the immunoglobulin heavy chain. In some embodiments, the diversity is in the immunoglobulin is in the immunoglobulin light chain. In some embodiments, the diversity is in the T-cell receptor. In some embodiments, the diversity is in one of the T-cell receptors selected from the group consisting of alpha, beta, gamma, and delta receptors. In some embodiments, there is an increase in the expression of T-cell receptor (TCR) alpha and/or beta. In some embodiments, there is an increase in the expression of T-cell receptor (TCR) alpha. In some embodiments, there is an increase in the expression of T-cell receptor (TCR) beta. In some embodiments, there is an increase in the expression of TCRab (i.e., TCR?/?).
(335) In some embodiments, the second expansion culture medium (e.g., sometimes referred to as CM2 or the second cell culture medium), comprises IL-2, OKT-3, as well as the antigen-presenting feeder cells (APCs), as discussed in more detail below.
(336) In some embodiments, the second expansion, for example, Step D according to
(337) 1. Feeder Cells and Antigen Presenting Cells
(338) In an embodiment, the second expansion procedures described herein (for example including expansion such as those described in Step D from
(339) In general, the allogenic PBMCs are inactivated, either via irradiation or heat treatment, and used in the REP procedures, as described in the examples, in particular example 14, which provides an exemplary protocol for evaluating the replication incompetence of irradiate allogeneic PBMCs.
(340) In some embodiments, PBMCs are considered replication incompetent and accepted for use in the TIL expansion procedures described herein if the total number of viable cells on day 14 is less than the initial viable cell number put into culture on day 0 of the REP and/or day 0 of the second expansion (i.e., the start day of the second expansion). See, for example, Example 14.
(341) In some embodiments, PBMCs are considered replication incompetent and accepted for use in the TIL expansion procedures described herein if the total number of viable cells, cultured in the presence of OKT3 and IL-2, on day 7 and day 14 has not increased from the initial viable cell number put into culture on day 0 of the REP and/or day 0 of the second expansion (i.e., the start day of the second expansion). In some embodiments, the PBMCs are cultured in the presence of 30 ng/ml OKT3 antibody and 3000 IU/ml IL-2. See, for example, Example 13.
(342) In some embodiments, PBMCs are considered replication incompetent and accepted for use in the TIL expansion procedures described herein if the total number of viable cells, cultured in the presence of OKT3 and IL-2, on day 7 and day 14 has not increased from the initial viable cell number put into culture on day 0 of the REP and/or day 0 of the second expansion (i.e., the start day of the second expansion). In some embodiments, the PBMCs are cultured in the presence of 5-60 ng/ml OKT3 antibody and 1000-6000 IU/ml IL-2. In some embodiments, the PBMCs are cultured in the presence of 10-50 ng/ml OKT3 antibody and 2000-5000 IU/ml IL-2. In some embodiments, the PBMCs are cultured in the presence of 20-40 ng/ml OKT3 antibody and 2000-4000 IU/ml IL-2. In some embodiments, the PBMCs are cultured in the presence of 25-35 ng/ml OKT3 antibody and 2500-3500 IU/ml IL-2.
(343) In some embodiments, the antigen-presenting feeder cells are PBMCs. In some embodiments, the antigen-presenting feeder cells are artificial antigen-presenting feeder cells. In an embodiment, the ratio of TILs to antigen-presenting feeder cells in the second expansion is about 1 to 25, about 1 to 50, about 1 to 100, about 1 to 125, about 1 to 150, about 1 to 175, about 1 to 200, about 1 to 225, about 1 to 250, about 1 to 275, about 1 to 300, about 1 to 325, about 1 to 350, about 1 to 375, about 1 to 400, or about 1 to 500. In an embodiment, the ratio of TILs to antigen-presenting feeder cells in the second expansion is between 1 to 50 and 1 to 300. In an embodiment, the ratio of TILs to antigen-presenting feeder cells in the second expansion is between 1 to 100 and 1 to 200.
(344) In an embodiment, the second expansion procedures described herein require a ratio of about 2.5?10.sup.9 feeder cells to about 100?10.sup.6 TILs. In another embodiment, the second expansion procedures described herein require a ratio of about 2.5?10.sup.9 feeder cells to about 50?10.sup.6 TILs. In yet another embodiment, the second expansion procedures described herein require about 2.5?10.sup.9 feeder cells to about 25?10.sup.6 TILs.
(345) In an embodiment, the second expansion procedures described herein require an excess of feeder cells during the second expansion. In many embodiments, the feeder cells are peripheral blood mononuclear cells (PBMCs) obtained from standard whole blood units from healthy blood donors. The PBMCs are obtained using standard methods such as Ficoll-Paque gradient separation. In an embodiment, artificial antigen-presenting (aAPC) cells are used in place of PBMCs.
(346) In general, the allogenic PBMCs are inactivated, either via irradiation or heat treatment, and used in the TIL expansion procedures described herein, including the exemplary procedures described in
(347) In an embodiment, artificial antigen presenting cells are used in the second expansion as a replacement for, or in combination with, PBMCs.
(348) 2. Cytokines
(349) The expansion methods described herein generally use culture media with high doses of a cytokine, in particular IL-2, as is known in the art.
(350) Alternatively, using combinations of cytokines for the rapid expansion and or second expansion of TILS is additionally possible, with combinations of two or more of IL-2, IL-15 and IL-21 as is generally outlined in International Publication No. WO 2015/189356 and W International Publication No. WO 2015/189357, hereby expressly incorporated by reference in their entirety. Thus, possible combinations include IL-2 and IL-15, IL-2 and IL-21, IL-15 and IL-21 and IL-2, IL-15 and IL-21, with the latter finding particular use in many embodiments. The use of combinations of cytokines specifically favors the generation of lymphocytes, and in particular T-cells as described therein.
(351) 3. Anti-CD3 Antibodies
(352) In some embodiments, the culture media used in expansion methods described herein (including those referred to as REP, see for example,
(353) As will be appreciated by those in the art, there are a number of suitable anti-human CD3 antibodies that find use in the invention, including anti-human CD3 polyclonal and monoclonal antibodies from various mammals, including, but not limited to, murine, human, primate, rat, and canine antibodies. In particular embodiments, the OKT3 anti-CD3 antibody is used (commercially available from Ortho-McNeil, Raritan, NJ or Miltenyi Biotech, Auburn, CA).
(354) E. Step E: Harvest TILS
(355) After the second expansion step, cells can be harvested. In some embodiments the TILs are harvested after one, two, three, four or more expansion steps, for example as provided in
(356) TILs can be harvested in any appropriate and sterile manner, including for example by centrifugation. Methods for TIL harvesting are well known in the art and any such know methods can be employed with the present process. In some embodiments, TILS are harvest using an automated system.
(357) Cell harvesters and/or cell processing systems are commercially available from a variety of sources, including, for example, Fresenius Kabi, Tomtec Life Science, Perkin Elmer, and Inotech Biosystems International, Inc. Any cell based harvester can be employed with the present methods. In some embodiments, the cell harvester and/or cell processing systems is a membrane-based cell harvester. In some embodiments, cell harvesting is via a cell processing system, such as the LOVO system (manufactured by Fresenius Kabi). The term LOVO cell processing system also refers to any instrument or device manufactured by any vendor that can pump a solution comprising cells through a membrane or filter such as a spinning membrane or spinning filter in a sterile and/or closed system environment, allowing for continuous flow and cell processing to remove supernatant or cell culture media without pelletization. In some embodiments, the cell harvester and/or cell processing system can perform cell separation, washing, fluid-exchange, concentration, and/or other cell processing steps in a closed, sterile system.
(358) In some embodiments, the harvest, for example, Step E according to
(359) In some embodiments, Step E according to
(360) In some embodiments, TILs are harvested according to the methods described in Example 30. In some embodiments, TILs between days 1 and 11 are harvested using the methods as described in Section 8.5 (referred to as the Day 11 TIL harvest in Example 30). In some embodiments, TILs between days 12 and 22 are harvested using the methods as described in Section 8.12 (referred to as the Day 22 TIL harvest in Example 30).
(361) F. Step F: Final Formulation/Transfer to Infusion Bag
(362) After Steps A through E as provided in an exemplary order in
(363) In an embodiment, TILs expanded using APCs of the present disclosure are administered to a patient as a pharmaceutical composition. In an embodiment, the pharmaceutical composition is a suspension of TILs in a sterile buffer. TILs expanded using PBMCs of the present disclosure may be administered by any suitable route as known in the art. In some embodiments, the T-cells are administered as a single intra-arterial or intravenous infusion, which preferably lasts approximately 30 to 60 minutes. Other suitable routes of administration include intraperitoneal, intrathecal, and intralymphatic.
(364) 1. Pharmaceutical Compositions, Dosages, and Dosing Regimens
(365) In an embodiment, TILs expanded using the methods of the present disclosure are administered to a patient as a pharmaceutical composition. In an embodiment, the pharmaceutical composition is a suspension of TILs in a sterile buffer. TILs expanded using PBMCs of the present disclosure may be administered by any suitable route as known in the art. In some embodiments, the T-cells are administered as a single intra-arterial or intravenous infusion, which preferably lasts approximately 30 to 60 minutes. Other suitable routes of administration include intraperitoneal, intrathecal, and intralymphatic administration.
(366) Any suitable dose of TILs can be administered. In some embodiments, from about 2.3?10.sup.10 to about 13.7?10.sup.10 TILs are administered, with an average of around 7.8?10.sup.10 TILs, particularly if the cancer is melanoma. In an embodiment, about 1.2?10.sup.10 to about 4.3?10.sup.10 of TILs are administered. In some embodiments, about 3?10.sup.10 to about 12?10.sup.10 TILs are administered. In some embodiments, about 4?10.sup.10 to about 10?10.sup.10 TILs are administered. In some embodiments, about 5?10.sup.10 to about 8?10.sup.10 TILs are administered. In some embodiments, about 6?10.sup.10 to about 8?10.sup.10 TILs are administered. In some embodiments, about 7?10.sup.10 to about 8?10.sup.10 TILs are administered. In some embodiments, the therapeutically effective dosage is about 2.3?10.sup.10 to about 13.7?10.sup.10. In some embodiments, the therapeutically effective dosage is about 7.8?10.sup.10 TILs, particularly of the cancer is melanoma. In some embodiments, the therapeutically effective dosage is about 1.2?10.sup.10 to about 4.3?10.sup.10 of TILs. In some embodiments, the therapeutically effective dosage is about 3?10.sup.10 to about 12?10.sup.10 TILs. In some embodiments, the therapeutically effective dosage is about 4?10.sup.10 to about 10?10.sup.10 TILs. In some embodiments, the therapeutically effective dosage is about 5?10.sup.10 to about 8?10.sup.10 TILs. In some embodiments, the therapeutically effective dosage is about 6?10.sup.10 to about 8?10.sup.10 TILs. In some embodiments, the therapeutically effective dosage is about 7?10.sup.10 to about 8?10.sup.10 TILs.
(367) In some embodiments, the number of the TILs provided in the pharmaceutical compositions of the invention is about 1?10.sup.6, 2?10.sup.6, 3?10.sup.6, 4?10.sup.6, 5?10.sup.6, 6?10.sup.6, 7?10.sup.6, 8?10.sup.6, 9?10.sup.6, 1?10.sup.7, 2?10.sup.7, 3?10.sup.7, 4?10.sup.7, 5?10.sup.7, 6?10.sup.7, 7?10.sup.7, 8?10.sup.7, 9?10.sup.7, 1?10.sup.8, 2?10.sup.8, 3?10.sup.8, 4?10.sup.8, 5?10.sup.8, 6?10.sup.8, 7?10.sup.8, 8?10.sup.8, 9?10.sup.8, 1?10.sup.9, 2?10.sup.9, 3?10.sup.9, 4?10.sup.9, 5?10.sup.9, 6?10.sup.9, 7?10.sup.9, 8?10.sup.9, 9?10.sup.9, 1?10.sup.10, 2?10.sup.10, 3?10.sup.10, 4?10.sup.10, 5?10.sup.10, 6?10.sup.10, 7?10.sup.10, 8?10.sup.10, 9?10.sup.10, 1?10.sup.11, 2?10.sup.11, 3?10.sup.11, 4?10.sup.11, 5?10.sup.11, 6?10.sup.11, 7?10.sup.11, 8?10.sup.11, 9?10.sup.11, 1?10.sup.12, 2?10.sup.12, 3?10.sup.12, 4?10.sup.12, 5?10.sup.12, 6?10.sup.12, 7?10.sup.12, 8?10.sup.12, 9?10.sup.12, 1?10.sup.13, 2?10.sup.13, 3?10.sup.13, 4?10.sup.13, 5?10.sup.13, 6?10.sup.13, 7?10.sup.13, 8?10.sup.13, and 9?10.sup.13. In an embodiment, the number of the TILs provided in the pharmaceutical compositions of the invention is in the range of 1?10.sup.6 to 5?10.sup.6, 5?10.sup.6 to 1?10.sup.7, 1?10.sup.7 to 5?10.sup.7, 5?10.sup.7 to 1?10.sup.8, 1?10.sup.8 to 5?10.sup.8, 5?10.sup.8 to 1?10.sup.9, 1?10.sup.9 to 5?10.sup.9, 5?10.sup.9 to 1?10.sup.10, 1?10.sup.10 to 5?10.sup.10, 5?10.sup.10 to 1?10.sup.11, 5?10.sup.11 to 1?10.sup.12, 1?10.sup.12 to 5?10.sup.12, and 5?10.sup.12 to 1?10.sup.13.
(368) In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is less than, for example, 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, 0.009%, 0.008%, 0.007%, 0.006%, 0.005%, 0.004%, 0.003%, 0.002%, 0.001%, 0.0009%, 0.0008%, 0.0007%, 0.0006%, 0.0005%, 0.0004%, 0.0003%, 0.0002% or 0.00010% w/w, w/v or v/v of the pharmaceutical composition.
(369) In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is greater than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19.75%, 19.50%, 19.25% 19%, 18.75%, 18.50%, 18.25% 18%, 17.75%, 17.50%, 17.25% 17%, 16.75%, 16.50%, 16.25% 16%, 15.75%, 15.50%, 15.25% 15%, 14.75%, 14.50%, 14.25% 14%, 13.75%, 13.50%, 13.25% 13%, 12.75%, 12.50%, 12.25% 12%, 11.75%, 11.50%, 11.25% 11%, 10.75%, 10.50%, 10.25% 10%, 9.75%, 9.50%, 9.25% 9%, 8.75%, 8.50%, 8.25% 8%, 7.75%, 7.50%, 7.25% 7%, 6.75%, 6.50%, 6.25% 6%, 5.75%, 5.50%, 5.25% 5%, 4.75%, 4.50%, 4.25%, 4%, 3.75%, 3.50%, 3.25%, 3%, 2.75%, 2.50%, 2.25%, 2%, 1.75%, 1.50%, 125%, 1%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, 0.009%, 0.008%, 0.007%, 0.006%, 0.005%, 0.004%, 0.003%, 0.002%, 0.001%, 0.0009%, 0.0008%, 0.0007%, 0.0006%, 0.0005%, 0.0004%, 0.0003%, 0.0002% or 0.00010% w/w, w/v, or v/v of the pharmaceutical composition.
(370) In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is in the range from about 0.00010% to about 50%, about 0.001% to about 40%, about 0.01% to about 30%, about 0.02% to about 29%, about 0.03% to about 28%, about 0.04% to about 27%, about 0.05% to about 26%, about 0.06% to about 25%, about 0.07% to about 24%, about 0.08% to about 23%, about 0.09% to about 22%, about 0.1% to about 21%, about 0.2% to about 20%, about 0.3% to about 19%, about 0.4% to about 18%, about 0.5% to about 17%, about 0.6% to about 16%, about 0.7% to about 15%, about 0.8% to about 14%, about 0.9% to about 12% or about 1% to about 10% w/w, w/v or v/v of the pharmaceutical composition.
(371) In some embodiments, the concentration of the TILs provided in the pharmaceutical compositions of the invention is in the range from about 0.0010% to about 10%, about 0.010% to about 5%, about 0.02% to about 4.5%, about 0.03% to about 4%, about 0.04% to about 3.5%, about 0.05% to about 3%, about 0.06% to about 2.5%, about 0.07% to about 2%, about 0.08% to about 1.5%, about 0.09% to about 1%, about 0.1% to about 0.9% w/w, w/v or v/v of the pharmaceutical composition.
(372) In some embodiments, the amount of the TILs provided in the pharmaceutical compositions of the invention is equal to or less than 10 g, 9.5 g, 9.0 g, 8.5 g, 8.0 g, 7.5 g, 7.0 g, 6.5 g, 6.0 g, 5.5 g, 5.0 g, 4.5 g, 4.0 g, 3.5 g, 3.0 g, 2.5 g, 2.0 g, 1.5 g, 1.0 g, 0.95 g, 0.9 g, 0.85 g, 0.8 g, 0.75 g, 0.7 g, 0.65 g, 0.6 g, 0.55 g, 0.5 g, 0.45 g, 0.4 g, 0.35 g, 0.3 g, 0.25 g, 0.2 g, 0.15 g, 0.1 g, 0.09 g, 0.08 g, 0.07 g, 0.06 g, 0.05 g, 0.04 g, 0.03 g, 0.02 g, 0.01 g, 0.009 g, 0.008 g, 0.007 g, 0.006 g, 0.005 g, 0.004 g, 0.003 g, 0.002 g, 0.001 g, 0.0009 g, 0.0008 g, 0.0007 g, 0.0006 g, 0.0005 g, 0.0004 g, 0.0003 g, 0.0002 g, or 0.0001 g.
(373) In some embodiments, the amount of the TILs provided in the pharmaceutical compositions of the invention is more than 0.0001 g, 0.0002 g, 0.0003 g, 0.0004 g, 0.0005 g, 0.0006 g, 0.0007 g, 0.0008 g, 0.0009 g, 0.001 g, 0.0015 g, 0.002 g, 0.0025 g, 0.003 g, 0.0035 g, 0.004 g, 0.0045 g, 0.005 g, 0.0055 g, 0.006 g, 0.0065 g, 0.007 g, 0.0075 g, 0.008 g, 0.0085 g, 0.009 g, 0.0095 g, 0.01 g, 0.015 g, 0.02 g, 0.025 g, 0.03 g, 0.035 g, 0.04 g, 0.045 g, 0.05 g, 0.055 g, 0.06 g, 0.065 g, 0.07 g, 0.075 g, 0.08 g, 0.085 g, 0.09 g, 0.095 g, 0.1 g, 0.15 g, 0.2 g, 0.25 g, 0.3 g, 0.35 g, 0.4 g, 0.45 g, 0.5 g, 0.55 g, 0.6 g, 0.65 g, 0.7 g, 0.75 g, 0.8 g, 0.85 g, 0.9 g, 0.95 g, 1 g, 1.5 g, 2 g, 2.5, 3 g, 3.5, 4 g, 4.5 g, 5 g, 5.5 g, 6 g, 6.5 g, 7 g, 7.5 g, 8 g, 8.5 g, 9 g, 9.5 g, or 10 g.
(374) The TILs provided in the pharmaceutical compositions of the invention are effective over a wide dosage range. The exact dosage will depend upon the route of administration, the form in which the compound is administered, the gender and age of the subject to be treated, the body weight of the subject to be treated, and the preference and experience of the attending physician. The clinically-established dosages of the TILs may also be used if appropriate. The amounts of the pharmaceutical compositions administered using the methods herein, such as the dosages of TILs, will be dependent on the human or mammal being treated, the severity of the disorder or condition, the rate of administration, the disposition of the active pharmaceutical ingredients and the discretion of the prescribing physician.
(375) In some embodiments, TILs may be administered in a single dose. Such administration may be by injection, e.g., intravenous injection. In some embodiments, TILs may be administered in multiple doses. Dosing may be once, twice, three times, four times, five times, six times, or more than six times per year. Dosing may be once a month, once every two weeks, once a week, or once every other day. Administration of TILs may continue as long as necessary.
(376) In some embodiments, an effective dosage of TILs is about 1?10.sup.6, 2?10.sup.6, 3?10.sup.6, 4?10.sup.6, 5?10.sup.6, 6?10.sup.6, 7?10.sup.6, 8?10.sup.6, 9?10.sup.6, 1?10.sup.7, 2?10.sup.7, 3?10.sup.7, 4?10.sup.7, 5?10.sup.7, 6?10.sup.7, 7?10.sup.7, 8?10.sup.7, 9?10.sup.7, 1?10.sup.8, 2?10.sup.8, 3?10.sup.8, 4?10.sup.8, 5?10.sup.8, 6?10.sup.8, 7?10.sup.8, 8?10.sup.8, 9?10.sup.8, 1?10.sup.9, 2?10.sup.9, 3?10.sup.9, 4?10.sup.9, 5?10.sup.9, 6?10.sup.9, 7?10.sup.9, 8?10.sup.9, 9?10.sup.9, 1?10.sup.10, 2?10.sup.10, 3?10.sup.10, 4?10.sup.10, 5?10.sup.10, 6?10.sup.10, 7?10.sup.10, 8?10.sup.10, 9?10.sup.10, 1?10.sup.11, 2?10.sup.11, 3?10.sup.11, 4?10.sup.11, 5?10.sup.11, 6?10.sup.11, 7?10.sup.11, 8?10.sup.11, 9?10.sup.11, 1?10.sup.12, 2?10.sup.12, 3?10.sup.12, 4?10.sup.12, 5?10.sup.12, 6?10.sup.12, 7?10.sup.12, 8?10.sup.12, 9?10.sup.12, 1?10.sup.13, 2?10.sup.13, 3?10.sup.13, 4?10.sup.13, 5?10.sup.13, 6?10.sup.13, 7?10.sup.13, 8?10.sup.13, and 9?10.sup.13. In some embodiments, an effective dosage of TILs is in the range of 1?10.sup.6 to 5?10.sup.6, 5?10.sup.6 to 1?10.sup.7, 1?10.sup.7 to 5?10.sup.7, 5?10.sup.7 to 1?10.sup.8, 1?10.sup.8 to 5?10.sup.8, 5?10.sup.8 to 1?10.sup.9, 1?10.sup.9 to 5?10.sup.9, 5?10.sup.9 to 1?10.sup.10, 1?10.sup.10 to 5?10.sup.10, 5?10.sup.10 to 1?10.sup.11, 5?10.sup.11 to 1?10.sup.12, 1?10.sup.12 to 5?10.sup.12, and 5?10.sup.12 to 1?10.sup.13.
(377) In some embodiments, an effective dosage of TILs is in the range of about 0.01 mg/kg to about 4.3 mg/kg, about 0.15 mg/kg to about 3.6 mg/kg, about 0.3 mg/kg to about 3.2 mg/kg, about 0.35 mg/kg to about 2.85 mg/kg, about 0.15 mg/kg to about 2.85 mg/kg, about 0.3 mg to about 2.15 mg/kg, about 0.45 mg/kg to about 1.7 mg/kg, about 0.15 mg/kg to about 1.3 mg/kg, about 0.3 mg/kg to about 1.15 mg/kg, about 0.45 mg/kg to about 1 mg/kg, about 0.55 mg/kg to about 0.85 mg/kg, about 0.65 mg/kg to about 0.8 mg/kg, about 0.7 mg/kg to about 0.75 mg/kg, about 0.7 mg/kg to about 2.15 mg/kg, about 0.85 mg/kg to about 2 mg/kg, about 1 mg/kg to about 1.85 mg/kg, about 1.15 mg/kg to about 1.7 mg/kg, about 1.3 mg/kg mg to about 1.6 mg/kg, about 1.35 mg/kg to about 1.5 mg/kg, about 2.15 mg/kg to about 3.6 mg/kg, about 2.3 mg/kg to about 3.4 mg/kg, about 2.4 mg/kg to about 3.3 mg/kg, about 2.6 mg/kg to about 3.15 mg/kg, about 2.7 mg/kg to about 3 mg/kg, about 2.8 mg/kg to about 3 mg/kg, or about 2.85 mg/kg to about 2.95 mg/kg.
(378) In some embodiments, an effective dosage of TILs is in the range of about 1 mg to about 500 mg, about 10 mg to about 300 mg, about 20 mg to about 250 mg, about 25 mg to about 200 mg, about 1 mg to about 50 mg, about 5 mg to about 45 mg, about 10 mg to about 40 mg, about 15 mg to about 35 mg, about 20 mg to about 30 mg, about 23 mg to about 28 mg, about 50 mg to about 150 mg, about 60 mg to about 140 mg, about 70 mg to about 130 mg, about 80 mg to about 120 mg, about 90 mg to about 110 mg, or about 95 mg to about 105 mg, about 98 mg to about 102 mg, about 150 mg to about 250 mg, about 160 mg to about 240 mg, about 170 mg to about 230 mg, about 180 mg to about 220 mg, about 190 mg to about 210 mg, about 195 mg to about 205 mg, or about 198 to about 207 mg.
(379) An effective amount of the TILs may be administered in either single or multiple doses by any of the accepted modes of administration of agents having similar utilities, including intranasal and transdermal routes, by intra-arterial injection, intravenously, intraperitoneally, parenterally, intramuscularly, subcutaneously, topically, by transplantation, or by inhalation.
(380) G. Optional Cell Viability Analyses
(381) Optionally, a cell viability assay can be performed after the Step B first expansion, using standard assays known in the art. For example, a trypan blue exclusion assay can be done on a sample of the bulk TILs, which selectively labels dead cells and allows a viability assessment. Other assays for use in testing viability can include but are not limited to the Alamar blue assay; and the MTT assay.
(382) 1. Cell Counts, Viability, Flow Cytometry
(383) In some embodiments, cell counts and/or viability are measured. The expression of markers such as but not limited CD3, CD4, CD8, and CD56, as well as any other disclosed or described herein, can be measured by flow cytometry with antibodies, for example but not limited to those commercially available from BD Bio-sciences (BD Biosciences, San Jose, CA) using a FACSCanto? flow cytometer (BD Biosciences). The cells can be counted manually using a disposable c-chip hemocytometer (VWR, Batavia, IL) and viability can be assessed using any method known in the art, including but not limited to trypan blue staining.
(384) In some embodiments, the TILs are analyzed for CD3+ cell population percentages. In some embodiments, the TILs for use in treatment are analyzed for CD3+ cell population percentages. In some embodiments, the TILs are CD3+/CD45+ TILs. In some embodiments, the CD3+ percentage is between about 70% and about 99.9%. In some embodiments, the CD3+ percentage is between about 74% and about 99.9%. In some embodiments, the CD3+ percentage is between about 74% and about 99.9%. In some embodiments, the CD3+ percentage is between about 74% and about 97.1%. In some embodiments, the CD3+ percentage is between about 80% and about 99.9%. In some embodiments, the CD3+ percentage is between about 85% and about 99.9%. In some embodiments, the CD3+ percentage is between about 90% and about 99.9%. In some embodiments, the CD3+ percentage is between about 85% and about 95%. In some embodiments, the CD3+ percentage is between about 80% and about 95%. In some embodiments, the CD3+ percentage is between about 95% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 70% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 74% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 74% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 74% and about 97.1%. In some embodiments, the CD3+/CD45+ percentage is between about 80% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 85% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 90% and about 99.9%. In some embodiments, the CD3+/CD45+ percentage is between about 85% and about 95%. In some embodiments, the CD3+/CD45+ percentage is between about 80% and about 95%. In some embodiments, the CD3+/CD45+ percentage is between about 95% and about 99.9%.
(385) In some cases, the bulk TIL population can be cryopreserved immediately, using the protocols discussed below. Alternatively, the bulk TIL population can be subjected to REP and then cryopreserved as discussed below. Similarly, in the case where genetically modified TILs will be used in therapy, the bulk or REP TIL populations can be subjected to genetic modifications for suitable treatments.
(386) 2. Cell Cultures
(387) In an embodiment, a method for expanding TILs may include using about 5,000 mL to about 25,000 mL of cell medium, about 5,000 mL to about 10,000 mL of cell medium, or about 5,800 mL to about 8,700 mL of cell medium. In an embodiment, expanding the number of TILs uses no more than one type of cell culture medium. Any suitable cell culture medium may be used, e.g., AIM-V cell medium (L-glutamine, 50 ?M streptomycin sulfate, and 10 ?M gentamicin sulfate) cell culture medium (Invitrogen, Carlsbad CA). In this regard, the inventive methods advantageously reduce the amount of medium and the number of types of medium required to expand the number of TIL. In an embodiment, expanding the number of TIL may comprise adding fresh cell culture media to the cells (also referred to as feeding the cells) no more frequently than every third or fourth day. Expanding the number of cells in a gas permeable container simplifies the procedures necessary to expand the number of cells by reducing the feeding frequency necessary to expand the cells.
(388) In an embodiment, the cell medium in the first and/or second gas permeable container is unfiltered. The use of unfiltered cell medium may simplify the procedures necessary to expand the number of cells. In an embodiment, the cell medium in the first and/or second gas permeable container lacks beta-mercaptoethanol (BME).
(389) In an embodiment, the duration of the method comprising obtaining a tumor tissue sample from the mammal; culturing the tumor tissue sample in a first gas permeable container containing cell medium therein; obtaining TILs from the tumor tissue sample; expanding the number of TILs in a second gas permeable container containing cell medium therein using aAPCs for a duration of about 14 to about 42 days, e.g., about 28 days.
(390) In an embodiment, TILs are expanded in gas-permeable containers. Gas-permeable containers have been used to expand TILs using PBMCs using methods, compositions, and devices known in the art, including those described in U.S. Patent Application Publication No. 2005/0106717 A1, the disclosures of which are incorporated herein by reference. In an embodiment, TILs are expanded in gas-permeable bags. In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the Xuri Cell Expansion System W25 (GE Healthcare). In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the WAVE Bioreactor System, also known as the Xuri Cell Expansion System W5 (GE Healthcare). In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume selected from the group consisting of about 100 mL, about 200 mL, about 300 mL, about 400 mL, about 500 mL, about 600 mL, about 700 mL, about 800 mL, about 900 mL, about 1 L, about 2 L, about 3 L, about 4 L, about 5 L, about 6 L, about 7 L, about 8 L, about 9 L, and about 10 L. In an embodiment, TILs can be expanded in G-Rex flasks (commercially available from Wilson Wolf Manufacturing). Such embodiments allow for cell populations to expand from about 5?10.sup.5 cells/cm.sup.2 to between 10?10.sup.6 and 30?10.sup.6 cells/cm.sup.2. In an embodiment this expansion is conducted without adding fresh cell culture media to the cells (also referred to as feeding the cells). In an embodiment, this is without feeding so long as medium resides at a height of about 10 cm in the G-Rex flask. In an embodiment this is without feeding but with the addition of one or more cytokines. In an embodiment, the cytokine can be added as a bolus without any need to mix the cytokine with the medium. Such containers, devices, and methods are known in the art and have been used to expand TILs, and include those described in U.S. Patent Application Publication No. US 2014/0377739A1, International Publication No. WO 2014/210036 A1, U.S. Patent Application Publication No. us 2013/0115617 A1, International Publication No. WO 2013/188427 A1, U.S. Patent Application Publication No. US 2011/0136228 A1, U.S. Pat. No. 8,809,050 B2, International publication No. WO 2011/072088 A2, U.S. Patent Application Publication No. US 2016/0208216 A1, U.S. Patent Application Publication No. US 2012/0244133 A1, International Publication No. WO 2012/129201 A1, U.S. Patent Application Publication No. US 2013/0102075 A1, U.S. Pat. No. 8,956,860 B2, International Publication No. WO 2013/173835 A1, U.S. Patent Application Publication No. US 2015/0175966 A1, the disclosures of which are incorporated herein by reference. Such processes are also described in Jin et al., J. Immunotherapy, 2012, 35:283-292. Optional Genetic Engineering of TILs
(391) In some embodiments, the TILs are optionally genetically engineered to include additional functionalities, including, but not limited to, a high-affinity T cell receptor (TCR), e.g., a TCR targeted at a tumor-associated antigen such as MAGE-1, HER2, or NY-ESO-1, or a chimeric antigen receptor (CAR) which binds to a tumor-associated cell surface molecule (e.g., mesothelin) or lineage-restricted cell surface molecule (e.g., CD19).
(392) H. Optional Cryopreservation of TILs
(393) As discussed above, and exemplified in Steps A through E as provided in
(394) When appropriate, the cells are removed from the freezer and thawed in a 37? C. water bath until approximately ? of the solution is thawed. The cells are generally resuspended in complete media and optionally washed one or more times. In some embodiments, the thawed TILs can be counted and assessed for viability as is known in the art.
(395) I. Phenotypic Characteristics of Expanded TILs
(396) In some embodiment, the TILs are analyzed for expression of numerous phenotype markers after expansion, including those described herein and in the Examples. In an embodiment, expression of one or more phenotypic markers is examined. In some embodiments, the phenotypic characteristics of the TILs are analyzed after the first expansion in Step B. In some embodiments, the phenotypic characteristics of the TILs are analyzed during the transition in Step C. In some embodiments, the phenotypic characteristics of the TILs are analyzed during the transition according to Step C and after cryopreservation. In some embodiments, the phenotypic characteristics of the TILs are analyzed after the second expansion according to Step D. In some embodiments, the phenotypic characteristics of the TILs are analyzed after two or more expansions according to Step D. In some embodiments, the marker is selected from the group consisting of TCRab (i.e., TCR?/?), CD57, CD28, CD4, CD27, CD56, CD8a, CD45RA, CD8a, CCR7, CD4, CD3, CD38, and HLA-DR. In some embodiments, the marker is selected from the group consisting of TCRab (i.e., TCR?/?), CD57, CD28, CD4, CD27, CD56, and CD8a. In an embodiment, the marker is selected from the group consisting of CD45RA, CD8a, CCR7, CD4, CD3, CD38, and HLA-DR. In some embodiments, expression of one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, or fourteen markers is examined. In some embodiments, the expression from one or more markers from each group is examined. In some embodiments, one or more of HLA-DR, CD38, and CD69 expression is maintained (i.e., does not exhibit a statistically significant difference) in fresh TILs as compared to thawed TILs. In some embodiments, the activation status of TILs is maintained in the thawed TILs.
(397) In an embodiment, expression of one or more regulatory markers is measured. In some embodiments, the regulatory marker is selected from the group consisting of CD137, CD8a, Lag3, CD4, CD3, PD-1, TIM-3, CD69, CD8a, TIGIT, CD4, CD3, KLRG1, and CD154. In some embodiments, the regulatory marker is selected from the group consisting of CD137, CD8a, Lag3, CD4, CD3, PD-1, and TIM-3. In some embodiments, the regulatory marker is selected from the group consisting of CD69, CD8a, TIGIT, CD4, CD3, KLRG1, and CD154. In some embodiments, regulatory molecule expression is decreased in thawed TILs as compared to fresh TILs. In some embodiments, expression of regulatory molecules LAG-3 and TIM-3 is decreased in thawed TILs as compared to fresh TILs. In some embodiments, there is no significant difference in CD4, CD8, NK, TCR?? expression. In some embodiments, there is no significant difference in CD4, CD8, NK, TCR?? expression, and/or memory markers in fresh TILs as compared to thawed TILs. In some embodiments, there is no significant difference in CD4, CD8, NK, TCR?? expression between the TILs produced by the methods provided herein, as exemplified for example in
(398) In some embodiments, no selection of the first population of TILs, second population of TILs, third population of TILs, harvested TIL population, and/or the therapeutic TIL population based on CD4, CD8, and/or NK, TCR?? expression is performed during any of steps, including those discussed above or as provided for example in
(399) In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, or harvested TIL population based on CD4, CD8, and/or NK, TCR?? expression is performed during any of steps (a) to (f) of the method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system.
(400) In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, or harvested TIL population based on CD4, CD8, and/or NK, TCR?? expression is performed during any of steps (a) to (h) of the method for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient.
(401) In some embodiments the memory marker is selected from the group consisting of CCR7 and CD62L
(402) In some embodiments, the viability of the fresh TILs as compared to the thawed TILs is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%. In some embodiments, the viability of both the fresh and thawed TILs is greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, or greater than 98%. In some embodiments, the viability of both the fresh and thawed product is greater than 80%, greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, or greater than 90%. In some embodiments, the viability of both the fresh and thawed product is greater than 86%.
(403) In an embodiment, restimulated TILs can also be evaluated for cytokine release, using cytokine release assays. In some embodiments, TILs can be evaluated for interferon-7 (IFN-7) secretion in response to stimulation either with OKT3 or co-culture with autologous tumor digest. For example, in embodiments employing OKT3 stimulation, TILs are washed extensively, and duplicate wells are prepared with 1?10.sup.5 cells in 0.2 mL CM in 96-well flat-bottom plates precoated with 0.1 or 1.0 ?g/mL of OKT3 diluted in phosphate-buffered saline. After overnight incubation, the supernatants are harvested and IFN-7 in the supernatant is measured by ELISA (Pierce/Endogen, Woburn, MA). For the co-culture assay, 1?10.sup.5 TIL cells are placed into a 96-well plate with autologous tumor cells. (1:1 ratio). After a 24-hour incubation, supernatants are harvested and IFN-7 release can be quantified, for example by ELISA.
(404) Flow cytometric analysis of cell surface biomarkers: TIL samples were aliquoted for flow cytometric analysis of cell surface markers see, for Example see Examples 7, 8, and 9.
(405) In some embodiments, the TILs are being evaluated for various regulatory markers. In some embodiments, the regulatory marker is selected from the group consisting of TCR ?/?, CD56, CD27, CD28, CD57, CD45RA, CD45RO, CD25, CD127, CD95, IL-2R-, CCR7, CD62L, KLRG1, and CD122. In some embodiments, the regulatory marker is TCR (X/P. In some embodiments, the regulatory marker is CD56. In some embodiments, the regulatory marker is CD27. In some embodiments, the regulatory marker is CD28. In some embodiments, the regulatory marker is CD57. In some embodiments, the regulatory marker is CD45RA. In some embodiments, the regulatory marker is CD45RO. In some embodiments, the regulatory marker is CD25. In some embodiments, the regulatory marker is CD127. In some embodiments, the regulatory marker is CD95. In some embodiments, the regulatory marker is IL-2R-. In some embodiments, the regulatory marker is CCR7. In some embodiments, the regulatory marker is CD62L. In some embodiments, the regulatory marker is KLRG1. In some embodiments, the regulatory marker is CD122.
(406) In an embodiment, the expanded TILs are analyzed for expression of numerous phenotype markers, including those described herein and in the Examples. In an embodiment, expression of one or more phenotypic markers is examined. In some embodiments, the marker is selected from the group consisting of TCRab (i.e., TCR?/?), CD57, CD28, CD4, CD27, CD56, CD8a, CD45RA, CD8a, CCR7, CD4, CD3, CD38, and HLA-DR. In some embodiments, the marker is selected from the group consisting of TCRab (i.e., TCR?/?), CD57, CD28, CD4, CD27, CD56, and CD8a. In an embodiment, the marker is selected from the group consisting of CD45RA, CD8a, CCR7, CD4, CD3, CD38, and HLA-DR. In some embodiments, expression of one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, or fourteen markers is examined. In some embodiments, the expression from one or more markers from each group is examined. In some embodiments, one or more of HLA-DR, CD38, and CD69 expression is maintained (i.e., does not exhibit a statistically significant difference) in fresh TILs as compared to thawed TILs. In some embodiments, the activation status of TILs is maintained in the thawed TILs.
(407) In an embodiment, expression of one or more regulatory markers is measured. In some embodiments, the regulatory marker is selected from the group consisting of CD137, CD8a, Lag3, CD4, CD3, PD1, TIM-3, CD69, CD8a, TIGIT, CD4, CD3, KLRG1, and CD154. In some embodiments, the regulatory marker is selected from the group consisting of CD137, CD8a, Lag3, CD4, CD3, PD1, and TIM-3. In some embodiments, the regulatory marker is selected from the group consisting of CD69, CD8a, TIGIT, CD4, CD3, KLRG1, and CD154. In some embodiments, regulatory molecule expression is decreased in thawed TILs as compared to fresh TILs. In some embodiments, expression of regulatory molecules LAG-3 and TIM-3 is decreased in thawed TILs as compared to fresh TILs. In some embodiments, there is no significant difference in CD4, CD8, NK, TCR?? expression. In some embodiments, there is no significant difference in CD4, CD8, NK, TCR?? expression, and/or memory markers in fresh TILs as compared to thawed TILs.
(408) In some embodiments the memory marker is selected from the group consisting of CCR7 and CD62L.
(409) In some embodiments, the viability of the fresh TILs as compared to the thawed TILs is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%. In some embodiments, the viability of both the fresh and thawed TILs is greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90%, greater than 95%, or greater than 98%. In some embodiments, the viability of both the fresh and thawed product is greater than 80%, greater than 81%, greater than 82%, greater than 83%, greater than 84%, greater than 85%, greater than 86%, greater than 87%, greater than 88%, greater than 89%, or greater than 90%. In some embodiments, the viability of both the fresh and thawed product is greater than 86%.
(410) In an embodiment, restimulated TILs can also be evaluated for cytokine release, using cytokine release assays. In some embodiments, TILs can be evaluated for interferon-7 (IFN-7) secretion in response to stimulation either with OKT3 or coculture with autologous tumor digest. For example, in embodiments employing OKT3 stimulation, TILs are washed extensively, and duplicate wells are prepared with 1?10.sup.5 cells in 0.2 mL CM in 96-well flat-bottom plates precoated with 0.1 or 1.0 ?g/mL of OKT3 diluted in phosphate-buffered saline. After overnight incubation, the supernatants are harvested and IFN-7 in the supernatant is measured by ELISA (Pierce/Endogen, Woburn, MA). For the coculture assay, 1?10.sup.5 TIL cells are placed into a 96-well plate with autologous tumor cells. (1:1 ratio). After a 24-hour incubation, supernatants are harvested and IFN-7 release can be quantified, for example by ELISA.
(411) In some embodiments, the phenotypic characterization is examined after cryopreservation.
(412) J. Metabolic Health of Expanded TILs
(413) The restimulated TILs are characterized by significant enhancement of basal glycolysis as compared to either freshly harvested TILs and/or post-thawed TILs. In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, harvested TIL population, and/or the therapeutic TIL population based on CD8 expression is performed during any of steps, including those discussed above or as provided for example in
(414) In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, or harvested TIL population based on CD8 expression is performed during any of steps (a) to (f) of the method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system.
(415) In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, or harvested TIL population based on CD8 expression is performed during any of steps (a) to (h) of the method for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient.
(416) The TILs prepared by the methods described herein are characterized by significant enhancement of basal glycolysis as compared to, for example, freshly harvested TILs and/or TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(417) Spare respiratory capacity (SRC) and glycolytic reserve can be evaluated for TILs expanded with different methods of the present disclosure. The Seahorse XF Cell Mito Stress Test measures mitochondrial function by directly measuring the oxygen consumption rate (OCR) of cells, using modulators of respiration that target components of the electron transport chain in the mitochondria. The test compounds (oligomycin, FCCP, and a mix of rotenone and antimycin A, described below) are serially injected to measure ATP production, maximal respiration, and non-mitochondrial respiration, respectively. Proton leak and spare respiratory capacity are then calculated using these parameters and basal respiration. Each modulator targets a specific component of the electron transport chain. Oligomycin inhibits ATP synthase (complex V) and the decrease in OCR following injection of oligomycin correlates to the mitochondrial respiration associated with cellular ATP production. Carbonyl cyanide-4 (trifluoromethoxy) phenylhydrazone (FCCP) is an uncoupling agent that collapses the proton gradient and disrupts the mitochondrial membrane potential. As a result, electron flow through the electron transport chain is uninhibited and oxygen is maximally consumed by complex IV. The FCCP-stimulated OCR can then be used to calculate spare respiratory capacity, defined as the difference between maximal respiration and basal respiration. Spare respiratory capacity (SRC) is a measure of the ability of the cell to respond to increased energy demand. The third injection is a mix of rotenone, a complex I inhibitor, and antimycin A, a complex III inhibitor. This combination shuts down mitochondrial respiration and enables the calculation of nonmitochondrial respiration driven by processes outside the mitochondria. In some embodiments, the comparison is to, for example, freshly harvested TILs and/or TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(418) In some embodiments, the metabolic assay is basal respiration. In general, second expansion TILs have a basal respiration rate that is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or at least 99% of the basal respiration rate of freshly harvested TILs and/or TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(419) In some embodiments, the metabolic assay is spare respiratory capacity. In general, the second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of
(420) In general, second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of
(421) In some embodiments, the metabolic assay is basal glycolysis. In some embodiments, second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of
(422) In general, the second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of
(423) Granzyme B Production: Granzyme B is another measure of the ability of TIL to kill target cells. Media supernatants restimulated as described above using antibodies to CD3, CD28, and CD137/4-1BB were also evaluated for their levels of Granzyme B using the Human Granzyme B DuoSet ELISA Kit (R & D Systems, Minneapolis, MN) according to the manufacturer's instructions. In some embodiments, the second expansion TILs or second additional expansion TILs (such as, for example, those described in Step D of
(424) In some embodiments, telomere length can be used as a measure of cell viability and/or cellular function. In some embodiments, the telomeres are surprisingly the same length in the TILs produced by the present invention as compared to TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(425) In some embodiments, TIL health is measured by IFN-gamma (IFN-?) secretion. In some embodiments, IFN-? secretion is indicative of active TILs. In some embodiments, a potency assay for IFN-? production is employed. IFN-? production is another measure of cytotoxic potential. IFN-? production can be measured by determining the levels of the cytokine IFN-? in the media of TIL stimulated with antibodies to CD3, CD28, and CD137/4-1BB. IFN-? levels in media from these stimulated TIL can be determined using by measuring IFN-? release. In some embodiments, an increase in IFN-? production in for example Step D as provided in
(426) In some embodiments, the cytotoxic potential of TIL to lyse target cells was assessed using a co-culture assay of TIL with the bioluminescent cell line, P815 (Clone G6), according to a bioluminescent redirected lysis assay (potency assay) for TIL assay which measures TIL cytotoxicity in a highly sensitive dose dependent manner.
(427) In some embodiments, the present methods provide an assay for assessing TIL viability, using the methods as described above. In some embodiments, the TILs are expanded as discussed above, including for example as provided in
(428) The present invention also provides assay methods for determining TIL viability. In some embodiments, the TILs have equal viability as compared to freshly harvested TILs and/or TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(429) In some embodiments, the method further comprises: (iv) performing an additional second expansion by supplementing the cell culture medium of the third population of TILs with additional IL-2, additional OKT-3, and additional APCs, wherein the additional second expansion is performed for at least 14 days to obtain a larger population of TILs than obtained in step (iii), wherein the larger population of TILs comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the third population of TILs, and wherein the third population is further assayed for viability.
(430) In some embodiments, prior to step (i), the cells are cryopreserved.
(431) In some embodiments, the cells are thawed prior to performing step (i).
(432) In some embodiments, step (iv) is repeated one to four times in order to obtain sufficient TILs for analysis.
(433) In some embodiments, steps (i) through (iii) or (iv) are performed within a period of about 40 days to about 50 days.
(434) In some embodiments, steps (i) through (iii) or (iv) are performed within a period of about 42 days to about 48 days.
(435) In some embodiments, steps (i) through (iii) or (iv) are performed within a period of about 42 days to about 45 days.
(436) In some embodiments, steps (i) through (iii) or (iv) are performed within about 44 days.
(437) In some embodiments, the cells from steps (iii) or (iv) express CD4, CD8, and TCR ?? at levels similar to freshly harvested cells.
(438) In some embodiments, the antigen presenting cells are peripheral blood mononuclear cells (PBMCs).
(439) In some embodiments, the PBMCs are added to the cell culture on any of days 9 through 17 in step (iii).
(440) In some embodiments, the effector T cells and/or central memory T cells in the larger population of TILs in step (iv) exhibit one or more characteristics selected from the group consisting of expression of CD27, expression of CD28, longer telomeres, increased CD57 expression, and decreased CD56 expression, relative to effector T cells, and/or central memory T cells in the third population of cells.
(441) In some embodiments, the effector T cells and/or central memory T cells exhibit increased CD57 expression and decreased CD56 expression.
(442) In some embodiments, the APCs are artificial APCs (aAPCs).
(443) In some embodiments, the method further comprises the step of transducing the first population of TILs with an expression vector comprising a nucleic acid encoding a high-affinity T cell receptor.
(444) In some embodiments, the step of transducing occurs before step (i).
(445) In some embodiments, the method further comprises the step of transducing the first population of TILs with an expression vector comprising a nucleic acid encoding a chimeric antigen receptor (CAR) comprising a single chain variable fragment antibody fused with at least one endodomain of a T-cell signaling molecule.
(446) In some embodiments, the step of transducing occurs before step (i).
(447) In some embodiments, the TILs are assayed for viability.
(448) In some embodiments, the TILs are assayed for viability after cryopreservation.
(449) In some embodiments, the TILs are assayed for viability after cryopreservation and after step (iv).
(450) The diverse antigen receptors of T and B lymphocytes are produced by somatic recombination of a limited, but large number of gene segments. These gene segments: V (variable), D (diversity), J (joining), and C (constant), determine the binding specificity and downstream applications of immunoglobulins and T-cell receptors (TCRs). The present invention provides a method for generating TILs which exhibit and increase the T-cell repertoire diversity (sometimes referred to as polyclonality). In some embodiments, the increase in T-cell repertoire diversity is as compared to freshly harvested TILs and/or TILs prepared using other methods than those provide herein including for example, methods other than those embodied in
(451) According to the present disclosure, a method for assaying TILs for viability and/or further use in administration to a subject. In some embodiments, the method for assay tumor infiltrating lymphocytes (TILs) comprises: (i) obtaining a first population of TILs; (ii) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs; and (iii) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the third population of TILs is at least 50-fold greater in number than the second population of TILs; (iv) harvesting, washing, and cryopreserving the third population of TILs; (v) storing the cryopreserved TILs at a cryogenic temperature; (vi) thawing the third population of TILs to provide a thawed third population of TILs; and (vii) performing an additional second expansion of a portion of the thawed third population of TILs by supplementing the cell culture medium of the third population with IL-2, OKT-3, and APCs for an additional expansion period (sometimes referred to as a reREP period) of at least 3 days, wherein the third expansion is performed to obtain a fourth population of TILs, wherein the number of TILs in the fourth population of TILs is compared to the number of TILs in the third population of TILs to obtain a ratio; (viii) determining based on the ratio in step (vii) whether the thawed population of TILs is suitable for administration to a patient; (ix) administering a therapeutically effective dosage of the thawed third population of TILs to the patient when the ratio of the number of TILs in the fourth population of TILs to the number of TILs in the third population of TILs is determined to be greater than 5:1 in step (viii).
(452) In some embodiments, the additional expansion period (sometimes referred to as a reREP period) is performed until the ratio of the number of TILs in the fourth population of TILs to the number of TILs in the third population of TILs is greater than 50:1.
(453) In some embodiments, the number of TILs sufficient for a therapeutically effective dosage is from about 2.3?10.sup.10 to about 13.7?10.sup.10.
(454) In some embodiments, steps (i) through (vii) are performed within a period of about 40 days to about 50 days. In some embodiments, steps (i) through (vii) are performed within a period of about 42 days to about 48 days. In some embodiments, steps (i) through (vii) are performed within a period of about 42 days to about 45 days. In some embodiments, steps (i) through (vii) are performed within about 44 days.
(455) In some embodiments, the cells from steps (iii) or (vii) express CD4, CD8, and TCR ? ? at levels similar to freshly harvested cells. In some embodiments the cells are TILs.
(456) In some embodiments, the antigen presenting cells are peripheral blood mononuclear cells (PBMCs). In some embodiments, the PBMCs are added to the cell culture on any of days 9 through 17 in step (iii).
(457) In some embodiments, the effector T cells and/or central memory T cells in the larger population of TILs in steps (iii) or (vii) exhibit one or more characteristics selected from the group consisting of expression of CD27, expression of CD28, longer telomeres, increased CD57 expression, and decreased CD56 expression, relative to effector T cells, and/or central memory T cells in the third population of cells.
(458) In some embodiments, the effector T cells and/or central memory T cells exhibit increased CD57 expression and decreased CD56 expression.
(459) In some embodiments, the APCs are artificial APCs (aAPCs).
(460) In some embodiments, the step of transducing the first population of TILs with an expression vector comprising a nucleic acid encoding a high-affinity T cell receptor.
(461) In some embodiments, the step of transducing occurs before step (i).
(462) In some embodiments, the step of transducing the first population of TILs with an expression vector comprising a nucleic acid encoding a chimeric antigen receptor (CAR) comprising a single chain variable fragment antibody fused with at least one endodomain of a T-cell signaling molecule.
(463) In some embodiments, the step of transducing occurs before step (i).
(464) In some embodiments, the TILs are assayed for viability after step (vii).
(465) The present disclosure also provides further methods for assaying TILs. In some embodiments, the disclosure provides a method for assaying TILs comprising: (i) obtaining a portion of a first population of cryopreserved TILs; (ii) thawing the portion of the first population of cryopreserved TILs; (iii) performing a first expansion by culturing the portion of the first population of TILs in a cell culture medium comprising IL-2, OKT-3, and antigen presenting cells (APCs) for an additional expansion period (sometimes referred to as a reREP period) of at least 3 days, to produce a second population of TILs, wherein the portion from the first population of TILs is compared to the second population of TILs to obtain a ratio of the number of TILs, wherein the ratio of the number of TILs in the second population of TILs to the number of TILs in the portion of the first population of TILs is greater than 5:1; (iv) determining based on the ratio in step (iii) whether the first population of TILs is suitable for use in therapeutic administration to a patient; (v) determining the first population of TILs is suitable for use in therapeutic administration when the ratio of the number of TILs in the second population of TILs to the number of TILs in the first population of TILs is determined to be greater than 5:1 in step (iv).
(466) In some embodiments, the ratio of the number of TILs in the second population of TILs to the number of TILs in the portion of the first population of TILs is greater than 50:1.
(467) In some embodiments, the method further comprises performing expansion of the entire first population of cryopreserved TILs from step (i) according to the methods as described in any of the embodiments provided herein.
(468) In some embodiments, the method further comprises administering the entire first population of cryopreserved TILs from step (i) to the patient.
(469) K. Closed Systems for TIL Manufacturing
(470) The present invention provides for the use of closed systems during the TIL culturing process. Such closed systems allow for preventing and/or reducing microbial contamination, allow for the use of fewer flasks, and allow for cost reductions. In some embodiments, the closed system uses two containers.
(471) Such closed systems are well-known in the art and can be found, for example, at http://www.fda.gov/cber/guidelines.htm and https://www.fda.gov/BiologicsBloodVaccines/GuidanceComplianceRegulatorylnformation/G uidances/Blood/ucm076779.htm.
(472) In some embodiments, the closed systems include luer lock and heat sealed systems as described in for example, Example 30. In some embodiments, the closed system is accessed via syringes under sterile conditions in order to maintain the sterility and closed nature of the system. In some embodiments, a closed system as described in Example 30 is employed. In some embodiments, the TILs are formulated into a final product formulation container according to the method described in Example 30, section 8.14 Final Formulation and Fill.
(473) As provided on the FDA website, closed systems with sterile methods are known and well described. See, https://www.fda.gov/BiologicsBloodVaccines/GuidanceComplianceRegulatorylnformation/G uidances/Blood/ucm076779.htm, as referenced above and provided in pertinent part below.
(474) Introduction
(475) Sterile connecting devices (STCDs) produce sterile welds between two pieces of compatible tubing. This procedure permits sterile connection of a variety of containers and tube diameters. This guidance describes recommended practices and procedures for use of these devices. This guidance does not address the data or information that a manufacturer of a sterile connecting device must submit to FDA in order to obtain approval or clearance for marketing. It is also important to note that the use of an approved or cleared sterile connecting device for purposes not authorized in the labeling may cause the device to be considered adulterated and misbranded under the Federal Food, Drug and Cosmetic Act.
(476) 1. FDA Recommendations
(477) Manufacturers of blood products who propose to routinely use an FDA-cleared STCD should incorporate information regarding such use in standard operating procedure (SOP) manuals for each blood product. These entries should include record keeping, product tracking, tube weld quality control, lot numbers of software and disposables (including source(s) of elements to be added). Quality control procedures should include a test of the integrity of each weld.
(478) 2. Applications of the STCD
(479) The user should be aware that use of the device may create a new product or significantly modify the configuration of a regulated product for which safety and efficacy have not been demonstrated. For those new products subject to licensure, applications, or application supplements must be submitted to FDA in addition to submission of a SOP. In general, pooling or mixing that involves cellular components represents a change in the product that requires submission and approval of a license application or application supplement. Such applications and application supplements should contain data and descriptions of manufacturing procedures that demonstrate that the new product is safe and effective for its intended use throughout the proposed dating period.
(480) The following comments are provided as guidance on the more common uses of an FDA cleared or approved STCD:
(481) L. Adding a New or Smaller Needle to a Blood Collection Set
(482) Using the STCD to add a needle prior to the initiation of a procedure (whole blood collection, plateletpheresis or source plasma collection) is not consideredto open a functionally closed system. If a needle is added during a procedure, only an STCD approved to weld liquid-filled tubing should be used. If the test of weld integrity is satisfactory, the use of an STCD is not considered to open a functionally closed system.
(483) Platelets, Pheresis prepared in an open system should be labeled with a 24 hour outdate and Platelets, Pheresis products prepared in a functionally closed system should be labeled with a five day outdate (See Revised Guideline for Collection of Platelets, Pheresis, Oct. 7, 1988).
(484) The source and specifications of added tubing and needles should be addressed in the blood center's SOP and records. Using the STCD to add needles does not represent a major change in manufacturing for which licensed establishments need preapproval.
(485) M. Using the STCD to Prepare Components
(486) When the STCD is used to attach additional component preparation bags, records should be properly maintained identifying the source of the transfer packs and the appropriate verification of blood unit number and ABO/Rh. All blood and blood components must be appropriately labeled (21 CFR 606.121).
EXAMPLES
(487) Adding a fourth bag to a whole blood collection triple-pack for the production of Cryoprecipitated AHF from Fresh Frozen Plasma. Connection of an additive solution to a red blood cell unit. Addition of an in-line filter that has been FDA cleared for use in manufacturing components. Addition of a third storage container to a plateletpheresis harness. For the above stated uses, procedures should be developed and records maintained, but licensees need not have FDA approval in order to institute the procedures.
(488) 1. Using the STCD to Pool Blood Products
(489) Appropriate use of an STCD to pool Platelets prepared from Whole Blood collection may obviate potential contamination from the spike and port entries commonly used. Pooling performed immediately before transfusion is an example of such appropriate use. Pooled Platelets should be administered not more than 4 hours after pooling (See 21 CFR 606.122(1)(2)).
(490) However, pooling and subsequent storage may increase the risk compared to administration of random donor units; if one contaminated unit is pooled with others and stored before administration, the total bacterial inoculum administered may be increased as a result of replication in the additional volume. Accordingly, the proposed use of an STCD to pool and store platelets for more than 4 hours should be supported by data which satisfactorily addresses whether such pooling is associated with increased risk.
(491) Such platelet pooling constitutes manufacture of a new product.
(492) Pooling or mixing that involves platelets is considered the manufacture of a new product that requires submission and approval of a license application or application supplement if the storage period is to exceed four hours.
(493) 2. Using the STCD to Prepare an Aliquot for Pediatric Use and Divided Units
(494) Pediatric units and divided units for Whole Blood, Red Blood Cells, and Fresh Frozen Plasma prepared using an STCD will not be considered a new product for which a biologics license application (BLA) supplement is required providing the following conditions are met: The manufacturer should have an approved biologics license or license supplement, for the original (i.e., undivided) product, including approval for each anticoagulant used. Labels should be submitted for review and approval before distribution. A notation should be made under the comments section of FDA Form 2567, Transmittal of Labels and Circulars. Final product containers approved for storage of the component being prepared should be used.
(495) Platelets manufactured under licensure must contain at least 5.5?(10).sup.10 platelets (21 CFR 640.24 (c)). Platelets, Pheresis manufactured under licensure should contain at least 3.0?(10).sup.11 platelets (See Revised Guideline for the Collection of Platelets, Pheresis, Oct. 7, 1988).
(496) Procedures to be followed regarding the use of an STCD to prepare divided products from Whole Blood collections and from plasma and platelets prepared by automated hemapheresis procedures should include descriptions of: How the apheresis harness or collection container will be modified with an FDA-cleared STCD; the minimum volume of the split plasma or whole blood products; the volume and platelet concentration of the split plateletpheresis products; storage time of the product. The product should be in an approved container and should be consistent with the storage time on the label of such container; method(s) to be used to label and track divided products in the blood center's records.
(497) NOTE: Procedures for labeling the aliquots should be clearly stated in the procedure record keeping should be adequate to permit tracking and recall of all components, if necessary.
(498) 3. Using an STCD to Connect Additional Saline or Anticoagulant Lines During an Automated Plasmapheresis Procedure
(499) Procedures should be developed and records maintained consistent with the instrument manufacturer's directions for use, but licensees need not have FDA approval in order to institute the procedures.
(500) 4. Using the STCD to Attach Processing Solutions
(501) When using an STCD to attach containers with processing solutions to washed or frozen red blood cell products, the dating period for the resulting products is 24 hours, unless data are provided in the form of license applications or application supplements to CBER to support a longer dating period (21 CFR 610.53(c)). Exemptions or modifications must be approved in writing from the Director, CBER (21 CFR 610.53(d)).
(502) 5. Using an STCD to Add an FDA-Cleared Leukocyte Reduction Filter
(503) Some leuko-reduction filters are not integrally attached to the Whole Blood collection systems. Procedures for use of an STCD for pre-storage filtration should be consistent with filter manufacturers' directions for use.
(504) Leukocyte reduction prior to issue constitutes a major manufacturing change. Therefore, for new leukocyte-reduced products prepared using an STCD, manufacturers must submit biologics license applications (21 CFR 601.2) or prior approval application supplements to FDA (21 CFR 601.12).
(505) Using an STCD to remove samples from blood product containers for testing (e.g., using an STCD to obtain a sample of platelets from a container of Platelets or Platelets, Pheresis for cross matching).
(506) If the volume and/or cell count of the product after sample withdrawal differ from what is stated on the original label or in the circular of information, the label on the product should be modified to reflect the new volume and/or cell count. For example, samples may not be removed that reduce the platelet count of a unit of Platelets to less than 5.5?(10).sup.10 platelets (21 CFR 640.24 (c)).
(507) 6. Additional Information from FDA Guidance
(508) The FDA guidance presents general guidance as well as specific information and examples concerning specifications for submission of applications and application supplements to FDA addressing use of an STCD. If further questions arise concerning appropriate use of an STCD, concerns should be directed to the Office of Blood Research and Review, Center for Biologics Evaluation and Research.
(509) In some embodiments, the closed system uses one container from the time the tumor fragments are obtained until the TILs are ready for administration to the patient or cryopreserving. In some embodiments when two containers are used, the first container is a closed G-container and the population of TILs is centrifuged and transferred to an infusion bag without opening the first closed G-container. In some embodiments, when two containers are used, the infusion bag is a HypoThermosol-containing infusion bag. A closed system or closed TIL cell culture system is characterized in that once the tumor sample and/or tumor fragments have been added, the system is tightly sealed from the outside to form a closed environment free from the invasion of bacteria, fungi, and/or any other microbial contamination.
(510) In some embodiments, the reduction in microbial contamination is between about 5% and about 100%. In some embodiments, the reduction in microbial contamination is between about 5% and about 95%. In some embodiments, the reduction in microbial contamination is between about 5% and about 90%. In some embodiments, the reduction in microbial contamination is between about 10% and about 90%. In some embodiments, the reduction in microbial contamination is between about 15% and about 85%. In some embodiments, the reduction in microbial contamination is about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95%, about 97%, about 98%, about 99%, or about 100%.
(511) The closed system allows for TIL growth in the absence and/or with a significant reduction in microbial contamination.
(512) Moreover, pH, carbon dioxide partial pressure and oxygen partial pressure of the TIL cell culture environment each vary as the cells are cultured. Consequently, even though a medium appropriate for cell culture is circulated, the closed environment still needs to be constantly maintained as an optimal environment for TIL proliferation. To this end, it is desirable that the physical factors of pH, carbon dioxide partial pressure and oxygen partial pressure within the culture liquid of the closed environment be monitored by means of a sensor, the signal whereof is used to control a gas exchanger installed at the inlet of the culture environment, and the that gas partial pressure of the closed environment be adjusted in real time according to changes in the culture liquid so as to optimize the cell culture environment. In some embodiments, the present invention provides a closed cell culture system which incorporates at the inlet to the closed environment a gas exchanger equipped with a monitoring device which measures the pH, carbon dioxide partial pressure and oxygen partial pressure of the closed environment, and optimizes the cell culture environment by automatically adjusting gas concentrations based on signals from the monitoring device.
(513) In some embodiments, the pressure within the closed environment is continuously or intermittently controlled. That is, the pressure in the closed environment can be varied by means of a pressure maintenance device for example, thus ensuring that the space is suitable for growth of TILs in a positive pressure state, or promoting exudation of fluid in a negative pressure state and thus promoting cell proliferation. By applying negative pressure intermittently, moreover, it is possible to uniformly and efficiently replace the circulating liquid in the closed environment by means of a temporary shrinkage in the volume of the closed environment.
(514) In some embodiments, optimal culture components for proliferation of the TILs can be substituted or added, and including factors such as IL-2 and/or OKT3, as well as combination, can be added.
(515) C. Cell Cultures
(516) In an embodiment, a method for expanding TILs, including those discuss above as well as exemplified in
(517) In an embodiment, the cell medium in the first and/or second gas permeable container is unfiltered. The use of unfiltered cell medium may simplify the procedures necessary to expand the number of cells. In an embodiment, the cell medium in the first and/or second gas permeable container lacks beta-mercaptoethanol (BME).
(518) In an embodiment, the duration of the method comprising obtaining a tumor tissue sample from the mammal; culturing the tumor tissue sample in a first gas permeable container containing cell medium therein; obtaining TILs from the tumor tissue sample; expanding the number of TILs in a second gas permeable container containing cell medium for a duration of about 7 to 14 days, e.g., about 11 days. In some embodiments pre-REP is about 7 to 14 days, e.g., about 11 days. In some embodiments, REP is about 7 to 14 days, e.g., about 11 days.
(519) In an embodiment, TILs are expanded in gas-permeable containers. Gas-permeable containers have been used to expand TILs using PBMCs using methods, compositions, and devices known in the art, including those described in U.S. Patent Application Publication No. 2005/0106717 A1, the disclosures of which are incorporated herein by reference. In an embodiment, TILs are expanded in gas-permeable bags. In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the Xuri Cell Expansion System W25 (GE Healthcare). In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the WAVE Bioreactor System, also known as the Xuri Cell Expansion System W5 (GE Healthcare). In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume selected from the group consisting of about 100 mL, about 200 mL, about 300 mL, about 400 mL, about 500 mL, about 600 mL, about 700 mL, about 800 mL, about 900 mL, about 1 L, about 2 L, about 3 L, about 4 L, about 5 L, about 6 L, about 7 L, about 8 L, about 9 L, and about 10 L.
(520) In an embodiment, TILs can be expanded in G-Rex flasks (commercially available from Wilson Wolf Manufacturing). Such embodiments allow for cell populations to expand from about 5?10.sup.5 cells/cm.sup.2 to between 10?10.sup.6 and 30?10.sup.6 cells/cm.sup.2. In an embodiment this is without feeding. In an embodiment, this is without feeding so long as medium resides at a height of about 10 cm in the G-Rex flask. In an embodiment this is without feeding but with the addition of one or more cytokines. In an embodiment, the cytokine can be added as a bolus without any need to mix the cytokine with the medium. Such containers, devices, and methods are known in the art and have been used to expand TILs, and include those described in U.S. Patent Application Publication No. US 2014/0377739A1, International Publication No. WO 2014/210036 A1, U.S. Patent Application Publication No. us 2013/0115617 A1, International Publication No. WO 2013/188427 A1, U.S. Patent Application Publication No. US 2011/0136228 A1, U.S. Pat. No. 8,809,050 B2, International publication No. WO 2011/072088 A2, U.S. Patent Application Publication No. US 2016/0208216 A1, U.S. Patent Application Publication No. US 2012/0244133 A1, International Publication No. WO 2012/129201 A1, U.S. Patent Application Publication No. US 2013/0102075 A1, U.S. Pat. No. 8,956,860 B2, International Publication No. WO 2013/173835 A1, U.S. Patent Application Publication No. US 2015/0175966 A1, the disclosures of which are incorporated herein by reference. Such processes are also described in Jin et al., J. Immunotherapy, 2012, 35:283-292.
(521) D. Optional Genetic Engineering of TILs
(522) In some embodiments, the TILs are optionally genetically engineered to include additional functionalities, including, but not limited to, a high-affinity T cell receptor (TCR), e.g., a TCR targeted at a tumor-associated antigen such as MAGE-1, HER2, or NY-ESO-1, or a chimeric antigen receptor (CAR) which binds to a tumor-associated cell surface molecule (e.g., mesothelin) or lineage-restricted cell surface molecule (e.g., CD19).
(523) E. Optional Cryopreservation of TILs
(524) Either the bulk TIL population or the expanded population of TILs can be optionally cryopreserved. In some embodiments, cryopreservation occurs on the therapeutic TIL population. In some embodiments, cryopreservation occurs on the TILs harvested after the second expansion. In some embodiments, cryopreservation occurs on the TILs in exemplary Step F of
(525) When appropriate, the cells are removed from the freezer and thawed in a 37? C. water bath until approximately ? of the solution is thawed. The cells are generally resuspended in complete media and optionally washed one or more times. In some embodiments, the thawed TILs can be counted and assessed for viability as is known in the art.
(526) In a preferred embodiment, a population of TILs is cryopreserved using CS10 cryopreservation media (CryoStor 10, BioLife Solutions). In a preferred embodiment, a population of TILs is cryopreserved using a cryopreservation media containing dimethylsulfoxide (DMSO). In a preferred embodiment, a population of TILs is cryopreserved using a 1:1 (vol:vol) ratio of CS10 and cell culture media. In a preferred embodiment, a population of TILs is cryopreserved using about a 1:1 (vol:vol) ratio of CS10 and cell culture media, further comprising additional IL-2.
(527) As discussed above in Steps A through E, cryopreservation can occur at numerous points throughout the TIL expansion process. In some embodiments, the bulk TIL population after the first expansion according to Step B or the expanded population of TILs after the one or more second expansions according to Step D can be cryopreserved. Cryopreservation can be generally accomplished by placing the TIL population into a freezing solution, e.g., 85% complement inactivated AB serum and 15% dimethyl sulfoxide (DMSO). The cells in solution are placed into cryogenic vials and stored for 24 hours at ?80? C., with optional transfer to gaseous nitrogen freezers for cryopreservation. See Sadeghi, et al., Acta Oncologica 2013, 52, 978-986.
(528) When appropriate, the cells are removed from the freezer and thawed in a 37? C. water bath until approximately ? of the solution is thawed. The cells are generally resuspended in complete media and optionally washed one or more times. In some embodiments, the thawed TILs can be counted and assessed for viability as is known in the art.
(529) In some cases, the Step B TIL population can be cryopreserved immediately, using the protocols discussed below. Alternatively, the bulk TIL population can be subjected to Step C and Step D and then cryopreserved after Step D. Similarly, in the case where genetically modified TILs will be used in therapy, the Step B or Step D TIL populations can be subjected to genetic modifications for suitable treatments.
(530) F. Optional Cell Viability Analyses
(531) Optionally, a cell viability assay can be performed after the first expansion (sometimes referred to as the initial bulk expansion), using standard assays known in the art. For example, a trypan blue exclusion assay can be done on a sample of the bulk TILs, which selectively labels dead cells and allows a viability assessment. Other assays for use in testing viability can include but are not limited to the Alamar blue assay; and the MTT assay.
(532) 1. Cell Counts, Viability, Flow Cytometry
(533) In some embodiments, cell counts and/or viability are measured. The expression of markers such as but not limited CD3, CD4, CD8, and CD56, as well as any other disclosed or described herein, can be measured by flow cytometry with antibodies, for example but not limited to those commercially available from BD Bio-sciences (BD Biosciences, San Jose, CA) using a FACSCanto? flow cytometer (BD Biosciences). The cells can be counted manually using a disposable c-chip hemocytometer (VWR, Batavia, IL) and viability can be assessed using any method known in the art, including but not limited to trypan blue staining.
(534) In some cases, the bulk TIL population can be cryopreserved immediately, using the protocols discussed below. Alternatively, the bulk TIL population can be subjected to REP and then cryopreserved as discussed below. Similarly, in the case where genetically modified TILs will be used in therapy, the bulk or REP TIL populations can be subjected to genetic modifications for suitable treatments.
(535) 2. Cell Cultures
(536) In an embodiment, a method for expanding TILs may include using about 5,000 mL to about 25,000 mL of cell medium, about 5,000 mL to about 10,000 mL of cell medium, or about 5,800 mL to about 8,700 mL of cell medium. In an embodiment, expanding the number of TILs uses no more than one type of cell culture medium. Any suitable cell culture medium may be used, e.g., AIM-V cell medium (L-glutamine, 50 ?M streptomycin sulfate, and 10 ?M gentamicin sulfate) cell culture medium (Invitrogen, Carlsbad CA). In this regard, the inventive methods advantageously reduce the amount of medium and the number of types of medium required to expand the number of TIL. In an embodiment, expanding the number of TIL may comprise feeding the cells no more frequently than every third or fourth day. Expanding the number of cells in a gas permeable container simplifies the procedures necessary to expand the number of cells by reducing the feeding frequency necessary to expand the cells.
(537) In an embodiment, the cell medium in the first and/or second gas permeable container is unfiltered. The use of unfiltered cell medium may simplify the procedures necessary to expand the number of cells. In an embodiment, the cell medium in the first and/or second gas permeable container lacks beta-mercaptoethanol (BME).
(538) In an embodiment, the duration of the method comprising obtaining a tumor tissue sample from the mammal; culturing the tumor tissue sample in a first gas permeable container containing cell medium therein; obtaining TILs from the tumor tissue sample; expanding the number of TILs in a second gas permeable container containing cell medium therein using aAPCs for a duration of about 14 to about 42 days, e.g., about 28 days.
(539) In an embodiment, TILs are expanded in gas-permeable containers. Gas-permeable containers have been used to expand TILs using PBMCs using methods, compositions, and devices known in the art, including those described in U.S. Patent Application Publication No. 2005/0106717 A1, the disclosures of which are incorporated herein by reference. In an embodiment, TILs are expanded in gas-permeable bags. In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the Xuri Cell Expansion System W25 (GE Healthcare). In an embodiment, TILs are expanded using a cell expansion system that expands TILs in gas permeable bags, such as the WAVE Bioreactor System, also known as the Xuri Cell Expansion System W5 (GE Healthcare). In an embodiment, the cell expansion system includes a gas permeable cell bag with a volume selected from the group consisting of about 100 mL, about 200 mL, about 300 mL, about 400 mL, about 500 mL, about 600 mL, about 700 mL, about 800 mL, about 900 mL, about 1 L, about 2 L, about 3 L, about 4 L, about 5 L, about 6 L, about 7 L, about 8 L, about 9 L, and about 10 L.
(540) In an embodiment, TILs can be expanded in G-Rex flasks (commercially available from Wilson Wolf Manufacturing). Such embodiments allow for cell populations to expand from about 5?10.sup.5 cells/cm.sup.2 to between 10?10.sup.6 and 30?10.sup.6 cells/cm.sup.2. In an embodiment this is without feeding. In an embodiment, this is without feeding so long as medium resides at a height of about 10 cm in the G-Rex flask. In an embodiment this is without feeding but with the addition of one or more cytokines. In an embodiment, the cytokine can be added as a bolus without any need to mix the cytokine with the medium. Such containers, devices, and methods are known in the art and have been used to expand TILs, and include those described in U.S. Patent Application Publication No. US 2014/0377739A1, International Publication No. WO 2014/210036 A1, U.S. Patent Application Publication No. us 2013/0115617 A1, International Publication No. WO 2013/188427 A1, U.S. Patent Application Publication No. US 2011/0136228 A1, U.S. Pat. No. 8,809,050 B2, International publication No. WO 2011/072088 A2, U.S. Patent Application Publication No. US 2016/0208216 A1, U.S. Patent Application Publication No. US 2012/0244133 A1, International Publication No. WO 2012/129201 A1, U.S. Patent Application Publication No. US 2013/0102075 A1, U.S. Pat. No. 8,956,860 B2, International Publication No. WO 2013/173835 A1, U.S. Patent Application Publication No. US 2015/0175966 A1, the disclosures of which are incorporated herein by reference. Such processes are also described in Jin et al., J. Immunotherapy, 2012, 35:283-292. Optional Genetic Engineering of TILs
(541) In some embodiments, the TILs are optionally genetically engineered to include additional functionalities, including, but not limited to, a high-affinity T cell receptor (TCR), e.g., a TCR targeted at a tumor-associated antigen such as MAGE-1, HER2, or NY-ESO-1, or a chimeric antigen receptor (CAR) which binds to a tumor-associated cell surface molecule (e.g., mesothelin) or lineage-restricted cell surface molecule (e.g., CD19).
IV. Methods of Treating Patients
(542) Methods of treatment begin with the initial TIL collection and culture of TILs. Such methods have been both described in the art by, for example, Jin et al., J Immunotherapy, 2012, 35(3):283-292, incorporated by reference herein in its entirety. Embodiments of methods of treatment are described throughout the sections below, including the Examples.
(543) The expanded TILs produced according the methods described herein, including for example as described in Steps A through F above or according to Steps A through F above (also as shown, for example, in
(544) In some embodiments, successfully grown TIL can be sampled for phenotype analysis (CD3, CD4, CD8, and CD56) and tested against autologous tumor when available. TIL can be considered reactive if overnight coculture yielded interferon-gamma (IFN-?) levels >200 pg/mL and twice background. (Goff, et al., J Immunother., 2010, 33:840-847; incorporated by reference herein in its entirety). In some embodiments, cultures with evidence of autologous reactivity or sufficient growth patterns can be selected for a second expansion (for example, a second expansion as provided in according to Step D of
(545) In some embodiments, the patient is not moved directly to ACT (adoptive cell transfer), for example, in some embodiments, after tumor harvesting and/or a first expansion, the cells are not utilized immediately. In such embodiments, TILs can be cryopreserved and thawed 2 days before administration to a patient. In such embodiments, TILs can be cryopreserved and thawed 1 day before administration to a patient. In some embodiments, the TILs can be cryopreserved and thawed immediately before the administration to a patient.
(546) Cell phenotypes of cryopreserved samples of infusion bag TIL can be analyzed by flow cytometry (e.g., FlowJo) for surface markers CD3, CD4, CD8, CCR7, and CD45RA (BD BioSciences), as well as by any of the methods described herein. Serum cytokines were measured by using standard enzyme-linked immunosorbent assay techniques. A rise in serum IFN-g was defined as >100 pg/mL and greater than 4 3 baseline levels.
(547) In some embodiments, the TILs produced by the methods provided herein, for example those exemplified in
(548) In some embodiments, IFN-gamma (IFN-?) is indicative of treatment efficacy and/or increased clinical efficacy. In some embodiments, IFN-? in the blood of subjects treated with TILs is indicative of active TILs. In some embodiments, a potency assay for IFN-? production is employed. IFN-? production is another measure of cytotoxic potential. IFN-? production can be measured by determining the levels of the cytokine IFN-? in the blood, serum, or TILs ex vivo of a subject treated with TILs prepared by the methods of the present invention, including those as described for example in
(549) In some embodiments, higher average IP-10 is indicative of treatment efficacy and/or increased clinical efficacy. In some embodiments, higher average IP-10 in the blood of subjects treated with TILs is indicative of active TILs. IP-10 production can be measured by determining the levels of the IP-10 in the blood of a subject treated with TILs prepared by the methods of the present invention, including those as described for example in
(550) In some embodiments, higher average MCP-1 is indicative of treatment efficacy and/or increased clinical efficacy. In some embodiments, higher average MCP-1 in the blood of subjects treated with TILs is indicative of active TILs. MCP-1 production can be measured by determining the levels of the MCP-1 in the blood of a subject treated with TILs prepared by the methods of the present invention, including those as described for example in
(551) In some embodiments, the TILs prepared by the methods of the present invention, including those as described for example in
(552) Measures of efficacy can include The disease control rate (DCR) measurements as well as overall response rate (ORR), as known in the art as well as described in the Examples provided herein, including Example 28.
(553) 1. Methods of Treating Cancers and Other Diseases
(554) The compositions and methods described herein can be used in a method for treating diseases. In an embodiment, they are for use in treating hyperproliferative disorders. They may also be used in treating other disorders as described herein and in the following paragraphs.
(555) In some embodiments, the hyperproliferative disorder is cancer. In some embodiments, the hyperproliferative disorder is a solid tumor cancer. In some embodiments, the solid tumor cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma. In some embodiments, the hyperproliferative disorder is a hematological malignancy. In some embodiments, the solid tumor cancer is selected from the group consisting of chronic lymphocytic leukemia, acute lymphoblastic leukemia, diffuse large B cell lymphoma, non-Hodgkin's lymphoma, Hodgkin's lymphoma, follicular lymphoma, and mantle cell lymphoma.
(556) In an embodiment, the invention includes a method of treating a cancer with a population of TILs, wherein a patient is pre-treated with non-myeloablative chemotherapy prior to an infusion of TILs according to the present disclosure. In an embodiment, the non-myeloablative chemotherapy is cyclophosphamide 60 mg/kg/d for 2 days (days 27 and 26 prior to TIL infusion) and fludarabine 25 mg/m.sup.2/d for 5 days (days 27 to 23 prior to TIL infusion). In an embodiment, after non-myeloablative chemotherapy and TIL infusion (at day 0) according to the present disclosure, the patient receives an intravenous infusion of IL-2 intravenously at 720,000 IU/kg every 8 hours to physiologic tolerance.
(557) Efficacy of the compounds and combinations of compounds described herein in treating, preventing and/or managing the indicated diseases or disorders can be tested using various models known in the art, which provide guidance for treatment of human disease. For example, models for determining efficacy of treatments for ovarian cancer are described, e.g., in Mullany, et al., Endocrinology 2012, 153, 1585-92; and Fong, et al., J. Ovarian Res. 2009, 2, 12. Models for determining efficacy of treatments for pancreatic cancer are described in Herreros-Villanueva, et al., World J Gastroenterol. 2012, 18, 1286-1294. Models for determining efficacy of treatments for breast cancer are described, e.g., in Fantozzi, Breast Cancer Res. 2006, 8, 212. Models for determining efficacy of treatments for melanoma are described, e.g., in Damsky, et al., Pigment Cell & Melanoma Res. 2010, 23, 853-859. Models for determining efficacy of treatments for lung cancer are described, e.g., in Meuwissen, et al., Genes & Development, 2005, 19, 643-664. Models for determining efficacy of treatments for lung cancer are described, e.g., in Kim, Clin. Exp. Otorhinolaryngol. 2009, 2, 55-60; and Sano, Head Neck Oncol. 2009, 1, 32.
(558) In some embodiments, IFN-gamma (IFN-?) is indicative of treatment efficacy for hyperproliferative disorder treatment. In some embodiments, IFN-? in the blood of subjects treated with TILs is indicative of active TILs. In some embodiments, a potency assay for IFN-? production is employed. IFN-? production is another measure of cytotoxic potential. IFN-? production can be measured by determining the levels of the cytokine IFN-? in the blood of a subject treated with TILs prepared by the methods of the present invention, including those as described for example in
(559) In some embodiments, higher average IP-10 is indicative of treatment efficacy and/or increased clinical efficacy for hyperproliferative disorder treatment. In some embodiments, higher average IP-10 in the blood of subjects treated with TILs is indicative of active TILs. In some embodiments, the TILs obtained by the present method provide for higher average IP-10 in the blood of subjects treated with the TILs of the present method as compared subjects treated with TILs prepared using methods referred to as process 1C, as exemplified in
(560) In some embodiments, higher average MCP-1 is indicative of treatment efficacy and/or increased clinical efficacy for hyperproliferative disorder treatment. In some embodiments, higher average MCP-1 in the blood of subjects treated with TILs is indicative of active TILs. In some embodiments, the TILs obtained by the present method provide for higher average MCP-1 in the blood of subjects treated with the TILs of the present method as compared subjects treated with TILs prepared using methods referred to as process 1C, as exemplified in
(561) In some embodiments, the TILs prepared by the methods of the present invention, including those as described for example in
(562) 2. Methods of Co-Administration
(563) In some embodiments, the TILs produced as described herein, including for example TILs derived from a method described in Steps A through F of
(564) 3. Optional Lymphodepletion Preconditioning of Patients
(565) In an embodiment, the invention includes a method of treating a cancer with a population of TILs, wherein a patient is pre-treated with non-myeloablative chemotherapy prior to an infusion of TILs according to the present disclosure. In an embodiment, the invention includes a population of TILs for use in the treatment of cancer in a patient which has been pre-treated with non-myeloablative chemotherapy. In an embodiment, the population of TILs is for administration by infusion. In an embodiment, the non-myeloablative chemotherapy is cyclophosphamide 60 mg/kg/d for 2 days (days 27 and 26 prior to TIL infusion) and fludarabine 25 mg/m.sup.2/d for 5 days (days 27 to 23 prior to TIL infusion). In an embodiment, after non-myeloablative chemotherapy and TIL infusion (at day 0) according to the present disclosure, the patient receives an intravenous infusion of IL-2 (aldesleukin, commercially available as PROLEUKIN) intravenously at 720,000 IU/kg every 8 hours to physiologic tolerance. In certain embodiments, the population of TILs is for use in treating cancer in combination with IL-2, wherein the IL-2 is administered after the population of TILs.
(566) Experimental findings indicate that lymphodepletion prior to adoptive transfer of tumor-specific T lymphocytes plays a key role in enhancing treatment efficacy by eliminating regulatory T cells and competing elements of the immune system (cytokine sinks). Accordingly, some embodiments of the invention utilize a lymphodepletion step (sometimes also referred to as immunosuppressive conditioning) on the patient prior to the introduction of the TILs of the invention.
(567) In general, lymphodepletion is achieved using administration of fludarabine or cyclophosphamide (the active form being referred to as mafosfamide) and combinations thereof. Such methods are described in Gassner, et al., Cancer Immunol. Immunother. 2011, 60, 75-85, Muranski, et al., Nat. Clin. Pract. Oncol., 2006, 3, 668-681, Dudley, et al., J Clin. Oncol. 2008, 26, 5233-5239, and Dudley, et al., J Clin. Oncol. 2005, 23, 2346-2357, all of which are incorporated by reference herein in their entireties.
(568) In some embodiments, the fludarabine is administered at a concentration of 0.5 ?g/mL-10 ?g/mL fludarabine. In some embodiments, the fludarabine is administered at a concentration of 1 ?g/mL fludarabine. In some embodiments, the fludarabine treatment is administered for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days or more. In some embodiments, the fludarabine is administered at a dosage of 10 mg/kg/day, 15 mg/kg/day, 20 mg/kg/day, 25 mg/kg/day, 30 mg/kg/day, 35 mg/kg/day, 40 mg/kg/day, or 45 mg/kg/day. In some embodiments, the fludarabine treatment is administered for 2-7 days at 35 mg/kg/day. In some embodiments, the fludarabine treatment is administered for 4-5 days at 35 mg/kg/day. In some embodiments, the fludarabine treatment is administered for 4-5 days at 25 mg/kg/day.
(569) In some embodiments, the mafosfamide, the active form of cyclophosphamide, is obtained at a concentration of 0.5 ?g/mL-10 ?g/mL by administration of cyclophosphamide. In some embodiments, mafosfamide, the active form of cyclophosphamide, is obtained at a concentration of 1 ?g/mL by administration of cyclophosphamide. In some embodiments, the cyclophosphamide treatment is administered for 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, or 7 days or more. In some embodiments, the cyclophosphamide is administered at a dosage of 100 mg/m.sup.2/day, 150 mg/m.sup.2/day, 175 mg/m.sup.2/day, 200 mg/m.sup.2/day, 225 mg/m.sup.2/day, 250 mg/m.sup.2/day, 275 mg/m.sup.2/day, or 300 mg/m.sup.2/day. In some embodiments, the cyclophosphamide is administered intravenously (i.e., i.v.) In some embodiments, the cyclophosphamide treatment is administered for 2-7 days at 35 mg/kg/day. In some embodiments, the cyclophosphamide treatment is administered for 4-5 days at 250 mg/m.sup.2/day i.v. In some embodiments, the cyclophosphamide treatment is administered for 4 days at 250 mg/m.sup.2/day i.v.
(570) In some embodiments, lymphodepletion is performed by administering the fludarabine and the cyclophosphamide together to a patient. In some embodiments, fludarabine is administered at 25 mg/m.sup.2/day i.v. and cyclophosphamide is administered at 250 mg/m.sup.2/day i.v. over 4 days.
(571) In an embodiment, the lymphodepletion is performed by administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days.
(572) 4. IL-2 Regimens
(573) In an embodiment, the IL-2 regimen comprises a high-dose IL-2 regimen, wherein the high-dose IL-2 regimen comprises aldesleukin, or a biosimilar or variant thereof, administered intravenously starting on the day after administering a therapeutically effective portion of the therapeutic population of TILs, wherein the aldesleukin or a biosimilar or variant thereof is administered at a dose of 0.037 mg/kg or 0.044 mg/kg IU/kg (patient body mass) using 15-minute bolus intravenous infusions every eight hours until tolerance, for a maximum of 14 doses. Following 9 days of rest, this schedule may be repeated for another 14 doses, for a maximum of 28 doses in total.
(574) In an embodiment, the IL-2 regimen comprises a decrescendo IL-2 regimen. Decrescendo IL-2 regimens have been described in O'Day, et al., J. Clin. Oncol. 1999, 17, 2752-61 and Eton, et al., Cancer 2000, 88, 1703-9, the disclosures of which are incorporated herein by reference. In an embodiment, a decrescendo IL-2 regimen comprises 18?10.sup.6 IU/m.sup.2 administered intravenously over 6 hours, followed by 18?10.sup.6 IU/m.sup.2 administered intravenously over 12 hours, followed by 18?10.sup.6 IU/m.sup.2 administered intravenously over 24 hrs, followed by 4.5?10.sup.6 IU/m.sup.2 administered intravenously over 72 hours. This treatment cycle may be repeated every 28 days for a maximum of four cycles. In an embodiment, a decrescendo IL-2 regimen comprises 18,000,000 IU/m.sup.2 on day 1, 9,000,000 IU/m.sup.2 on day 2, and 4,500,000 IU/m.sup.2 on days 3 and 4.
(575) In an embodiment, the IL-2 regimen comprises administration of pegylated IL-2 every 1, 2, 4, 6, 7, 14 or 21 days at a dose of 0.10 mg/day to 50 mg/day.
(576) 5. Adoptive Cell Transfer
(577) Adoptive cell transfer (ACT) is a very effective form of immunotherapy and involves the transfer of immune cells with antitumor activity into cancer patients. ACT is a treatment approach that involves the identification, in vitro, of lymphocytes with antitumor activity, the in vitro expansion of these cells to large numbers and their infusion into the cancer-bearing host. Lymphocytes used for adoptive transfer can be derived from the stroma of resected tumors (tumor infiltrating lymphocytes or TILs). TILs for ACT can be prepared as described herein. In some embodiments, the TILs are prepared, for example, according to a method as described in
6. Exemplary Treatment Embodiments
(578) In some embodiments, the present disclosure provides a method of treating a cancer with a population of tumor infiltrating lymphocytes (TILs) comprising the steps of (a) obtaining a first population of TILs from a tumor resected from a patient; (b) performing an initial expansion of the first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein the second population of TILs is at least 5-fold greater in number than the first population of TILs, and wherein the first cell culture medium comprises IL-2; (c) performing a rapid expansion of the second population of TILs using a population of myeloid artificial antigen presenting cells (myeloid aAPCs) in a second cell culture medium to obtain a third population of TILs, wherein the third population of TILs is at least 50-fold greater in number than the second population of TILs after 7 days from the start of the rapid expansion; and wherein the second cell culture medium comprises IL-2 and OKT-3; (d) administering a therapeutically effective portion of the third population of TILs to a patient with the cancer. In some embodiments, the present disclosure a population of tumor infiltrating lymphocytes (TILs) for use in treating cancer, wherein the population of TILs are obtainable by a method comprising the steps of (b) performing an initial expansion of a first population of TILs obtained from a tumor resected from a patient in a first cell culture medium to obtain a second population of TILs, wherein the second population of TILs is at least 5-fold greater in number than the first population of TILs, and wherein the first cell culture medium comprises IL-2; (c) performing a rapid expansion of the second population of TILs using a population of myeloid artificial antigen presenting cells (myeloid aAPCs) in a second cell culture medium to obtain a third population of TILs, wherein the third population of TILs is at least 50-fold greater in number than the second population of TILs after 7 days from the start of the rapid expansion; and wherein the second cell culture medium comprises IL-2 and OKT-3; (d) administering a therapeutically effective portion of the third population of TILs to a patient with the cancer. In some embodiments, the method comprises a first step (a) of obtaining the first population of TILs from a tumor resected from a patient. In some embodiments, the IL-2 is present at an initial concentration of about 3000 IU/mL and OKT-3 antibody is present at an initial concentration of about 30 ng/mL in the second cell culture medium. In some embodiments, first expansion is performed over a period not greater than 14 days. In some embodiments, the first expansion is performed using a gas permeable container. In some embodiments, the second expansion is performed using a gas permeable container. In some embodiments, the ratio of the second population of TILs to the population of aAPCs in the rapid expansion is between 1 to 80 and 1 to 400. In some embodiments, the ratio of the second population of TILs to the population of aAPCs in the rapid expansion is about 1 to 300. In some embodiments, the cancer for treatment is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma. In some embodiments, the cancer for treatment is selected from the group consisting of melanoma, ovarian cancer, and cervical cancer. In some embodiments, the cancer for treatment is melanoma. In some embodiments, the cancer for treatment is ovarian cancer. In some embodiments, the cancer for treatment is cervical cancer. In some embodiments, the method of treating cancer further comprises the step of treating the patient with a non-myeloablative lymphodepletion regimen prior to administering the third population of TILs to the patient. In some embodiments, the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m2/day for two days followed by administration of fludarabine at a dose of 25 mg/m2/day for five days. In some embodiments, the high dose IL-2 regimen comprises 600,000 or 720,000 IU/kg of aldesleukin, or a biosimilar or variant thereof, administered as a 15-minute bolus intravenous infusion every eight hours until tolerance.
V. Exemplary Embodiments
(579) In some embodiments, the present invention provides a method for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 11 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 11 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient.
(580) In some embodiment, the cryopreservation process comprises cryopreservation in a media comprising DMSO. In some embodiments, the cryopreservation media comprises 7% to 10% DMSO. In some embodiments, the cryopreservation medium in CS10.
(581) In some embodiments, the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for administering a therapeutically effective dosage of the TILs in step (h).
(582) In some embodiments, the number of TILs sufficient for administering a therapeutically effective dosage in step (h) is from about 2.3?10.sup.10 to about 13.7?10.sup.10.
(583) In some embodiments, the antigen presenting cells (APCs) are PBMCs.
(584) In some embodiments, the PBMCs are added to the cell culture on any of days 9 through 11 in step (d).
(585) In some embodiments, prior to administering a therapeutically effective dosage of TIL cells in step (h), a non-myeloablative lymphodepletion regimen has been administered to the patient.
(586) In some embodiments, the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days.
(587) In some embodiments, the method further comprises the step of treating the patient with a high-dose IL-2 regimen starting on the day after administration of the TIL cells to the patient in step (h).
(588) In some embodiments, the high-dose IL-2 regimen comprises 600,000 or 720,000 IU/kg administered as a 15-minute bolus intravenous infusion every eight hours until tolerance.
(589) In some embodiments, the third population of TILs in step (d) provides for increased efficacy, increased interferon-gamma (IFN-?) production, increased polyclonality, increased average IP-10, and/or increased average MCP-1 when adiminstered to a subject. In some embodiments, the increase in IFN-?, increased average IP-10, and/or increased average MCP-1 is measured in the blood of the subject treated with the TILs.
(590) In some embodiments, the cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma. In some embodiments, the cancer is selected from the group consisting of melanoma, HNSCC, cervical cancers, and NSCLC. In some embodiments, the cancer is melanoma. In some embodiments, the cancer is HNSCC. In some embodiments, the cancer is a cervical cancer. In some embodiments, the cancer is NSCLC.
(591) In an embodiment, the invention provides a method for expanding tumor infiltrating lymphocytes (TILs).
(592) The present invention provides a method for expanding tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a tumor sample from a patient, wherein said tumor sample comprises a first population of TILs; (b) processing said tumor sample into multiple tumor fragments; (c) adding said tumor fragments into a closed container; (d) performing an initial expansion of said first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein said first cell culture medium comprises IL-2, wherein said initial expansion is performed in said closed container providing at least 100 cm.sup.2 of gas-permeable surface area, wherein said initial expansion is performed within a first period of about 7-14 days to obtain a second population of TILs, wherein said second population of TILs is at least 50-fold greater in number than said first population of TILs, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) expanding said second population of TILs in a second cell culture medium, wherein said second cell culture medium comprises IL-2, OKT-3, and peripheral blood mononuclear cells (PBMCs, also known as mononuclear cells (MNCs)), wherein said expansion is performed within a second period of about 7-14 days to obtain a third population of TILs, wherein said third population of TILs exhibits an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein said expansion is performed in a closed container providing at least 500 cm.sup.2 of gas-permeable surface area, and wherein the transition from step (d) to step (e) occurs without opening the system; (f) harvesting said third population of TILs obtained from step (e), wherein the transition from step (e) to step (f) occurs without opening the system; and (g) transferring said harvested TIL population from step (f) to an infusion bag, wherein said transfer from step (f) to (g) occurs without opening the system. In some embodiments, the method is an in vitro or an ex vivo method.
(593) In some embodiments, the method further comprises harvesting in step (f) via a cell processing system, such as the LOVO system manufactured by Fresenius Kabi. The term LOVO cell processing system also refers to any instrument or device manufactured by any vendor that can pump a solution comprising cells through a membrane or filter such as a spinning membrane or spinning filter in a sterile and/or closed system environment, allowing for continuous flow and cell processing to remove supernatant or cell culture media without pelletization. In some cases, the cell processing system can perform cell separation, washing, fluid-exchange, concentration, and/or other cell processing steps in a closed, sterile system.
(594) In some embodiments, the closed container is selected from the group consisting of a G-container and a Xuri cellbag.
(595) In some embodiments, the infusion bag in step (g) is a HypoThermosol-containing infusion bag.
(596) In some embodiments, the first period in step (d) and said second period in step (e) are each individually performed within a period of 10 days, 11 days, or 12 days.
(597) In some embodiments, the first period in step (d) and said second period in step (e) are each individually performed within a period of 11 days.
(598) In some embodiments, steps (a) through (g) are performed within a period of about 25 days to about 30 days.
(599) In some embodiments, steps (a) through (g) are performed within a period of about 20 days to about 25 days.
(600) In some embodiments, steps (a) through (g) are performed within a period of about 20 days to about 22 days.
(601) In some embodiments, steps (a) through (g) are performed in 22 days or less.
(602) In some embodiments, steps (c) through (f) are performed in a single container, wherein performing steps (c) through (f) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (c) through (f) in more than one container.
(603) In some embodiments, the PBMCs are added to the TILs during the second period in step (e) without opening the system.
(604) In some embodiments, the effector T cells and/or central memory T cells obtained from said third population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from said second population of cells.
(605) In some embodiments, the effector T cells and/or central memory T cells obtained from said third population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from said second population of cells.
(606) In some embodiments, the risk of microbial contamination is reduced as compared to an open system.
(607) In some embodiments, the TILs from step (g) are infused into a patient.
(608) The present invention also provides a method of treating cancer in a patient with a population of tumor infiltrating lymphocytes (TILs) comprising the steps of: (a) obtaining a tumor sample from a patient, wherein said tumor sample comprises a first population of TILs; (b) processing said tumor sample into multiple tumor fragments; (c) adding said tumor fragments into a closed container; (d) performing an initial expansion of said first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein said first cell culture medium comprises IL-2, wherein said initial expansion is performed in said closed container providing at least 100 cm.sup.2 of gas-permeable surface area, wherein said initial expansion is performed within a first period of about 7-14 days to obtain a second population of TILs, wherein said second population of TILs is at least 50-fold greater in number than said first population of TILs, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) expanding said second population of TILs in a second cell culture medium, wherein said second cell culture medium comprises IL-2, OKT-3, and peripheral blood mononuclear cells (PBMCs), wherein said expansion is performed within a second period of about 7-14 days to obtain a third population of TILs, wherein said third population of TILs exhibits an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein said expansion is performed in a closed container providing at least 500 cm.sup.2 of gas-permeable surface area, and wherein the transition from step (d) to step (e) occurs without opening the system; (f) harvesting said third population of TILs obtained from step (e), wherein the transition from step (e) to step (f) occurs without opening the system; (g) transferring said harvested TIL population from step (f) to an infusion bag, wherein said transfer from step (f) to (g) occurs without opening the system; and (h) administering a therapeutically effective amount of TIL cells from said infusion bag in step (g) to said patient.
(609) In some embodiments, the present invention also comprises a population of tumor infiltrating lymphocytes (TILs) for use in treating cancer, wherein the population of TILs is obtainable from a method comprising the steps of: (b) processing a tumor sample obtained from a patient wherein said tumour sample comprises a first population of TILs into multiple tumor fragments; (c) adding said tumor fragments into a closed container; (d) performing an initial expansion of said first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein said first cell culture medium comprises IL-2, wherein said initial expansion is performed in said closed container providing at least 100 cm.sup.2 of gas-permeable surface area, wherein said initial expansion is performed within a first period of about 7-14 days to obtain a second population of TILs, wherein said second population of TILs is at least 50-fold greater in number than said first population of TILs, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) expanding said second population of TILs in a second cell culture medium, wherein said second cell culture medium comprises IL-2, OKT-3, and peripheral blood mononuclear cells (PBMCs), wherein said expansion is performed within a second period of about 7-14 days to obtain a third population of TILs, wherein said third population of TILs exhibits an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein said expansion is performed in a closed container providing at least 500 cm.sup.2 of gas-permeable surface area, and wherein the transition from step (d) to step (e) occurs without opening the system; (f) harvesting said third population of TILs obtained from step (e), wherein the transition from step (e) to step (f) occurs without opening the system; (g) transferring said harvested TIL population from step (f) to an infusion bag, wherein said transfer from step (f) to (g) occurs without opening the system. In some embodiments, the method comprises a first step (a) obtaining the tumor sample from a patient, wherein said tumor sample comprises the first population of TILs. In some embodiments, the population of TILs is for administration from said infusion bag in step (g) in a therapeutically effective amount.
(610) In some embodiments, prior to administering a therapeutically effective amount of TIL cells in step (h), a non-myeloablative lymphodepletion regimen has been administered to said patient. In some embodiments, the populations of TILs is for administration to a patient who has undergone a non-myeloablative lymphodepltion regimen.
(611) In some embodiments, the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days.
(612) In some embodiments, the method further comprises the step of treating said patient with a high-dose IL-2 regimen starting on the day after administration of said TIL cells to said patient in step (h). In some embodiments, the populations of TILs is for administration prior to a high-dose IL-2 regimen. In some embodiments, the population of TILs is for administration one day before the start of the high-dose IL-2 regimen.
(613) In some embodiments, the high-dose IL-2 regimen comprises 600,000 or 720,000 IU/kg administered as a 15-minute bolus intravenous infusion every eight hours until tolerance.
(614) In some embodiments, the effector T cells and/or central memory T cells obtained from said third population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from said second population of cells.
(615) In some embodiments, the effector T cells and/or central memory T cells obtained from said third population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from said second population of cells.
(616) The present invention also provides a method for expanding tumor infiltrating lymphocytes (TILs) comprising the steps of (a) adding processed tumor fragments into a closed system; (b) performing in a first expansion of said first population of TILs in a first cell culture medium to obtain a second population of TILs, wherein said first cell culture medium comprises IL-2, wherein said first expansion is performed in a closed container providing a first gas-permeable surface area, wherein said first expansion is performed within a first period of about 3-14 days to obtain a second population of TILs, wherein said second population of TILs is at least 50-fold greater in number than said first population of TILs, and wherein the transition from step (a) to step (b) occurs without opening the system; (c) expanding said second population of TILs in a second cell culture medium, wherein said second cell culture medium comprises IL-2, OKT-3, and antigen-presenting cells, wherein said expansion is performed within a second period of about 7-14 days to obtain a third population of TILs, wherein said third population of TILs exhibits an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein said expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) harvesting said third population of TILs obtained from step (c), wherein the transition from step (c) to step (d) occurs without opening the system; and (e) transferring said harvested TIL population from step (d) to an infusion bag, wherein said transfer from step (d) to (e) occurs without opening the system.
(617) In some embodiments, the method further comprises the step of cryopreserving the infusion bag comprising the harvested TIL population using a cryopreservation process. In some embodiments, the cryopreservation process is performed using a 1:1 ratio of harvested TIL population to CS10 media.
(618) In some embodiments, the antigen-presenting cells are peripheral blood mononuclear cells (PBMCs). In some embodiments, the antigen-presenting cells are artificial antigen-presenting cells.
(619) In some embodiments, the harvesting in step (d) is performed using a LOVO cell processing system.
(620) In some embodiments, the multiple fragments comprise about 50 fragments, wherein each fragment has a volume of about 27 mm.sup.3. In some embodiments, the multiple fragments comprise about 30 to about 60 fragments with a total volume of about 1300 mm.sup.3 to about 1500 mm.sup.3. In some embodiments, the multiple fragments comprise about 50 fragments with a total volume of about 1350 mm.sup.3. In some embodiments, the multiple fragments comprise about 50 fragments with a total mass of about 1 gram to about 1.5 grams.
(621) In some embodiments, the second cell culture medium is provided in a container selected from the group consisting of a G-container and a Xuri cellbag.
(622) In some embodiments, the infusion bag in step (e) is a HypoThermosol-containing infusion bag.
(623) In some embodiments, the first period in step (b) and said second period in step (c) are each individually performed within a period of 10 days, 11 days, or 12 days. In some embodiments, the first period in step (b) and said second period in step (c) are each individually performed within a period of 11 days.
(624) In some embodiments, the steps (a) through (e) are performed within a period of about 25 days to about 30 days. In some embodiments, the steps (a) through (e) are performed within a period of about 20 days to about 25 days. In some embodiments, the steps (a) through (e) are performed within a period of about 20 days to about 22 days. In some embodiments, the steps (a) through (e) are performed in 22 days or less. In some embodiments, the steps (a) through (e) and cryopreservation are performed in 22 days or less.
(625) In some embodiments, the steps (b) through (e) are performed in a single closed system, wherein performing steps (b) through (e) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (b) through (e) in more than one container.
(626) In some embodiments, the antigen-presenting cells are added to the TILs during the second period in step (c) without opening the system.
(627) In some embodiments, the effector T cells and/or central memory T cells obtained from said third population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from said second population of cells.
(628) In some embodiments, the effector T cells and/or central memory T cells obtained from said third population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from said second population of cells.
(629) In some embodiments, the risk of microbial contamination is reduced as compared to an open system.
(630) In some embodiments, the TILs from step (e) are infused into a patient.
(631) In some embodiments, the closed container comprises a single bioreactor. In some embodiments, the closed container comprises a G-REX-10. In some embodiments, the closed container comprises a G-REX-100. In some embodiments, the closed container comprises a G-Rex 500. In some embodiments, the closed container comprises a Xuri or Wave bioreactor gas permeable bag.
(632) In some embodiments, the present disclosure provides a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (b) adding tumor fragments into a closed system wherein the tumour fragments comprise a first population of TILs; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system.
(633) In some embodiments, the method also comprises as a first step: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments.
(634) In an embodiment, the method is an in vitro or an ex vivo method.
(635) In some embodiments, the present disclosure provides a method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system.
(636) In an embodiment, the method is an in vitro or an ex vivo method.
(637) In some embodiments, the method further comprises the step of cryopreserving the infusion bag comprising the harvested TIL population in step (f) using a cryopreservation process.
(638) In some embodiments, the cryopreservation process is performed using a 1:1 ratio of harvested TIL population to cryopreservation media. In some embodiments, the cryopreservation media comprises dimethylsulfoxide. In some embodiments, the cryopreservation media is selected from the group consisting of Cryostor CS10, HypoThermasol, or a combination thereof.
(639) In some embodiments, the antigen-presenting cells are peripheral blood mononuclear cells (PBMCs).
(640) In some embodiments, the PBMCs are irradiated and allogeneic.
(641) In some embodiments, the PBMCs are added to the cell culture on any of days 9 through 14 in step (d).
(642) In some embodiments, the antigen-presenting cells are artificial antigen-presenting cells.
(643) In some embodiments, the harvesting in step (e) is performing using a LOVO cell processing system.
(644) In some embodiments, the tumor fragments are multiple fragments and comprise about 4 to about 50 fragments, wherein each fragment has a volume of about 27 mm.sup.3. In some embodiments, the multiple fragments comprise about 30 to about 60 fragments with a total volume of about 1300 mm.sup.3 to about 1500 mm.sup.3. In some embodiments, the multiple fragments comprise about 50 fragments with a total volume of about 1350 mm.sup.3. In some embodiments, the multiple fragments comprise about 50 fragments with a total mass of about 1 gram to about 1.5 grams.
(645) In some embodiments, the cell culture medium is provided in a container selected from the group consisting of a G-container and a Xuri cellbag.
(646) In some embodiments, the infusion bag in step (f) is a HypoThermosol-containing infusion bag.
(647) In some embodiments, the first period in step (c) and the second period in step (e) are each individually performed within a period of 10 days, 11 days, or 12 days. In some embodiments, the first period in step (c) and the second period in step (e) are each individually performed within a period of 11 days. In some embodiments, steps (a) through (f) are performed within a period of about 25 days to about 30 days. In some embodiments, steps (a) through (f) are performed within a period of about 20 days to about 25 days. In some embodiments, steps (a) through (f) are performed within a period of about 20 days to about 22 days. In some embodiments, steps (a) through (f) are performed in 22 days or less. In some embodiments, steps (a) through (f) and cryopreservation are performed in 22 days or less.
(648) In some embodiments, the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for a therapeutically effective dosage of the TILs. In some embodiments, the number of TILs sufficient for a therapeutically effective dosage is from about 2.3?10.sup.10 to about 13.7?10.sup.10.
(649) In some embodiments, steps (b) through (e) are performed in a single container, wherein performing steps (b) through (e) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (b) through (e) in more than one container.
(650) In some embodiments, the antigen-presenting cells are added to the TILs during the second period in step (d) without opening the system.
(651) In some embodiments, the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells.
(652) In some embodiments, the effector T cells and/or central memory T cells obtained from the third population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from the second population of cells.
(653) In some embodiments, the risk of microbial contamination is reduced as compared to an open system.
(654) In some embodiments, the TILs from step (f) are infused into a patient.
(655) In some embodiments, the multiple fragments comprise about 4 fragments. In some embodiments, the 4 fragments are placed into a G-REX-100. In some embodiments, the 4 fragments are about 0.5 cm in diameter. In some embodiments, the 4 fragments are placed into a G-REX-100. In some embodiments, the 4 fragments are about 0.1 cm, 0.2 cm, 0.3 cm, 0.4 cm, 0.5 cm, 0.6 cm, 0.7 cm, 0.8 cm, 0.9 cm, or 1 cm in diameter. In some embodiments, the 4 fragments are about 0.1 cm, 0.2 cm, 0.3 cm, 0.4 cm, 0.5 cm, 0.6 cm, 0.7 cm, 0.8 cm, 0.9 cm, or 1 cm in diameter and are placed into a G-REX-100. In some embodiments, the 4 fragments are about 0.1 cm, 0.2 cm, 0.3 cm, 0.4 cm, 0.5 cm, 0.6 cm, 0.7 cm, 0.8 cm, 0.9 cm, or 1 cm in diameter are placed into a container with an equivalent volume to a G-REX-100. In some embodiments, the 4 fragments are about 0.5 cm in diameter and are placed into a G-REX ?100. In some embodiments, the 4 fragments are about 0.5 cm in diameter and are placed into a container with an equivalent volume to a G-REX-100.
(656) Further details of steps (a), (b), (c), (d), (e) and (f) are provided herein below, including for example but not limited to the embodiments described under the headings STEP A: Obtain Patient Tumor Sample, STEP B: First Expansion, STEP C: First Expansion to Second Expansion Transition, STEP D: Second Expansion, STEP E: Harvest TILS and STEP F: Final Formulation/Transfer to Infusion Bag.
(657) In some embodiments, the present disclosure provides methods for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient.
(658) In some embodiments, the invention provides a therapeutic population of tumor infiltrating lymphocytes (TILs) for use in treating cancer, wherein the population is obtainable from a method comprising the steps of: (b) adding tumor fragments into a closed system wherein the tumour fragments comprise a first population of TILs; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; and (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process.
(659) In some embodiments, the population is obtainable by a method also comprising as a first step: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments.
(660) In an embodiment, the method is an in vitro or an ex vivo method.
(661) In some embodiments, any of steps (a) to (f) comprise one or more features disclosed herein, e.g. one or more features disclosed under the headings STEP A: Obtain Patient Tumor Sample, STEP B: First Expansion, STEP C: First Expansion to Second Expansion Transition, STEP D: Second Expansion, STEP E: Harvest TILs and STEP F: Final Formulation/Transfer to Infusion Bag.
(662) In some embodiments, step (g) comprises one or more features disclosed herein, e.g. one or more features disclosed under the heading STEP H: Optional Cryopreservation of TILs. In some embodiments, step (h) comprise one or more features disclosed herein, e.g. one or more features disclosed under the heading STEP F:1 Pharmaceutical Compositions, Dosages and Dosing Regimens.
(663) In some embodiments, the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for administering a therapeutically effective dosage of the TILs in step (h).
(664) In some embodiments, the number of TILs sufficient for administering a therapeutically effective dosage in step (h) is from about 2.3?10.sup.10 to about 13.7?10.sup.10.
(665) In some embodiments, the antigen presenting cells (APCs) are PBMCs.
(666) In some embodiments, the PBMCs are added to the cell culture on any of days 9 through 14 in step (d).
(667) In some embodiments, prior to administering a therapeutically effective dosage of TIL cells in step (h), a non-myeloablative lymphodepletion regimen has been administered to the patient.
(668) In some embodiments, there is provided a therapeutic population of tumor infiltrating lymphocytes (TILs) for use in treating cancer and in combination with a non-myeloablative lymphodepletion regimen. In some embodiments, the non-myeloablative lymphodepletion regimen is administered prior to administering the therapeutic population of tumor infiltrating lymphocytes (TILs).
(669) In some embodiments, the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days.
(670) In some embodiments, the step of treating the patient with a high-dose IL-2 regimen starting on the day after administration of the TIL cells to the patient in step (h).
(671) In some embodiments, there is provided a therapeutic population of tumor infiltrating lymphocytes (TILs) for use in treating cancer and in combination with high-dose IL-2 regimen. In some embodiments, the high-dose IL-2 regimen starts on the day after administration of the therapeutic population of TIL cells.
(672) In some embodiments, the high-dose IL-2 regimen comprises 600,000 or 720,000 IU/kg administered as a 15-minute bolus intravenous infusion every eight hours until tolerance.
(673) In some embodiments, the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells.
(674) In some embodiments, the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from the second population of cells.
(675) The present disclosure also provides methods for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) adding processed tumor fragments from a tumor resected from a patient into a closed system to obtain a first population of TILs; (b) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (a) to step (b) occurs without opening the system; (c) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) harvesting the therapeutic population of TILs obtained from step (c), wherein the transition from step (c) to step (d) occurs without opening the system; and (e) transferring the harvested TIL population from step (d) to an infusion bag, wherein the transfer from step (d) to (e) occurs without opening the system.
(676) In some embodiments, the therapeutic population of TILs harvested in step (d) comprises sufficient TILs for a therapeutically effective dosage of the TILs.
(677) In some embodiments, the number of TILs sufficient for a therapeutically effective dosage is from about 2.3?10.sup.10 to about 13.7?10.sup.10.
(678) In some embodiments, the method further comprises the step of cryopreserving the infusion bag comprising the harvested TIL population using a cryopreservation process.
(679) In some embodiments, the cryopreservation process is performed using a 1:1 ratio of harvested TIL population to CS10 media.
(680) In some embodiments, the present disclosure provides methods for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient.
wherein no selection of TIL population is performed during any of steps (a) to (h). In an embodiment, no selection of the second population of TILs (the pre-REP population) based on phenotype is performed prior to performing the second expansion of step (d). In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, or harvested TIL population based on CD8 expression is performed during any of steps (a) to (h).
(681) In some embodiments, the present disclosure provides methods for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2 to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process, wherein the cryopreservation process comprises mixing of a cryopreservation media with the harvested TIL population; (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient.
wherein no selection of TIL population is performed during any of steps (a) to (h). In an embodiment, no selection of the second population of TILs (for example, the pre-REP population) based on phenotype is performed prior to performing the second expansion of step (d). In an embodiment, no selection of the first population of TILs, second population of TILs, third population of TILs, or harvested TIL population based on CD8 expression is performed during any of steps (a) to (h). In some embodiments, the non-myeloablative lymphodepletion regimen is administered prior to administering the harvested TIL population. In some embodiments, the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days.
(682) In some embodiments, the antigen-presenting cells are peripheral blood mononuclear cells (PBMCs). In some embodiments, the PBMCs are irradiated and allogeneic. In some embodiments, the PBMCs are added to the cell culture on any of days 9 through 14 in step (c).
(683) In some embodiments, the antigen-presenting cells are artificial antigen-presenting cells.
(684) In some embodiments, the harvesting in step (d) is performed using a LOVO cell processing system.
(685) In some embodiments, the method comprises harvesting in step (d) is via a LOVO cell processing system, such as the LOVO system manufactured by Fresenius Kabi. The term LOVO cell processing system also refers to any instrument or device that can pump a solution comprising cells through a membrane or filter such as a spinning membrane or spinning filter in a sterile and/or closed system environment, allowing for continuous flow and cell processing to remove supernatant or cell culture media without pelletization. In some cases, the cell processing system can perform cell separation, washing, fluid-exchange, concentration, and/or other cell processing steps in a closed, sterile system.
(686) In some embodiments, the tumor fragments are multiple fragments and comprise about 4 to about 50 fragments, wherein each fragment has a volume of about 27 mm.sup.3. In some embodiments, the multiple fragments comprise about 30 to about 60 fragments with a total volume of about 1300 mm.sup.3 to about 1500 mm.sup.3. In some embodiments, the multiple fragments comprise about 50 fragments with a total volume of about 1350 mm.sup.3. In some embodiments, the multiple fragments comprise about 50 fragments with a total mass of about 1 gram to about 1.5 grams.
(687) In some embodiments, the multiple fragments comprise about 4 fragments. In some embodiments, the 4 fragments are placed into a G-REX-100. In some embodiments, the 4 fragments are about 0.1 cm, 0.2 cm, 0.3 cm, 0.4 cm, 0.5 cm, 0.6 cm, 0.7 cm, 0.8 cm, 0.9 cm, or 1 cm in diameter. In some embodiments, the 4 fragments are about 0.1 cm, 0.2 cm, 0.3 cm, 0.4 cm, 0.5 cm, 0.6 cm, 0.7 cm, 0.8 cm, 0.9 cm, or 1 cm in diameter and are placed into a G-REX-100. In some embodiments, the 4 fragments are about 0.1 cm, 0.2 cm, 0.3 cm, 0.4 cm, 0.5 cm, 0.6 cm, 0.7 cm, 0.8 cm, 0.9 cm, or 1 cm in diameter are placed into a container with an equivalent volume to a G-REX-100. In some embodiments, the 4 fragments are about 0.5 cm in diameter and are placed into a G-REX-100. In some embodiments, the 4 fragments are about 0.5 cm in diameter and are placed into a container with an equivalent volume to a G-REX-100.
(688) In some embodiments, the cell culture medium is provided in a container selected from the group consisting of a G-container and a Xuri cellbag.
(689) In some embodiments, the infusion bag in step (e) is a HypoThermosol-containing infusion bag.
(690) In some embodiments, the first period in step (b) and the second period in step (c) are each individually performed within a period of 10 days, 11 days, or 12 days. In some embodiments, the first period in step (b) and the second period in step (c) are each individually performed within a period of 11 days. In some embodiments, steps (a) through (e) are performed within a period of about 25 days to about 30 days. In some embodiments, steps (a) through (e) are performed within a period of about 20 days to about 25 days. In some embodiments, steps (a) through (e) are performed within a period of about 20 days to about 22 days. In some embodiments, steps (a) through (e) are performed in 22 days or less. In some embodiments, steps (a) through (e) and cryopreservation are performed in 22 days or less.
(691) In some embodiments, steps (b) through (e) are performed in a single container, wherein performing steps (b) through (e) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (b) through (e) in more than one container.
(692) In some embodiments, the antigen-presenting cells are added to the TILs during the second period in step (c) without opening the system.
(693) In some embodiments, the effector T cells and/or central memory T cells obtained in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells.
(694) In some embodiments, the effector T cells and/or central memory T cells obtained in the therapeutic population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells.
(695) In some embodiments, the risk of microbial contamination is reduced as compared to an open system.
(696) In some embodiments, the TILs from step (e) are infused into a patient.
(697) In some embodiments, the closed container comprises a single bioreactor. In some embodiments, the closed container comprises a G-REX-10. In some embodiments, the closed container comprises a G-REX-100.
VI. Further Exemplary Embodiments
(698) 1. A method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3, to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system. 2. The method according to claim 56, further comprising the step of cryopreserving the infusion bag comprising the harvested TIL population in step (f) using a cryopreservation process. 3. The method according to claim 56, wherein the cryopreservation process is performed using a 1:1 ratio of harvested TIL population to cryopreservation media. 4. The method according to claim 56, wherein the antigen-presenting cells are peripheral blood mononuclear cells (PBMCs). 5. The method according to claim 4, wherein the PBMCs are irradiated and allogeneic. 6. The method according to claim 4, wherein the PBMCs are added to the cell culture on any of days 9 through 14 in step (d). 7. The method according to claim 56, wherein the antigen-presenting cells are artificial antigen-presenting cells. 8. The method according to claim 56, wherein the harvesting in step (e) is performed using a membrane-based cell processing system. 9. The method according to claim 56, wherein the harvesting in step (e) is performed using a LOVO cell processing system. 10. The method according to claim 56, wherein the multiple fragments comprise about 4 to about 50 fragments, wherein each fragment has a volume of about 27 mm.sup.3. 11. The method according to claim 56, wherein the multiple fragments comprise about 30 to about 60 fragments with a total volume of about 1300 mm.sup.3 to about 1500 mm.sup.3. 12. The method according to claim 9, wherein the multiple fragments comprise about 50 fragments with a total volume of about 1350 mm.sup.3. 13. The method according to claim 56, wherein the multiple fragments comprise about 50 fragments with a total mass of about 1 gram to about 1.5 grams. 14. The method according to claim 56, wherein the cell culture medium is provided in a container selected from the group consisting of a G-container and a Xuri cellbag. 15. The method according to claim 56, wherein the cell culture medium in step (d) further comprises IL-15 and/or IL-21. 16. The method according to claim any of the preceding claims, wherein the IL-2 concentration is about 10,000 IU/mL to about 5,000 IU/mL. 17. The method according to claim 565,wherein the IL-15 concentration is about 500 IU/mL to about 100 IU/mL. 18. The method according to claim 56, wherein the IL-21 concentration is about 20 IU/mL to about 0.5 IU/mL. 19. The method according to claim 56, wherein the infusion bag in step (f) is a HypoThermosol-containing infusion bag. 20. The method according to claim 3, wherein the cryopreservation media comprises dimethlysulfoxide (DMSO). 21. The method according to claim 567, wherein the wherein the cryopreservation media comprises 7% to 10% DMSO. 22. The method according to claim 56, wherein the first period in step (c) and the second period in step (e) are each individually performed within a period of 10 days, 11 days, or 12 days. 23. The method according to claim 56, wherein the first period in step (c) and the second period in step (e) are each individually performed within a period of 11 days. 24. The method according to claim 56, wherein steps (a) through (f) are performed within a period of about 10 days to about 22 days. 25. The method according to claim 56, wherein steps (a) through (f) are performed within a period of about 20 days to about 22 days. 26. The method according to claim 56, wherein steps (a) through (f) are performed within a period of about 15 days to about 20 days. 27. The method according to claim 56, wherein steps (a) through (f) are performed within a period of about 10 days to about 20 days. 28. The method according to claim 56, wherein steps (a) through (f) are performed within a period of about 10 days to about 15 days. 29. The method according to claim 56, wherein steps (a) through (f) are performed in 22 days or less. 30. The method according to claim 56, wherein steps (a) through (f) are performed in 20 days or less. 31. The method according to claim 56, wherein steps (a) through (f) are performed in 15 days or less. 32. The method according to claim 56, wherein steps (a) through (f) are performed in 10 days or less. 33. The method according to claim 2, wherein steps (a) through (f) and cryopreservation are performed in 22 days or less. 34. The method according to any one of claims 1 to 33, wherein the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for a therapeutically effective dosage of the TILs. 35. The method according to claim 34, wherein the number of TILs sufficient for a therapeutically effective dosage is from about 2.3?10.sup.10 to about 13.7?10.sup.10. 36. The method according to any one of claims 1 to 35, wherein steps (b) through (e) are performed in a single container, wherein performing steps (b) through (e) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (b) through (e) in more than one container. 37. The method according to any one of claims 1 to 36, wherein the antigen-presenting cells are added to the TILs during the second period in step (d) without opening the system. 38. The method according to any one of claims 1 to 37, wherein the third population of TILs in step (d) provides for increased efficacy, increased interferon-gamma production, increased polyclonality, increased average IP-10, and/or increased average MCP-1 when adiminstered to a subject. 39. The method according to any one of claims 1 to 38, wherein the third population of TILs in step (d) provides for at least a five-fold or more interferon-gamma production when adiminstered to a subject. 40. The method according to any one of claims 1 to 39, wherein the third population of TILs in step (d) is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells. 41. The method according to any one of claims 1 to 40, wherein the effector T cells and/or central memory T cells obtained from the third population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from the second population of cells. 42. The method according to any one of claims 1 to 41, wherein the risk of microbial contamination is reduced as compared to an open system. 43. The method according to any one of claims 1 to 42, wherein the TILs from step (g) are infused into a patient. 44. The method according to any one of claims 1 to 43, wherein the multiple fragments comprise about 4 fragments. 45. A method for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3, to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient. 46. The method according to claim 45, wherein the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for administering a therapeutically effective dosage of the TILs in step (h). 47. The method according to claim 46, wherein the number of TILs sufficient for administering a therapeutically effective dosage in step (h) is from about 2.3?10.sup.10 to about 13.7?10.sup.10. 48. The method according to claim 47, wherein the antigen presenting cells (APCs) are PBMCs. 49. The method according to claim 48, wherein the PBMCs are added to the cell culture on any of days 9 through 14 in step (d). 50. The method according to any of claims 45 to 49, wherein prior to administering a therapeutically effective dosage of TIL cells in step (h), a non-myeloablative lymphodepletion regimen has been administered to the patient. 51. The method according to claim 50, where the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m2/day for two days followed by administration of fludarabine at a dose of 25 mg/m2/day for five days. 52. The method according to any of claims 45 to 51, further comprising the step of treating the patient with a high-dose IL-2 regimen starting on the day after administration of the TIL cells to the patient in step (h). 53. The method according to claim 52, wherein the high-dose IL-2 regimen comprises 600,000 or 720,000 IU/kg administered as a 15-minute bolus intravenous infusion every eight hours until tolerance. 54. The method according to any of the preceding claims, wherein the third population of TILs in step (d) is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells. 55. The method according to any of the preceding claims, wherein the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from the second population of cells. 56. The method according to any of the preceding claims, wherein the cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma. 57. The method according to any of the preceding claims, wherein the cancer is selected from the group consisting of melanoma, HNSCC, cervical cancers, and NSCLC. 58. The method according to any of the preceding claims, wherein the cancer is melanoma. 59. The method according to any of the preceding claims, wherein the cancer is HNSCC. 60. The method according to any of the preceding claims, wherein the cancer is a cervical cancer. 61. The method according to any of the preceding claims, wherein the cancer is NSCLC. 62. A method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) adding processed tumor fragments from a tumor resected from a patient into a closed system to obtain a first population of TILs; (b) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3, to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (a) to step (b) occurs without opening the system; (c) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) harvesting the therapeutic population of TILs obtained from step (c), wherein the transition from step (c) to step (d) occurs without opening the system; and (e) transferring the harvested TIL population from step (d) to an infusion bag, wherein the transfer from step (d) to (e) occurs without opening the system. 63. The method according to claim 62, wherein the therapeutic population of TILs harvested in step (d) comprises sufficient TILs for a therapeutically effective dosage of the TILs. 64. The method according to claim 63, where the number of TILs sufficient for a therapeutically effective dosage is from about 2.3?10.sup.10 to about 13.7?10.sup.10. 65. The method according to claim 64, further comprising the step of cryopreserving the infusion bag comprising the harvested TIL population using a cryopreservation process. 66. The method according to claim 65, wherein the cryopreservation process is performed using a 1:1 ratio of harvested TIL population to cryopreservation media. 67. The method according to claim 62, wherein the antigen-presenting cells are peripheral blood mononuclear cells (PBMCs). 68. The method according to claim 67, wherein the PBMCs are irradiated and allogeneic. 69. The method according to claim 68, wherein the PBMCs are added to the cell culture on any of days 9 through 14 in step (c). 70. The method according to claim 62, wherein the antigen-presenting cells are artificial antigen-presenting cells. 71. The method according to claim 62, wherein the harvesting in step (d) is performed using a LOVO cell processing system. 72. The method according to claim 62, wherein the multiple fragments comprise about 4 to about 50 fragments, wherein each fragment has a volume of about 27 mm.sup.3. 73. The method according to claim 62, wherein the multiple fragments comprise about 30 to about 60 fragments with a total volume of about 1300 mm.sup.3 to about 1500 mm.sup.3. 74. The method according to claim 63, wherein the multiple fragments comprise about 50 fragments with a total volume of about 1350 mm.sup.3. 75. The method according to claim 62, wherein the multiple fragments comprise about 50 fragments with a total mass of about 1 gram to about 1.5 grams. 76. The method according to claim 62, wherein the multiple fragments comprise about 4 fragments. 77. The method according to claim 62, wherein the second cell culture medium is provided in a container selected from the group consisting of a G-container and a Xuri cellbag. 78. The method according to claim 62, wherein the infusion bag in step (e) is a HypoThermosol-containing infusion bag. 79. The method according to claim 62, wherein the first period in step (b) and the second period in step (c) are each individually performed within a period of 10 days, 11 days, or 12 days. 80. The method according to claim 62, wherein the first period in step (b) and the second period in step (c) are each individually performed within a period of 11 days. 81. The method according to claim 62, wherein steps (a) through (e) are performed within a period of about 10 days to about 22 days. 82. The method according to claim 62, wherein steps (a) through (e) are performed within a period of about 10 days to about 20 days. 83. The method according to claim 62, wherein steps (a) through (e) are performed within a period of about 10 days to about 15 days. 84. The method according to claim 62, wherein steps (a) through (e) are performed in 22 days or less. 85. The method according to claim 65, wherein steps (a) through (e) and cryopreservation are performed in 22 days or less. 86. The method according to any one of claims 62 to 85, wherein steps (b) through (e) are performed in a single container, wherein performing steps (b) through (e) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (b) through (e) in more than one container. 87. The method according to any one of claims 62 to 86, wherein the antigen-presenting cells are added to the TILs during the second period in step (c) without opening the system. 88. The method according to any one of claims 62 to 87, wherein the third population of TILs in step (d) is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the effector T cells and/or central memory T cells obtained in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells. 89. The method according to any one of claims 62 to 88, wherein the effector T cells and/or central memory T cells obtained in the therapeutic population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells. 90. The method according to any one of claims 62 to 89, wherein the risk of microbial contamination is reduced as compared to an open system. 91. The method according to any one of claims 62 to 90, wherein the TILs from step (e) are infused into a patient. 92. The method according to any of the preceding claims wherein the closed container comprises a single bioreactor. 93. The method according to claim 92, wherein the closed container comprises a G-REX-10. 94. The method according to claim 92, wherein the closed container comprises a G-REX ?100. 95. The method according to any one of claims 1 to 61, wherein at step (d) the antigen presenting cells (APCs) are added to the cell culture of the second population of TILs at a APC:TIL ratio of 25:1 to 100:1. 96. The method according to claim 95, wherein the cell culture has a ratio of 2.5?10.sup.9 APCs to 100?10.sup.6 TILs. 97. The method according to any one of claims 62 to 94, wherein at step (c) the antigen presenting cells (APCs) are added to the cell culture of the second population of TILs at a APC:TIL ratio of 25:1 to 100:1. 98. The method according to claim 97, wherein the cell culture has ratio of 2.5?10.sup.9 APCs to 100?10.sup.6 TILs. 99. A population of expanded TILs for use in the treatment of a subject with cancer, wherein the population of expanded TILs is a third population of TILs obtainable by a method comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, and optionally OKT-3, to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; and (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process. 100. The population of TILs for use to treat a subject with cancer according to claim 99, wherein the method further comprises one or more of the features recited in any of claims 1 to 99. 101. A method for expanding tumor infiltrating lymphocytes (TILs) into a therapeutic population of TILs comprising: (a) obtaining a first population of TILs from a tumor resected from a patient by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, optionally OKT-3, and optionally a tumor necrosis factor receptor superfamily (TNFRSF) agonist, to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and optionally a tumor necrosis factor receptor superfamily (TNFRSF) agonist, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system. 102. The method according to claim 5601, further comprising the step of cryopreserving the infusion bag comprising the harvested TIL population in step (f) using a cryopreservation process. 103. The method according to claim 5601, wherein the cryopreservation process is performed using a 1:1 ratio of harvested TIL population to cryopreservation media. 104. The method according to claim 5601, wherein the antigen-presenting cells are peripheral blood mononuclear cells (PBMCs). 105. The method according to claim 5604, wherein the PBMCs are irradiated and allogeneic. 106. The method according to claim 5604, wherein the PBMCs are added to the cell culture on any of days 9 through 14 in step (d). 107. The method according to claim 5601, wherein the antigen-presenting cells are artificial antigen-presenting cells. 108. The method according to claim 5601, wherein the harvesting in step (e) is performed using a membrane-based cell processing system. 109. The method according to claim 5601, wherein the harvesting in step (e) is performed using a LOVO cell processing system. 110. The method according to claim 5601, wherein the multiple fragments comprise about 4 to about 50 fragments, wherein each fragment has a volume of about 27 mm.sup.3. 111. The method according to claim 5601, wherein the multiple fragments comprise about 30 to about 60 fragments with a total volume of about 1300 mm.sup.3 to about 1500 mm.sup.3. 112. The method according to claim 5609, wherein the multiple fragments comprise about 50 fragments with a total volume of about 1350 mm.sup.3. 113. The method according to claim 5601, wherein the multiple fragments comprise about 50 fragments with a total mass of about 1 gram to about 1.5 grams. 114. The method according to claim 5601, wherein the cell culture medium is provided in a container selected from the group consisting of a G-container and a Xuri cellbag. 115. The method according to claim 5601, wherein the cell culture medium in step (d) further comprises IL-15 and/or IL-21. 116. The method according to claim any of claims 101 to 115, wherein the IL-2 concentration is about 10,000 IU/mL to about 5,000 IU/mL. 117. The method according to claim 5615, wherein the IL-15 concentration is about 500 IU/mL to about 100 IU/mL. 118. The method according to claim 5601, wherein the IL-21 concentration is about 20 IU/mL to about 0.5 IU/mL. 119. The method according to claim 5601, wherein the infusion bag in step (f) is a HypoThermosol-containing infusion bag. 120. The method according to claim 5603, wherein the cryopreservation media comprises dimethlysulfoxide (DMSO). 121. The method according to claim 5617, wherein the wherein the cryopreservation media comprises 7% to 10% DMSO. 122. The method according to claim 5601, wherein the first period in step (c) and the second period in step (e) are each individually performed within a period of 10 days, 11 days, or 12 days. 123. The method according to claim 5601, wherein the first period in step (c) and the second period in step (e) are each individually performed within a period of 11 days. 124. The method according to claim 5601, wherein steps (a) through (f) are performed within a period of about 10 days to about 22 days. 125. The method according to claim 5601, wherein steps (a) through (f) are performed within a period of about 20 days to about 22 days. 126. The method according to claim 5601, wherein steps (a) through (f) are performed within a period of about 15 days to about 20 days. 127. The method according to claim 5601, wherein steps (a) through (f) are performed within a period of about 10 days to about 20 days. 128. The method according to claim 5601, wherein steps (a) through (f) are performed within a period of about 10 days to about 15 days. 129. The method according to claim 5601, wherein steps (a) through (f) are performed in 22 days or less. 130. The method according to claim 5601, wherein steps (a) through (f) are performed in 20 days or less. 131. The method according to claim 5601, wherein steps (a) through (f) are performed in 15 days or less. 132. The method according to claim 5601, wherein steps (a) through (f) are performed in 10 days or less. 133. The method according to claim 5602, wherein steps (a) through (f) and cryopreservation are performed in 22 days or less. 134. The method according to any one of claims 101 to 133, wherein the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for a therapeutically effective dosage of the TILs. 135. The method according to claim 5634, wherein the number of TILs sufficient for a therapeutically effective dosage is from about 2.3?10.sup.10 to about 13.7?10.sup.10. 136. The method according to any one of claims 101 to 135, wherein steps (b) through (e) are performed in a single container, wherein performing steps (b) through (e) in a single container results in an increase in TIL yield per resected tumor as compared to performing steps (b) through (e) in more than one container. 137. The method according to any one of claims 101 to 136, wherein the tumor necrosis factor receptor superfamily (TNFRSF) agonist is a 4-1BB antibody. 138. The method according to any one of claims 101 to 137, wherein the antigen-presenting cells are added to the TILs during the second period in step (d) without opening the system. 139. The method according to any one of claims 101 to 138, wherein the third population of TILs in step (d) provides for increased efficacy, increased interferon-gamma production, increased polyclonality, increased average IP-10, and/or increased average MCP-1 when adminstered to a subject. 140. The method according to any one of claims 101 to 139, wherein the third population of TILs in step (d) provides for at least a five-fold or more interferon-gamma production when adminstered to a subject. 141. The method according to any one of claims 101 to 140, wherein the third population of TILs in step (d) is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells. 142. The method according to any one of claims 101 to 141, wherein the effector T cells and/or central memory T cells obtained from the third population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from the second population of cells. 143. The method according to any one of claims 101 to 142, wherein the risk of microbial contamination is reduced as compared to an open system. 144. The method according to any one of claims 101 to 143, wherein the TILs from step (g) are infused into a patient. 145. The method according to any one of claims 101 to 144, wherein the multiple fragments comprise about 4 fragments. 146. A method for treating a subject with cancer, the method comprising administering expanded tumor infiltrating lymphocytes (TILs) comprising: (a) obtaining a first population of TILs from a tumor resected from a subject by processing a tumor sample obtained from the patient into multiple tumor fragments; (b) adding the tumor fragments into a closed system; (c) performing a first expansion by culturing the first population of TILs in a cell culture medium comprising IL-2, optionally OKT-3, and optionally a tumor necrosis factor receptor superfamily (TNFRSF) agonist, to produce a second population of TILs, wherein the first expansion is performed in a closed container providing a first gas-permeable surface area, wherein the first expansion is performed for about 3-14 days to obtain the second population of TILs, wherein the second population of TILs is at least 50-fold greater in number than the first population of TILs, and wherein the transition from step (b) to step (c) occurs without opening the system; (d) performing a second expansion by supplementing the cell culture medium of the second population of TILs with additional IL-2, optionally OKT-3, and optionally a tumor necrosis factor receptor superfamily (TNFRSF) agonist, and antigen presenting cells (APCs), to produce a third population of TILs, wherein the second expansion is performed for about 7-14 days to obtain the third population of TILs, wherein the third population of TILs is a therapeutic population of TILs, wherein the second expansion is performed in a closed container providing a second gas-permeable surface area, and wherein the transition from step (c) to step (d) occurs without opening the system; (e) harvesting the therapeutic population of TILs obtained from step (d), wherein the transition from step (d) to step (e) occurs without opening the system; and (f) transferring the harvested TIL population from step (e) to an infusion bag, wherein the transfer from step (e) to (f) occurs without opening the system; (g) optionally cryopreserving the infusion bag comprising the harvested TIL population from step (f) using a cryopreservation process; and (h) administering a therapeutically effective dosage of the third population of TILs from the infusion bag in step (g) to the patient. 147. The method according to claim 5646, wherein the therapeutic population of TILs harvested in step (e) comprises sufficient TILs for administering a therapeutically effective dosage of the TILs in step (h). 148. The method according to claim 5647, wherein the number of TILs sufficient for administering a therapeutically effective dosage in step (h) is from about 2.3?10.sup.10 to about 13.7?10.sup.10. 149. The method according to claim 5648, wherein the antigen presenting cells (APCs) are PBMCs. 150. The method according to claim 5649, wherein the PBMCs are added to the cell culture on any of days 9 through 14 in step (d). 151. The method according to any one of claims 146 to 150, wherein the tumor necrosis factor receptor superfamily (TNFRSF) agonist is a 4-1BB antibody. 152. The method according to any of claims 146 to 151, wherein prior to administering a therapeutically effective dosage of TIL cells in step (h), a non-myeloablative lymphodepletion regimen has been administered to the patient. 153. The method according to claim 5652, where the non-myeloablative lymphodepletion regimen comprises the steps of administration of cyclophosphamide at a dose of 60 mg/m.sup.2/day for two days followed by administration of fludarabine at a dose of 25 mg/m.sup.2/day for five days. 154. The method according to any of claims 146 to 153, further comprising the step of treating the patient with a high-dose IL-2 regimen starting on the day after administration of the TIL cells to the patient in step (h). 155. The method according to claim 5654, wherein the high-dose IL-2 regimen comprises 600,000 or 720,000 IU/kg administered as a 15-minute bolus intravenous infusion every eight hours until tolerance. 156. The method according to any of claims 146 to 155, wherein the third population of TILs in step (d) is a therapeutic population of TILs which comprises an increased subpopulation of effector T cells and/or central memory T cells relative to the second population of TILs, wherein the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit one or more characteristics selected from the group consisting of expressing CD27+, expressing CD28+, longer telomeres, increased CD57 expression, and decreased CD56 expression relative to effector T cells, and/or central memory T cells obtained from the second population of cells. 157. The method according to any of claims 146 to 156, wherein the effector T cells and/or central memory T cells in the therapeutic population of TILs exhibit increased CD57 expression and decreased CD56 expression relative to effector T cells and/or central memory T cells obtained from the second population of cells. 158. The method according to any of claims 146 to 157, wherein the cancer is selected from the group consisting of melanoma, ovarian cancer, cervical cancer, non-small-cell lung cancer (NSCLC), lung cancer, bladder cancer, breast cancer, cancer caused by human papilloma virus, head and neck cancer (including head and neck squamous cell carcinoma (HNSCC)), renal cancer, and renal cell carcinoma. 159. The method according to any of claims 146 to 158, wherein the cancer is selected from the group consisting of melanoma, HNSCC, cervical cancers, and NSCLC. 160. The method according to any of claims 146 to 159, wherein the cancer is melanoma. 161. The method according to any of claims 146 to 160, wherein the cancer is HNSCC. 162. The method according to any of claims 146 to 161, wherein the cancer is a cervical cancer. 163. The method according to any of claims 146 to 162, wherein the cancer is NSCLC. 164. A cryopreservation composition comprising the population of TILs according to any one of the preceding claims, a cryoprotectant medium comprising dimethylsulfoxide (DMSO), and an electrolyte solution. 165. The cryopreservation composition according to claim 5664, further comprising one or more stabilizers and one or more lymphocyte growth factors. 166. The cryopreservation composition according to claim 5665, wherein the one or more stabilizers comprise human serum albumin (HSA) and the one or more lymphocyte growth factors comprise IL-2. 167. The cryopreservation composition according to claim 5666, wherein the composition optionally comprises OKT-3. 168. The cryopreservation composition according to claim 5664, wherein the cryoprotectant medium comprising DMSO and the electrolyte solution are present in a ratio of about 1.1:1 to about 1:1.1. 169. The cryopreservation composition according to claim 5668, wherein the cryoprotectant medium comprising DMSO and the electrolyte solution are present in a ratio of about 1:1. 170. The cryopreservation composition according to claim 5664, wherein 100 mL of the composition comprises the population of TILs in an amount of about 1?10.sup.6 to about 9?10.sup.14; the cryoprotectant medium comprising DMSO in an amount of about 30 mL to about 70 mL, the electrolyte solution in an amount of about 30 mL to about 70 mL; HSA in an amount of about 0.1 g to about 1.0 g; and IL-2 in an amount of about 0.001 mg to about 0.005 mg. 171. The cryopreservation composition according to claim 5664, wherein 100 mL of the composition comprises the population of TILs in an amount of about 1?10.sup.7 to about 1?10.sup.11; the cryoprotectant medium in an amount of about 30 mL to about 70 mL, wherein the cryoprotectant medium comprises about 10% DMSO; the electrolyte solution in an amount of about 30 mL to about 70 mL; HSA in an amount of about 0.3 g to about 0.7 g; and IL-2 in an amount of about 0.001 mg to about 0.003 mg. 172. The cryopreservation composition according to claim 5664, wherein 100 mL of the composition consists essentially of the population of TILs in an amount of about 1?10.sup.7 to about 1?10.sup.11; the cryoprotectant medium in an amount of about 30 mL to about 70 mL, wherein the cryoprotectant medium consists essentially of about 10% DMSO; the electrolyte solution in an amount of about 30 mL to about 70 mL; HSA in an amount of about 0.3 g to about 0.7 g; and IL-2 in an amount of about 0.001 mg to about 0.003 mg. 173. The cryopreservation composition according to claim 5664, wherein the composition is for use in treating a subject with cancer. 174. A cryopreservation composition comprising a population of TILs, a cryoprotectant medium comprising dimethylsulfoxide (DMSO), and an electrolyte solution, wherein 100 mL of the composition comprises the population of TILs in an amount of about 1?10.sup.7 to about 1?10.sup.11; the cryoprotectant medium in an amount of about 30 mL to about 70 mL, wherein the cryoprotectant medium comprises about 10% DMSO; the electrolyte solution in an amount of about 30 mL to about 70 mL; HSA in an amount of about 0.3 g to about 0.7 g; and IL-2 in an amount of about 0.001 mg to about 0.003 mg. 175. A cryopreservation composition consisting essentially of a population of TILs, a cryoprotectant medium comprising dimethylsulfoxide (DMSO), and an electrolyte solution, wherein 100 mL of the composition consists essentially of the population of TILs in an amount of about 1?10.sup.7 to about 1?10.sup.11; the cryoprotectant medium in an amount of about 30 mL to about 70 mL, wherein the cryoprotectant medium consists essentially of about 10% DMSO; the electrolyte solution in an amount of about 30 mL to about 70 mL; HSA in an amount of about 0.3 g to about 0.7 g; and IL-2 in an amount of about 0.001 mg to about 0.003 mg. 176. An infusion bag comprising a cryopreservation composition according to any one of claims 164 to 175. 177. The infusion bag of claim 5676, wherein the infusion bag is a HypoThermosol-containing infusion bag. 178. A storage bag comprising a cryopreservation composition according to any one of claims 164 to 175. 179. The storage bag of claim 5678, wherein the storage bag is a CryoStore CS750 Freezing bag.
Examples
(699) The embodiments encompassed herein are now described with reference to the following examples. These examples are provided for the purpose of illustration only and the disclosure encompassed herein should in no way be construed as being limited to these examples, but rather should be construed to encompass any and all variations which become evident as a result of the teachings provided herein.
Example 1: Closed System Assays
(700) As discussed herein, protocols and assays were developed for generating TIL from patient tumors in a closed system.
(701) This Example describes a novel abbreviated procedure for generating clinically relevant numbers of TILs from patients' resected tumor tissue in G-REX devices and cryopreservation of the final cell product. Additional aspects of this procedure are described in Examples 2 to 8.
Definitions/Abbreviations
(702) BSCBiological Safety Cabinet ? C.degrees Celsius CO.sub.2Carbon dioxide CD3Cluster of Differentiation 3 CM1Complete Medium 1 CM2Complete Medium 2 TIWBTumor Isolation Wash Buffer CM4Complete Medium 4 CRFControl Rate Freezer EtOHethanol GMPGood Manufacturing Practice IL-2, rIL-2-Interleukin-2, Recombinant human Interleukin-2, IUInternational Unit LLiter LN2liquid nitrogen mLmilliliter ?lmicroliter mMmillimolar ?mmicrometer NANot Applicable PBMCPeripheral Blood Mononuclear Cell PPEPersonal Protective Equipment Pre-REPInitial TIL cultures originating from tumor fragments REPRapid Expansion Protocol TILTumor Infiltrating Lymphocytes TIWBTIL Isolation Wash Buffer SOPStandard Operating Procedure
Procedure 1. Advanced preparation: Day 0 (Performed up to 36 hours in advance) 1.1 Prepared TIL Isolation Wash Buffer (TIWB) by supplementing 500 mL Hanks Balanced Salt Solution with 50 ?g/mL Gentamicin. For 10 mg/mL Gentamicin stock solution transferred 2.5 mL to HBSS. For 50 mg/mL stock solution transferred 0.5 mL to HBSS. 1.2. Prepared CM1 media with GlutaMax? per LAB-005 Preparation of media for PreREP and REP for CM2 instructions. Store at 4? C. up to 24 hours. Allowed to warm at 37? C. for at least 1 hour prior to use. 1.3. Removed IL-2 aliquot(s) from ?20? C. freezer and placed aliquot(s) in 2-8? C. refrigerator. 2. Receipt of tumor tissue 2.1. Kept all paperwork received with tumor tissue and obtained photos of transport container and tumor tissue. 2.2. If TempTale was provided printed and saved the associated document; saved the PDF. 2.3. Removed tumor specimen and secondary container (zip top bag) from shipper and stored at 4? C. until ready for processing. 2.4 Shipped unused tumor either in HypoThermasol or as frozen fragments in CryoStor CS10 (both commercially available from BioLife Solutions, Inc.). 3. Tumor processing for TIL 3.1. Aseptically transferred the following materials to the BSC, as needed, and labeled according to Table 3 below.
(703) TABLE-US-00009 TABLE 3 Materials for tumor isolation. Minimum Item Quantity In-Process Label Tumor 1 N/A Petri dish, 150 mm 1 Dissection Petri dish, 100 mm 4 Wash 1, 2, 3, 4 Petri dish, 100 mm 1 Unfavorable Tissue 6 well plate 2 Lid Label - Tumor Fragments Plate Bottom - Favorable Tissue Ruler 2 N/A Wash Buffer 1 N/A Forceps 1 N/A Long forceps 1 N/A Scalpel As needed N/A 3.2. Labeled the circles of the Tumor Fragments Dishes with the letters A-J. 3.3. Labeled the undersides of the wells of the Favorable Tissue Dishes with the letters A-J. 3.4. Transferred 5 mL Gentamicin to the HBSS bottle. Labeled as TIWB. 3.5. Swirled to mix. 3.6. Pipetted 50 mL TIWB to each of the following: 1. Wash 1 dish 2. Wash 2 dish 3. Wash 3 dish 4. Wash 4 dish 3.7. Pipetted 2 mL TIWB into wells A-J of the Favorable Tissue Dish. 3.8. Covered the Favorable Tissue Dishes (6-well plate bottom) with the corresponding Tumor Fragments Dish (6-well plate lid). 3.9. Using long forceps, removed the tumor(s) from the Specimen bottle and transferred to the Wash 1 dish. 3.10. Incubated the tumor at ambient temperature in the Wash 1 dish for 3 minutes. 3.11. During the incubation, relabeled the Specimen bottle Bioburden and stored at 2-8? C. until submitted to Quality Control for testing. 3.12. Discarded long forceps and used short forceps for further manipulations. 3.13. Using forceps transferred the tumor to the Wash 2 dish. 3.14. Incubated the tumor at ambient temperature in the Wash 2 dish for 3 minutes. 3.15. Using forceps transferred the tumor to the Wash 3 dish. 3.16. Incubated the tumor at ambient in the Wash 3 dish for 3 minutes. 3.17. Removed the Tumor Fragment Dishes (6-well plate lids) from the Favorable Tissue Dishes (6-well plate bottoms) and placed the Tumor Fragments Dishes upside down on the BSC surface. 3.18. Using a transfer pipette, added approximately 4 evenly-spaced, individual drops of TIWB to each circle of the Tumor Fragments dishes. 3.19. Placed a ruler underneath the Dissection dish. 3.20. Using forceps transferred the tumor to the Dissection dish. 3.21. Using the ruler under the Dissection dish, measured and recorded the length of the tumor. 3.22. For tumors greater than 1 cm additional Favorable Tissue Dishes were made. 3.23. Performed an initial dissection of the tumor pieces in the Dissection dish into 10 intermediate pieces and care was taken to conserve the tumor structure of each intermediate piece. 3.24. Transferred any intermediate tumor pieces not being actively dissected into fragments to the Wash 4 dish to ensure the tissue remained hydrated during the entire dissection procedure. 3.25. Working with one intermediate tumor piece at a time, carefully sliced the tumor into up to 3?3?3 mm fragments in the Dissection Dish, using the ruler underneath the dish for reference. When scalpel became dull, replaced with a new scalpel. 3.26. Continued dissecting fragments from the intermediate tumor piece until all tissue in the intermediate piece had been evaluated. 3.27. Selected favorable fragments and using a transfer pipette transferred up to 4 favorable fragments into the TIWB drops in one circle in the Tumor Fragments dish. 3.28. Using a transfer pipette transferred any remaining favorable fragments from the tumor piece, when available, to the corresponding well in the Favorable Tissue Dish. 3.29. Using a transfer pipette transferred as much as possible of the unfavorable tissue and waste product to the Unfavorable Tissue dish to clear the dissection dish. Unfavorable tissue was indicated by yellow adipose tissue or necrotic tissue. 3.30. Continued processing by repeating step 7.3.25-7.3.30 for the remaining intermediate tumor pieces, working one intermediate piece at a time until all of the tumor had been processed. 3.31. If fewer than 4 tumor fragments were available in the corresponding circle of the Tumor Fragments Dish, it was acceptable to use fragments from a non-corresponding well of the Favorable Tissue Dish as available to achieve the 40 fragment goal. When less than 40 fragments, 10-40 were placed in a singled G-Rex 100M flask. 4. Seeding G-Rex 100M flask 4.1. Aseptically transferred the following materials to the BSC, as needed, and labeled according to the Table 4 below.
(704) TABLE-US-00010 TABLE 4 Additional Materials for Seeding Flasks. Minimum Item Quantity In-Process Label G-Rex 100M flask As Needed Lot# Warm CM1 As Needed Lot# IL-2 Aliquots As Needed Lot# 4.2. Supplemented each liter of CM1 with 1 mL of IL-2 stock solution (6?10.sup.6 IU/mL). 4.3. Placed 1000 mL of pre-warmed CM1 containing 6,000 IU/mL of IL-2 in each G-REX 100M bioreactor needed as determined by Table 5 below. 4.4. Using a transfer pipette, transferred the appropriate number of tumor fragments to each G-Rex 100M flask, distributing fragments per Table 5. 4.5. When one or more tumor fragments transferred to the G-Rex 100M flask float, obtained one additional tumor fragment if available from the Favorable Tissue Dish and transferred it to the G-Rex 100M flask. 4.6. Recorded the total number of fragments added to each flask. 4.7. Discarded the Unfavorable Tissue dish. 4.8. Placed each G-REX 100M bioreactor in 37? C., 5% CO.sub.2 incubator. 4.9. When more than 40 fragments were available: 4.9.1. When >41 fragments were obtained, placed 1000 mL of pre-warmed complete CM1 in a second G-REX 100M bioreactor.
(705) TABLE-US-00011 TABLE 5 Number of G-REX bioreactors needed. Number of Number of Fragments G-REX G-REX CM1 needed 1-40 G-REX 100M 1 1000 mL 41-80 distribute G-REX 100M 2 2000 mL between flasks >80 Freeze fragments in CS10 after 15 minute pre- incubation 5. Advanced Preparation: Day 11 (Prepared up to 24 hours in advance) 5.1. Prepared 6 L of CM2 with GlutaMax. Used reference laboratory procedures for Preparation of media for PreREP and REP for CM2 instructions. Warmed at 37? C. 1 hour prior to use. 5.2. Thawed IL-2 aliquots: Removed IL-2 aliquots from freezer and placed at 4? C. 6. Harvest TIL (Day 11) 6.1. Carefully removed G-REX-100M flasks from incubator and placed in BSC2. Were careful to not disturb the cells on the bottom of the flask. 6.2. Using GatherRex or peristaltic pump aspirated ?900 mL of cell culture supernatant from flask(s). 6.3. Resuspended TIL by gently swirling flask. Observed that all cells have been liberated from the membrane. 6.4. Using peristaltic pump or GatherRex transferred the residual cell suspension to an appropriately sized blood transfer pack (300-1000 mL). Was careful to not allow the fragments to be transferred to the blood transfer pack. 6.5. Spiked the transfer pack with a 4 plasma transfer set (ensure clamp is closed). 6.6. Massaged the pack to ensure the cell suspension was well mixed and using a 3 mL syringe, removed 1 mL TIL suspension for cell counts. Clamped the tubing and recapped female luer connector with a new sterile luer cap. 6.7. Placed the transfer pack into a plastic zip top bag and replaced into the incubator until ready to use. 7. Media preparation 7.1. Allowed media to warm at 37? C. for >1 hr. 7.2. Added 3 mL of 6?10.sup.6 IU/mL stock rhIL-2 to 6 L CM2 to reach a final concentration of 3,000 IU/mL rhIL-2. Label as complete CM2. 7.3. Sterile welded a 4 plasma transfer set with female luer to a 1 L Transfer pack. 7.4. Transferred 500 mL complete CM2 to a 1 L transfer pack. Detached fluid transfer set or syringe and attached a sterile luer plug to the female luer port. 7.5. Spiked the pack with a sample site coupler. 7.6. Using a 1.0 mL syringe with needle drew up 150 ?L of 1 mg/mL anti-CD3 (clone OKT3) and transferred to 500 mL complete CM2 through sample site coupler. Drew back on the syringe to ensure all reagent was flushed from the line. Stored at 37? C. until use. 8. Flask preparation 8.1. Transferred 4.5 L complete CM2 to a G-REX-500M flask using the graduations on the flask for reference. 8.2. Placed flask into 37? C. incubator until ready. 9. Thaw irradiated feeders 9.1. Utilized 5.0?10.sup.9 allogenic irradiated feeders from two or more donors for use. 9.2. Removed feeders from LN2 freezer and placed in a biohazard transport bag. 9.3. With feeder bags in the biohazard transport bag, thawed feeders in 37? C. incubator or bead bath. Kept bags static and submerged. Removed feeders from bath when almost completely thawed but still cold. 9.4. Sprayed or wiped feeder bags with 70% EtOH and place in BSC2. Added each feeder bag directly to the open G-Rex 500M to assure sufficient number of irradiated cells (5?10.sup.9 cells, +/?20%). 9.5. Closed both clamps on a fenwal Y type connector with male luer lock. 9.6. Spiked each feeder bag with a leg of the Y connector. 9.7. Removed 1 L transfer pack with 500 mL complete CM2+OKT3 and transferred to BSC. 9.8. Aseptically attached a 60 mL syringe to a 3 way stopcock, and aseptically attached the transfer pack to the male end of the stopcock. 9.9. Aseptically attached the Y connector to the 3 way stopcock. 9.10. Drew the entire contents of the feeder bags into the syringe, recorded the volume, and dispensed 5.0?10.sup.9 allogenic irradiated feeders into the transfer pack. 9.11. Clamped and detached transfer pack from apparatus, and plug female luer lock with a new sterile luer plug. 9.12. Using a needle and 3 mL syringe pulled 1 mL for cell counts from the sample site coupler. 9.13. When +/?10% of the target cell number (5.0?10.sup.9) was reached with >70% viability, proceeded. 9.14. When less than 90% of the target cell number (5.0?10.sup.9) was reached with >70% viability thawed another bag and repeated 7.9.4-7.9.12. When greater than 110% of the target cell number was achieved, calculated the proper volume required for desired cell dose and proceeded. 10. Co-culture TIL and feeders in G-REX 500M flask 10.1. Removed the G-REX 500M flask containing prepared media from the incubator and placed in the BSC2. 10.2. Attached feeder transfer pack to G-REX-500M and allowed contents of the bag to drain into the 500M. 10.3. Removed TIL suspension from the incubator and placed in the BSC. 10.4. Calculated volume of TIL suspension to add to achieve 200?10.sup.6 total viable cells.
(TVC/mL)/200?10.sup.6=mL 10.5. When TIL were between 5-200?10.sup.6 total viable cells, added all TIL (total volume) to the G-REX-500M. When TIL count was greater than 200?10.sup.6 total viable cells, added calculated volume necessary for 200?10.sup.6 TIL to be distributed to an individual G-REX-500M. Remaining TIL were spun down and frozen in at least two cryovials at up to 10.sup.8/mL in CS10, labeled with TIL identification and date frozen. 10.6. Placed the G-REX-500M in a 37? C., 5% CO.sub.2 incubator for 5 days. 11. Advanced preparation: Day 16-18 11.1. Warmed 1 10 L bag of AIM V for cultures initiated with less than 50?10.sup.6 TIL warmed 2 for those initiated with greater than 50?10.sup.6 TIL at 37? C. at least 1 hr or until ready to use. 12. Perform TIL cell count: Day 16-18 12.1. Removed G-REX-500M flask from incubator and placed in BSC2. Were careful not to disturb the cell culture on the bottom of the flask. 12.2. Aseptically removed 4 L of cell culture media from the G-REX-500M flask and placed into a sterile container. 12.3. Swirled the G-REX-500M until all TIL had been resuspended from the membrane. 12.4. Using GatherRex or peristaltic pump transferred cell suspension to a 2L transfer pack. Retained the 500M flask for later use. Sealed the port with the sample site coupler to avoid loss of TILs. 12.5. Spiked the transfer pack with a sample site coupler and using a 3 mL syringe and needle removed 2?1 mL independent samples for a cell count. 12.6. Calculated the total number of flasks required for subculture according to the following formula. Rounded fractions up.
Total viable cells/1.0?10.sup.9=flask # 13. Prepare CM4 13.1. Prepared a 10 L bag of AIM-V for every two 500M flasks needed. Warmed additional media as necessary. 13.2. For every 10 L of AIM-V needed, added 100 mL of GlutaMAX to make CM4. 13.3. Supplemented CM4 media with rhIL-2 for a final concentration of 3,000 IU/mL rhIL-2. 14. Split the cell culture 14.1. Using the graduations on the flask, gravity filled each G-REX-500M to 5 L. 14.2. Evenly distributed the TIL volume amongst the calculated number of G-REX ?500 Ms. 14.3. Placed flasks in a 37? C., 5% CO.sub.2 incubator until harvest on Day 22 of REP. 15. Advanced Preparation: Day 22-24 15.1. Prepared 2 L of 1% HSA wash buffer by adding 40 mL of 25% HSA to each of two 1 L bags of PlasmaLyte A 7.4. Pool into a LOVO ancillary bag. 15.2. Supplemented 200 mL CS10 with IL-2 @ 600 IU/mL. 15.3. Pre-cooled four 750 mL aluminum freezer canisters at 4? C. 16. Harvest TIL: Day 22-24 16.1. Removed the G-REX-500M flasks from the 37? C. incubator and placed in the BSC2. Were careful to not disturb the cell culture on the bottom of the flask. 16.2. Aspirated and discarded 4.5 L of cell culture supernatant from each flask. 16.3. Swirled the G-REX-500M flask to completely resuspend the TIL. 16.4. Weighed the 3-5 L bioprocess bag prior to use. 16.5. Using GatherRex or peristaltic pump, harvested TIL into the bioprocess bag. 16.6. Mixed bag well and using a 3 mL syringe take 2?2 mL samples from the syringe sample port for cell counting. 16.7. Weighed the bag and found the difference between the initial and final weight. Used the following calculation to determine the volume of cell suspension.
Net weight of cell suspension (mL)/1.03=volume (mL) 17. Filter TIL and prepare LOVO Source bag 17.1. Placed the bag containing cell culture into the BSC2. 17.2. Placed a 170 ?m blood filter into the BSC2 and closed all clamps. 17.3. Sterile welded a source leg of the filter to the cell suspension. 17.4. Weighed a new appropriately sized bioprocess bag (this was referred to as the LOVO source bag). 17.5. Sterile welded the terminal end of the filter to the LOVO source bag. 17.6. Elevated the cell suspension by hanging cells on an IV pole to set up a gravity-flow transfer of cells. Note: (Did not allow the source bag to hang from the filtration apparatus.) 17.7. Opened all necessary clamps and allowed TIL to drain from the cell suspension bag through the filter and into the LOVO source bag. 17.8. Once all cells were transferred to the LOVO source bag, closed all clamps and sealed the LOVO source bag tubing to remove filter. 17.9. Weighed the LOVO source bag and calculate volume. 17.10. The LOVO source bag was ready for the LOVO. 17.11. Removed the LOVO final product bag from the disposable kit by sealing the tubing near the bag. 18. Formulate TIL 1:1 in cold CS10 supplemented with 600 IU/mL rhIL-2 18.1. Calculated required number of cryobags needed. (volume of cell product?2) 100 number of required bags (round down) 18.2. Calculated the volume to dispense into each bag. (volume of cell product?2) number of required bags volume to add to each bag 18.3. Aseptically transferred the following materials in Table 6 to the BSC.
(706) TABLE-US-00012 TABLE 6 Materials for TIL cryopreservation. Minimum Item Quantity In-Process Label Cell product 1 Lot# Aluminum freezer cassette 1 n/a (750 ml) Cold CS10 + IL-2 @600 As Needed Lot# IU/mL Cell Connect CC1 device 1 n/a 750 mL cryobags calculated Label aliquots 1- largest# 100 mL syringe #cryobags + 1 n/a 3 way stopcock 1 n/a Cryovials 5 TIL Cryo-product satellite vials 19. TIL formulation 19.1. Closed all clamps on Cell Connect CC1. 19.2. To the cell connect device aseptically attached the LOVO final product, CS10 bag luer lock and the appropriate number of cryobags. Replaced the 60 mL syringe with a 100 mL syringe. 19.3. The amount of CS10 volume needed was equivalent to the volume of the LOVO final product bag. 19.4. Opened the stopcock pathway and unclamp the line between the LOVO final product bag and syringe to pull CS10 into the syringe, reclamp CS10 path. Unclamped pathway to the cell bag to push CS10 into the LOVO final product bag. Used the syringe to measure the volume added to the LOVO final product bag. Repeated as necessary using a new syringe until desired amount of CS10 is transferred. 19.5. Mixed LOVO final product bag by inversion. 19.6. Replaced 100 mL syringe 19.7. Opened clamps on 750 mL cryobags one at a time 19.8. Only opened clamps that are directly associated with the formulated product and the cryobag in use. 19.9. Used the 100 mL syringe to measure the volume of formulated product leading to the cryobag. 19.10. Transferred 100 mL of formulated product into each cryobag. 19.11. After addition to each bag pulled back on the syringe to remove all air bubbles from cryobags and reclamped the associated line. 19.12. On the final bag pull back a 10 mL retain for QC testing. 19.13. Sealed each cryobag, leaving as little tubing as possible. 19.14. Removed the syringe containing the retained sample and transferred to a 50 mL conical tube; transferred 1.5 ml into individual cryovials and froze into a controlled rate freezer. 19.15. Transferred sealed bags to 4? C. while labels were prepared. 19.16. Labeled each cryobag with product description, name and date, volume, cell count, and viability. 19.17. Placed each cryobag into pre-cooled aluminum freezer canisters. 20. Cryopreservation of TIL using Control Rate Freezer (CRF) 20.1. Followed standard procedure for the controlled rate freezer. 20.2. After using the CRF, stored cryobags in liquid nitrogen (LN2). 21. Determined expected results and measure acceptance criteria.
Example 2: Process Run on 8 Patient Tumors
(707) The process of Example 1 was run using 8 patient tumors to produce 8 batches of TILs. Good recovery from culture, viability, cell counts, CD3+(indicating the % T cell content) and IFN-gamma (IFN-g or IFN-?) release were obtained, as shown in Table 7 below and in
(708) TABLE-US-00013 TABLE 7 Results of Testing of Identity, Potency, and Viability/Recovery of the Process of Example 1. IFNg Cells/mL (pg/1e6 (Viable + % Recovery cells/24 hr) CD3 (%) Nonviable) Fresh/tovo % Viability M1061T 4570 95.3 1.27E+08 103 88.1 M1062T 3921 99.7 1.65E+08 89 84.5 M1063T 5587 98.7 1.51E+08 112 82.1 M1064T 619 84.5 1.75E+08 83 86.8 M1065T 1363 96.8 3.42E+07 128 76.4 EP11001T 4253 90.4 1.82E+08 92 77.9 M1056T 6065 94.2 2.11E+08 85 84.8 M105ST 1007 99 2.72E+08 89 87.6
Example 3: Scalability of Modified TIL Process
(709) The studies presented here were performed in a process development (PD) lab, and subsequently, a process qualification (PQ) study utilizing engineering runs was performed in the GMP clean room suite at a manufacturing facility. Three PQ/engineering runs were completed in the GMP facility clean room according to a qualification protocol, and a batch record based on the PD studies presented here. Acceptance criteria for the engineering runs were set prospectively. The PQ study is further summarized below, and test results obtained for the engineering batches are provided in the following sections.
(710) The number of cells generated from pre-rapid expansion protocol (pre-REP) cultures often exceeded 100?10.sup.6 viable cells. In addition, including a freeze-thaw cycle between the Pre-REP and REP culture steps reduced the viable cell yield. By eliminating the in-process cryopreservation step, the REP could be reliably and regularly initiated with an increased number of TIL. This change allowed the duration of the REP to be decreased by a proportional amount of cell doubling times to roughly 11 days without impacting cell dose. In addition, the reduced culture time from activation to harvest results in a product that is less differentiated and potentially better able to persist in-vivo (Tran 2008).
(711) The PD study validated the initiation of the REP culture with up to 200?10.sup.6 cells with a fixed number of feeder cells. The optimal time to harvest the REP culture was then evaluated over 9 to 14 days. Cultures were seeded at feeder to TIL ratios ranging from 100:1 to 25:1. Optimization of harvest time was determined by measuring total cell count, viability, immunophenotype, media consumption, metabolite analysis, interleukin-2 (IL-2) analysis, and the functional analyses described below.
(712) Immunophenotyping of cells at the end of the REP culture was evaluated on the basis of the markers listed in Table 8 below. The phenotypic activation and differentiation state of the cells was evaluated. Statistical differences in phenotype were not observed among any of the experimental conditions.
(713) TABLE-US-00014 TABLE 8 Markers of Activation and Differentiation Assayed on Process Optimization Cultures. Target Label for Detection Clone Panel 1 TCRab (i.e., TCR?/?) PE/Cy7 IP26 CD57 PerCP-Cy5.5 HNK-1 CD28 PE CD28.2 CD4 FITC OKT4 CD27 APC-H7 M-T271 CD56 APC N901 CD8a PB RPA-T8 Panel 2 CD45RA PE/Cy7 HI100 CD3 PerCP/Cy5.5 SP34-2 CCR7 PE 150503 CD8 FITC HIT8 CD4 APC/Cy7 OKT4 CD38 APC HB-7 HLA-DR PB L243 Panel 3 CD137 PE/Cy7 4B4-1 CD3 PerCP/Cy5.5 SP34-2 Lag3 PE 3DS223H CD8 FITC HIT8 CD4 APCCy7 OKT4 PD1 APC EH12.2H7 Tim-3 BV421 F38-2E2 Abbreviations: PE/Cy7 = Phycoerythrin: Cy-7 Tandem Conjugate; PerCP-Cy5.5 = Peridinin-chlorophyll-protein Complex: CY5.5 Conjugate; PE = Phycoerythrin; FITC = Fluorescein Isothiocyanate Conjugate; APC-H7 = Allophycocyanin: H7 Tandem Conjugate; APC = Allophycocyanin; PB = Pacific Blue?
(714) Media consumption and metabolite production remained within tolerable limits for all conditions tested; and IL-2 levels remained greater than 150 IU/mL of culture supernatant (data not shown).
(715) Tumor cell killing by T-cells is understood to be mediated by activation of the T-cell receptor on the effector T-cell in response to peptides presented on the surface of tumor cells. Ex vivo expanded T-cells must retain the ability to be activated and proliferate in response to TCR activation if they are to persist in vivo upon infusion and mediate tumor regression.
(716) To assess the activation potential of the cultured cells, TIL harvested at different time points were reactivated with irradiated allogeneic PBMC loaded with OKT3. TIL cultures were harvested after 7 days and assayed for fold-expansion. The results of this study are summarized in TABLE 9.
(717) TABLE-US-00015 TABLE 9 Summary of Results: Proliferation of Post-REP TIL Upon Re-culture with OKT3 Loaded Allogeneic PBMC. P-value Harvest Day Fold-Expansion SD (Student ttest) Experiment 1 Day 9 43 6.088 NA Day 10 48 3.105 NA Day 11 71 11.137 0.135 Day 14 60 6.995 Experiment 2 Day 9 44 6.276 NA Day 10 27 4.762 NA Day 11 72 18.795 0.045 Day 14 41 7.050 Experiment 3 Day 9 54 5.810 NA Day 10 54 9.468 NA Day 11 65 1.674 0.071 Day 14 50 8.541
(718) This study demonstrated that the potential for TIL to be activated in this assay increased with each day of culture through Day 11 (harvest Days 9-11). Cells harvested on Day 11 of the modified process performed similarly to control TIL maintained in culture for 14 days similar to the current process.
(719) These studies demonstrated the scalability of the modified TIL process and established an acceptable range of seeding ratios of TIL to feeder cells. In addition, the growth characteristics were found to persist through Day 14 of culture, while culture conditions remained optimal through Day 11. The conditions tested showed no measurable effect on TIL phenotype. Cells harvested on REP culture Day 11 demonstrated the best ability to respond to reactivation while the cell culture conditions remained within tolerances. These changes were adopted and validated at full scale with the culture split occurring on Day 5 and harvest on Day 11.
(720) Engineering runs were implemented at the process development facility in order to gain experience in manufacturing and testing the TIL product prior to the GMP manufacturing of autologous TIL product for administration to patients. The manufacturing procedure used for the engineering runs was at the same scale as that to be used in the manufacturing of GMP TIL product. Experience in growing TIL from various types of tumors including metastases of melanoma, breast, head and neck squamous cell carcinoma (HNSCC), cervical carcinoma, and lung cancer has determined that the dissection and outgrowth of TIL from metastatic tumor samples is similar for these cancers (Sethuraman 2016, JITC P42). Because the initial isolation of tumor fragments and outgrowth of lymphocytes appears to be similar between tumor histologies, these engineering runs are sufficient to qualify the process for the production of TIL from HNSCC, cervical and melanoma tumors.
(721) Table 10 shows the source and characteristics of tumor samples used for the engineering runs.
(722) TABLE-US-00016 TABLE 10 Tumor Samples Tested for Engineering Runs. Engineering Engineering Engineering Tumor Sample Run 1 Run 2 Run 3 Patient ID 1001185 600-D455 40231 Source Biotheme Research BioOptions Moffitt Tissue Lung, Left Breast, Melanoma ERPR+Her2? Date Processed Jan. 5, 2017 Jan. 12, 2017 Jan. 26, 2017
(723) Release testing of the three engineering runs of TIL at the process development facility was completed (Table 11) as described below. Product was tested on Day 16 and Day 22. IFN-? secretion was also determined for the three engineering runs (Table 12) as detailed elsewhere.
(724) TABLE-US-00017 TABLE 11 Product Release Test Results for Engineering Runs at Process Development Facility. Test Acceptance Engineering Runs Parameter Method Criteria Run 1 Run 2 Run 3 Day 16 Sterility* BacT Alert No Grwoth No growth No growth No growth Mycoplasma PCR Negative from Negative Negative Negative Day 7 split Day 22 Viability (%) AOPI ?70% 82.3% 85.13% 84.6% Total Viable AOPI Report results 2.6 ? 10.sup.10 1 ? 10.sup.10 1.4 ? 10.sup.11 Cells Sterility Gram Stain Negative Negative Negative Negative Sterility Final BacT/Alert No Growth Negative Negative Pending Product* % CD45.sup.+CD3.sup.+ Flow ?90% 99.3% 96.3% 99.8% cytometey Endotoxin Endo Safe ?0.7 EU/mL <0.5 EU/mL <0.5 EU/mL <0.5 EU/mL Mycoplasma PCR Negative Negative Negative Negative Final Product Appearance Visual Intact bag with Intact bag, no Intact bag, no Intact bag, Inspection no visible clumps visible clumps visible clumps no visible clumps *Final sterility results for Day 16 and Day 22 are not available until after final product release for shipment. The gram stain results from Day 22 are used for sterility shipment release.
(725) TABLE-US-00018 TABLE 12 Additional Functional Characterization: Measurement of IFN-? Secretion. Functional Expected Engineering Run Characterization Method Results Run 1 Run 2 Run 3 IFN-? Stimulation with ELISA >2 standard 3085 +/? 182 2363 +/? 437 pending anti-CD3, CD28, CD137 deviations over (pg/million cells) non-stimulated IFN-? Non-stimulated ELISA Not applicable 34 +/? 5 27 +/? 10 pending (pg/million cells)
(726) In conclusion, the data from the engineering runs demonstrate that TIL drug product can be manufactured for the purpose of autologous administration to patients.
Example 4: Lymphodepletion
(727) Cell counts can be taken at day 7 and prior to lymphodepletion. The final cell product included up to approximately 150?10.sup.9 viable cells formulated in a minimum of 50% HypoThermosol? in Plasma-Lyte A? (volume/volume) and up to 0.5% HSA (compatible for human infusion) containing 300 IU/mL IL2. The final product was available for administration in one of two volumes for infusion: 1) 250 mL (in a 300-mL capacity infusion bag) when the total TIL harvested are ?75?10.sup.9 OR 2) 500 mL (in a 600-mL capacity infusion bag) when the total TIL harvested are <150?10.sup.9
(728) The total number of cells that could be generated for the final TIL infusion product for each patient due to patient-to-patient variation in T-cell expansion rates during the REP step cannot be predicted. A lower limit of cells on day 3, 4, 5, 6, 7 of the 3 to 14-day REP is set based on the minimum number of cells needed in order to make a decision to lymphodeplete the patient using the cyclophosphamide plus fludarabine chemotherapy regimen. Once we have begun lymphodepletion based on this minimal attained cell number, we are committed to treating the patient with the available number of TIL we generate in the REP by any of days 3 to 14, and in many cases day 7. The upper limit of the range for infusion (150?10.sup.9 viable cells) is based on the known published upper limit safely infused where a clinical response has been attained. Radvanyi, et al., Clin Cancer Res 2012, 18, 6758-6770.
Example 5: Process 2ADay 0
(729) This example describes the detailed day 0 protocol for the 2A process described in Examples 1 to 4.
(730) Preparation. 1. Confirmed Tumor Wash Medium, CM1, and IL-2 are within expiration date. 2. Placed CM1 (cell media 1) in incubator.
(731) Method. 1. Cleaned the biological safety cabinet (BSC). 2. Set up in-process surveillance plates and left in biosafety cabinet for 1-2 hours during procedure. 3. Placed the TIL media CM1 in the biological safety cabinet. 4. Prepared TIL media CM1 containing 6000 IU/mL IL-2: 4.1. 1 L CM1 4.2. 1 ml IL-2 (6,000,000 IU/mL) 4.3. Placed 25 ml of CM1+IL2 into 50 ml conical to be used for fragments when adding to G-REX. 4.4. Placed in 37? C. incubator to pre-warm 5. Wiped G-REX 100MCS package with 70% alcohol and place in biosafety cabinet. Closed all clamps except filter line. 6. Performed Acacia pump calibration. 7. Attached the red line of G-REX 100MCS flask to the outlet line of the acacia pump boot. 8. Attached pumpmatic to inlet line of pump boot and placed in bottle with media. Released clamps to pump boot. 9. Pumped remaining 975 ml of pre-warmed CM1 containing 6,000 IU/ml of IL-2 in each G-REX 100MCS bioreactor. 10. Heated seal red line, disconnect from pump boot. 11. Placed label on G-REX. 12. Placed G-REX 100MCS in incubator until needed.
(732) Tissue Dissection 1. Recorded the start time of tumor processing. 2. Transferred Tumor Wash Medium to BSC. 3. Placed 5 100 mm petri dishes in biosafety cabinet, 3 for washes, 1 for holding and 1 for unfavorable tissue. Labeled dishes accordingly. Unfavorable tissue was indicated by yellow adipose tissue or necrotic tissue. 4. Placed three 6 well plates into biosafety cabinet. 5. Pipetted 3-5 mL of Tumor Wash Medium into each well of one six well plates for excess tumor pieces. 6. Pipetted 50 mL of Tumor Wash Medium to wash dishes 1-3 and holding dish. 7. Placed two 150 mm dissection dishes into biosafety cabinet. 8. Placed 3 sterile 50 mL conical tubes into the BSC. 9. Labeled one as forceps tumor wash medium, the second as scalpel tumor wash medium, and third for Tumor wash medium used in for lid drops. 10. Added 5-20 mL of tumor wash medium to each conical. The forceps and scalpels were dipped into the tumor wash media as needed during the tumor washing and dissection process. 11. Placed scapel and forceps in appropriate tubes. 12. Using long forceps removed the tumor(s) from the Specimen bottle and transferred to the Wash 1 dish. 13. Incubated the tumor at ambient in the Wash 1 dish for ?3 minutes. 14. During the incubation, re-labeled the Specimen bottle Bioburden and stored at 2-8? C. until the final harvest or further sterility testing is required. 15. Using forceps transferred the tumor to the Wash 2 dish. 16. Incubated the tumor at ambient in the Wash 2 dish for ?3 minutes. 17. During the incubation, using a transfer pipette, added approximately 4 evenly-spaced, individual drops of Tumor Wash Medium to each circle of the 6 well plate lids designated as Tumor Fragments dishes. 18. Using forceps transferred the tumor to the Wash 3 dish. 19. Incubated the tumor at ambient in the Wash 3 dish for ?3 minutes. 20. The 150 mm dish lid was used for dissection. Placed a ruler underneath. 21. Using forceps transferred the tumor to the Dissection dish, measured and recorded the length of the tumor. 22. Took photograph of tumor. 23. Performed an initial dissection of the tumor pieces in the Dissection dish into intermediate pieces taking care to conserve the tumor structure of each intermediate piece. 24. Transferred any intermediate tumor pieces not being actively dissected into fragments to the tissue holding dish to ensure the tissue remained hydrated during the entire dissection procedure. 25. Worked with one intermediate tumor piece at a time, carefully sliced the tumor into approximately 3?3?3 mm fragments in the Dissection Dish, using the rule underneath the dish for reference 26. Continued dissecting fragments from the intermediate tumor piece until all tissue in the intermediate piece had been evaluated. 27. Selected favorable fragments and using a transfer pipette transferred up to 4 favorable fragments into the wash medium drops in one circle in the Tumor Fragments dish. Using a transfer pipette scalpel or forceps, transferred, as much as possible of the unfavorable tissue and waste product to the Unfavorable Tissue dish to clear the dissection dish. All remaining tissue was place into one of the wells of the six-well plate. (Unfavorable tissue was indicated by yellow adipose tissue or necrotic tissue.) 28. Continued processing by repeating step 23-26 for the remaining intermediate tumor pieces, working one intermediate piece at a time until the entire tumor had been processed. (Obtained a fresh scalpel or forceps as needed, to be decided by processing technician.) 29. Moved fragment plates toward rear of hood. 30. Using transfer pipette, the scapel, or the forceps, transferred up to 50 of the best tumor fragments to the 50 mL conical tube labeled tumor fragments containing the CM1. 31. Removed floaters from 50 mL conical with transfer pipet. Recorded number of fragments and floaters. 32. Removed all unnecessary items from hood, retaining the favorable tissue plates if they contain extra fragments. Wiped hood with alcohol wipe. 33. Removed G-REX 100MCS from incubator, wipe with 70% alcohol and place in biosafety cabinet. 34. Swirled conical with tumor fragments and poured the contents on the 50 ml conical into the G-Rex 100MCS flask 35. If one or more tumor fragments transferred to the G-Rex 100M flask float, obtained one additional tumor fragment when available from the Favorable Tissue Dish and transfer it to the G-Rex 100M flask. 36. Recorded incubator # (s) and total number of fragments added to each flask. 37. Placed the G-REX 100M bioreactor in 37? C., 5% CO.sub.2 incubator 38. Any unused tumor were placed in 100 mL of HypoThermosol and delivered to the laboratory. 39. Recorded the stop time of tumor processing. 40. Discarded any un-used TIL complete media containing IL-2 and any un-used aliquots of IL-2. 41. Cleaned biological safety cabinet. 42. Placed the Bioburden sample in the proper storage conditions. 43. Recorded data. 44. Saved the picture as file specimen ID #Tumor process Date to the prepared patient's file. 45. Ordered and ensured delivery of settle plates to the microbiology lab.
Example 6: Process 2ADay 11
(733) This example describes the detailed day 11 protocol for the 2A process described in Examples 1 to 4.
(734) Prior Preparation. 1. Day before processing: 1.1. CM2 could be prepared the day before processing occurred. Place at 4? C. 2. Day of processing. 2.1. Prepared the feeder cell harness. 2.1.1. Closed all clamps on a CC2 and 4S-4M60 connector sets. 2.1.2. Sterile welded 4 spikes of 4S-4M60 harness to the spike line on the CC2 removing the spike. 2.1.3. Set aside for feeder cell pooling. 2.2. Prepared 5 mL of cryopreservation media per CTF-FORM-318 and place at 4? C. until needed.
(735) Clean Room Environmental MonitoringPre-Processing 1. Recorded clean room information. 2. Biosafety Cabinets (BSC) were cleaned with large saturated alcohol wipes or alcohol spray. 3. Verified Particle Counts for 10 minutes before beginning processing. 4. Set up in-process surveillance plates and left in biosafety cabinet for 1-2 hours during procedure.
(736) Prepare G-Rex 500MCS Flask: 1. Using 10 mL syringe aseptically transferred 0.5 mL of IL-2 (stock is 6?10.sup.6 IU/mL) for each liter of CM2 (cell media 2) into the bioprocess bag through an unused sterile female luer connector. 2. Used excess air in the syringe to clear the line, drew up some media from the bag and expel back into back. This ensured all the IL-2 has been mixed with the media. Mixed well. 3. Opened exterior packaging and place G-Rex 500MCS in the BSC. Closed all clamps on the device except large filter line. 4. Sterile welded the red harvest line from the G-Rex 500MCS to the pump tubing outlet line. 5. Connected bioprocess bag female luer to male luer of the Pump boot. 6. Hung the bioprocess bag on the IV pole, opened the clamps and pump 4.5 Liters of the CM2 media into the G-Rex 500MCS. Cleared the line, clamp, and heat seal. 7. Retained the line from pump to media. It was used when preparing feeder cells. 8. Placed G-Rex 500MCS in the incubator.
(737) Prepare Irradiated Feeder Cells 1. Sealed and removed spike(s) from IL TP. Clamped both lines. 2. Recorded the dry weight of a 1 L transfer pack (TP). 3. Sterile welded the 1 L transfer pack to the acacia pump boot ?12 from bag. 4. The other end of the pump tubing was still connected to the 10 L labtainer. 5. Pumped 500 mL CM2 by weight into the TP. 6. Closed clamp and sealed close to weld joint. 7. Placed in incubator. 8. Verified and Logged out feeder cell bags. 9. Recorded feeder lot used. 10. Wiped bags with alcohol. 11. Placed in zip lock bags. 12. Thawed feeder cells in the 37? C. (+/?1? C.) water bath. Recorded temperature of water bath. 13. Removed and dried with gauze. 14. Passed feeder cells through pass thru into Prep Room. 15. Transferred to BSC in Clean Room. 16. Using the previously prepared feeder harness, welded the 1 L TP with media to one of the unused lines on the sample port side of the 3 way stopcock as close as possible to the seal junction loosing as little tubing as possible. 17. Put feeder harness into BSC. 18. Spiked each of the 3 feeder bags with the spike from the feeder harness into the single port of the feeder bag. 19. Rotated the stopcock valve so the 1 L TP is in the OFF position. 20. Working with one bag at a time, opened the clamps on the line to the feeder bag, expel air in syringe and draw the contents of the feeder bag into the syringe. Expelled air from syringe helped in recovering cells. Closed clamp to feeder bag. 21. Recorded the volume recovered of thawed feeder cells in each bag. 22. Rotated the stopcock valve so that the feeder bag is in the OFF position 23. Opened the clamp on the TP and dispense the contents of the syringe into the TP. 24. Ensured the line has been cleared and re-clamp the TP. You may have had to draw some air into syringe from TP for use in clearing the line. 25. Mixed the cells well. 26. Closed clamp to feeder bag. 27. Rotated stopcock so syringe port is in the OFF position. Disconnected the 60 mL syringe from the stopcock. 28. Replaced with new syringe for each feeder bag. 29. Left syringe on after final bag. 30. Mixed final feeder formulation well. 31. Rotated stopcock so feeder cell suspension is in the OFF position. 32. Mixed cells cell and using a 5 mL syringe and needless port, rinsed port with some cell solution to ensure accurate sampling and remove 1 ml of cells, placed into tube labeled for counting. 33. Repeated with second syringe. These two independent samples each had a single cell count performed. 34. Turned stopcock so feeder suspension is in the OPEN position and using the 60 ml syringe attached to harness expelled air into the TP to clear the line. 35. Removed syringe and covered luer port with a new sterile cap. 36. Heated seal the TP close to weld joint, removed the harness. 37. Recorded mass of transfer pack with cell suspension and calculated the volume of cell suspension. 38. Placed in incubator. 39. Performed a single cell counts on the feeder cell sample and record data and attach counting raw data to batch record. 40. Documented the Cellometer counting program. 41. Verified the correct dilution was entered into the Cellometer. 42. Calculated the total viable cell density in the feeder transfer pack. 43. If cell count was <5?10.sup.9, thawed more cells, count, and added to feeder cells. 44. Re-weighed feeder bag and calculated volume. 45. Calculated volume of cells to remove.
(738) Addition of Feeder to G-REX 1. Sterile welded a 4 transfer set to feeder TP. 2. In the BSC attached an appropriately sized syringe to the female luer welded to the feeder transfer pack. 3. Mixed cells well and removed the volume calculated in step 40 or 41 to achieve 5.0?10.sup.9 cells. Discarded unneeded cells. 4. Using a 1 mL syringe and 18G needle draw up 0.150 mL of OKT3, removed needle and transferred to the feeder TP through the female luer. 5. Rinsed tubing and syringe with feeder cell and mixed bag well. Cleared the line with air from syringe. 6. Removed the G-Rex 500MCS from the incubator, wiped with alcohol wipes and placed beside the SCD. 7. Sterile welded the feeder bag to the red line on the G-Rex 500MCS. Unclamped the line and allowed the feeder cells to flow into the flask by gravity. 8. Ensured the line has been completely cleared then heat sealed the line close to the original weld and removed the feeder bag. 9. Returned the G-Rex 500MCS to the incubator and recorded time.
(739) Prepare TIL: Record Time Initiation of TIL Harvest 1. Carefully removed G-Rex 100MCS from incubator and closed all clamps except large filter line. 2. Welded a 1 L transfer pack to the redline on the G-REX 100MCS. 3. Closed clamp on a 300 ml TP. Heat seal ?12 inches from the bag removing the spike. Recorded dry weight/mass. 4. Sterile welded the 300 mL transfer pack to the cell collection line on the 100MCS close to the heat seal. Clamped the line. 5. Released all clamps leading to the 1 L TP. 6. Using the GatheRex transferred ?900 mL of the culture supernatant to the 1 L transfer pack. Gatherex stopped when air entered the line. Clamped the line and heat seal. 7. Swirled the flask until all the cells had been detached from the membrane. Checked the membrane to make sure all cells are detached. 8. Tilted flask away from collection tubing and allowed tumor fragments to settle along edge. 9. Slowly tipped flask toward collection tubing so fragments remain on opposite side of flask. 10. Using the GatheRex transferred the residual cell suspension into the 300 mL transferred pack avoiding tumor fragments. 11. Rechecked that all cells had been removed from the membrane. 12. If necessary, back washed by releasing clamps on GatheRex and allowed some media to flow into the G-Rex 100MCS flask by gravity. 13. Vigorously tapped flask to release cells and pumped into 300 ml TP. 14. After collection was complete, closed the red line and heat seal. 15. Heated seal the collection line leaving roughly the same length of tubing as when dry weight was recorded. 16. Recorded mass (including dry mass) of the 300 ml TP containing the cell suspension and calculated the volume of cell suspension. 17. In the BSC spike the 300 mL TP with a 4 plasma transferred set. Mixed cells well. Aseptically attached a 5 mL syringe draw 1 mL, placed in cryo vial. Repeated with second syringe. These were used for cell counting, viability. 18. Re-clamped and replaced luer cap with new sterile luer cap. 19. Placed in incubator and recorded time place in incubator. 20. Performed a single cell count on each sample and recorded data and attach counting raw data to batch record. 21. Documented the Cellometer counting program. 22. Verified the correct dilution was entered into the Cellometer. 23. If necessary adjusted total viable TIL density to ?2?10.sup.8 viable cells. 24. Calculated volume to remove or note adjustment not necessary. 25. In the BSC aseptically attached an appropriately sized syringe to the 300 mL TP. 26. If required, removed the calculated volume of cells calculated in the Calculate volume to remove table. 27. Clamped and heat sealed the 300 ml TP. 28. Transferred excess cells to an appropriately sized conical tube and placed in the incubator with cap loosened for later cryopreservation. 29. Removed the G-Rex 500MCS from the incubator and place beside the SCD. 30. Sterile welded the 300 ml TP to the inlet line of the Acacia pump. 31. Sterile welded the red line of the G-Rex 500MCS to the outlet line of the Acacia pump. 32. Pumped cells into flask. 33. Ensured the line has been completely cleared then heat sealed the red line close to the original weld. 34. Checked that all clamps on the G-Rex 500MCS were closed except the large filter line. 35. Returned the G-Rex 500MCS to the incubator and record the time placed in the G-Rex incubator. 36. Ordered and ensured delivery of settle plates to the microbiology lab.
Cryopreservation of Excess
(740) Calculated amount of freezing media to add to cells:
(741) TABLE-US-00019 TABLE 13 Target cell concentration was 1 ? 10.sup.8/ml A. Total cells removed (from step 15) mL B. Target cell concentration 1 ? 10.sup.8 cells/mL Volume of freezing media to add (A/B) mL 37. Spun down TIL at 400?g for 5 min at 20? C. with full brake and full acceleration. 38. Aseptically aspirated supernatant. 39. Gently tapped bottom of tube to resuspend cells in remaining fluid. 40. While gently tapping the tube slowly added prepared freezing media. 41. Aliquoted into appropriate size cryo tubes and record time cells placed into ?80? C.
Example 7: Process 2ADay 16
(742) This example describes the detailed day 16 protocol for the 2A process described in Examples 1 to 4.
(743) Clean Room Environmental MonitoringPre-Processing. 1. Biosafety Cabinets were cleaned with large saturated alcohol wipes or alcohol spray. 2. Verified Particle Counts for 10 minutes before beginning processing. 3. Set up in-process surveillance plates and left in biosafety cabinet for 1-2 hour during procedure.
(744) Harvest and Count TIL. 1. Warmed one 10 L bag of CM4 for cultures initiated with less than 50?10.sup.6 TIL in a 37? C. incubator at least 30 minutes or until ready to use. 2. In the BSC aseptically attached a Baxter extension set to a 10 L Labtainer bag. 3. Removed the G-Rex 500MCS flask from the incubator and placed on the benchtop adjacent the GatheRex. Checked all clamps were closed except large filter line. Moved the clamp on the quick connect line close to the T junction. 4. Sterile welded a 10 L Labtainer to the red harvest line on the G-Rex 500MCS via the weldable tubing on the Baxter extension. 5. Heat sealed a 2 L transfer pack 2 below the Y removing the spike and recorded dry weight. Sterile welded the 2 L TP to the clear collection line on the G-Rex 500MCS. 6. Set the G-Rex 500MCS on a level surface. 7. Unclamped all clamps leading to the 10 L Labtainer and using the GatheRex transferred ?4 L of culture supernatant to the 10 L Labtainer. 8. Harvested according to appropriate GatheRex harvesting instructions. 9. Clamped the red line and recorded time TIL harvest initiated. 10. GatheRex stopped when air entered the line. Clamped the red line. 11. After removal of the supernatant, swirled the flask until all the cells had been detached from the membrane. Tilted the flask to ensure hose was at the edge of the flask. 12. Released all clamps leading to the 2 L TP and using the GatheRex transfer the residual cell suspension into the 2 L TP maintaining the tilted edge until all cells were collected. 13. Inspected membrane for adherent cells. 14. If necessary, back washed by releasing clamps on red line and allowed some media to flow into the flask by gravity. 15. Closed the red line and triple heat seal. 16. Vigorously tapped flask to release cells. 17. Added cells to 2 L TP. 18. Heated seal the 2 L transfer pack leaving roughly the same length of tubing as when dry weight was recorded. 19. Retained G-Rex 500MCS, it was reused in the split. 20. Recorded mass of transfer pack with cell suspension and calculated the volume of cell suspension. 21. Determined cell suspension volume, including dry mass. 22. Sterile welded a 4 transfer set to the cell suspension bag. 23. In the BSC mixed the cells gently and with 20 cc syringe draw up 11 ml and aliquoted as shown in Table 14:
(745) TABLE-US-00020 TABLE 14 Testing parameters. Test Sample volume Vessel Cell Count 2-2 mL samples Cryovials and viability Mycoplasma 1 mL Cryovial stored at 4? C. until testing completed. Sterility 1 mL Inoculated 0.5 mL into one each anaerobic and aerobic culture bottles Flow 2-2 mL Unused cell count (Cryopreserved for future batch testing) Remainder of Discarded cells 24. Heat sealed. Closed the luer connection retaining the clamp 25. Labeled and placed the cell suspension in the incubator and recorded time placed in the incubator. 26. Calculated new volume. 27. Recorded Volume in 2 L transfer pack based on volume of cell suspension and volume removed for QC (11 mL). 28. Inoculated and ordered sterility testing. 29. Stored the mycoplasma sample at 4? C. in the pending rack for mycoplasma testing. 30. Set aside until TIL was seeded.
(746) Cell Count:
(747) Performed single cell counts and recorded data and attach counting raw data to batch record. Documented Dilution. Documented the Cellometer counting program. Verified the correct dilution was entered into the Cellometer.
(748) Method Continued: 31. Calculated the total number of flasks required for subculture **Re-used the original vessel and rounded fractions of additional vessels up.
(749) IL-2 Addition to CM 1. Placed 10 L bag of Aim V with Glutamax in the BSC. 2. Spiked the media bag with a 4 plasma transfer set. 3. Attached an 18G needle to a 10 mL syringe and draw 5 mL of IL-2 into the syringe (final concentration is 3000 IU/ml). 4. Removed the needle and aseptically attach the syringe to the plasma transfer set and dispensed IL-2 into the bag. 5. Flushed the line with air, draw up some media and dispense into the bag. This insured all IL-2 is in the media. 6. Repeated for remaining bags of Aim V.
(750) Prepare G-REX500MCS Flasks 1. Determined amount of CM4 to add to flasks. Recorded volume of cells added per flask and volume of CM4 5000 mL-A. 2. Closed all clamps except the large filter line. 3. Sterile welded the inlet line of the Acacia pump to the 4 plasma transfer set on the media bag containing CM4. 4. Sterile welded the outlet line of the pump to the G-Rex 500MCS via the red collection line. 5. Pump determined amount of CM4 into the G-Rex 500MCS using lines on flask as guide. 6. Heated seal the G-Rex 500MCS red line. 7. Repeated steps 4-6 for each flask. Multiple flasks could be filled at the same time using gravity fill or multiple pumps. A Y connector could be welded to the outlet line of the pump and the two arms welded to two G-Rex 500MCS flasks filling both at the same time. 8. Placed flasks in a 37? C., 5% CO.sub.2.
(751) Seed Flasks With TIL 1. Closed all clamps on G-Rex 500MCS except large filter line 2. Sterile welded cell product bag to inlet line of the Acacia pump. 3. Sterile welded the other end of the pump to the red line on the G-Rex 500MCS. 4. Placed pump boot in pump. 5. Placed the cell product bag on analytical balance and recorded time TIL added to G-REX flask. 6. Zeroed the balance. 7. Unclamped lines and pump required volume of cells into G-Rex 500MCS by weight assuming 1 g=1 mL. 8. Turned cell bag upside down and pump air to clear the line. Heated seal red line of G-Rex 500MCS. Placed flask in incubator. 9. Sterile welded the outlet line of the pump to the next G-Rex 500MCS via the red collection line 10. Mixed cells well. 11. Repeated cell transfer for all flasks. 12. Placed flasks in a 37? C., 5% CO.sub.2 and recorded time TIL added to G_REX flask. 13. Ordered testing for settle plates to the microbiology lab. 14. Recorded accession numbers. 15. Ordered testing for aerobic and anaerobic sterility. 16. Ensured delivery of plates and bottles to the microbiology lab.
(752) Cryopreservation of Flow or Excess Cells: 1. Calculated amount of freezing media required: a. Target cell concentration was 1?10.sup.8/ml; record total cells removed. Target cell concentration was 1?10.sup.8 cells/mL. Calculated total volume of freezing media to add. 2. Prepared cryo preservation media and placed at 40? C. until needed. 3. Spun down TIL at 400?g for 5 min at 20? C. with full brake and full acceleration. 4. Aseptically aspirated supernatant. 5. Gently tapped bottom of tube to resuspend cells in remaining fluid. 6. While gently tapping the tube slowly added prepared freezing media. 7. Aliquoted into appropriate sized labelled cryo tubes. 8. Placed vial in a Mr. Frosty or equivalent and placed in a ?80? C. freezer. 9. Within 72 hours transferred to permanent storage location and documented and recorded date and time placed in ?80? C. freezer.
Example 8: Process 2ADay 22
(753) This example describes the detailed day 22 protocol for the 2A process described in Examples 1 to 4.
(754) Document Negative In-Process Sterility Results
(755) Before beginning harvest, obtained the Day 16 preliminary sterility results from Microbiology lab. Contacted the Laboratory Director or designee for further instructions if the results were positive.
(756) Clean Room Environmental MonitoringPre-Processing 1. Verified Particle Counts for 10 minutes before beginning processing. 2. Biosafety Cabinets were cleaned with large saturated alcohol wipes or alcohol spray. 3. Set up in-process surveillance plates and left in biosafety cabinet for 1-2 hour during procedure.
(757) Advanced Preparation 1. In BSC aseptically attached a Baxter extension set to a 10 L labtainer bag or equivalent. Label LOVO filtrate bag. 2. Placed three 1 L bags of PlasmaLyte A in the BSC 3. Prepared pool and labeled the PlasmaLyte A bags with 1% HSA: 3.1. Closed all clamps on a 4S-4M60 Connector set and spiked each of the PlasmaLyte bags. 3.2. Welded one of the male ends of the 4S-4M60 to the inlet line of the Acacia pump boot. 3.3. Welded the outlet line of the pump boot to a 3 liter collection bag. Closed all clamps on 3 L bag except the line to pump. 3.4. Pumped the 3 liters of Plasmalyte into the 3 liter bag. If necessary removed air from 3 L bag by reversing the pump. 3.5. Closed all clamps except line with female luer. 3.6. Using two 100 mL syringes and 16-18G needles, load 120 mL of 25% HSA. Red capped syringes. 3.7. Attached one syringe to the female luer on the 3 liter bag and transferred HSA to 3 L PlasmaLyte bag. Mix well. 3.8. Repeated with second syringe. 3.9. Mixed well. 3.10. Closed all clamps. 3.11. Using a 10 mL syringe, removed 5 mL of PlasmaLyte with 1% HSA from the needleless port on the 3 liter bag. 3.12. Capped syringe and kept in BSC for IL-2 dilution. 3.13. Closed all clamps. 3.14. Heated seal removing the female luer line from the pump boot. 3.15. Labeled LOVO Wash buffer and date. Expired within 24 hrs at ambient temperature.
(758) IL-2 Preparation 1. Dispensed Plasmalyte/1% HSA from 5 mL syringe into a labeled 50 ml sterile conical tube. 2. Added 0.05 mL IL-2 stock to the tube containing PlasmaLyte. 3. Labeled IL-2 6?10.sup.4 4. Capped label and store at 2-8? C. Record volumes.
(759) Preparation of Cells 1. Closed all clamps on a 10 L Labtainer bag. At Attach Baxter extension set to the 10 L bag via luer connection. 2. Removed the G-REX 500M flasks from the 37? C. 3. Sterile welded the red media removal line from the G-Rex 500MCS to the extension set on the 10 L bioprocess bag. 4. Sterile welded the clear cell removal line from the G-Rex 500MCS to a 3 L collection bag and labeled pooled cell suspension. 5. Unclamped red line and 10 L bag. 6. Used the GatheRex pump, volume reduced the first flask. Note: If an air bubble was detected then the pump could stop prematurely. If full volume reduction was not complete reactivated GatheRex pump. 7. Closed the clamp on the supernatant bag and red line. 8. Swirled the G-REX 500M flask until the TIL were completely resuspended while avoiding splashing or foaming. Made sure all cells have been dislodged from the membrane. 9. Opened clamps on clear line and 3 L cell bag. 10. Tilted the G-Rex flask such that the cell suspension was pooled in the side of the flask where the collection straw was located. 11. Started GatherRex to collect the cell suspension. Note: If the cell collection straw was not at the junction of the wall and bottom membrane, rapping the flask while tiled at a 450 angle was usually sufficient to properly position the straw. 12. Ensured all cells had been removed from the flask. 13. If cells remained in the flask, added 100 mL of supernatant back to the flask, swirled, and collected into the cell suspension bag. 14. Closed clamp on the line to the cell collection bag. Released clamps on GatheRex. 15. Heated seal clear line of G-Rex 500MCS. 16. Heated seal red line of G-Rex 500MCS. 17. Repeated steps 3-16 for additional flasks. 18. It was necessary to replace 10 L supernatant bag as needed after every 2nd flask. 19. Multiple GatherRex could be used. 20. Documented number of G-Rex 500MCS processed. 21. Heated seal cell collection bag. Recorded number of G-REX harvested. 22. With a marker made a mark ?2 from one of the female luer connectors on a new 3 liter collection bag. 23. Heated seal and removed the female luer just below the mark. 24. Labeled as LOVO Source Bag 25. Recorded the dry weight. 26. Closed all clamps of a 170 ?m blood filter. 27. Sterile welded the terminal end of the filter to the LOVO source bag just below the mark. 28. Sterile welded a source line of the filter to the bag containing the cell suspension. 29. Elevated the cell suspension by hanging cells on an IV pole to initiate gravity-flow transfer of cells. (Note: Did not allow the source bag to hang from the filtration apparatus.) 30. Opened all necessary clamps and allow TIL to drain from the cell suspension bag through the filter and into the LOVO source bag. 31. Once all cells were transferred to the LOVO source bag, closed all clamps, heated seal just above the mark and detached to remove filter. 32. Mixed bag well and using a two 3 mL syringe take 2 independent 2 mL samples from the syringe sample port for cell counting and viability. 33. Weighed the bag and determined the difference between the initial and final weight. 34. Recorded data and place in incubator, including dry mass.
(760) Cell Count.
(761) Performed a single cell count on each sample and recorded data and attach counting raw data to batch record. Documented the Cellometer counting program. Verified the correct dilution was entered into the Cellometer. Determined total number of nucleated cells. Determined number of TNC to remove to retain=1.5?10.sup.11 cells for LOVO processing. Place removed cell into appropriate size container for disposal.
(762) LOVO Harvest
(763) The 10 L Labtainer with Baxter extension set in Prior Preparation was the replacement filtrate bag welded to the LOVO kit later on. Turned LOVO on and follow the screen displays.
(764) Check weigh scales and pressure sensor
(765) To access the Instrument Operation Profile: 1. Touched the information button. 2. Touched the instrument settings tab. 3. Touched the Instrument Operation Profile button. 4. The Instrument Operation Profile displayed.
(766) Check the Weigh Scales 1. Made sure there was nothing hanging on any of the weigh scales and reviewed the reading for each scale. 2. If any of the scales read outside of a range of 0+/?2 g, performed weigh scale calibration as described in the Weigh Scale Calibration Manual from the manufacturer. 3. If all scales were in tolerance with no weight hanging, proceed to hang a 1-kg weight on each scale (#1-4) and reviewed the reading. 4. If any of the scales read outside of a range of 1000+/?10 g when a 1-kg weight was hanging, performed weigh scale calibration as described in the LOVO Operator's Manual from the manufacturer.
(767) Check the Pressure Sensor 1. Reviewed the pressure sensor reading on the Instrument Operation Profile Screen. 2. N/A: If the pressure sensor reading was outside 0+/?10 mmHg, stored a new atmospheric pressure setting in Service Mode as described in the LOVO Operator's Manual from the manufacturer. a. Touched the check button on the Instrument Operation Profile screen. b. Touched the check button on the Instrument Settings tab. 3. If weigh scale calibration had been performed or a new atmospheric pressure setting had been stored, repeated the relevant sections.
(768) To start the procedure, selected the TIL G-Rex Harvest protocol from the drop-down menu on the Protocol Selection Screen and press Start. 1. The Procedure Setup Screen displayed. 2. Touched the Solutions Information button. 3. The Solution 1 Screen displayed. Review the type of wash buffer required for Solution 1. (Should read PlasmaLyte.) 4. Touched the Next button to advance to the Solution 2 Screen. Reviewed the type of wash buffer required for Solution 2. (Should read NONE, indicating that the protocol had been configured to only use one type of wash buffer, which was PlasmaLyte) 5. Touched the check button on the Solution 2 Information Screen to return to the Procedure Setup screen. 6. Touched the Procedure Information Button. 7. The Procedure Information Screen displayed. 8. Touched the User ID entry field. A keypad will display. Entered the initials of the performer and verifier. Touched the button to accept the entry. 9. Touched the Source ID entry field. A keypad will display. Entered the product lot #. Touched the button to accept the entry. 10. Touched the Procedure ID entry field. A keypad will display. Entered TIL Harvest. Touched the button to accept the entry. 11. If there are extra notes to record, touched the Procedure Note entry field. A keypad displayed. Entered any notes. Touched the button to accept the entry. NOTE: The Procedure Note entry field is optional and can be left blank. 12. Touched the check button on the Procedure Information Screen to return to the Procedure Setup Screen. 13. Verified that a check displays in the Procedure Information button. If no check displays, touched the Procedure Information button again and ensured that the User ID, Source ID, and Procedure ID fields all had entries. 14. Touched the Parameter Configuration Button. 15. The General Procedure Information Screen displayed. 16. Touched the Source Volume (mL) entry field. A numeric keypad displayed. Entered the Calculated volume of cell suspension (mL) from Table 1 17. Touched the button to accept the entry. 18. Touched the Source PCV (%) entry field. The TIL (viable+dead) screen displays. 19. Touched the Cell Concentration entry field. A numeric keypad displayed. Entered the Total Cellular concentration/mL from Table 14 in the Source product in units of ?10.sup.6/mL. The entry could range from 00.0 to 99.9. Touched the button to accept the entry and return to the General Procedure Information Screen. NOTE: After the Cell Concentration was accepted, the Source PCV (%) entry field on the General Procedure Information Screen displayed the PCV % calculated by the LOVO, based on the Cell Concentration entry made by the operator. 20. On the General Procedure screen, touched the Next button to advance to screen 4 of 8, the Final Product Volume (Retentate Volume) screen. Note: Screens 2 and 3 did not have any entry fields for the operator to fill in. 21. The Final Product Volume (Retentate Volume) screen displayed. 22. Using the Total nucleated cells (TNC) value from Table 15, determined the final product target volume in the table below (Table 16). Entered the Final Product Volume (mL) associated with that Cell Range during LOVO Procedure setup.
(769) TABLE-US-00021 TABLE 15 Determination of Final Product Target Volume. Final Product (Retentate) Volume to Cell Range Target (mL) 0 < Total (Viable + Dead) Cells ? 7.1E10 150 7.1E10 < Total (Viable + Dead) Cells ? 1.1E11 200 1.1E11 < Total (Viable + Dead) Cells ? 1.5E11 250
(770) TABLE-US-00022 TABLE 16 Product target volume. Total nucleated cells (TNC) ? 10.sup.6 Final Product (Retentate) Target Volume (mL) 23. To target the specified volume from Table 16 touched the Final Product Volume (mL) entry field. A numeric keypad displayed. Entered the desired Final Product Volume in unit of mL. Touched the button to accept the entry. 24. Touched on the Final Product Volume (Retentate Volume) screen to return to the Procedure Setup Screen. Note: Screens 5-8 did not have any entry fields for the operator to fill in. 25. Verified that a Check displays in the Parameter Configuration button. If no check displays, touched the Procedure Information button again and ensured that Source Volume and Source PCV on page 1 have entries. Also ensured that either the Target Minimum Final Product Volume checkbox was checked OR the Final Product Volume (mL) field had an entry on page 4. 26. Touched the Estimate Button at the top right corner of the screen. 27. The Estimation Summary Screen displayed. Confirmed sufficient and accurate values for Source and PlasmaLyte Wash Buffer. 28. Loaded the disposable kit: Followed screen directions for kit loading by selecting help button (?). 29. Made a note of the volumes displayed for Filtrate and Solution 1 (read PlasmaLyte) 30. Made a note of the volumes displayed for Filtrate and Solution 1 (read PlasmaLyte). 31. For instructions on loading the disposable kit touched the help button or followed instructions in operators manual for detailed instructions. 32. When the standard LOVO disposable kit had been loaded, touched the Next button. The Container Information and Location Screen displays. Removed filtrate bag from scale #3. 33. For this protocol, the Filtrate container was New and Off Scale 34. If the Filtrate container was already shown as New and Off-Scale, no changes were made. 35. If the Filtrate container type was shown as Original, touched the Original button to toggle to New. 36. If the Filtrate location was shown as On-Scale, touched the On-Scale button to toggle to Off-Scale. 37. If the volume of Filtrate to be generated was ?2500 mL, the Filtrate Container Location was shown as On-Scale For consistency among runs, the Filtrate Container Location was changed to Off-Scale and container type was new. 38. Touched the On-Scale button to toggle to Off-Scale. Attached transfer set Use sterile welding technique to replace the LOVO disposable kit Filtrate container with a 10-L bag. Opened the weld. 39. Placed the Filtrate container on the benchtop. Did NOT hang the Filtrate bag on weigh scale #3. Weigh scale #3 was empty during the procedure. 40. Opened any plastic clamps on the tubing leading to the Filtrate container. NOTE: If the tubing was removed from the F clamp during welding, replaced in clamp. 41. Touched the Filtrate Container Capacity entry field. A numeric keypad displayed. Entered the total new Filtrate capacity (10,000 mL). Touched the check button to accept the entry. 42. Used sterile welding technique to replace the LOVO disposable kit Filtrate container with a 10-L bag. Opened the weld. Note: If tubing was removed from the F clamp during welding, replaced in clamp. 43. Placed the new Filtrate container on the benchtop. Did NOT hang the Filtrate bag on weigh scale #3. Weigh scale #3 was empty during the procedure 44. Opened any plastic clamps on the tubing leading to the Filtrate container. 45. For the Retentate container, the screen displayed Original and On-Scale. 46. No changes were made to the Retentate container. 47. When all changes were made to the Filtrate container and appropriate information entered, touched the Next button. 48. The Disposable Kit Dry Checks overlay displays. Checked that the kit had been loaded properly, then pressed the Yes button. 49. All LOVO mechanical clamps closed automatically and the Checking Disposable Kit Installation screen displayed. The LOVO went through a series of pressurizing steps to check the kit. 50. After the disposable kit check passed successfully, the Connect Solutions screen displayed. 51. 3 L was the wash volume. Entered this value on screen. 52. Used sterile welding technique to attach the 3-L bag of PlasmaLyte to the tubing passing through Clamp 1. Opened the weld. 53. Hung the PlasmaLyte bag on an IV pole, 54. Opened any plastic clamps on the tubing leading to the PlasmaLyte bag. 55. Verified that the Solution Volume entry is 3000 mL. This was previously entered. 56. Touched the Next button. The Disposable Kit Prime overlay displayed. Verified that the PlasmaLyte was attached and any welds and plastic clamps on the tubing leading to the PlasmaLyte were open, then touched the Yes button. NOTE: Because only one type of wash buffer (PlasmaLyte) was used during the LOVO procedure, no solution was attached to the tubing passing through Clamp 2. The Roberts clamp on this tubing remained closed during the procedure. 57. Disposable kit prime started and the Priming Disposable Kit Screen displayed. Visually observed that PlasmaLyte moving through the tubing connected to the bag of PlasmaL Lyte. If no fluid was moving, pressed the Pause Button on the screen and determined if a clamp or weld was still closed. Once the problem had been solved, pressed the Resume button on the screen to resume the Disposable Kit Prime. 58. When disposable kit prime finished successfully, the Connect Source Screen displayed. 59. For this protocol, the Source container was New and Off-Scale 60. If the Source container was already shown as New and Off-Scale, no changes were made. 61. If the Source location was shown as On-Scale, touched the On-Scale button to toggle to Off-Scale. 62. Touched the Source Capacity (mL) entry field. A numeric keypad displayed. Enter the capacity of the container that held the Source product. Touched the check button to accept the entry. Note: The Source Capacity entry was used to make sure that the Source bag was able to hold the additional solution that was added to the bag during the Source Prime phase. 63. Used sterile welding technique to attach the Source container to the tubing passing through Clamp S. Opened the weld. Remove the tubing from the clamp as needed. 64. Made sure to replace source tubing into the S clamp. 65. Touched the Next button. The Source Prime overlay displayed. Verified that the Source was attached to the disposable kit and any welds and plastic clamps on the tubing leading to the Source were open, then touched the Yes button. 66. Source prime started and the Priming Source Screen displayed. Visually observed that PlasmaLyte was moving through the tubing attached to the Source bag. If no fluid was moving, pressed the Pause Button on the screen and determined if a clamp or weld was still closed. Once the problem had been solved, pressed the Resume button on the screen to resume the Source Prime. 67. When Source prime finished successfully, the Start Procedure Screen displayed. 68. Pressed the Start button. The Pre-Wash Cycle 1 pause screen appeared, with the instructions to Coat IP, Mix Source. 69. Pre-coated the IP bag. 70. Before pressing the Start button, removed the IP bag from weigh scale #2 (could also remove tubing from the IP top port tubing guide) and manually inverted it to allow the wash buffer added during the disposable kit prime step to coat all interior surfaces of the bag. 71. Re-hung the IP bag on weigh scale #2 (label on the bag faced to the left). Replaced the top port tubing in the tubing guide, if it was removed. 72. Mixed the Source bag. 73. Before pressing the Start button, removed the Source bag from weigh scale #1 and inverted it several times to create a homogeneous cell suspension. 74. Rehung the Source bag on weigh scale #1 or the IV pole. Made sure the bag was not swinging. 75. Pressed the Start button. 76. The LOVO started processing fluid from the Source bag and the Wash Cycle 1 Screen displayed.
(771) During the LOVO procedure, the system automatically paused to allow the operator to interact with different bags. Different screens displayed during different pauses. Followed the corresponding instructions for each screen.
(772) Source Rinse Pause
(773) After draining the Source bag, the LOVO added wash buffer to the Source bag to rinse the bag. After the configured volume of wash buffer had been added to the Source bag, the LOVO paused automatically and displayed the Source Rinse Paused Screen.
(774) When the Source Rinse Paused Screen displayed, the operator: 1. Removed the Source bag from weigh scale #1. 1. Inverted the Source bag several times to allow the wash buffer to touch the entire bag interior. 2. Re-hung the Source bag on weigh scale #1. Made sure the Source bag is not swinging on weigh scale #1. 3. Pressed the Resume button.
(775) The LOVO processed the rinse fluid from the Source bag, then continued with the automated procedure.
(776) Mix IP Bag Pause
(777) To prepare cells for another pass through the spinner, the IP bag was diluted with wash buffer. After adding the wash buffer to the IP bag, the LOVO paused automatically and displayed the Mix IP bag Pause Screen.
(778) When the Mix IP bag Pause Screen displayed, the operator: 1. Removed the IP bag from weigh scale #2. Could also remove the tubing from the IP top port tubing guide. 2. Inverted the IP bag several times to thoroughly mix the cell suspension. 3. Re-hung the IP bag on weigh scale #2. Also replaced the IP top port tubing in the tubing guide, if it was removed. Made sure the IP bag was not swinging on weigh scale #2. 4. Pressed the Resume button. The LOVO began processing fluid from the IP bag.
(779) Massage IP Corners Pause
(780) During the final wash cycle of the LOVO procedure, cells were pumped from the IP bag, through the spinner, and to the Retentate (Final Product) bag. When the IP bag was empty, 10 mL of wash buffers was added to the bottom port of the IP bag to rinse the bag. After adding the rinse fluid, the LOVO paused automatically and displayed the Massage IP corners Pause Screen.
(781) When the Massage IP corners Pause Screen displayed, the operator: 1. Did NOT remove the IP bag from weigh scale #2. 2. With the IP bag still hanging on weigh scale #2, massaged the corners of the bag to bring any residual cells into suspension. 3. Made sure the IP bag was not swinging on weigh scale #2. 4. Pressed the Resume button. 5. The LOVO began pumping out the rinse fluid from the IP bag.
(782) At the end of the LOVO procedure, the Remove Products Screen displayed. When this screen displayed, all bags on the LOVO kit could be manipulated.
(783) Note: Did not touch any bags until the Remove Products Screen displays.
(784) Placed a hemostat on the tubing very close to the port on the Retentate bag to keep the cell suspension from settling into the tubing and triple heat sealed below the hemostat.
(785) Removed the retentate bag by breaking the middle seal and transferred to the BSC.
(786) Followed the instructions on the Remove Products Screen
(787) Touched the Next button. All LOVO mechanical clamps opened and the Remove Kit Screen displayed.
(788) Followed the instructions on the Remove Kit screen. When completed proceeded.
(789) Touched the Next button. All LOVO mechanical clamps closed and the Results Summary Screen displayed. Recorded the data from the results summary screen in Table 17. Closed all pumps and filtered support.
(790) TABLE-US-00023 TABLE 17 LOVO results summary table. Elapsed Elapsed Source Process- Process- ing Time ing Time Source Retentate Filtrate Solution (parenthe- (parenthe- Pause Volume Volume Volume 1 Volume ses #) ses #) Time (mL) (mL) (mL) (mL) A. B. C. D. E. F. G.
(791) Touched the Next button. The Protocol Selection Screen displayed.
(792) LOVO Shutdown Procedure 1. Ensured all clamps were closed and filter support is in the upright position. 2. Touched the STOP button on the front of the LOVO. 3. The STOP Button Decision Overlay displayed. 4. The Shutdown Confirmation Overlay displayed. 5. Touched the Yes button. The Shutting Down Screen displayed. 6. After a few seconds, the Power Off Screen displayed. When this screen displayed, turned off the LOVO using the switch on the back left of the instrument.
(793) Recorded final formulated product volume in a table.
(794) Calculate Amount of IL-2 Required from Final Product Table
(795) TABLE-US-00024 A. Calculated amount of IL-2 needed for final product. (300 IU/ml of IL-2 final product): Final product volume (ml) [Volume of Formulated Cell Product from Final Formulated Product Volume Table] ? 300 IU/ml = IU of IL-2 required mL ? 300IU = IU of IL-2 required B. IU IL-2 required ? working stock dilution (Concentration of 6 ? 10.sup.4 IU/mL) prepared in IL-2 preparation step = volume (ml) of IL-2 to add to final product. IU of IL-2 required from above] ? 60,000 IU/ml = ml IL-2 working stock
(796) Determined the Number of Cryobags and Retain Volume
(797) Marked on the Target volume and retain table below the number of cryopreservation bags and volume of retention sample for product.
(798) Targeted volume/bag calculation: (Final formulated volumevolume adjustment due to not getting 100% recovery=10 mL)/# bags.
(799) Prepared cells with 1:1 (vol:vol) CS10 (CryoStor 10, BioLife Solutions) and IL-2. 1. Assemble Connect apparatus 1.1. Sterile welded the CS750 cryobags to the CC2 Cell Connect apparatus replacing one of the distal male luer ends for each bag. 1.2. Retained the clamps in the closed position. 1.3. Labeled the bags 1-4. 2. Prepared cells with IL-2 and connected apparatus. 2.1. In BSC spike the cell product bag with a 4 plasma transfer set with female luer connector. Be sure the clamp was closed on the transfer set. 2.2. With an appropriate size syringe drew up the volume of IL-2 working dilution determined from the Final Product Table. 2.3. Dispensed into LOVO product. 2.4. Sterile welded LOVO product bag to CC2 single spike line removing the spike. 2.5. Placed cells and apparatus in transport bag and place at 2-8? C. for ?15 min. 3. Addition of CS10 3.1. In BSC attached 3 way stopcock to male luer on bag of cold CS10. 3.2. Attached appropriate size syringe to female luer of stopcock. 3.3. Unclamped bag and drew up the amount of CS10 determined in the Final Formulated Product Volume table. 3.4. Removed syringe and red capped. 3.5. Repeated if multiple syringes were required. 3.6. Removed cell/CC2 apparatus from 2-8? C. refrigerator and placed in BSC. 3.7. Attached first syringe containing CS10 to middle luer of stopcock. Turned stopcock so line to CS750 bags is in OFF position. 3.8. Slowly and with gentle mixing, added CS10 (1:1, vol:vol) to cells. 3.9. Repeated for additional syringes of CS10.
(800) Addition of Formulated Cell Product into Cryobags 1. Replaced syringe with appropriate size syringe for volume of cells to be placed in each cryo bag. 2. Mixed cell product. 3. Opened the clamp leading to the cell product bag and drew up appropriate volume 4. Turned stopcock so cell product bag is in OFF position and dispensed the contents of the syringe into cryobag #1. Cleared the line with air from syringe.
(801) Record Final Product Volume 1. Using needless port and appropriate size syringe, drew up amount of retain determined previously. 2. Place retained in 50 mL conical tube labelled Retain 3. Using the syringe attached to the harness removed all air from bag drawing up cells to about 1 past bag into tubing. Clamped and heat sealed. Placed at 2-8? C. 4. Turned stopcock so cryo bags were in the OFF position 5. Mixed cells in cell product bag and repeat steps 3-8 for remaining CS750 bags using a new syringe on the stopcock and new syringe to obtain cell retain. 6. Retained should be set aside for processing once product was in CRF.
(802) Controlled-Rate Freezer (CRF) Procedure (See Also Example 9) 1. Turned on the CRF (CryoMed Controlled Rate Freezer, Model 7454) and associated laptop computer. 2. Logged onto the computer using account and password 3. Opened Controlled Rate Freezer icon located on the desktop. 4. Clicked the Run button on the Main screen. 5. Clicked Open Profile, Click Open. 6. Entered the Run File Name followed by the date in this format: runMMDDYYYY. 7. Entered the Data Tag as the date with no dashes as MMDDYYY. 8. Closed door to the CRF. 9. Clicked Start Run. 10. Selected COM 6 on the pull down menu. 11. Clicked Ok. Waited about 30 seconds. 12. When Profile Download, pops up, Clicked OK. Clicked Save. (See Example 9 for controlled-rate freezing profile details.) 13. Waited to press green button until the samples were in the CRF. The freezer was held at 4? C. until ready to add them. 14. Added samples to CRF. 15. Waited until CRF returns to 4? C. Once temperature was reached, clicked the green continue button. This initiated program to go to next step in program. 16. Performed a visual inspection of the cryobags for the following (Note: did not inspect for over or underfill): container integrity, port integrity, seal integrity, presence of cell clumps, and presence of particles. 17. Placed approved hang tag labels on each bag. 18. Verified final product label including: Lot number, product name, manufacturer date, product volume, other additives, storage temperature, and expiration. 19. Placed each cryobag (with hangtag) into an over-bag. 20. Heat sealed. 21. Placed in a cold cassette. 22. Repeated for each bag. 23. Placed the labeled cryobags into preconditioned cassettes and transferred to the CRF. 24. Evenly distributed the cassettes in the rack in the CRF. 25. Applied ribbon thermocouple to the center cassette, or place dummy bag in center position. 26. Closed the door to the CRF. 27. Once the chamber temperature reached 4? C.+/?1.5? C., Press Run on the PC Interface software. 28. Recorded the time and the chamber temperature that the product is transferred to the CRF.
(803) Processing of Quality Control Sample 1. Aseptically transferred the following materials to the BSC, as needed, and labeled according to the table below: 2. Used a new pipette for pipette the following: QC and Retention Table 3. Delivered to QC: 1Cell Count tube, 1Endotoxin tube, 1Mycoplasma tube, 1Gram stain tube, 1 tube restimulation tube, and 1flow tube to QC for immediate testing. The remaining duplicate tubes were placed in the controlled rate freezer. 4. Contacted the QC supervisor notifying of required testing. 5. See Table 18 for testing and storage instructions.
(804) TABLE-US-00025 TABLE 18 Testing and storage instructions. Test Vessel Cell Count and Cryovials. viability Mycoplasma Cryovial stored at 4? C. until testing completed. Sterility Inoculate 0.5 mL into an anaerobic and 0.5 mL into an aerobic culture bottle. Gram Stain Cryovial stored at 4? C. until testing completed. Endotoxin Cryovial stored at 4? C. until testing completed. Flow Cryovial stored at 4? C. until testing completed. Post Cryopreserve for future testing: Consist of 5 satellite vial, Formulation 1 -Cell Count tube, 1- Endotoxin tube, 1-Mycoplasma Retention tube, 1-Gram stain tube, and 1- flow tube to QC for immediate testing. Restimulation Sample is delivered at room temperature and assay must be started within 30 minutes of cell count results.
(805) Cell Count
(806) Performed a single cell count on each sample and recorded data and attached counting raw data to batch record. Document the Cellometer counting program. Verified the correct dilution was entered into the Cellometer.
(807) Cryopreservation of Post Formulation Retention Cells: 1. Placed vial in CRF. 2. Moved to storage location after completion of freeze and recorded date and time placed in CFR. Recorded date and time moved to LN2.
(808) Microbiology Testing 1. Ordered testing for settle plates to the microbiology lab. 2. Recorded accession numbers. 3. Ordered testing for aerobic and anaerobic sterility. 4. Ensured delivery of plates and bottles to the microbiology lab.
(809) Post-Cryopreservation of Cell Product Bags 1. Stopped the freezer after the completion of the run. Run could be stopped by clicking on the Stop button or pressing the Back key on the freezer keypad. 2. Removed cryobags from cassette 3. Transferred cassettes to vapor phase LN2. 4. Recorded storage location. 5. Entered any additional comments when the text entry window opens again. This window appeared regardless of the Run stop method. 6. Printed the profile report and attached to the batch record labeled with the lot number for the run. 7. Terminated Warm Mode and closed the Run screen with Exit button.
Example 9: Cryopreservation Process
(810) This example describes the cryopreservation process method for TILs prepared with the abbreviated, closed procedure described above in Example 8 using the CryoMed Controlled Rate Freezer, Model 7454 (Thermo Scientific).
(811) The equipment used, in addition to that described in Example 9, is as follows: aluminum cassette holder rack (compatible with CS750 freezer bags), cryostorage cassettes for 750 mL bags, low pressure (22 psi) liquid nitrogen tank, refrigerator, thermocouple sensor (ribbon type for bags), and CryoStore CS750 Freezing bags (OriGen Scientific).
(812) The freezing process provides for a 0.5? C. rate from nucleation to ?20? C. and 1? C. per minute cooling rate to ?80? C. end temperature. The program parameters are as follows: Step 1wait at 4? C.; Step 2: 1.0? C./min (sample temperature) to ?4? C.; Step 3: 20.0? C./min (chamber temperature) to ?45? C.; Step 4: 10.0? C./min (chamber temperature) to ?10.0? C.; Step 5: 0.5? C./min (chamber temperature) to ?20? C.; and Step 6: 1.0? C./min (sample temperature) to ?80? C.
(813) A depiction of the procedure of this example in conjunction with the process of Examples 1 to 8 is shown in
Example 10: Characterization of Process 2A TILs
(814) This example describes the characterization of TILs prepared with the abbreviated, closed procedure described above. In summary, the abbreviated, closed procedure (process 2A, described in Examples 1 to 9) had the advantages over prior TIL manufacturing processes given in Table 19. Advantages for the Pre-REP can include: increased tumor fragments per flask, shortened culture time, reduced number of steps, and/or being amenable to closed system. Advantages for the Pre-REP to REP transition can include: shortened pre-REP-to-REP process, reduced number of steps, eliminated phenotyping selection, and/or amenable to closed system. Advantages for the REP can include: reduced number of steps, shorter REP duration, closed system transfer of TIL between flasks, and/or closed system media exchanges. Advantages for the Harvest can include: reduced number of steps, automated cell washing, closed system, and reduced loss of product during wash. Advantages for the final formulation and/or product can include shipping flexibility.
(815) TABLE-US-00026 TABLE 19 Comparison of exemplary process 1C and an embodiment of process 2A. Process Step Process 1C-Embodiment Process 2A-Embodiment Pre-REP 4 fragments per 10 G-REX-10 flasks 40 fragments per 1 G-REX-100M 11-21 day duration flask 11 day duration Pre-REP to Pre-REP TIL are frozen until Pre-REP TIL directly move to REP REP phenotyped for selection then thawed on day 11 Transition to proceed to the REP (~day 30) REP requires 25-200 ? 10.sup.6 TIL REP requires >40 ? 10.sup.6 TIL REP 6 G-REX-100M flasks on REP day 1 G-REX-500M flask on day 11 0 25-200 ? 10.sup.6 TIL and 5 ? 10.sup.9 PBMC 5 ? 10.sup.6 TIL and 5 ? 10.sup.8 PBMC feeders feeders on day 11 per flask on REP day 0 Split to ?6 G-REX-500M flasks Split to 18-36 flasks on REP day 7 on day 16 14 day duration 11 day duration Harvest TIL harvested via centrifugation TIL harvested via LOVO automated cell washing system Final Fresh product in Hypothermosol Cryopreserved product in Formulation Single infusion bag PlasmaLyte-A + 1% HSA and Limited shipping stability CS10 stored in LN.sub.2 Multiple aliquots Longer shipping stability Overall 43-55 days 22 days Estimated Process Time
(816) A total of 9 experiments were performed using TILs derived from 9 tumors described in Table 20. All the data shown here was measured from thawed frozen TIL product from process TC and an embodiment of process 2A.
(817) TABLE-US-00027 TABLE 20 Description of Tumor Donors, Processing Dates and Processing Locations Tumor ID Tissue type Source Tissue M1061 Melanoma MT group Primary-left lateral foot M1062 Melanoma Moffitt N/A M1063 Melanoma MT group Metastatic C-right groin M1064 Melanoma MT group Metastatic C-left ankle M1065 Melanoma Bio Metastatic-Axillary lymph node Options EP11001 ER+PR+ MT group Primary-left breast invasive ductal carcinoma M1056* Melanoma Moffitt N/A M1058* Melanoma MT group Metastatic-Stage IIB Right scalp M1023* Melanoma Atlantic Primary-Right axilla Health
(818) The procedures described herein for process 2A were used to produce the TILs for characterization in this example. Briefly, for the REP, on Day 11, one G-REX-500M flask containing 5 L of CM2 supplemented with 3000 IU/ml rhil-2, 30 ng/mL anti-CD3 (Clone OKT3) and 5?10.sup.9 irradiated allogeneic feeder PBMC cells was prepared. TILs harvested from the pre-REP G-REX-100M flask after volume reduction were counted and seeded into the G-REX-500M flask at a density that ranged between 5?10.sup.6 and 200?10.sup.6 cells. The flask was then placed in a humidified 37? C., 5% CO.sub.2 tissue Culture incubator for five days. On Day 16, volume of the G-REX-500M flask was reduced, TILs were counted and their viability determined. At this point, the TIL were expanded into multiple G-REX-500M flasks (up to a maximum of six flasks), each with a seeding density of 1?10.sup.9 TILs/flask. All flasks were then placed in humidified 37? C., 500 CO.sub.2 tissue Culture incubators for an additional six days. On Day 22, the day of harvest, each flask was volume reduced by 90%, the cells were pooled together and filtered through a 170 ?m blood filter, and then collected into a 3 L Origin EV3000 bag or equivalent in preparation for automated washing using the LOVO. TILs were washed using the LOVO automated cell processing system which replaced 99.99% of cell culture media with a wash buffer consisting of PlasmaLyte-A supplemented with 1% HSA. The LOVO operates using spinning filtration membrane technology that recovers over 92% of the TIL while virtually eliminating residual tissue culture components, including serum, growth factors, and cytokines, as well as other debris and particulates. After completion of the wash, a cell count was performed to determine the expansion of the TILs and their viability upon harvest. CS10 was added to the washed TIL at a 1:1 volume:volume ratio to achieve the Process 2A final formulation. The final formulated product was aliquoted into cryostorage bags, sealed, and placed in pre-cooled aluminum cassettes. Cryostorage bags containing TIL were then frozen using a CryoMed Controlled Rate Freezer (ThermoFisher Scientific, Waltham, MA) according to the procedures described herein, including in Example 9.
(819) Cell counts and percentage viability for the nine runs were compared in
(820) The cell surface markers shown in the following results were analyzed using flow cytometry (Canto II flow cytometer, Becton, Dickinson, and Co., Franklin Lakes, NJ, USA) using suitable commercially-available reagents. Results for markers of interest are shown in
(821) Diverse methods have been used to measure the length of telomeres in genomic DNA and cytological preparations. The telomere restriction fragment (TRF) analysis is the gold standard to measure telomere length (de Lange et al., 1990). However, the major limitation of TRF is the requirement of a large amount of DNA (1.5 ?g). Here, two widely used techniques for the measurement of telomere lengths were applied, namely fluorescence in situ hybridization (FISH) and quantitative PCR.
(822) Flow-FISH was performed using the Dako kit (K532711-8 RUO Code K5327 Telomere PNA Kit/FITC for Flow Cytometry, PNA FISH Kit/FITC. Flow, 20 tests) and the manufacturer's instructions were followed to measure average length of telomere repeat. Briefly, the cells were surface was stained with CD3 APC for 20 minutes at 4? C., followed by GAM Alexa 546 for 20 minutes. The antigen-antibody complex was then cross-linked with 2 mM BS3 (Fisher Scientific) chemical cross-linker. PNA-telomere probe binding in a standard population of T-cells with long telomeres, Jurkat 1301 T leukemia cell line (1301 cells) was used as an internal reference standard in each assay. Individual TILs were counted following antibody incubation and mixed with 1301 cells (ATCC) at a 1:1 cell ratio. 5?10.sup.5 TILs were mixed with 5?10.sup.5 1301 cells. In situ hybridization was performed in hybridization solution (70% formamide, 1% BSA, 20 mM Tris pH 7.0) in duplicate and in the presence and absence of a FITC-conjugated Telomere PNA probe (Panagene), FITC-00-CCC-TAA-CCC-TAA-CCC-TAA, complementary to the telomere repeat sequence at a final concentration of 60 nM. After addition of the Telomere PNA probe, cells were incubated for 10 minutes at 81? C. in a shaking water bath. The cells were then placed in the dark at room temperature overnight. The next morning, excess telomere probe was removed by washing 2 times with PBS pre-warmed to 40? C. Following the washes, DAPI (Invitrogen, Carlsbad, CA) was added at a final concentration of 75 ng/mL. DNA staining with DAPI was used to gate cells in the G0/G1 population. Sample analysis was performed using our flow cytometer (BD Canto II, Mountain View, CA). Telomere fluorescence of the test sample was expressed as a percentage of the fluorescence (fl) of the 1301 cells per the following formula: Relative telomere length=[(mean FITC fl test cells w/probe-mean FITC fl test cells w/o probe)?DNA index 1301 cells?100]/[(mean FITC fl 1301 cells w/probemean FITC fl 1301 cells w/o probe)?DNA index test cell.
(823) Real time qPCR was also used to measure relative telomere length (Nucleic Acids Res. 2002 May 15; 30(10): e47, 20, Leukemia, 2013, 27, 897-906). Briefly, the telomere repeat copy number to single gene copy number (T/S) ratio was determined using an BioRad PCR thermal cycler (Hercules, CA) in a 96-well format. Ten ng of genomic DNA was used for either the telomere or hemoglobin (hgb) PCR reaction and the primers used were as follows: Tel-1b primer (CGG TTT GTT TGG GTT TGG GTT TGG GTT TGG GTT TGG GTT), Tel-2b primer (GGC TTG CCT TAC CCT TAC CCT TAC CCT TAC CCT TAC CCT), hgb1 primer (GCTTCTGACACAACTGTGTTCACTAGC), and hgb2 primer (CACCAACTTCATCCACGTTCACC). All samples were analyzed by both the telomere and hemoglobin reactions, and the analysis was performed in triplicate on the same plate. In addition to the test samples, each 96-well plate contained a five-point standard curve from 0.08 ng to 250 ng using genomic DNA isolated from 1301 cell line. The T/S ratio (?dCt) for each sample was calculated by subtracting the median hemoglobin threshold cycle (Ct) value from the median telomere Ct value. The relative T/S ratio (?ddCt) was determined by subtracting the T/S ratio of the 10.0 ng standard curve point from the T/S ratio of each unknown sample.
(824) Flow-FISH results are shown in
(825) In conclusion, process 2A produced a potent TIL product with a young phenotype as defined by high levels of co-stimulatory molecules, low levels of exhaustion markers, and an increased capability to secrete cytokine upon reactivation. The abbreviated 22 day expansion platform allows for the rapid generation of clinical scale doses of TILs for patients in urgent need of therapy. The cryopreserved drug product introduces critical logistical efficiencies allowing rapid manufacture and flexibility in distribution. This expansion method overcomes traditional barriers to the wider application of TIL therapy.
Example 11: Use of IL-2, IL-15, and IL-21 Cytokine Cocktail
(826) This example describes the use of IL-2, IL-15, and IL-21 cytokines, which serve as additional T cell growth factors, in combination with the TIL process of Examples 1 to 10.
(827) Using the process of Examples 1 to 10, TILs were grown from colorectal, melanoma, cervical, triple negative breast, lung and renal tumors in presence of IL-2 in one arm of the experiment and, in place of IL-2, a combination of IL-2, IL-15, and IL-21 in another arm at the initiation of culture. At the completion of the pre-REP, cultures were assessed for expansion, phenotype, function (CD107a+ and IFN-?) and TCR V? repertoire. IL-15 and IL-21 are described elsewhere herein and in Gruijl, et al., IL-21 promotes the expansion of CD27+CD28+ tumor infiltrating lymphocytes with high cytotoxic potential and low collateral expansion of regulatory T cells, Santegoets, S. J., J Transl Med., 2013, 11:37 (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3626797/).
(828) The results showed that enhanced TIL expansion (>20%), in both CD4.sup.+ and CD8.sup.+ cells in the IL-2, IL-15, and IL-21 treated conditions were observed in multiple histologies relative to the IL-2 only conditions. There was a skewing towards a predominantly CD8.sup.+ population with a skewed TCR V? repertoire in the TILs obtained from the IL-2, IL-15, and IL-21 treated cultures relative to the IL-2 only cultures. IFN-? and CD107a were elevated in the IL-2, IL-15, and IL-21 treated TILs, in comparison to TILs treated only IL-2.
Example 12: Phase 2, Multicenter, Three-Cohort Study in Melanoma
(829) This Phase 2, multicenter, three-cohort study is designed to assess the safety and efficacy of a TIL therapy manufactured according to process 1C (as described herein) in patient with metastatic melanoma. Cohorts one and two will enroll up to 30 patients each and cohort three is a re-treatment cohort for a second TIL infusion in up to ten patients. The first two cohorts are evaluating two different manufacturing processes: processes 1C and an embodiment of process 2A (described in Examples 1 to 10, respectively. Patients in cohort one receive fresh, non-cryopreserved TIL and cohort two patients receive product manufactured through the process described in Examples 1 to 10, yielding a cryopreserved product. The study design is shown in
Example 13: Qualifying Individual Lots of Gamma-Irradiated Peripheral Mononuclear Cells
(830) This Example describes a novel abbreviated procedure for qualifying individual lots of gamma-irradiated peripheral mononuclear cells (PBMCs, also known as MNC) for use as allogeneic feeder cells in the exemplary methods described herein.
(831) Each irradiated MNC feeder lot was prepared from an individual donor. Each lot or donor was screened individually for its ability to expand TIL in the REP in the presence of purified anti-CD3 (clone OKT3) antibody and interleukin-2 (IL-2). In addition, each lot of feeder cells was tested without the addition of TIL. to verify that the received dose of gamma radiation was sufficient to render them replication incompetent.
Definitions/Abbreviations
(832) BSCBiological Safety Cabinet CD3Cluster of Differentiation 3; surface marker protein T-lymphocytes CFCentrifugal CM2Complete Medium for TIL # CMOContract Manufacturing Organization CO.sub.2Carbon Dioxide EtOHEthyl Alcohol GMPGood Manufacturing Practice IL-2Interleukin 2 IUInternational Units LN2Liquid Nitrogen mini-REPMini-Rapid Expansion Protocol mlMilliliter MNCMononuclear Cells NANot Applicable OKT3MACS GMP CD3 pure (clone OKT3) antibody PPEPersonal Protective Equipment Pre-REPBefore Rapid Expansion Protocol QSQuantum Satis; fill to this quantity REPRapid Expansion Protocol TILTumor Infiltrating Lymphocytes T2525 cm.sup.2 tissue culture flask ?gMicrograms ?LMicroliter
Procedure
Background 7.1.1 Gamma-irradiated, growth-arrested MNC feeder cells were required for REP of TIL. Membrane receptors on the feeder MNCs bind to anti-CD3 (clone OKT3) antibody and crosslink to TIL in the REP flask, stimulating the TIL to expand. Feeder lots were prepared from the leukapheresis of whole blood taken from individual donors. The leukapheresis product was subjected to centrifugation over Ficoll-Hypaque, washed, irradiated, and cryopreserved under GMP conditions. 7.1.2 It is important that patients who received TIL therapy not be infused with viable feeder cells as this can result in Graft-Versus-Host Disease (GVHD). Feeder cells are therefore growth-arrested by dosing the cells with gamma-irradiation, resulting in double strand DNA breaks and the loss of cell viability of the MNC cells upon reculture.
Evaluation Criteria and Experimental Set-Up
(833) Feeder lots were evaluated on two criteria: 1) their ability to expand TIL in co-culture >100-fold and 2) their replication incompetency. 7.2.2 Feeder lots were tested in mini-REP format utilizing two primary pre-REP TIL lines grown in upright T25 tissue culture flasks. 7.2.3 Feeder lots were tested against two distinct TIL lines, as each TIL line is unique in its ability to proliferate in response to activation in a REP. 7.2.4 As a control, a lot of irradiated MNC feeder cells which has historically been shown to meet the criteria of 7.2.1 was run alongside the test lots. 7.2.5 To ensure that all lots tested in a single experiment receive equivalent testing, sufficient stocks of the same pre-REP TIL lines were available to test all conditions and all feeder lots. 7.2.6 For each lot of feeder cells tested, there was a total of six T25 flasks: 7.2.6.1 Pre-REP TIL line #1 (2 flasks) 7.2.6.2 Pre-REP TIL line #2 (2 flasks) 7.2.6.3 Feeder control (2 flasks) NOTE: Flasks containing TIL lines #1 and #2 evaluated the ability of the feeder lot to expand TIL. The feeder control flasks evaluated the replication incompetence of the feeder lot.
(834) Experimental Protocol 7.3.1 Day ?2/3, Thaw of TIL lines 7.3.1.1 Prepared CM2 medium. 7.3.1.2 Warmed CM2 in 37? C. water bath. 7.3.1.3 Prepared 40 ml of CM2 supplemented with 3000 IU/ml IL-2. Keep warm until use. 7.3.1.4 Placed 20 ml of pre-warmed CM2 without IL-2 into each of two 50 ml conical tubes labeled with names of the TIL lines used. 7.3.1.5 Removed the two designated pre-REP TIL lines from LN2 storage and transferred the vials to the tissue culture room. 7.3.1.6 Recorded TIL line identification. 7.3.1.7 Thawed vials by placing them inside a sealed zipper storage bag in a 37? C. water bath until a small amount of ice remains. 7.3.1.8 Sprayed or wiped thawed vials with 70% ethanol and transfer vials to BSC. 7.3.1.9 Using a sterile transfer pipet, immediately transferred the contents of vial into the 20 ml of CM2 in the prepared, labeled 50 ml conical tube. 7.3.1.10 QS to 40 ml using CM2 without IL-2 to wash cells. 7.3.1.11 Centrifuged at 400?CF for 5 minutes. 7.3.1.12 Aspirated the supernatant and resuspend in 5 ml warm CM2 supplemented with 3000 IU/ml IL-2. 7.3.1.13 Removed small aliquot (20 ?l) in duplicate for cell counting using an automated cell counter. Record the counts. 7.3.1.14 While counting, placed the 50 ml conical tube with TIL cells into a humidified 37? C., 5% CO.sub.2 incubator, with the cap loosened to allow for gas exchange. 7.3.1.15 Determined cell concentration and dilute TIL to 1?10.sup.6 cells/ml in CM2 supplemented with IL-2 at 3000 IU/ml. 7.3.1.16 Cultured in 2 ml/well of a 24-well tissue culture plate in as many wells as needed in a humidified 37? C. incubator until Day 0 of the mini-REP. 7.3.1.17 Cultured the different TIL lines in separate 24-well tissue culture plates to avoid confusion and potential cross-contamination. 7.3.2 Day 0, initiate Mini-REP 7.3.2.1 Prepared enough CM2 medium for the number of feeder lots to be tested. (e.g., for testing 4 feeder lots at one time, prepared 800 ml of CM2 medium). 7.3.2.2 Aliquoted a portion of the CM2 prepared in 7.3.2.1 and supplement it with 3000 IU/ml IL-2 for the culturing of the cells. (e.g., for testing 4 feeder lots at one time, prepare 500 ml of CM2 medium with 3000 IU/ml IL-2). 7.3.2.3 The remainder of the CM2 with no IL-2 will be used for washing of cells as described below. 7.3.2.4 Working with each TIL line separately to prevent cross-contamination, removed the 24-well plate with TIL culture from the incubator and transferred to the BSC. 7.3.2.5 Using a sterile transfer pipet or 100-1000 ?l Pipettor and tip, removed about 1 ml of medium from each well of TIL to be used and place in an unused well of the 24-well tissue culture plate. This was used for washing wells. 7.3.2.6 Using a fresh sterile transfer pipet or 100-1000 ?l Pipettor and tip, mixed remaining medium with TIL in wells to resuspend the cells and then transferred the cell suspension to a 50 ml conical tube labeled with the TIL name and recorded the volume. 7.3.2.7 Washed the wells with the reserved media and transferred that volume to the same 50 ml conical tube. 7.3.2.8 Spun the cells at 400?CF to collect the cell pellet. 7.3.2.9 Aspirated off the media supernatant and resuspend the cell pellet in 2-5 ml of CM2 medium containing 3000 IU/ml IL-2, volume to be used based on the number of wells harvested and the size of the pelletvolume should be sufficient to ensure a concentration of >1.3?10.sup.6 cells/ml. 7.3.2.10 Using a serological pipet, mixed the cell suspension thoroughly and recorded the volume. 7.3.2.11 Removed 200 ?l for a cell count using an automated cell counter. 7.3.2.12 While counting, placed the 50 ml conical tube with TIL cells into a humidified, 5% CO.sub.2, 37? C. incubator, with the cap loosened to allow gas exchange. 7.3.2.13 Recorded the counts. 7.3.2.14 Removed the 50 ml conical tube containing the TIL cells from the incubator and resuspend them cells at a concentration of 1.3?10.sup.6 cells/ml in warm CM2 supplemented with 3000 IU/ml IL-2. Returned the 50 ml conical tube to the incubator with a loosened cap. 7.3.2.15 If desired, kept the original 24-well plate to reculture any residual TIL. 7.3.2.16 Repeated steps 7.3.2.4-7.3.2.15 for the second TIL line. 7.3.2.17 Just prior to plating the TIL into the T25 flasks for the experiment, TIL were diluted 1:10 for a final concentration of 1.3?10.sup.5 cells/ml as per step 7.3.2.35 below.
(835) Prepare MACS GMP CD3 Pure (OKT3) Working Solution 7.3.2.18 Took out stock solution of OKT3 (1 mg/ml) from 4? C. refrigerator and placed in BSC. 7.3.2.19 A final concentration of 30 ng/ml OKT3 was used in the media of the mini-REP. 7.3.2.20 600 ng of OKT3 were needed for 20 ml in each T25 flask of the experiment; this was the equivalent of 60 ?l of a 10 ?g/ml solution for each 20 ml, or 360 ?l for all 6 flasks tested for each feeder lot. 7.3.2.21 For each feeder lot tested, made 400 ?l of a 1:100 dilution of 1 mg/ml OKT3 for a working concentration of 10 ?g/ml (e.g., for testing 4 feeder lots at one time, make 1600 ?l of a 1:100 dilution of 1 mg/ml OKT3: 16 ?l of 1 mg/ml OKT3+1.584 ml of CM2 medium with 3000 IU/ml IL-2.)
(836) Prepare T25 flasks 7.3.2.22 Labeled each flask with the name of the TIL line tested, flask replicate number, feeder lot number, date, and initials of analyst. 7.3.2.23 Filled flask with the CM2 medium prior to preparing the feeder cells. 7.3.2.24 Placed flasks into 37? C. humidified 5% CO.sub.2 incubator to keep media warm while waiting to add the remaining components. 7.3.2.25 Once feeder cells were prepared, the components will be added to the CM2 in each flask.
(837) Prepare MACS GMP CD3 Pure (OKT3) Working Solution.
(838) TABLE-US-00028 TABLE 21 Solutions Volume in Volume in co-culture control (feeder Component flasks only) flasks CM2 + 300 IU/ml IL-2 18 ml 19 ml MNC: 1.3 ? 10.sup.7 ml in CM2 + 3000 IU 1 ml 1 ml IL-2 (final concentration 1.3 ? 10.sup.7/flask) OKT3: 10 ?/ml in CM2 + 3000 IU IL-2 60 ?l 60 ?l TIL: 1.3 ? 10.sup.5 ml in CM2 with 3000 IU of 1 ml 0 IL-2 (final concentration 1.3 ? 10.sup.5 flask)
(839) Prepare Feeder Cells 7.3.2.26 A minimum of 78?10.sup.6 feeder cells were needed per lot tested for this protocol. Each 1 ml vial frozen by SDBB had 100?10.sup.6 viable cells upon freezing. Assuming a 50% recovery upon thaw from LN2 storage, it was recommended to thaw at least two 1 ml vials of feeder cells per lot giving an estimated 100?10.sup.6 viable cells for each REP. Alternately, if supplied in 1.8 ml vials, only one vial provided enough feeder cells. 7.3.2.27 Before thawing feeder cells, pre-warmed approximately 50 ml of CM2 without IL-2 for each feeder lot to be tested. 7.3.2.28 Removed the designated feeder lot vials from LN2 storage, placed in zipper storage bag, and place on ice. Transferred vials to tissue culture room. 7.3.2.29 Thawed vials inside closed zipper storage bag by immersing in a 37? C. water bath. 7.3.2.30 Removed vials from zipper bag, spray or wipe with 70% EtOH and transferred vials to BSC. 7.3.2.31 Using a transfer pipet immediately transferred the contents of feeder vials into 30 ml of warm CM2 in a 50 ml conical tube. Washed vial with a small volume of CM2 to remove any residual cells in the vial. 7.3.2.32 Centrifuged at 400?CF for 5 minutes. 7.3.2.33 Aspirated the supernatant and resuspended in 4 ml warm CM2 plus 3000 IU/ml IL-2. 7.3.2.34 Removed 200 ?l for cell counting using the Automated Cell Counter. Recorded the counts. 7.3.2.34 Resuspended cells at 1.3?10.sup.7 cells/ml in warm CM2 plus 3000 IU/ml IL-2. 7.3.2.34 Diluted TIL cells from 1.3?10.sup.6 cells/ml to 1.3?10.sup.5 cells/ml. Worked with each TIL line independently to prevent cross-contamination.
(840) Setup Co-Culture 7.3.2.36 Diluted TIL cells from 1.3?10.sup.6 cells/ml to 1.3?10.sup.5 cells/ml. Worked with each TIL line independently to prevent cross-contamination. 7.3.2.36.1 Added 4.5 ml of CM2 medium to a 15 ml conical tube. 7.3.2.36.2 Removed TIL cells from incubator and resuspended well using a 10 ml serological pipet. 7.3.2.36.3 Removed 0.5 ml of cells from the 1.3?10.sup.6 cells/ml TIL suspension and added to the 4.5 ml of medium in the 15 ml conical tube. Returned TIL stock vial to incubator. 7.3.2.36.4 Mixed well. 7.3.2.36.5 Repeated steps 7.3.2.36.1-7.3.2.36.4 for the second TIL line. 7.3.2.36.6 If testing more than one feeder lot at one time, diluted the TIL to the lower concentration for each feeder lot just prior to plating the TIL. 7.3.2.37 Transferred flasks with pre-warmed media for a single feeder lot from the incubator to the BSC. 7.3.2.38 Mixed feeder cells by pipetting up and down several times with a 1 ml pipet tip and transferred 1 ml (1.3?10.sup.7 cells) to each flask for that feeder lot. 7.3.2.39 Added 60 ?l of OKT3 working stock (10 ?g/ml) to each flask. 7.3.2.40 Returned the two control flasks to the incubator. 7.3.2.41 Transferred 1 ml (1.3?10.sup.5) of each TIL lot to the correspondingly labeled T25 flask. 7.3.2.42 Returned flasks to the incubator and incubate upright. Did not disturb until Day 5. 7.3.2.43 Repeated 7.3.2.36-7.3.2.42 for all feeder lots tested.
(841) Day 5, Media Change 7.3.3.1 Prepared CM2 with 3000 IU/ml IL-2. 10 ml is needed for each flask 7.3.3.2 To prevent cross-contamination, handled the flasks for a single feeder lot at a time. Removed flasks from the incubator and transfer to the BSC, care was taken not to disturb the cell layer on the bottom of the flask. 7.3.3.3 Repeated for all flasks including control flask. 7.3.3.4 With a 10 ml pipette, transferred 10 ml warm CM2 with 3000 IU/ml IL-2 to each flask. 7.3.3.5 Returned flasks to the incubator and incubate upright until Day 7. Repeated 7.3.3.1-7.3.3.6 for all feeder lots tested.
(842) Day 7, Harvest 7.3.4.1 To prevent cross-contamination, handled the flasks for a single feeder lot at a time. 7.3.4.2 Removed flasks from the incubator and transfer to the BSC, care as taken not to disturb the cell layer on the bottom of the flask. 7.3.4.3 Without disturbing the cells growing on the bottom of the flasks, removed 10 ml of medium from each test flask and 15 ml of medium from each of the control flasks. 7.3.4.4 Using a 10 ml serological pipet, resuspended the cells in the remaining medium and mix well to break up any clumps of cells. 7.3.4.5 Recorded the volumes for each flask. 7.3.4.6 After thoroughly mixing cell suspension by pipetting, removed 200 ?l for cell counting. 7.3.4.7 Counted the TIL using the appropriate standard operating procedure in conjunction with the automatic cell counter equipment. 7.3.4.8 Recorded counts in Day 7. 7.3.4.9 Repeated 7.3.4.1-7.3.4.8 for all feeder lots tested. 7.3.4.10 Feeder control flasks were evaluated for replication incompetence and flasks containing TIL were evaluated for fold expansion from Day 0 according to the criteria listed in Table 21 (below).
(843) Day 7, Continuation of Feeder Control Flasks to Day 14 7.3.5.1 After completing the Day 7 counts of the feeder control flasks, added 15 ml of fresh CM2 medium containing 3000 IU/ml IL-2 to each of the control flasks. 7.3.5.2 Returned the control flasks to the incubator and incubated in an upright position until Day 14.
(844) Day 14, Extended Non-Proliferation of Feeder Control Flasks 7.3.6.1 To prevent cross-contamination, handled the flasks for a single feeder lot at a time. 7.3.6.2 Removed flasks from the incubator and transfer to the BSC, care was taken not to disturb the cell layer on the bottom of the flask. 7.3.6.3 Without disturbing the cells growing on the bottom of the flasks, removed approximately 17 ml of medium from each control flasks. 7.3.6.4 Using a 5 ml serological pipet, resuspended the cells in the remaining medium and mixed well to break up any clumps of cells. 7.3.6.5 Recorded the volumes for each flask. 7.3.6.6 After thoroughly mixing cell suspension by pipetting, removed 200 ?l for cell counting. 7.3.6.7 Counted the TIL using the appropriate standard operating procedure in conjunction with the automatic cell counter equipment. 7.3.6.8 Recorded counts. 7.3.6.9 Repeated 7.3.4.1-7.3.4.8 for all feeder lots tested.
Results and Acceptance Criteria
(845) Results 10.1.1 The dose of gamma irradiation was sufficient to render the feeder cells replication incompetent. All lots were expected to meet the evaluation criteria and also demonstrated a reduction in the total viable number of feeder cells remaining on Day 7 of the REP culture compared to Day 0. 10.1.2 All feeder lots were expected to meet the evaluation criteria of 100-fold expansion of TIL growth by Day 7 of the REP culture. 10.1.3 Day 14 counts of Feeder Control flasks were expected to continue the non-proliferative trend seen on Day 7.
(846) Acceptance Criteria 10.2.1 The following acceptance criteria were met for each replicate TIL line tested for each lot of feeder cells 10.2.2 Acceptance was two-fold, as follows (outlined in the Table below).
(847) TABLE-US-00029 TABLE 22 Acceptance Criteria Test Acceptance criteria Irradiation of MNC/ No growth observed at 7 and 14 days Replication Incompetence TIL expansion At least a 100-fold expansion of each TIL (minimum of 1.3 ? 10.sup.7 viable cells) 10.2.2.1 Evaluated whether the dose of radiation was sufficient to render the MNC feeder cells replication incompetent when cultured in the presence of 30 ng/ml OKT3 antibody and 3000 IU/ml IL-2. 10.2.2.1.1 Replication incompetence was evaluated by total viable cell count (TVC) as determined by automated cell counting on Day 7 and Day 14 of the REP. 10.2.2.1.2 Acceptance criteria was No Growth, meaning the total viable cell number has not increased on Day 7 and Day 14 from the initial viable cell number put into culture on Day 0 of the REP. 10.2.2.2 Evaluated the ability of the feeder cells to support TIL expansion. 10.2.2.2.1 TIL growth was measured in terms of fold expansion of viable cells from the onset of culture on Day 0 of the REP to Day 7 of the REP. 10.2.2.2.1 On Day 7, TIL cultures achieved a minimum of 100-fold expansion, (i.e., greater than 100 times the number of total viable TIL cells put into culture on REP Day 0), as evaluated by automated cell counting. 10.2.2.3 Should a lot fail to meet the two criteria above, the lot was retested according to the contingency plan outlined in Section 10.3 below. 10.2.2.4 Following retesting of a failed lot, any MNC feeder lot that did not meet the two acceptance criteria in both the original evaluation and the contingency testing was excluded. 10.2.2.5 Any MNC feeder lots that meet acceptance criteria but were judged to have poor performance in regard to the ability to expand TIL relative to other previous feeder lots tested in parallel with the same pre-REP TIL lines were excluded.
(848) Contingency Testing of MNC Feeder Lots that do not Meet Acceptance Criteria 10.3.1 In the event that an MNC feeder lot did not meet the either of the acceptance criteria outlined in Section 10.2 above, the following steps will be taken to retest the lot to rule out simple experimenter error as its cause. 10.3.2 If there are two or more remaining satellite testing vials of the lot, then the lot was retested. If there were one or no remaining satellite testing vials of the lot, then the lot was failed according to the acceptance criteria listed in Section 10.2 above. 10.3.3 Two trained personnel, include the original person who evaluated the lot in question, both tested the lot at the same time. 10.3.4 Repeating Section 7.2-7.3 was done to re-evaluate the lot in question. 10.3.5 Each person tested the lot in question as well as a control lot (as defined in Section 7.2.4 above). 10.3.6 In order to be qualified, the lot in question and the control lot had to achieve the acceptance criteria of Section 10.2 for both of the personnel doing the contingency testing. 10.3.7 Upon meeting these criteria, the lot was then released for CMO use as outlined in Section 10.2 above.
Example 14: Qualifying Individual Lots of Gamma-Irradiated Peripheral Blood Mononuclear Cells
(849) This Example describes a novel abbreviated procedure for qualifying individual lots of gamma-irradiated peripheral blood mononuclear cells (PBMC) for use as allogeneic feeder cells in the exemplary methods described herein. This example provides a protocol for the evaluation of irradiated PBMC cell lots for use in the production of clinical lots of TIL. Each irradiated PBMC lot was prepared from an individual donor. Over the course of more than 100 qualification protocols, it was been shown that, in all cases, irradiated PBMC lots from SDBB (San Diego Blood Bank) expand TIL >100-fold on Day 7 of a REP. This modified qualification protocol was intended to apply to irradiated donor PBMC lots from SDBB which were then further tested to verify that the received dose of gamma radiation was sufficient to render them replication incompetent. Once demonstrated that they maintained replication incompetence over the course of 14 days, donor PBMC lots were considered qualified for usage to produce clinical lots of TIL.
Key Terms and Definitions
(850) ?gMicrogram ?lMicroliter AIM-Vcommercially available cell culture medium Biological Safety Cabinet BSCCluster of Differentiation CDComplete Medium for TIL #2 CM2CM2 supplemented with 3000 IU/ml IL-2 CM2IL2Contract Manufacturing Organization CO.sub.2Carbon Dioxide EtOHEthanol GMPGood Manufacturing Practices GyGray ILInterleukin IUInternational Units LN2Liquid Nitrogen MIMilliliter NANot Applicable OKT3anti-CD3 monoclonal antibody designation P202-20 ?l pipettor P20020-200 ?l pipettor PBMCperipheral blood mononuclear cells P1000100-1000 ?l pipettor PPEPersonal Protective Equipment REPRapid Expansion Protocol SDBBSan Diego Blood Bank TILTumor Infiltrating Lymphocytes T2525 cm2 tissue culture flask ?gtimes gravitymeasure of relative centrifugal force
(851) Specimens include Irradiated donor PBMC (SDBB).
(852) Procedure
(853) Background
(854) 7.1.1 Gamma-irradiated, growth-arrested PBMC were required for current standard REP of TIL. Membrane receptors on the PBMCs bind to anti-CD3 (clone OKT3) antibody and crosslink to TIL in culture, stimulating the TIL to expand. PBMC lots were prepared from the leukapheresis of whole blood taken from individual donors. The leukapheresis product was subjected to centrifugation over Ficoll-Hypaque, washed, irradiated, and cryopreserved under GMP conditions. It is important that patients who received TIL therapy not be infused with viable PBMCs as this could result in Graft-Versus-Host Disease (GVHD). Donor PBMCs are therefore growth-arrested by dosing the cells with gamma-irradiation, resulting in double strand DNA breaks and the loss of cell viability of the PBMCs upon reculture.
(855) Evaluation Criteria 7.2.1 Evaluation criterion for irradiated PBMC lots was their replication incompetency.
(856) Experimental Set-Up 7.3.1 Feeder lots were tested in mini-REP format as if they were to be co-cultured with TIL, using upright T25 tissue culture flasks. 7.3.1.1 Control lot: One lot of irradiated PBMCs, which had historically been shown to meet the criterion of 7.2.1, was run alongside the experimental lots as a control. 7.3.2 For each lot of irradiated donor PBMC tested, duplicate flasks was run.
Experimental Protocol
(857) All tissue culture work in this protocol was done using sterile technique in a BSC.
(858) Day 0
(859) 7.4.1 Prepared ?90 ml of CM2 medium for each lot of donor PBMC to be tested. Kept CM2 warm in 37? C. water bath. 7.4.2 Thawed an aliquot of 6?10.sup.6 IU/ml IL-2. 7.4.3 Returned the CM2 medium to the BSC, wiping with 70% EtOH prior to placing in hood. For each lot of PBMC tested, removed about 60 ml of CM2 to a separate sterile bottle. Added IL-2 from the thawed 6?10.sup.6 IU/ml stock solution to this medium for a final concentration of 3000 IU/ml. Labeled this bottle as CM2/IL2 (or similar) to distinguish it from the unsupplemented CM2. 7.4.4 Labeled two T25 flasks for each lot of PBMC to be tested. Minimal label included: 7.4.4.1 Lot number 7.4.4.2 Flask number (1 or 2) 7.4.4.3 Date of initiation of culture (Day 0)
Prepare OKT3 7.4.5 Took out the stock solution of anti-CD3 (OKT3) from the 4? C. refrigerator and placed in the BSC. 7.4.6 A final concentration of 30 ng/ml OKT3 was used in the media of the mini-REP. 7.4.7 Prepared a 10 ?g/ml working solution of anti-CD3 (OKT3) from the 1 mg/ml stock solution. Placed in refrigerator until needed. 7.4.7.1 For each PBMC lot tested, prepare 150 ?l of a 1:100 dilution of the anti-CD3 (OKT3) stock E.g., for testing 4 PBMC lots at one time, prepare 600 ?l of 10 ?g/ml anti-CD3 (OKT3) by adding 6 ?l of the 1 mg/ml stock solution to 594 ?l of CM2 supplemented with 3000 IU/ml IL-2.
Prepare Flasks 7.4.8 Added 19 ml per flask of CM2/IL-2 to the labeled T25 flasks and placed flasks into 37? C., humidified, 5% CO.sub.2 incubator while preparing cells.
Prepare Irradiate PBMC 7.4.9 Worked with each donor PBMC lot individually to avoid the potential cross-contamination of the lots. 7.4.10 Retrieved vials of PBMC lots to be tested from LN2 storage. These were placed at ?80? C. or kept on dry ice prior to thawing. 7.4.11 Placed 30 ml of CM2 (without IL-2 supplement) into 50 ml conical tubes for each lot to be thawed. Labeled each tube with the different lot numbers of the PBMC to be thawed. Capped tubes tightly and place in 37? C. water bath prior to use. As needed, returned 50 ml conical tubes to the BSC, wiping with 70% EtOH prior to placing in the hood. 7.4.12 Removed a vial PBMC from cold storage and place in a floating tube rack in a 37? C. water bath to thaw. Allowed thaw to proceed until a small amount of ice remains in the vial. 7.4.13 Sprayed or wiped thawed vial with 70% EtOH and transfer to BSC. 7.4.14 Using a sterile transfer pipet, immediately transferred the contents of the vial into the 30 ml of CM2 in the 50 ml conical tube. Removed about 1 ml of medium from the tube to rinse the vial; returned rinse to the 50 ml conical tube. Capped tightly and swirl gently to wash cells. 7.4.15 Centrifuged at 400?g for 5 min at room temperature. 7.4.16 Aspirated the supernatant and resuspend the cell pellet in 1 ml of warm CM2/IL-2 using a 1000 ?l pipet tip. Alternately, prior to adding medium, resuspended cell pellet by dragging capped tube along an empty tube rack. After resuspending the cell pellet, brought volume to 4 ml using CM2/IL-2 medium. Recorded volume. 7.4.17 Removed a small aliquot (e.g., 100 ?l) for cell counting using an automated cell counter. 7.4.17.1 Performed counts in duplicate according to the particular automated cell counter SOP. It most likely was necessary to perform a dilution of the PBMC prior to performing the cell counts. A recommended starting dilution was 1:10, but this varied depending on the type of cell counter used. 7.4.17.2 Recorded the counts. 7.4.18 Adjusted concentration of PBMC to 1.3?10.sup.7 cells/ml as per the worksheet in step 7.4.15.2 using CM2/IL-2 medium. Mixed well by gentle swirling or by gently aspirating up-and-down using a serological pipet.
Set Up Culture Flasks 7.4.19 Returned two labeled T25 flasks to the BSC from the tissue culture incubator. 7.4.20 Returned the 10 ?g/ml vial of anti-CD3/OKT3 to the BSC. 7.4.21 Added 1 ml of the 1.3?10.sup.7 PBMC cell suspension to each flask. 7.4.22 Added 60 ?l of the 10 ?g/ml anti-CD3/OKT3 to each flask. 7.4.23 Returned capped flasks to the tissue culture incubators for 14 days of growth without disturbance. 7.4.24 Placed anti-CD3/OKT3 vial back into the refrigerator until needed for the next lot. 7.4.25 Repeated steps 7.4.9-7.4.24 for each lot of PBMC to be evaluated.
Day 14, Measurement of Non-Proliferation of PBMC 7.4.26 Working with each lot independently, carefully returned the duplicate T25 flasks to the BSC. 7.4.27 For each flask, using a fresh 10 ml serological pipet, removed ?17 ml from each of the flasks, then carefully pulled up the remaining media to measure the volume remaining in the flasks. Recorded volume. 7.4.28 Mixed sample well by pipetting up and down using the same serological pipet. 7.4.29 Removed a 200 ?l sample from each flask for counting. 7.4.30 Counted cells using an automated cell counter. 7.4.31 Repeated steps 7.4.26-7.4.31 for each lot of PBMC being evaluated.
Results and Acceptance Criterion
Results 10.1.1 The dose of gamma irradiation was expected to be sufficient to render the feeder cells replication incompetent. All lots were expected to meet the evaluation criterion, demonstrating a reduction in the total viable number of feeder cells remaining on Day 14 of the REP culture compared to Day 0.
Acceptance Criterion 10.2.1 The following acceptance criterion were met for each irradiated donor PBMC lot tested: 10.2.2 No growthmeant that the total number of viable cells on Day 14 was less than the initial viable cell number put into culture on Day 0 of the REP. 10.2.3 Should a lot fail to meet the criterion above, the lot was retested per the Contingency Testing Procedure outlined in the section 10.4. 10.2.4 Following retesting of a failed lot, any MNC feeder lot that did not meet the acceptance criterion in both the original evaluation and the contingency testing was excluded.
Contingency Testing of PBMC Lots which do not Meet Acceptance Criterion. 10.4.1 In the event than an irradiated donor PBMC lot did not meet the acceptance criterion above, the following steps were taken to retest the lot to rule out simple experimenter error as the cause of its failure. 10.4.2 If there were two or more remaining satellite vials of the lot, then the lot was retested. If there are one or no remaining satellite vials of the lot, then the lot was failed according to the acceptance criterion of section 10.2 above. 10.4.3 Whenever possible, two trained personnel (preferably including the original person who evaluated the lot in question) did the testing of the two separate vials independently. This was the preferred method of contingency testing. Aside from the separate vials of PBMC, the same reagents could be used by both personnel. 10.4.3.1. If two personnel were not available, one person did the testing of the two PBMC vials for the failed lot, working with each vial independently. 10.4.4 Repeating of section 7.4 Experimental Protocol was done to re-evaluated the lot in question. 10.4.5 In addition to the lot in question, a control lot was tested by each person carrying out the contingency testing. 10.4.5.1 If two personnel perform contingency testing, both personnel tested the control lot independently. 10.4.5.2 If only one person is available to perform contingency testing, it was not necessary for the control lot to be run in duplicate. 10.4.5.3 To be qualified, a PBMC lot going through contingency testing had both the control lot and both replicates of the lot in question achieve the acceptance criterion of Section 10.2 to pass. 10.4.5.4 Upon meeting this criterion, the lot was then released for CMO usage as outlined in section 10.2.
Example 15: Cellometer IC2 Image Cytometer Automatic Cell Counter
(860) This Example describes the procedure for operation of the Cellometer K2 Image Cytometer automatic cell counter.
1. Definitions
(861) ?l Microliter AOPI Acridine Orange Propidium Iodine BSC Biological Safety Cabinet DPBS Dulbecco's Phosphate Buffered Saline ml Milliliter MNC Mononuclear Blood Cells NA Not Applicable PBMC Peripheral Blood Mononuclear Cells PPE Personal Protective Equipment Pre-REP Initial TIL culture before Rapid Expansion Protocol of culture REP Rapid Expansion Protocol TIL Tumor Infiltrating Lymphocytes
7. Procedure
(862) 7.1 Cell suspension preparation 7.1.1 Trypan Blue Preparation The final Trypan blue concentration was 0.10%. The manufacturer recommended preparing a stock solution of 0.2%. 7.1.1.1 When using Trypan blue on the Cellometer K2, diluted the stock (0.4%) with PBS to 0.2%. 7.1.1.2 Filtered the Trypan blue with a 0.2-0.4 micron filter and aliquot in small volumes into labeled, capped tubes. 7.1.1.3 Mixed the cell suspension at 1:1 with 0.2% trypan blue. 7.1.2 AOPI Preparation 7.1.2.1 When using AOPI on the Cellometer K2, obtained the AOPI solution. 7.1.2.2 Stained cell sample at 1:1 with AOPI solution. NOTE: When counting high concentration cultures, diluted the cell samples in cell culture medium prior to the final 1:1 dilution with Trypan Blue or AOPI. Used manufacturer's suggested range of counting to determine the best dilution to use.
(863) 7.2 Cellometer K2 Set-Up 7.2.1 Turned on the Cellometer K2 equipment. 7.2.2 Selected the Cellometer Image Cytometer icon on the associated computer monitor. 7.2.3 On the main screen of the software, selected one of the Assays listed in the dropdown box. 7.2.3.1 When selecting the appropriate Assay, the Cell Type and Image Mode self-populated. 7.2.3.2 Under Sample section, clicked on Set User/Sample ID to open another screen to input operator's information for specimen. 7.2.3.2.1 Entered User ID. This will consist of the user's three letter initials. 7.2.3.2.2 Entered Sample ID. The sample ID is derived from incoming specimen information. 7.2.3.3 Set up dilution parameters. 7.2.3.3.1 If no other dilution was made besides the 1:1 mixture, the dilution factor was 2. 7.2.3.3.2 If a dilution was made prior to the final 1:1 mixture, the dilution factor was 2 times of the prior dilution. 7.2.3.3.3 Updated dilution factor according to the mixture used in the dilution section of the screen. Clicked on the pencil icon to bring up the dialog screens. 7.2.3.3.4 Verified that F1 Image and F2 Image sections are identical to each other. 7.2.3.3.5 Clicked on the Save button after set up has been completed.
(864) 7.3 Cell Counting 7.3.1 Removed the plastic backing from both sides of a Cellometer counting chamber slide (SD100) and placed it on top of a clean, lint-free wipe. 7.3.2 After preparing the cell suspension, removed a small aliquot of the sample and transferred it into a well of a multiwell cell culture plate or tube. 7.3.3 If diluting the sample, performed the dilution using cell culture medium. 7.3.4 Added 20 ?l of cell suspension into a well of the multiwell cell culture plate or tube. 7.3.5 Added 20 111 of 0.2% trypan blue or the AOPI solution to the 20111 of cell suspension and mix sample thoroughly. 7.3.6 Measured 20 IA of the 1:1 solution and transferred it into one side of the counting chamber.
(865) NOTE: Avoided touching the clear area of the slide. 7.3.7 If necessary, repeated the sample on the other side of the slide. 7.3.8. Inserted the chamber into the slot on the front of the Cellometer. 7.3.8 For the AOPI cell counting, clicked on Preview Fl on the main screen to preview the green fluorescent image (live cell) image. For Trypan blue counting, clicked on Preview Brightfield. 7.3.9 Using the focusing wheel, brought image into optimal focus. Cells had a bright center and a clearly-defined edge. 7.3.10 Clicked Count to begin the counting process. 7.3.11 Results were displayed in a counting results pop-up box on the computer screen showing the results of the counting process.
Example 16: Preparation of IL-2 Stock Solution (Cellgenix)
(866) This Example describes the process of dissolving purified, lyophilized recombinant human interleukin-2 into stock samples suitable for use in further tissue culture protocols, including all of those described in the present application and Examples, including those that involve using rhIL-2.
3. Definitions/Abbreviations
(867) ?L: microliter BSC: Biological Safety Cabinet BSL2: Biosafety Level 2 D-PBS: Dulbecco's Phosphate Buffered Saline G: Gauge GMP: Good Manufacturing Processing HAc: Acetic Acid HSA: Human Serum Albumin mL: Milliliter NA: Not applicable PPE: Personal Protective Equipment rhIL-2; IL-2: Recombinant human Interleukin-2 COA: Certificate of Analysis
6. Procedure
(868) 6.1 Prepare 0.2% Acetic Acid solution (HAc). 6.1.1 Transferred 29 mL sterile water to a 50 mL conical tube. 6.1.2 Added 1 mL 1N acetic acid to the 50 mL conical tube. 6.1.3 Mixed well by inverting tube 2-3 times. 6.1.4 Sterilized the HAc solution by filtration using a Steriflip filter. 6.1.5 Capped, dated, and labeled the solution Sterile 0.2% Acetic Acid Solution. 6.1.6 Solution expired after 2 months. Stored at room temperature.
(869) 6.2 Prepare 1% HSA in PBS. 6.2.1 Added 4 mL of 25% HSA stock solution to 96 mL PBS in a 150 mL sterile filter unit. 6.2.2 Filtered solution. 6.2.3 Capped, dated, and labeled the solution 1% HSA in PBS. 6.2.4 Solution expired after 2 months. Store 4? C.
(870) 6.3 For Each Vial of rhIL-2 Prepared, Fill Out Forms.
(871) 6.4 Prepared rhIL-2 Stock Solution (6?10.sup.6 IU/mL Final Concentration) 6.4.1 Each lot of rh1L-2 was different and required information found in the manufacturer's Certificate of Analysis (COA), such as: 6.4.1.1 Mass of rhIL-2 per vial (mg) 6.4.1.2 Specific activity of rhIL-2 (IU/mg) 6.4.1.3 Recommended 0.2% HAc reconstitution volume (mL) 6.4.2 Calculated the volume of 1% HSA required for rhIL-2 lot by using the equation below:
(872)
(873)
(874) 6.5 Storage of rhIL-2 Solution 6.5.1 For short-term storage (<72 hrs), stored vial at 4? C. 6.5.2 For long-term storage (>72 hrs), aliquoted vial into smaller volumes and stored in cryovials at ?20? C. until ready to use. Avoided freeze/thaw cycles. Expired 6 months after date of preparation. 6.5.3 Rh-IL-2 labels included vendor and catalog number, lot number, expiration date, operator initials, concentration and volume of aliquot.
Example 17: Preparation of Media for Pre-Rep and Rep Processes
(875) This Example describes the procedure for the preparation of tissue culture media for use in protocols involving the culture of tumor infiltrating lymphocytes (TIL) derived from various tumor types including, but not limited to, metastatic melanoma, head and neck squamous cell carcinoma (HNSCC), ovarian carcinoma, triple-negative breast carcinoma, and lung adenocarcinoma. This media can be used for preparation of any of the TILs described in the present application and Examples.
3. Definition
(876) ?g microgram ?m micrometer ?M micromolar AIM-V? serum-free tissue culture medium (Thermo Fisher Scientific) BSC Biological Safety Cabinet CM1 Complete Medium #1 CM2 Complete Medium #2 CM3 Complete Medium #3 CM4 Complete Medium #4 IU or U International units ml milliliter mM millimolar NA not applicable PPE personal protective equipment Pre-REP pre-Rapid Expansion Process REP Rapid Expansion Process rhIL-2, IL-2 recombinant human Interleukin-2 RPMI1640 Roswell Park Memorial Institute medium, formulation 1640 SOP Standard Operating Procedure TIL tumor infiltrating lymphocytes
7. Procedure
(877) 7.1 All Procedures are Done Using Sterile Technique in a BSC (Class II, Type A2). 7.1.1 Sprayed surface of hood with 70% ethanol prior to its use. 7.1.2 Sprayed all items and reagents with 70% ethanol prior to placing them into tissue culture hood.
(878) 7.2 Aliquotting of 200 mM L-Glutamine 7.2.1 L-glutamine was supplied in larger volumes than needed for the preparation of serum (e.g., 100 ml or 500 ml volumes). 7.2.2 Thawed bottle of L-glutamine in 37? C. water bath. 7.2.3 Mixed L-glutamine well after thawing, as it precipitates after thaw. Ensured that all precipitates have returned to solution prior to aliquotting. 7.2.4 Placed 5-10 ml aliquots of L-glutamine into sterile 15 ml conical tubes. 7.2.5 Labeled tubes with concentration, vendor, lot number, date aliquotted, and expiration date. 7.2.6 Tubes were then stored at ?20? C. and pulled as needed for media preparation.
(879) 7.3 Preparation of CM1 7.3.1 Removed the following reagents from cold storage and warmed them in a 37? C. water bath: 7.3.1.1 RPMI1640 7.3.1.2 Human AB serum 7.3.1.3 200 mM L-glutamine 7.3.2 Removed the BME from 4? C. storage and place in tissue culture hood. 7.3.3 Placed the gentamycin stock solution from room temperature storage into tissue culture hood. 7.3.4 Prepared CM1 medium according to Table 23 below by adding each of the ingredients into the top section of a 0.2 um filter unit appropriate to the volume to be filtered.
(880) TABLE-US-00030 TABLE 23 Preparation of CM1 Final Final Volume Ingredient concentration 500 ml Final Volume IL RPMI1640 NA 450 ml 900 ml Human AB serum, 50 ml 100 ml heat-inactivated 10% 200 mM L-glutamine 2 mM 5 ml 10 ml 55 mM BME 55 ?M 0.5 ml 1 ml 50 mg/ml gentamicin 50 ?g/ml 0.5 ml 1 ml sulfate 7.3.5 Labeled the CM1 media bottle with its name, the initials of the preparer, the date it was filtered/prepared, the two week expiration date and store at 4? C. until needed for tissue culture. Media can be aliquotted into smaller volume bottles as required. 7.3.6 Any remaining RPMI1640, Human AB serum, or L-glutamine was stored at 4? C. until next preparation of media. 7.3.7 Stock bottle of BME was returned to 4? C. storage. 7.3.8 Stock bottle of gentamicin was returned to its proper RT storage location. 7.3.9 Because of the limited buffering capacity of the medium, CM1 was discarded no more than two weeks after preparation, or as the phenol red pH indicator showed an extreme shift in pH (bright red to pink coloration). 7.3.10 On the day of use, prewarmed required amount of CM1 in 37? C. water bath and add 6000 IU/ml IL-2. 7.3.11 Additional supplementationas needed 7.3.11.1 CM1 supplemented with GlutaMAX? 7.3.11.1.1 CM1 could be prepared by substituting 2 mM GTutaMAX? for 2 mM glutamine (final concentration, see Table 2.) If this was done, labeled the media bottle as in Step 7.3.5 above adding 2 mM GlutaMAX to prevent confusion with the standard formulation of CM1. 7.3.11.2 CM1 supplemented with extra antibiotic/antimycotic 7.3.11.2.1 Some CM1 formulations required additional antibiotic or antimycotic to prevent contamination of pre-REP TIL grown from certain tumor types. 7.3.11.2.2 Added antibiotic/antimycotic to the final concentrations shown in Table 24 below. 7.3.11.2.3 If this was done, label the media bottle as in Step 7.3.1 above adding the name/s of the additional antibiotic/antimycotic to prevent confusion with the standard formulation of CM1.
(881) TABLE-US-00031 TABLE 24 Additional supplementation of CM1, as needed. Stock Final Supplement concentration Dilution concentration GlutaMAXTm 200 mM 1:100 2mM Penicillin/ 10,000 U/ml 1:100 100 U/ml penicillin streptomycin penicillin 100 ?g/ml 10,000 ?g/ml streptomycin streptomycin Amphotericin B 250 ?g/ml 1:100 2.5 ?g/ml
(882) 7.4 Preparation of CM2 7.4.1 Removed prepared CM1 from refrigerator or prepare fresh CM1 as per Section 7.3 above. 7.4.2 Removed AIM-V? from refrigerator. 7.4.3 Prepared the amount of CM2 needed by mixing prepared CM1 with an equal volume of AIM-V? in a sterile media bottle. 7.4.4 Added 3000 IU/ml IL-2 to CM2 medium on the day of usage. 7.4.5 Made sufficient amount of CM2 with 3000 IU/ml IL-2 on the day of usage. 7.4.6 Labeled the CM2 media bottle with its name, the initials of the preparer, the date it was filtered/prepared, the two week expiration date and store at 4? C. until needed for tissue culture. Media was aliquotted into smaller volume bottles as required. 7.4.7 Returned any CM2 without IL-2 to the refrigerator where it can be stored for up to two weeks, or until phenol red pH indicator shows an extreme shift in pH (bright red to pink coloration).
(883) 7.5 Preparation of CM3 7.5.1 Prepared CM3 on the day it was required for use. 7.5.2 CM3 was the same as AIM-V? medium, supplemented with 3000 IU/ml IL-2 on the day of use. 7.5.3 Prepared an amount of CM3 sufficient to experimental needs by adding IL-2 stock solution directly to the bottle or bag of AIM-V. Mixed well by gentle shaking. Label bottle with 3000 IU/ml IL-2 immediately after adding to the AIM-V. If there was excess CM3, stored it in bottles at 4? C. labeled with the media name, the initials of the preparer, the date the media was prepared, and its expiration date (7 days after preparation). 7.5.4 Discarded media supplemented with IL-2 after 7 days storage at 4? C.
(884) 7.6 Preparation of CM4 7.6.1 CM4 was the same as CM3, with the additional supplement of 2 mM GTutaMAX? (final concentration). 7.6.1.1 For every 1 L of CM3, added 10 ml of 200 mM GlutaMAX?. 7.6.2 Prepared an amount of CM4 sufficient to experimental needs by adding IL-2 stock solution and GTutaMAX? stock solution directly to the bottle or bag of AIM-V. Mixed well by gentle shaking. 7.6.3 Labeled bottle with 3000 IL/nil IL-2 and GlutaMAX immediately after adding to the AIM-V. 7.6.4 If there was excess CM4, stored it in bottles at 4? C. labeled with the media name, GlutaMAX, the initials of the preparer, the date the media was prepared, and its expiration date (7 days after preparation). 7.6.5 Discarded media supplemented with IL-2 after 7 days storage at 4? C.
Example 18: Surface Antigen Staining of Post REP TIL
1. Purpose
(885) The Example describes the procedure for cell surface staining of post-REP TILs by flow cytometry. This procedure can be applied to any TILs described in the application and Examples.
Key Terms and Definitions
(886) ?: Alpha ?: Beta ?l: Microliter APC: Allophycocyanin Ax647: Alex Fluor 647 BD: Becton Dickinson Company BSA: Bovine Serum Albumin BSC: Biological Safety Cabinet BV421: Brilliant Violet 421 CD: Cluster of Differentiation CST: Cytometer Setup and Tracking Cy: Cyanine DPBS: Dulbecco's Phosphate Buffered Saline FACS: Fluorescence Activated Cell Sorter FBS: Fetal Bovine Serum FITC: Fluorescein Isothiocyanate FMO: Fluorescence Minus One G: Gram H7: Analog of Cy7 Ml: Milliliter PE: Phycoerythrin PerCP-Cy5.5: Peridinin-Chlorophyll proteins PPE: Personal Protective Equipment REP: Rapid Expansion Protocol SIT: Sample Injection Tube TCR: T Cell Receptor w/v: Weight to Volume
(887) Flow Cytometry Antibodies and Stains
(888) TABLE-US-00032 TABLE 25 Live/Dead Aqua Stain ThermoFisher Catalog # L34966. Catalog Target Format Clone Supplier Number TCRab PE/Cy7 IP26 BioLegend 306720 (i.e., TCR?/?) CD57 PerCP-Cy5.5 HNK-1 BioLegend 359622 CD28 PE CD28.2 BioLegend 302908 CD4 FITC OKT4 eBioscience 11-0048-42 CD27 APC-H7 M-T271 BD Biosciences 560222 CD56 APC N901 Beckman IM2474U Coulter CD8a PB RPA-T8 BioLegend 301033 CD45R A PE-Cy7 HI100 BD Biosciences 560675 CD8a PerCP/Cy5.5 RPA-T8 BioLegend 301032 CCR7 PE 150503 BD Biosciences 560765 CD3 APC/Cy7 HIT3a BioLegend 300318 CD38 APC HB-7 BioLegend 356606 HLA-DR PB L243 BioLegend 307633 CD69 PE-Cy7 FN50 BD Biosciences 557745 TIGIT PE MBSA43 eBioscience 12-9500-42 KLRG1 Ax647 SA231A2 BioLegend 367704 CD154 BV421 TRAP1 BD Biosciences 563886 CD137 PE/Cy7 4B4-1 BioLegend 309818 Lag3 PE 3DS223H eBioscience 12-2239-42 PD1 APC EH12.2H 7 BioLegend 329908 Tim-3 BV421 F38-2E2 BioLegend 345008
7. Procedure
(889) 7.1 Reagent Preparation 7.1.1 FACS Wash Buffer 7.1.1.1 Added 2% (w/v) heat-inactivated FBS to DPBS (Add 10 ml FBS to 490 mLs of 1?dPBS). 7.1.1.2 Added 0.1% (w/v) NaN.sub.3 (76.9 ul to 500 mL bottle.) 7.1.1.3 Solution was stored at 40? C. Discard after 30 days. 7.1.2 Aqua dye 7.1.2.1 Added 50 ?l of DMSO to the vial of reactive dye. 7.1.2.2 Mixed well and visually confirm that all of the dye has dissolved. 7.1.2.3 Dye that was not used for the procedure was aliquoted and frozen at 20? C. until the next use. Did not freeze/thaw a second time. 7.1.3 Antibody Cocktail Preparation. 7.1.3.1 Cocktails were made up in polypropylene tubes such as an Eppendorf tube 7.1.3.2 Cocktails were stored for up to 6 months.
(890) TABLE-US-00033 TABLE 26 Differentiation Panel 1 (DF1): Catalog Target Format Clone Supplier Number Titre TCRab PE/Cy7 IP26 BioLegend 306720 3 (i.e., TCR?/?) CD57* PerCP- HNK-1 BioLegend 359622 2 Cy5.5 CD28* PE CD28.2 BioLegend 302908 2 CD4 FITC OKT4 eBioscience 11-0048-42 2 CD27* APC-H7 M-T271 BD 560222 3 Biosciences CD56 APC N901 Beckman IM2474U 3 Coulter CD8a PB RPA-T8 BioLegend 301033 2 FACS 33 Buffer
(891) TABLE-US-00034 TABLE 27 Differentiation Panel 2 (DF2): Catalog Target Format Clone Supplier Number Titre CD45RA* PE-Cy7 HI100 BD 560675 1 Biosciences CCD3 PerCP/Cy5.5 SP34-2 BD 552852 2 Biosciences CCCR7* PE 150503 BD 560765 5 Biosciences CCD8 FITC HIT8 BioLegend 300906 2 CCD4 APC/Cy7 OKT4 BioLegend 317418 2 CCD38* APC HB-7 BioLegend 356606 1 HHLA-DR PB L243 BioLegend 307633 2 FACS 35 Buffer
(892) TABLE-US-00035 TABLE 28 T-cell Activation Panel 1 (Tact1) Catalog Target Format Clone Supplier Number Titre CD137* PE/Cy7 4B4-1 BioLegend 309818 2 CD3 PerCP/Cy5.5 SP34-2 BD 552852 2 Biosciences Lag3* PE 3DS223H eBioscience 12- 5 2239-42 CD8 FITC HIT8 BioLegend 300906 2 CD4 APCCy7 OKT4 BioLegend 317418 2 PD1* APC EH12.2H7 BioLegend 329908 2 Tim-3* BV421 F38-2E2 BioLegend 345008 2 FACS 33 Buffer
(893) TABLE-US-00036 TABLE 29 T-cell Activation Panel 2 (Tact2) Catalog Target Format Clone Supplier Number Titre CD69* PE-Cy7 FN50 BD 557745 3 Biosciences CD3 PerCP/Cy5.5 SP34-2 BD 552852 2 Biosciences TIGIT* PE MBSA43 eBioscience 12-9500- 3 42 CD8 FITC HIT8 BioLegend 300906 2 CD4 APCCy7 OKT4 BioLegend 317418 2 KLRG1* Ax647 SA231A2 BioLegend 367704 1 CD154* BV421 TRAP1 BD 563886 3 Biosciences FACS 34 Buffer
(894) 7.2 Flow Cytometry Assay Requirements 7.2.1 Flow Cytometer Calibration 7.2.1.1 The flow cytometer was calibrated on the day of the assay using CST beads following manufacturer's instructions. 7.2.1.2 The operator ensured that the flow cytometer had passed calibration, where performance and baseline checks are valid. 7.2.2 Compensation/FMO Controls 7.2.2.1 Single color compensation samples were prepared using the BD compensation beads and the ArCTM Amine Reactive Compensation Bead Kit. 7.2.2.2 FMO control, cell containing samples were stained with a cocktail of antibodies minus the following single antibody conjugate, CD27, CD28, and CD57. 7.2.3 MFI Standardization 7.2.3.1 Cytometer voltages was determined daily with a bead control and target voltage values.
(895) 7.3 Sample Staining 7.3.1 Labeled FACS tube with the Sample ID-DF1, Sample ID-DF2, Sample ID-T1, Sample ID-T2. 7.3.2 Labeled one set of FMO controls with CD27-APC-H7, CD28-PE, CD57-PerCPCy5.5, CD45RA-PECy7, CCR7-PE, CD38-APC, CD137-PE7, Lag3-PE, PD1 APC, Tim3-BV421, CD69-PE7, TIGIT-PE, KLRG1-Ax647, and CD154-BV421. 7.3.3 Added 0.5 to 2 million cells to each tube. 7.3.4 QS to 3 mLs of 1?PBS to each tube. 7.3.5 Spun the tubes at 400?g, high acceleration and brake, for 5 minutes. 7.3.6 While the samples were centrifuging, prepared the dead cell labeling Aqua dye. 7.3.7 Removed an Aqua aliquot from the freezer and dilute 1/200 in PBS. Keep dark. Add 2 uL dye to 198 uL DPBS. 7.3.8 Decanted or aspirated the supernatant from step 7.3.5. 7.3.9 Added 25 uL of Aqua solution from above to samples and FMO controls. 7.3.10 Incubated for 15 minutes at Room Temperature (RT) in the dark. 7.3.11 Note: If cells were initially stored in a protein free media, then a blocking step should be added, such as 5 uL TruStain for 10 minutes at room temperature. 7.3.12 Added 50 uL of antibody cocktails to appropriate tubes. 7.3.13 Shook tube rack to mix. 7.3.14 Incubated for 15 minutes at RT in the dark. 7.3.15 Recording starting and ending times. Added 3 mL of FACS Wash buffer. 7.3.16 Spun tubes at 400?g, high acceleration and brake, for 5 minutes. 7.3.17 When centrifuge spin was complete, decanted or aspirated the supernatant. 7.3.18 Resuspended cells by sliding the tubes along an empty rack. 7.3.19 Added 100 uL of 1% ParaFormaldehyde to each tube. 7.3.20 Stored at 40C in dark until ready to collect on Flow Cytometer. Note: Samples could be stored for up to 72 hours.
(896) 7.4 L/D Aqua Compensation Control. 7.4.1 Labeled FACS tubes as L/D Aqua compensation control. 7.4.2 Added one drop of Arc beads to the tube. 7.4.3 Added 3 ?l of L/D Aqua directly to the beads. 7.4.4 Incubated the tubes at room temperature in the dark for 10 to 30 min. 7.4.5 Recorded starting and ending incubation time on the worksheet 7.4.6 After incubation, added 3 ml of FACS Wash to each tube. 7.4.7 Spun tubes at 400?g, high acceleration and brake, for 5 minutes. 7.4.8 Decanted or aspirated the supernatant. 7.4.9 Resuspended the tubes with 500 ?l of 1% PFA solution. Added 1 drop of negative bead. Placed at 40? C. in dark until collection.
(897) 7.5 Compensation Control Staining. 7.5.1 Labeled FACS tubes as shown in the Post-REP TIL Phenotype worksheet. 7.5.2 Added the antibodies as shown in the Post-REP TIL Phenotype worksheet. 7.5.3 After incubation, added 3 mLs of FACS buffer to each tube. 7.5.4 Spun tubes at 500 g, high acceleration and brake, for 2 minutes. 7.5.5 Decanted or aspirated the supernatant. 7.5.6 Resuspended the tubes with 500 ?l of 1% PFA in PBS and stored at 2-80? C. in the dark.
(898) 7.6 Data Acquisition 7.6.1 Opened FACSDiva software and login. 7.6.2 In the cytometer mismatch dialog, clicked Use CST Settings. 7.6.3 Created a new experiment by clicking on Experiment tab and selecting the Extended Phenotype template. 7.6.4 Double clicked on Target Values experiment and adjusted voltages to reach the target values determined by flow core operator. 7.6.5 Copied instrument settings and pasted them onto the new experiment. 7.6.6 Created a Specimen for each individual and named it appropriately. 7.6.7 Created names for the samples according to the labels on their tubes. 7.6.8 Gently vortexed or flick with finger before placing the tube in the SIT. 7.6.9 Acquired the data under RECORD in the Acquisition board. 7.6.10 Ran the samples at a speed of less than 7,500 events per second. 7.6.11 Collected between 50,000 to 100,000 live events excluding debris.
Example 19: Process 2A Verification Process Development
(899) The experiments in this Example were completed to analyze Process 2A for the manufacture of TIL from patient-derived tumors of melanoma and a single breast cancer including the outgrowth of TIL from tumors in a pre-REP procedure, followed by a modified REP. Special emphasis was placed on the establishment of a frozen TIL product and a comparison of the performance of the frozen TIL product against the current fresh TIL product process (Process 1C). This report will demonstrate that similar profiles are observed in assessment of fresh and thawed critical quality attributes (cell number, % viability, % CD3+ T-cells, and bead-stimulated gamma interferon (IFN-?) production) as well as a re-stimulation extended phenotype procedure (reREP) whether the same TIL product is fresh or frozen. Data presented to support this conclusion include proliferation, viability, phenotype, IFN-? release, potency, telomere length, and metabolic activity. The results characterize the Process 2A, a shortened pre-REP/REP process followed by the cryopreservation of TIL as well as compare the 2A process to the longer 1C process, as described herein.
(900) Tumor donor descriptions, processing dates and processing locations can be found in Table 1 below (*indicates that REP was started using a frozen pre-REP TIL line):
(901) TABLE-US-00037 TABLE 30 Description of Tumor Donors, Processing Dates And Processing Locations. Tumor ID Tissue Type Source Tissue M1061 Melanoma MT group Primary-left lateral foot M1062 Melanoma Moffitt N/A M1063 Melanoma MT group Metastatic C-right groin M1064 Melanoma MT group Metastatic C-left ankle M1065 Melanoma Bio Metastatic-Axillary Options lymph node EP11001 ER+PR+ MT group Primary-left breast invasive ductal carcinoma M1056* Melanoma Moffitt N/A M1058* Melanoma MT group Metastatic-Stage IIB Right scalp M1023* Melanoma Atlantic Primary-Right axilla Health
3. Background Information
(902) 3.1 LN-144 is an immunotherapeutic product for treating patients with metastatic melanoma. The product was composed of autologous tumor-infiltrating T lymphocytes (TIL) obtained from an individual patient following surgical resection of a tumor and expanded ex vivo through cell culture of morcellated tumor fragments (pre-REP) followed by Rapid Expansion of TIL in the presence of high dose IL-2, anti-CD3, and co-stimulatory APC. Following non-myeloablative lympho-depletion preconditioning, the patient received a single infusion of his/her TIL and subsequent intravenous infusions of aldesleukin (IL-2) every 8 hours for a maximum of 6 doses. Studies involving alternative methods of TIL expansion in the setting of Damage Associated Molecular Pattern Molecules (DAMPs) within the tumor microenvironment (TNE) have also demonstrated effective expansion of T-cells useful for therapy (Donia 2014; Sommerville, 2012). The Process 1C which has been used for commercial production of TIL involves a production schedule that can take ?45-55 days to produce an infusible TIL product which is delivered to an immunodepleted patient within 24 hours. The immunodepletion of the recipient patient must be timed precisely with the harvest of the current TIL product. Delays in harvest or delivery of the fresh product can negatively impact an immunodepleted patient awaiting infusion. Process 2A improved upon Process 1C by decreasing manufacturing lead time and materials, due to the decreased lengths of both pre-REP and REP procedures. In addition, Process 2A increased flexibility for product shipment time. The differences between Process 1C and Process 2A in the pre-REP, REP and harvest of process (see Table 2) includes: 3.1.1 Larger flasks with increased tumor fragment capacity used in the pre-REP procedure. 3.1.2 Steps that made use of closed system or which are amenable to future adaptation to a closed system. 3.1.3 Decreased number of days in both pre-REP and REP procedures. 3.1.4 A direct-to-REP approach, which eliminated the need to phenotype pre-REP populations prior to selecting specific populations of pre-REP TIL to proceed to REP. 3.1.5 A co-culture with a pre-set number of irradiated, allogeneic PBMC APC in conjunction with anti-CD3 (clone OKT3) calculated for sufficient expansion of TIL. 3.1.6 An automated cell-washing system for harvest. 3.1.7 A CS10-based final formulation that was cryogenically-preserved prior to shipping.
(903) TABLE-US-00038 TABLE 31 Impact of Process 2A on Process 1C. Process Step Process 1C Process 2A Impact STEP A: After surgery, can be After surgery, can be frozen Same. Obtain Patient frozen after harvest and after harvest and before tumor sample before Step B. Step B. Physical fragmentation Physical fragmentation Increased tumor fragments STEP B: 4 fragments per 10 G- 40 fragments per 1 G-REX- per flask First Expansion REX-10 flasks 100M flask Shortened culture time 11-21 day duration 11 day duration (3 days to Reduced number of steps Growth media medium 14 days range) Amenable to closed system comprises IL-2 Growth media medium comprises IL-2 STEP C: Step B TILs are frozen Step B TILs directly move Shortened pre-REP-to-REP First Expansion until phenotyped for to Step D on Step B day 11 process to Second selection then thawed to Step D requires 25- Reduced number of steps Expansion proceed to Step D (~day 200 ? 10.sup.6 TIL Eliminated phenotyping Transition 30) selection Amenable to closed system Step D requires >40 ? 10.sup.6 TIL STEP D: 6 G-REX-100M flasks 1 G-REX-500M flask on Reduced number of steps Second on Step D day 0 Step B day 11 Shorter REP duration Expansion 5 ? 10.sup.6 TIL and 5 ? 10.sup.8 25-200 ? 10.sup.6 TIL and 5 ? 10.sup.9 Closed system transfer of antigen presenting cell antigen presenting cell TIL between flasks feeders per flask on Step feeders on Step B day 11 Closed system media D day 0 Split to ?6 G-REX-500M exchanges Split to 18-36 flasks on flasks on day 16 Step D day 7 11 day duration for Step D 14 day duration for Step Growth media medium D comprises IL-2, OKT-3, Growth media medium and antigen-presenting cells comprises IL-2, OKT-3, and antigen-presenting cells Reduced number of steps STEP E: TIL harvested via TIL harvested via LOVO Automated cell washing Harvest TILS centrifugation automated cell washing Closed system system Reduced loss of product during wash STEP F: Fresh product in Cryopreserved product in Shipping flexibility Final Hypothermosol PlasmaLyte-A + 1% HSA Flexible patient scheduling Formulation/ Single infusion bag and CS10 stored in LN2 More timely release testing Transfer to Limited shipping stability Multiple aliquots Infusion Bag Longer shipping stability Overall 43-55 days from Step A 22 days from Step A Faster turnaround to patient Estimated through Step E through Step E Decreased clean room Process throughput Time Decreased Cost of Goods
4. Abbreviations
(904) ?g microgram ?l microliter ?m micrometer APC Antigen presenting cells CD Cluster of Differentiation CM Central memory CM1, CM2, Culture Media 1, 2 CO.sub.2 Carbon dioxide CS10 CryoStor? CS10 cryopreservation medium (BioLife Solutions) Ct PCR threshold cycle DAMPs Damage Associated Molecular Pattern molecules dCt Difference between reference Ct value and test Ct value ddCt Difference between dCt and 10 ng standard Ct value ECAR Extracellular acidification rate (measure of glycolysis) EM Effector memory ER+/PR+ Estrogen Receptor+/Progesterone Receptor+ GMP Good Manufacturing Practices HBSS Hanks Balanced Salt Solution HSA Human serum albumin IFN-? Interferon gamma IL Interleukin IU International units LN2 Liquid nitrogen Ml milliliter Mm millimeter ND Not determined Ng Nanogram ? C. degrees Celsius OCR Oxygen consumption rate (measure of oxidative phosphorylation) OKT3 Clone designation of anti-CD3 monoclonal antibody PBMC Peripheral Blood Mononuclear Cells PD Process Development REP Rapid Expansion Protocol Rh Recombinant human SOP Standard operating procedure T/S Telomere repeat copy number to single gene copy number ratio TIL Tumor Infiltrating Lymphocyte VDJ Variable, diversity, and joining segments of the T cell receptor V?, V? The mature T cell receptor variable region segments in the predominant Tumor Infiltrating Lymphocyte ?g microgram ?l microliter ?m micrometer APC Antigen presenting cells CD Cluster of Differentiation CM Central memory CM1, CM2, Culture Media 1, 2 CO2 Carbon dioxide CS10 CryoStor? CS10 cryopreservation medium (BioLife Solutions) Ct PCR threshold cycle DAMPs Damage Associated Molecular Pattern molecules dCt Difference between reference Ct value and test Ct value ddCt Difference between dCt and 10 ng standard Ct value ECAR Extracellular acidification rate (measure of glycolysis) EM Effector memory ER+/PR+ Estrogen Receptor+/Progesterone Receptor+ GMP Good Manufacturing Practices HBSS Hanks Balanced Salt Solution HSA Human serum albumin IFN-? Interferon gamma IL Interleukin IU International units LN2 Liquid nitrogen Ml milliliter Mm millimeter ND Not determined Ng Nanogram ? C. degrees Celsius OCR Oxygen consumption rate (measure of oxidative phosphorylation) OKT3 Clone designation of anti-CD3 monoclonal antibody PBMC Peripheral Blood Mononuclear Cells PD Process Development REP Rapid Expansion Protocol Rh Recombinant human SOP Standard operating procedure T/S Telomere repeat copy number to single gene copy number ratio TIL Tumor Infiltrating Lymphocyte VDJ Variable, diversity, and joining segments of the T cell receptor V?, V? The mature T cell receptor variable region segments in the predominant Tumor Infiltrating Lymphocyte
5. Experimental Design
(905) 5.1 Process 2A 5.1.1 Pre-REP: Upon receipt, the tumor was transferred to a Biological Safety Cabinet (Class II, Type A2). Using sterile technique, the tumor is removed from the shipping container and washed in HBSS containing 50 ?g/mL gentamicin. The technician morcellates the tumor into 40?3?3?3 mm fragments which are transferred to a G-REX ?100M flask containing pre-warmed CM1 media supplemented with 6000 IU/mL rhIL-2. The flask is placed in a 37? C., 5% CO.sub.2 humidified tissue culture incubator for 11 days. If the tumor generates more than 40 fragments, then more than one G-REX-100M may be set up. Cells are then harvested and prepared for the REP. 5.1.2 REP: On Day 11, one G-REX-500M flask containing 5 L of CM2 supplemented with 3000 IU/mL rhIL-2, 30 ng/mL anti-CD3 (Clone OKT3) and 5?10.sup.9 irradiated allogeneic feeder PBMC cells is prepared. TIL harvested from the pre-REP G-REX-100M flask after volume reduction are counted and seeded into the G-REX-500M flask at a density that can range between 5?10.sup.6 and 200?10.sup.6 cells. The flask is then placed in a humidified 37? C., 5% CO.sub.2 tissue culture incubator for five days. On Day 16, volume of the G-REX-500M flask is reduced, TIL are counted and their viability determined. At this point, the TIL are expanded into multiple G-REX-500M flasks (up to a maximum of six flasks), each with a seeding density of 1?10.sup.9 TIL/flask. All flasks are then placed in humidified 37? C., 5% CO.sub.2 tissue culture incubators for an additional six days. On Day 22, the day of harvest, each flask is volume reduced by 90%, the cells are pooled together and filtered through a 170 ?m blood filter, and then collected into a 3 L Origin EV3000 bag or equivalent in preparation for automated washing using the LOVO. 5.1.3 Harvest and Final Formulation: TIL are washed using the LOVO automated cell processing system which replaces 99.99% of cell culture media with a wash buffer consisting of PlasmaLyte-A supplemented with 1% HSA. The LOVO operates using spinning filtration membrane technology that recovers over 92% of the TIL while virtually eliminating residual tissue culture components, including serum, growth factors, and cytokines, as well as other debris and particulates. After completion of the wash, a cell count is performed to determine the expansion of the TIL and their viability upon harvest. CS10 is added to the washed TIL at a 1:1 volume:volume ratio to achieve the Process 2A final formulation. The final formulated product is aliquoted into cryostorage bags, sealed, and placed in pre-cooled aluminum cassettes. Cryostorage bags containing TIL are then frozen using a CryoMed Controlled Rate Freezer (ThermoFisher Scientific, Waltham, MA) according to SOP LAB-018 Rev 000 Operation of Controlled Rate Freezer.
(906) 5.2 TIL Samples: Four Conditions of TIL were Collected for Characterization Comparison. 5.2.1 Fresh harvested TIL (direct from PlasmaLyte-A with 1% HSA wash buffer) Thawed TIL (direct from thawed final product bag) 5.2.2 Fresh Extended Phenotype reREP TIL (fresh harvested TIL cultured for 7-14 days with IL-2, PBMC feeders, and anti-CD3 clone OKT3) 5.2.3 Thawed Extended Phenotype TIL (thawed TIL cultured for 7-14 days with IL-2, PBMC feeders, and anti-CD3 clone OKT3)
(907) 5.3 Testing Overview (See
6. Results Achieved
(908) A total of 9 experiments were performed using the TIL derived from the tumors described in section 2.3 the experimental design and harvest conditions in section 5.1. TIL harvested using Process 2A were subjected to the testing outlined in section 5.3.2 for the purpose of understanding their ability to expand, their viability, phenotype, cytotoxic potential, and metabolic profile. All measures were taken for the fresh harvested TIL product and the thawed frozen TIL product (Process 2A).
(909) 6.1 Cell Counts and Viability 6.1.1 Cell counts were taken at the end of the pre-REP, on Day 5 or 6 of the REP (expansion day), and at the end of the REP, both prior to LOVO wash and after LOVO wash. The cell counts were then used to determine the expansion of TIL during the REP and the recovery of TIL after washing on the LOVO. After thaw, the cells were counted again to determine the post-thaw recovery (based on the concentration at which the TIL were frozen) and the post-thaw viability prior to proceeding with other analytical assay. Table 3 summarizes all of these results for the nine Process 2A runs.
(910) TABLE-US-00039 TABLE 32 Cell counts, % viability, and expansion of TIL from Process 2A runs. M1061T M1062T M1063T M1064T M1065T EP11001T M1056T M1058T M1023T pre-REP 3.3 ? 10.sup.7 1 ? 10.sup.8 7.5 ? 10.sup.7 1.8 ? 10.sup.8 4.1 ? 10.sup.6 5.4 ? 10.sup.s 7 ? 10.sup.7 4.7 ? 10.sup.7 4.8 ? 10.sup.7 Inoculum Day 5/6 1.3 ? 10.sup.9 4 ? 10.sup.9 3 ? 10.sup.9 3.6 ? 10.sup.9 6.6 ? 10.sup.8 2.8 ? 10.sup.9 4.0 ? 10.sup.9 3.7 ? 10.sup.9 2.2 ? 10.sup.9 Count Fold Expansion from Day 0 898 590 470 130 1900 522 771 1400 850 to Day 11 Harvest 2.8 ? 10.sup.10 5.6 ? 10.sup.10 3.5 ? 10.sup.10 2.3 ? 10.sup.10 7.8 ? 10.sup.9 2.63 ? 10.sup.10 5 ? 10.sup.10 6.7 ? 10.sup.10 4.1 ? 10.sup.10 LOVO 100 68 100 100 92 95 100 90 99 Recovery (%) Cryostorage 3 ? 30 2 ? 100 2 ? 100 2 ? 50 3 ? 100 2 ? 65 2 ? 100 2 ? 100 2 ? 100 Bags ml ml ml ml ml ml ml ml ml Post-thaw 103 84 90 88 101 82 82 86 78 Recovery (%) Post-thaw 84.75 84.36 77.15 83.48 79.98 74.85 80.28 85.03 89.21 Viability (%) 6.1.2 Process 2A SOP defines the starting number of TIL for a REP as a range of 5 200?10.sup.6 TIL. The range of nine TIL samples used to start the Process 2A REPs was from 4.1?106 (M1065T)1.8?10.sup.8 (M1064T), with an average starting TIL number of 6.58?10.sup.7. Interestingly, the REP plated with the lowest number of TIL expanded to the greatest degree at REP harvest (range of expansion for all 9 REPs: 130-1900-fold; average expansion, 840-fold). The average number of TIL harvested at the end of these nine Process 2A REPs was 4.49?10.sup.10 (range 7.8?10.sup.9-6.7?10.sup.10). 6.1.3 For comparative statistics of Process 1C, see Chemistry, Manufacturing, and Controls (CMC) Section of Investigational New Drug (IND) Application for LN144/LN-145. 6.1.4 Process 1C utilizes manual handling and centrifugation to wash the TIL product. This is time consuming, but more importantly can result in the loss of up to 25% of the product between harvest and final formulation. The automatic cell washing LOVO system provides a way to minimize cell loss and also introduces a closed system wash which decreases the risk of contamination of the product during the wash steps. The recovery of the product following the LOVO wash step of the protocol and showed an average of 93.8?10.4% recovery of the TIL product going into the wash step. This statistic includes TIL product for M1062T, which had a LOVO recovery of 68%, during which an operator error in the operation of the LOVO resulted in the need to centrifuge the sample and then restart the LOVO procedure (see Section 7, Deviations and Discrepancies). This represents a highly favorable improvement upon the Process 1C washing step on the REP harvest day. 6.1.5 Recovery of TIL after the thaw is also a major concern for a frozen TIL product. Recovery of the product was determined by measuring the number of cells recovered from the bag after the thaw compared to the number of cells placed into each freeze bag prior to cryopreservation. The range of recovery from thaw was 78-103%, with an average recovery of 88.2?8.6%. 6.1.6 Though there is a significant difference in the viability of the samples prior to or after thawing, on average, there is only a 2% loss in viability upon thaw. The viability of the TIL going into cryopreservation was 84.3?4.7%, and the same TIL after thawing had a viability of 82.1?4.4% (p=0.0742, paired Student's t-test, non-parametric). Release criteria for the fresh clinical TIL Process 1C product requires a minimum of 70% viability. Regardless of a small loss of viability upon thaw, all 9 runs of Process 2A met this release criterion following thaw of the cryogenic product. Table 4 and
(911) TABLE-US-00040 TABLE 33 Comparison of viability of fresh and thawed product. M1061T M1062T M1063T M1064T M1065T EP11001T M1056T M1058T M1023T Fresh + 88.05 84.45 82.05 86.75 76.35 77.9 84.8 87.5 90.5 CS10 Thaw 84.75 84.36 77.15 83.48 79.98 74.85 80.28 85.03 89.21 6.2 Re-REP expansion of TIL. In addition to examining at the ability of the fresh product to expand in a REP, he ability of both the fresh and the thawed TIL product to expand upon restimulation with fresh irradiated allogeneic PBMC feeder APCs and fresh anti-CD3 was evaluated. After 7 days, these restimulated TIL products were analyzed for their ability to expand from initial culture conditions.
(912) TABLE-US-00041 TABLE 34 Comparison of fresh and thawed TIL expansion in re-REP culture M1061T M1062T M1063T M1064T M1065T EP11001T M1056T M1058T M1023T Fresh + 139.67 264 227 60.12 24.67 268.83 176 316.33 202.33 Thaw 177.33 110.33 220.67 177.6 220.2 302.5 114.77 190.67 73.82 6.3 Cell Culture Metabolites. One of the major premises of Lion 2A was that less tech time and process transfers would lead to cost savings and limit variability. Possible adverse consequences of this were increases in undesirable metabolites and decreases in nutrient sources. As shown in
(913) 6.4 IL-2 Quantification. 6.4.1 The main driver of TIL proliferation in the pre-REP in addition to supplemental glucose, glutamine and sufficient oxygenation, is the provision of high levels of rhIL-2. Following its addition to serum containing media, IL-2 levels were measured at 2-3.5?10.sup.3 IU/ml, only falling to about 1.0?103 IU/ml over the 11 days of culture. This is well above the 30-100 IU/ml necessary to sustain T-cell proliferation. Assessment of IL-2 concentrations using different sources of IL-2 (Prometheus, Akron, Cellgenix) is currently being tested in separate experiments (QP-17-010: Qualification of IL-2 from Cellgenix, Akron and Prometheus) at Lion Biotechnologies, Tampa.
(914) 6.5 IFN-? Production 6.5.1 After 24 hr stimulation of TIL with magnetic anti-CD3, CD28 and 4-1BB Dynabeads as described in sections 5.3.5.3, supernatant from cultures was collected and analyzed for IFN-? using ELISA kits. All restimulated TIL produced more IFN-? than their unstimulated counterparts, showing that the stimulation of the TIL resulted in their activation.
(915) Tables 6 and 7 show the average values of IFN-? secretion in the 9 Process 2A runs. IFN-? secretion into the surrounding medium upon restimulation is not different between the fresh TIL product and the thawed, cryopreserved TIL. Table 6 shows that fresh product produced an average of 4143?2285 pg IFN-?/106 TIL while thawed product produced 3910?1487 pg IFN-?/106 TIL (p=0.55 using paired Student's t-test). If normalized to total TIL product (Table 7), on average, stimulated fresh TIL produced 86?61 grams IFN-?, while thawed stimulated TIL produced 68?40 grams IFN-? (p=0.13). These findings indicate that both fresh and thawed TIL products produce IFN-? and that there is no difference in the ability of either fresh or thawed matching TIL to produce IFN-? upon stimulation with anti-CD3/anti-CD28/anti-4-1BB.
(916) TABLE-US-00042 TABLE 35 IFN-? secretion in fresh and thawed TIL (expressed as pg/10.sup.6cells/24 hrs) M1061T M1062T M1063T M1064T M1065T EP11001T M1056T M1058T M1023T Fresh 4570 3921 5589 619 1363 4263 6065 2983 7918 Thaw 3158 3543 5478 1563 2127 5059 4216 4033 6010 Fresh Re-REP 3638 1732 971 2676 2753 1461 2374 770 3512 Thaw Re-REP 2970 2060 1273 1074 1744 2522 5042 4038 923
(917) TABLE-US-00043 TABLE 36 IFN-? secretion in fresh and thawed TIL. All values are in 1012(expressed as grams/10.sup.6cells/24 hrs) M1061T M1062T M1063T M1064T M1065T EP11001T M1056T M1058T M1023T Fresh 67.1 78.4 99.6 8.4 4.8 66.1 157.0 109.0 187.0 Thaw 47.7 59.7 87.9 18.7 7.5 64.4 88.9 127.0 111.0
(918) 6.6 Granzyme B Production 6.6.1 TIL were stimulated with magnetic anti-CD3, CD28 and 4-1BB Dynabeads for 24 hr as described in 5.2.5.3, and supernatant from cultures was collected after 24 hr and analyzed Granzyme B levels by ELISA. All restimulated TIL produced more Granzyme B than their unstimulated counterparts, showing that the stimulation of the TIL resulted in their activation.
(919) All products showed granzyme B production ranging from 9190 pg/10.sup.6 viable cells to 262000 pg/10.sup.6 viable cells (Table 8). Table 6 shows that fresh product produced an average of 60644+42959, while fresh and thawed re-REP produced 93600+67558 and 103878+84515 respectively. Comparison between the fresh re-REP and thawed re-REP showed that there is no difference in the ability of the TIL obtained from either conditions (p=0.7). Due to the lack of Granzyme B measurement in the thawed product, no statistical analysis were performed using the fresh TIL product.
(920) TABLE-US-00044 TABLE 37 Granzyme B secretion in fresh TIL, fresh reREP TIL, and thawed reREP TIL (expressed as pg/10.sup.6cells/24 hrs) M1061T M1062T M1063T M1064T M1065T EP11001T M1056T M1058T M1023T Fresh 10600 108000 49100 28400 24300 17900 120000 12900 79100 Fresh ReREP 216000 37700 42400 91800 192000 22200 97300 73800 69200 Thaw ReREP 262000 113000 35100 65600 48700 9190 147000 201000 53300
(921) 6.7 Flow Cytometric Analysis of Cell Surface Biomarkers
(922) Phenotypic profiling of TILs: Four antibody panels have been standardized at LION to broadly characterize the functional profile of T-cells. These panels were used to assess the immunophenotyping of fresh TIL, thawed TIL, fresh re-REP TIL, and thawed re-REP TIL. All the data used for graphical representation in this section are also provided in a table format (Tables 14-24) in the appendix section 10.
(923) 6.8 Bioluminescent Redirected Lysis Assay 6.8.1 To determine the potential ability of the Process 2A TIL to kill their target tumor cells, we developed a potency assay involving the co-culture of TIL with a bioluminescent surrogate target cell line P815, as described in section 5.3.2.4. A 4 hour co-culture of the different TIL compositions with P815 in the presence of anti-CD3 stimulation gives a measure of the cytotoxic potential of the TIL cells expressed as LU50, lytic units which can be defined as the number of TIL necessary to kill 50% of the target cells. This measure is then expressed as LU50/106 TIL.
(924) TABLE-US-00045 TABLE 38 Lytic units produced by TIL against P815 target cell line Fresh Fresh reREP Thaw reREP M1061T 21.7 42.3 342 M1062T 5.9 17.0 20.9 M1063T 14.2 161 12.5 M10641 22.2 8.7 4.4 M10651 42.6 411 128 8 EP11001T 1.8 4.3 147 M1056T 25.0 16.6 18.2 M10513T 76.9 13.8 16.6 M1023T 30.8 25.6 30.4 avg ? sd 26.8 ? 22.5 20.6 ? 13.3 31.1 ? 37.6
(925) 6.9 Cellular Metabolism Profile of TIL 6.9.1 To assess the metabolic health of post-REP TIL, we utilized the Seahorse metabolism analyzer instruments (XFp and XFe96) from Agilent Technologies (Santa Clara, CA) following the protocol outlined in section 5.3.2.6. Briefly, by treating cells with inhibitors that target certain aspects of either oxidative phosphorylation or glycolysis, cells are stressed in such a way that allows for the determination of their SRC and glycolytic reserve. In addition, basal levels of both oxidative phosphorylation (basal OCR) and glycolysis (basal ECAR) can be determined. Finally, because inhibitors of oxidative phosphorylation and glycolysis are combined in the same test, a potential hidden reserve of SRC can be discerned which is only apparent when the cells are treated with the competitive inhibitor of glycolysis, 2-deoxyglucose (2-DG), (labeled SRC2DG), resulting in an increase in SRC which would otherwise remain hidden. This extra respiratory capacity has been labeled as Covert SRC. Table 9 shows the metabolic profiles of the fresh harvested TIL, fresh re-REP TIL, and thawed re-REP TIL derived from the metabolic stress test performed on the cells. 6.9.2
(926) TABLE-US-00046 TABLE 39 Metabolic Profile of Process 2A TIL p v. p v. fresh r M1061 M1062 M1063 Moff2 Moff3 Moff4 EP11001T M1064 M1065 avg sd fresh REP Basal OCR, pmol/min PLLA 50.33 33.95 74.89 36.80 38.48 39.89 63.02 55.89 49.16 14.56 fresh re-REP 38.92 38.48 54.35 25.98 18.68 38.61 37.33 41.04 36.67 10.57 0.03 thaw re-REP 39.25 43.28 60.05 30.68 57.90 59.08 27.85 52.58 32.82 44.83 12.90 0.48 0.11 Overt SRC, pmol/min PLLA 24.74 10.45 101.18 47.32 77.00 35.07 31.39 3.02 41.27 33.22 fresh re-REP 51.72 36.46 48.24 28.34 37.69 21.02 9.93 99.71 41.64 27.17 0.29 thaw re-REP 47.38 40.40 121.86 26.04 37.32 86.47 58.45 89.59 56.45 62.66 30.75 0.16 0.12 SRC20G, pmol/min PLLA 14.01 5.72 35.98 29.97 74.62 24.42 31.39 20.70 29.60 20.67 fresh re-REP 81.80 78.82 52.73 38.69 92.37 42.35 -12.81 137.15 63.89 44.45 0.08 thaw re-REP 76.97 77.72 177.48 48.27 56.57 69.05 74.14 130.76 85.89 88.54 40.59 0.00 0.25 Covert SRC, pmol/min PLLA 0.00 0.00 0.00 0.00 0.00 0.00 0.00 17.68 2.21 6.25 fresh re-REP 30.08 42.36 4.50 10.35 54.68 21.33 0.00 2.63 20.74 20.13 0.02 thaw re-REP 29.59 37.32 55.62 22.23 19.25 0.00 15.68 41.16 29.44 27.81 16.10 0.01 0.52 Basal ECAR, mpH/min PLLA 53.44 27.55 136.33 48.72 89.80 62.29 108.38 72.07 74.82 35.20 fresh re-REP 96.48 96.63 171.47 102.87 145.19 153.97 35.60 147.02 118.65 44.19 0.10 thaw re-REP 143.35 173.93 193.39 149.19 169.21 73.17 98.64 96.37 90.55 131.98 43.15 0.01 0.38 Glycolytic Reserve, mpH/min PLLA 32.11 26.18 52.00 19.09 38.01 39.03 43.14 76.43 40.75 17.61 fresh re-REP 24.06 8.75 18.17 ?8.28 ?5.89 10.31 35.34 20.80 12.91 14.85 0.003 thaw re-REP 15.50 ?18.94 13.56 ?6.78 11.45 54.84 ?21.37 ?12.66 ?5.47 3.35 23.75 0.01 0.47 6.9.3 A direct comparison of fresh to frozen products using the re-REP procedure has enabled us to determine that both the fresh and frozen TIL products, upon identical stimulation conditions, result in metabolic profiles that are statistically indistinct. Both fresh re-REP and thawed re-REP TIL have similar levels of basal respiration (
(927) 6.10 Telomere Length Measurement 6.10.1 Measurement of Telomere Length of Post REP TIL by Flow Fish and qPCR. 6.10.1.1 Flow-FISH was performed using Dako/Agilent Pathology Solutions (Telomere PNA Kit/FITC for Flow Cytometry) kit and the manufacturer's instructions were followed to measure the average length of the Telomere repeat. 1301 T-cell leukemia cell line (Sigma-Aldrich, St. Louis, MO)) was used as an internal reference standard in each assay. Individual TIL were counted and mixed with 1301 cells at a 1:1 cell ratio. 2?106 TIL were mixed with 2?106 1301 cells. In situ hybridization was performed in hybridization solution (70% formamide, 1% BSA, 20 mM Tris, pH 7.0) in duplicate and in the presence and absence of a FITC-conjugated Telomere PNA probe (FITC-00-CCCTAA-CCC-TAA-CCC-TAA) complementary to the telomere repeat sequence at a final concentration of 60 nM. After addition of the Telomere PNA probe, cells were incubated for 10 minutes at 82? C. in a heat block. The cells were then placed in the dark at room temperature overnight. The next morning, excess telomere probe was removed by washing 2 times for 10 minutes each on a heat block at 40? C. with Wash Solution. Following the washes, DAPI (Invitrogen, Carlsbad, CA) was added at a final concentration of 75 ng/ml. DNA staining with DAPI was used to gate cells in the G0/G1 population. Sample analysis was performed using a Yeti flow cytometer (Propel-Labs, Fort Collins, CO). Telomere fluorescence of the test sample was expressed as a percentage of the fluorescence (fl) of the 1301 cells per the following formula:Relative telomere length=[(mean FITC fl test cells w/probe-mean FITC fl test cells w/o probe)?DNA index of 1301 cells?100]/[(mean FITC fl 1301 cells w/probemean FITC fl 1301 cells w/o probe)?DNA index of test cells. 6.10.1.2 qPCR: Real time qPCR was used to measure relative telomere length. Briefly, the telomere repeat copy number to single gene copy number (T/S) ratio was determined using an Bio-Rad PCR thermal cycler (Bio-Rad Laboratories, Hercules, CA) in a 96-well format. Ten nanograms of genomic DNA was used for either telomere (Tel) or hemoglobin (hgb) PCR reaction and the primers used were as follows: Tel-1b primer (CGG TTT GTT TGG GTT TGG GTT TGG GTT TGG GTT TGG GTT), Tel-2b primer (GGC TTG CCT TAC CCT TAC CCT TAC CCT TAC CCT TAC CCT), hgb1 primer (GCTTCTGACACAACTGTGTTCACTAGC), and hgb2 primer (CACCAACTTCATCCACGTTCACC). All samples were analyzed by both the telomere and hemoglobin reactions, and the analysis was performed in triplicate on the same plate. In addition to the test samples, each 96-well plate contained a five-point standard curve from 0.08 ng to 250 ng using genomic DNA isolated from 1301 cells. The T/S ratio (?dCt) for each sample was calculated by subtracting the median hemoglobin threshold cycle (Ct) value from the median telomere Ct value. The relative T/S ratio (?ddCt) was determined by subtracting the T/S ratio of the 10 ng standard curve point from the T/S ratio of each unknown sample. 6.10.1.3 Telomere Length Results and Discussion: Telomeres are caps (repetitive nucleotide sequences) at the end of the linear chromosomes which play a critical role in facilitating complete chromosome replication Telomere measurement is an emerging tool in the study of such conditions as degenerative diseases, cancer, and aging. Previous studies from NIH (J. Immunol. 2005, Nov. 15; 175(10):7046-52; Clin Cancer Res. 2011, Jul. 1; 17(13): 4550-4557) have shown that longer telomere length of TIL is associated with clinical response. Conversely, Radvanyi's group found no significant difference in the telomere length of TIL between responders and non-responders (Clin Cancer Res; 18(24); 6758-70). Thus far, there is no evidence to prove that telomere length is associated with the length of in vitro T cell culture. It is possible that post-REP TIL cultured by Process 2A (22 day culture) will have longer telomere length when compared to TIL cultured by Process 1C process (25-36 day culture).
7. Discrepancies and Deviations
(928) 7.1 Process Deviations 7.1.1 M1061T: REP cells were split on Day 6 into 4 G-Rex500M flasks. 7.1.2 M1062T: REP cells were split on Day 6 into 4 G-Rex500M flasks. Due to an operator error on the LOVO filtration system, an emergency stop occurred during the procedure which required a manual collection of the TIL from the disposable kit. The TIL were successfully filtered during a second LOVO run. 7.1.3 M1063T: No deviations M1064T: No deviations 7.1.4 M1065T: Pre-REP cells were below specification for cell count on Day 11 (<5?10.sup.6 cells) but were continued into the REP. On REP Day 6, the cells were counted and placed back into the G-Rex500M and fed with 4.5 L fresh media. The TIL were not expanded on this day due to insufficient cell count (<1?10.sup.9 cells on REP Day 6). 7.1.5 EPI1001T: No deviations 7.1.6 M1056T: Pre-REP cells were cultured at LION in a G-Rex 100 flask for up to 21 days. Tumor fragments were filtered out on pre-REP Day 11 and the TIL were frozen down on day of harvest in 100% CS10 at 30?106 cells per 1.5 ml vial. Frozen TIL were thawed at Moffitt PD in CM1 supplemented with 6000 IU/mL rhIL-2 and rested for 3 days before initiating Day 0 of the REP. On REP Day 6, TIL were expanded into 4 flasks which proceeded to harvest on REP Day 11. 7.1.7 M1058T: Pre-REP cells were cultured at LION in a G-Rex 100 flask for up to 21 days. Tumor fragments were filtered out on pre-REP Day 11 and the TIL were frozen down on day of harvest in 100% CS10 at 30?106 cells per 1.5 ml vial. Frozen TIL were thawed at Moffitt PD in CM1 supplemented with 6000 IU/mL rhIL-2 and rested for 3 days before initiating Day 0 of the REP. On REP Day 6, cells were split into 4 flasks which proceeded to harvest on REP Day 11. 7.1.8 M1023T: Pre-REP cells were cultured at LION in G-Rex10 flasks for up to 21 days. Tumor fragments were filtered out on pre-REP Day 11 and the TIL were frozen down on day of harvest in 100% CS10 at 30?106 cells per 1.5 ml vial. Frozen TIL were thawed at Moffitt PD in CM1 supplemented with 6000 IU/mL rhIL-2 and rested for 3 days prior to initiating Day 0 of the REP. On REP Day 6, cells were expanded into 4 flasks which proceeded to harvest on REP Day 11.
(929) 7.2 Testing Deviations 7.2.1 In-depth cytokine analysis and TCR sequencing were not performed
8. Conclusions and Recommendations 8.1 Developing a More Robust Process. The challenge to Lion was to convert the earlier Lion Process 1C, which had a long processing time, to a potentially more commercializable Lion Process 2A which utilizes refinements resulting in shorter processing time and a cryopreserved final formulation of the TIL product. To this end, nine Process Development runs were conducted to confirm that the old and new processes demonstrated comparable cell yields and comparable TIL potency and phenotype. Of particular note was the markedly decreased complexity of the overall process, resulting in a 50% reduction in the overall length of the pre-REP and REP processes, yet still resulting in comparable TIL yields (7.8?10.sup.9-67?10.sup.9 cells) compared to the historic Lion Process 1C currently practiced at our contract manufacturer. This was recently updated for the June 2017 ASCO presentation (Mean: 41.04?109 cells with a range of 1.2-96?10.sup.9 cells). In addition, Lion has successfully developed a cryopreserved TIL product which demonstrated a post-thaw recovery of 78-103% with >70% viability of TIL, consistent with current Process 1C release criteria (see Table 2). 8.2 The Role of the Extended Phenotypic Analysis (Re-REP). The ability to proliferate in response to mitogenic stimulation (as in the experimental re-REPs presented in this report) is a critical quality attribute of TIL. The experiments presented here show that 8/9 thawed TIL products were able to expand >100-fold in one week compared to 7/9 matched fresh TIL products, supporting the comparability of the thawed TIL product to the fresh TIL product (Table 2). Two additional critical quality attributes of TIL are their ability to release IFN-? and/or Granzyme B following cytokine (CD3/CD28/4-1BB) stimulation. Cytokine stimulation of both the fresh and thawed products resulted in IFN-? release exceeding 2 ng/10.sup.6 cells/24 hours in 7/9 fresh products and all thawed products (
(930) TABLE-US-00047 TABLE 40 Acceptance criteria for feasibility and comparability Acceptance Criteria for Acceptance Criteria Sampling Point Parameter Test Method Feasibility for Comparability Day 22 Total Viable Cells Automated Cell ?1.5 ? 10% viable cells No statistical Counter with ACPI significance between fresh and frozen ReREP arms (p- value < 0.05) % Viability Automated Cell ?70% viable No statistical Counter with ACPI significance between fresh and frozen ReREP arms (p- value < 0.05) Purity Flow Cytometry ?90% T-cells No statistical significance between fresh and frozen ReREP arms (p- value < 0.05) TCR Sequencing N/A N/A Potency IFNI( ELISA ?2x background No statistical and significance between ?400pg/1 ? 10.sup.6 viable cells/24 hrs fresh and frozen ReREP arms (p- value < 0.05) Granzyme B ELISA ?2x background N/A Bioluminescent N/A N/A Redirected Lysis Assay Respiration Seahorse Stress N/A N/A Test
(931) Based on the feasibility criteria listed in Table 11, TIL will be evaluated on whether or not the requirements were met. All individual criteria were met for each experiment and each TIL line (n=9). Student t-test was used for statistical analysis. Non-parametric student T-test was used to calculate the p-value for % viability as viability measures will not be a Gaussian distribution. See, Table 41 below.
(932) TABLE-US-00048 TABLE 41 Meeting Feasibility Acceptance Criteria. Purity Potency (IFNy (Flow ELISA) Cell Count % Viability Cytometry) pg/1 ? 10.sup.6 cells/24 h TIL Line Fresh Thaw Fresh Thaw Fresh Thaw Fresh Thaw M1061T 6.48 ? 10.sup.9 6.66 ? 10.sup.9 88.05 84.93 95.3 91.5 4570 3158 M1062T 6.76 ? 10.sup.9 5.70 ? 10.sup.9 84.45 83.73 99.7 98.9 3921 3543 M1063T 14.9 ? 10.sup.9 13.5 ? 10.sup.9 82.05 77.15 98.7 99.6 5589 5478 M1064T 8.06 ? 10.sup.9 7.08 ? 10.sup.9 86.75 83.36 84.5 89.8 619 1563 M1065T 3.06 ? 10.sup.9 3.10 ? 10.sup.9 76.35 80.90 96.8 91.4 1363 2127 EP11001T 14.9 ? 10.sup.9 12.2 ? 10.sup.9 77.9 74.85 90.4 94.3 4263 5059 M1056T 13.1 ? 10.sup.9 10.7 ? 10.sup.9 84.8 80.20 94.2 94.1 6065 4216 M1058T 23.4 ? 10.sup.9 20.1 ? 10.sup.9 87.5 85.07 99 96.2 2983 4033 M1023T 18.4 ? 10.sup.9 144 ? 10.sup.9 90.5 89.52 96.5 98.8 7918 6010 P value 0.1132 0.0742 0.9855 0.5821 Significantly No No No No different
(933) Based on the acceptance criteria listed in Table 40, fresh and frozen re-REP TIL were evaluated on whether or not the requirements were met. (Viability not reported since the duration of re-REP was 7 days and residual irradiated PBMC could not be distinguished from TIL.) Numbers in parentheses denote the criteria that were not met. Based on the purity criteria measured using CD3+ expression, 6/9 fresh Re-REP TIL products met the stringent >90% criteria (M1061, M1065 and EP11001 did not) and 8/9 thawed products passed the acceptance criteria even following Re-REP. The low number of CD3+ TIL in EP11001T fresh re-REP might be attributed to extreme downregulation of T cell receptor. Measurement of CD3+ TIL as a measure of purity was not determined for M023T thaw re-REP TIL. For this TIL composition, purity was estimated using TCR?? staining and is denoted by an asterisk (*). Student-t test was used for the statistical analysis. See, Table 42 below.
(934) TABLE-US-00049 TABLE 42 Meeting Comparability Acceptance Criteria. Purity Potency (IFNy ELISA) Cell Count (Flow Cytometry) pg/1 ? 10.sup.6 cells/24 h Fresh Thaw Fresh Thaw Fresh Thaw TIL Line Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP M1061T 1.40 ? 10.sup.6 1.77 ? 10.sup.6 (86.1) 99.3 3638 2970 M1062T 2.64 ? 10.sup.6 1.10 ? 10.sup.6 99.3 97.1 1732 2060 M1063T 2.27 ? 10.sup.6 2.21 ? 10.sup.6 99.2 97.4 971 1273 M1064T 1.76 ? 10.sup.6 1.15 ? 10.sup.6 83.8 37.8 2676 1074 M1065T 3.16 ? 10.sup.6 1.91 ? 10.sup.6 (78.1) (75.8) 2753 1744 EP11001T 2.02 ? 10.sup.6 0.738 ? 10.sup.6 (18.2) 85.4 1461 2522 M1056T 0.601 ? 10.sup.6 1.78 ? 10.sup.6 98.1 96.7 2374 5042 M1058T 0.740 ? 10.sup.6 2.20 ? 10.sup.6 98.4 99.2 770 4038 M1023T 2.69 ? 10.sup.6 3.03 ? 10.sup.6 97 39.9* 3512 923 P value 0.6815 0.3369 0.7680 Significantly No No No different
BIBLIOGRAPHY
(935) Goff S L, Dudley M E, Citrin D E, Somerville R P, Wunderlich J R, Danforth D N, Zlott D A, Yang J C, Sherry R M, Kammula U S, Klebanoff C A, Hughes M S, Restifo N P, Langhan M M, Shelton T E, Lu L, Kwong M L, Ilyas S, Klemen N D, Payabyab E C, Morton K E, Toomey M A, Steinberg S M, White D E, Rosenberg S A. Randomized, Prospective Evaluation Comparing Intensity of Lymphodepletion Before Adoptive Transfer of Tumor-Infiltrating Lymphocytes for Patients With Metastatic Melanoma. J. Clin Oncol. 2016 Jul. 10; 34(20):2389-97. doi: 10.1200/JCO.2016.66.7220. Epub 2016 May 23. PubMed PMID: 27217459; PubMed Central PMCID: PMC4981979. Hinrichs C S, Rosenberg S A. Exploiting the curative potential of adoptive T-cell therapy for cancer. Immunol Rev. 2014 January; 257(1):56-71. doi:10.1111/imr.12132. Review. PubMed PMID: 24329789; PubMed Central PMCID: PMC3920180. Jin J, Sabatino M, Somerville R, Wilson J R, Dudley M E, Stroncek D F, Rosenberg S A. Simplified method of the growth of human tumor infiltrating lymphocytes in gas-permeable flasks to numbers needed for patient treatment. J Immunother. 2012 April; 35(3):283-92. d10.1097/CJI.0b013e31824e801f. PubMed PMID: 22421946; PubMed Central PMCID: PMC3315105. Somerville R P, Devillier L, Parkhurst M R, Rosenberg S A, Dudley M E. Clinical scale rapid expansion of lymphocytes for adoptive cell transfer therapy in the WAVER bioreactor. J Transl Med. 2012 Apr. 4; 10:69. Donia M, Larsen S M, Met O, Svane I M. Simplified protocol for clinical-grade tumor-infiltrating lymphocyte manufacturing with use of the Wave bioreactor. Cytotherapy. 2014 August; 16(8):1117-20. doi: 10.1016/j.jcyt.2014.02.004; PubMed PMID: 24831841. Henning A L, Levitt D E, Vingren J L, McFarlin B K. Measurement of T-Cell Telomere Length Using Amplified-Signal FISH Staining and Flow Cytometry. Curr Protoc Cytom. 2017 Jan. 5; 79:7.47.1-7.47.10. doi: 10.1002/cpcy.11. PubMed PMID 28055115 Kelesidis T, Schmid I. Assessment of Telomere Length, Phenotype, and DNA Content. Curr Protoc Cytom. 2017 Jan. 5; 79:7.26.1-7.26.23. doi: 10.1002/cpcy.12. PubMed PMID: 28055113. Gardner M, Bann D, Wiley L, Cooper R, Hardy R, Nitsch D, Martin-Ruiz C, Shiels P, Sayer A A, Barbieri M, Bekaert S, Bischoff C, Brooks-Wilson A, Chen W, Cooper C, Christensen K, De Meyer T, Deary I, Der G, Diez Roux A, Fitzpatrick A, Hajat A, Halaschek-Wiener J, Harris S, Hunt S C, Jagger C, Jeon H S, Kaplan R, Kimura M, Lansdorp P, Li C, Maeda T, Mangino M, Nawrot T S, Nilsson P, Nordfjall K, Paolisso G, Ren F, Riabowol K, Robertson T, Roos G, Staessen J A, Spector T, Tang N, Unryn B, van der Harst P, Woo J, Xing C, Yadegarfar M E, Park J Y, Young N, Kuh D, von Zglinicki T, Ben-Shlomo Y; Halcyon study team. Gender and telomere length: systematic review and meta-analysis. Exp Gerontol. 2014 March; 51:15-27. doi:10.1016/j.exger.2013.12.004. Epub 2013 Dec. 21. Review. PubMed PMID: 24365661; PubMed Central PMCID: PMC4523138. Carbonari M, Tedesco T, Fiorilli M. Correlation between terminal restriction fragments and flow-FISH measures in samples over wide range telomere lengths. Cell Prolif. 2014 February; 47(1):20-7. doi: 10.1111/cpr.12086. PubMed PMID: 24450811. Rufer N, Dragowska W, Thombury G, Roosnek E, Lansdorp P M. Telomere length dynamics in human lymphocyte subpopulations measured by flow cytometry. Nat Biotechnol. 1998 August; 16(8):743-7. PubMed PMID: 9702772. Li Y, Liu S, Hemandez J, Vence L, Hwu P, Radvanyi L. MART-1-specific melanoma tumor-infiltrating lymphocytes maintaining CD28 expression have improved survival and expansion capability following antigenic restimulation in vitro. J. Immunol. 2010 Jan. 1; 184(1):452-65. doi: 10.4049/jimmunol.0901101. Epub 2009 Nov. 30. PubMed PMID: 19949105. Rosenberg S A, Dudley M E. Adoptive cell therapy for the treatment of patients with metastatic melanoma. Curr Opin Immunol. 2009 April; 21(2):233-40. doi:10.1016/j.coi.2009.03.002. Epub 2009 Mar. 21. Review. PubMed PMID: 19304471; PubMed Central PMCID: PMC3459355. Shen X, Zhou J, Hathcock K S, Robbins P, Powell D J Jr, Rosenberg S A, Hodes R J. Persistence of tumor infiltrating lymphocytes in adoptive immunotherapy correlates with telomere length. J Immunother. 2007 January; 30(1):123-9. PubMed PMID:17198091; PubMed Central PMCID: PMC2151201. Zhou J, Shen X, Huang J, Hodes R J, Rosenberg S A, Robbins P F. Telomere length of transferred lymphocytes correlates with in vivo persistence and tumor regression in melanoma patients receiving cell transfer therapy. J. Immunol. 2005 Nov. 15; 175(10):7046-52. PubMed PMID: 16272366; PubMed Central PMCID: PMC1351312. Maciejowski J, de Lange T. Telomeres in cancer: tumour suppression and genome instability. Nat Rev Mol Cell Biol. 2017 March; 18(3):175-186. doi:10.1038/nrm.2016.171. Epub 2017 Jan. 18. Review. PubMed PMID: 28096526. Erdel F, Kratz K, Willcox S, Griffith J D, Greene E C, de Lange T. Telomere Recognition and Assembly Mechanism of Mammalian Shelterin. Cell Rep. 2017 Jan. 3; 18(1):41-53. doi: 10.1016/j.celrep.2016.12.005. PubMed PMID: 28052260; PubMed Central PMCID: PMC5225662. Cardenas M E, Bianchi A, de Lange T. A Xenopus egg factor with DNA-binding properties characteristic of terminus-specific telomeric proteins. Genes Dev.1993 May; 7(5):883-94. PubMed PMID: 7684008. de Lange T. Activation of telomerase in a human tumor. Proc Natl Acad Sci USA. 1994 Apr. 12; 91(8):2882-5. Review. PubMed PMID: 8159672; PubMed Central PMCID: PMC43476. de Lange T, Shiue L, Myers R M, Cox D R, Naylor S L, Killery A M, Varmus H E. Structure and variability of human chromosome ends. Mol Cell Biol. 1990 February; 10(2):518-27. PubMed PMID: 2300052; PubMed Central PMCID: PMC360828.
9. Additional Tables
(936) TABLE-US-00050 TABLE 43 FIG. 39: CD4+ cells Tumor ID M1061 M1062 M1063 M1064 M1065 EP11001 M1056 M1058 M1023 Fresh 4.85 34 10.5 41.7 64.9 64.7 4.15 12.3 8.38 Thaw 5.68 33 11.3 49.5 61.7 62.6 3.46 17.9 7.6 Fresh ReREP 8.1 23.5 19.2 39/ 31.9 16.3 6.46 12.9 16.7 Thaw ReREP 11 33 15.3 49.3 39.3 26.7 9.51 17.2 19.1
(937) TABLE-US-00051 TABLE 44 FIG. 40: CD8+ cells Tumor ID M1061 M1062 M1063 M1064 M1065 EP11001 M1056 M1058 M1023 Fresh 45.6 54.7 85.8 38.2 28.6 22.3 93.2 84 88.8 Thaw 50.8 55.7 76.7 37 22.8 19 92.9 76.6 84.3 Fresh ReREP 63 48.3 72.4 37.9 47.8 5.87 90.3 74.5 74.4 Thaw ReREP 66.3 46.7 47 21.6 19.1 9.23 82.8 63.7 64.3
(938) TABLE-US-00052 TABLE 45 FIG. 41: CD4+CD154+ cells and FIG. 105: CD8+CD154+ cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD154+ 78.6 nd nd nd 93.3 62.1 94 76.2 CD8 CD154+ 37.3 nd nd nd 85.8 19.9 89.3 61.1 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD154+ 88.9 84 56 82.1 68.2 93.6 97 90.3 CD8 CD154+ 35.6 49 12.5 19 59.1 77.88 0.025 90.1 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD154+ 91 87.2 79.1 83.1 89.3 92 90.1 92.6 77.9 66.9 CD8 CD154+ 17 20.3 40 36.9 23 27.6 40.5 52.1 17.9 13.7 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD154+ 0 91.6 52.1 87.1 77 86.4 92.7 85.1 90.7 81.3 CD8 CD154+ 0.00609 61.8 45.3 74.8 47.3 81.7 73.6 78.3 24.2 27.1
(939) TABLE-US-00053 TABLE 46 FIG. 43: CD4+CD69+ cells and FIG. 17: CD8+CD69+ cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD69+ 33.9 nd nd nd 82.2 68.8 51.3 84.8 CD8 CD69+ 22.4 nd nd nd 83 78.3 67.8 78.6 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD69+ 58.7 69.6 67.6 77.6 77.6 86.7 85.5 78.5 CD8 CD69+ 80.9 80 62.7 73.2 87.6 87.9 92.2 88.3 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD69+ 82.7 84.4 78.7 58.3 83.9 84.9 89.7 644.6 33.8 38.7 CD8 CD69+ 78.9 72.3 69.5 54.5 80.3 86 68 77.8 41.3 48.8 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD69+ 90.2 93.2 74.7 39.1 96.1 93.8 91.1 93.7 35.3 80.1 CD8 CD69+ 91.3 90.5 87.6 52.9 95.4 94.2 93.1 93.6 71.1 88.1
(940) TABLE-US-00054 TABLE 47 FIG. 45: CD4 +CD137+ cells and FIG. 19 CD8+CD137+ cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD137+ 19.8 nd nd nd 65.4 30.4 nd 1.31 CD8 CD137+ 19.8 nd nd nd 65.4 30.4 nd 1.31 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD137+ 15.4 30.4 73 78.1 62.6 53.2 51.6 64.7 CD8 CD137+ 28.8 43.1 39.3 35.3 84.4 85.7 71.1 81 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD137+ 524 7.26 7.78 5.4 4.28 3.65 6.89 4.6 4.28 9.67 CD8 CD137+ 3.23 7.26 7.78 5.4 4.28 3.65 6.89 4.6 4.28 9.67 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD137+ 31.1 24.6 65.1 47.8 221 18.6 61.6 56.9 49.8 50.8 CD8 CD137+ 50.9 33.8 57.3 54.6 77.3 78.8 76.9 87 58 50.3
(941) TABLE-US-00055 TABLE 48 FIG. 47: CD4+CM cells and FIG. 21 CD8+CM cells M1061 M1062 M1063 M1064 TCell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CM 1.08 n/d 0.59 0.29 10.4 2.08 14.4 0.13 CD8 CM 0.37 n/d 0.9 0.17 3.2 0.66 73.2 0.13 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CM 2.32 7.71 13.8 12.6 13.4 22.3 15.9 18.6 CD8 CM 1.85 9.38 6.48 14.2 15.7 25.7 24.2 25.8 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CM 0.42 0.53 0.48 1.17 1.83 1.5 1.36 1.8 2.45 1.79 CD8 CM 0.21 0.67 2.65 1.79 0.33 0.72 0.91 0.67 1.99 2.22 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CM 7.03 2.28 18.9 3.73 49.6 55.6 20.1 12.6 22.1 12.7 CD8 CM 5.05 1.6 11.4 3.37 25.8 26.4 21.6 19.8 11.1 7.59
(942) TABLE-US-00056 TABLE 49 FIG. 49: CD4+EM cells and FIG. 23 CD8+EM cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 EM 90 n/d 98.3 98.9 83.9 97.2 84.1 99.8 CD8 EM 89.1 n/d 80.6 87.9 92.4 97.8 20.8 98.8 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 EM 95.6 84.4 84.5 83.4 84.3 73.7 80.6 80.4 CD8 EM 97.2 87.9 90.8 82.3 82.5 72.2 74.5 73 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 EM 99.4 99.4 96.7 97.4 97.1 97.8 97.4 97.6 9.62 95.3 CD8 EM 98.3 98.6 91.8 95.5 98.8 98.9 98.8 99.2 93.9 95.2 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 EM 91.7 97 74.3 90.7 36.2 25.5 73.9 81.8 73.1 76.4 CD8 EM 91.5 96.1 83 90.8 73.2 71.9 77.1 78.2 84.1 85.1
(943) TABLE-US-00057 TABLE 50 FIG. 51: CD4+CD28+ cells and FIG. 25 CD8+CD28+ cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD28+ 4.6 5.85 33.2 37 10.5 11.2 31.9 27.6 CD8 CD28+ 30.1 34 24.5 23.1 83.8 49.3 22.5 15.5 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD28+ 6.75 7.18 21.6 27.8 18.6 15 23 27.6 CD8 CD28+ 24.6 17.9 10 6.4 28.6 18.9 15.7 11 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 CD28+ 41.7 38.2 63.2 59.8 3.97 3.29 12.2 17.5 8.27 7.48 CD8 CD28+ 13.4 8.52 14.5 12 53 54.4 56.5 62.1 76.5 80.8 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 CD28+ 12.3 15.2 13.3 20 6.22 9.29 12.3 16.5 15.4 17.9 CD8 CD28+ 6.9 2.43 2.07 3.75 24 34 27 36.9 42 43.9
(944) TABLE-US-00058 TABLE 51 FIG. 53: CD4+PD-1+ cells and FIG. 27 CD8+PD-1+ cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 PD-1+ 48.5 nd nd nd 77 40.6 nd 22.4 CD8 PD-1+ 37.1 nd nd nd 56 24.6 nd 14 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 PD-1+ 36.8 34.2 15.7 26.7 43.9 66 32.4 14.5 CD8 PD-1+ 40.4 35.3 6.3 6.21 18 20.4 35.6 23.2 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 PD-1+ 7.87 7.23 33.3 28.2 33.9 32.8 41.7 38 22.7 23.8 CD8 PD-1+ 1.61 0.72 19.2 12.5 23.8 24.7 78.4 59.8 42.6 36.1 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 PD-1+ 22.4 15.5 40.9 33.4 56 51.3 40.3 32.5 18.9 27.3 CD8 PD-1+ 6.49 5.73 29.8 34.6 18.9 15.2 68.6 47 28.9 36.1
(945) TABLE-US-00059 TABLE 52 FIG. 55: CD4+LAG3+ cells and FIG. 29 CD8+LAG3+ cells M1061 M1062 M1063 M1064 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 LAG3+ 16.8 nd nd nd 93.5 37.3 nd 6.8 CD8 LAG3+ 74 nd nd nd 98.4 81.5 nd 31.8 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 LAG3+ 68.3 73.1 35.2 56.9 26.9 27.3 52.6 64 CD8 LAG3+ 98.3 98.7 97.1 97.7 89.6 85.1 92.8 94.7 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 LAG3+ 47.2 30.5 35.5 20.1 25 27.4 48.6 38 14.5 7.65 CD8 LAG3+ 85.3 38.7 89.6 64.2 83.4 81.9 93.2 66.3 90.3 71.1 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 LAG3+ 65.8 68.2 40.9 46 44.1 39.1 52.1 51 48.5 17.7 CD8 LAG3+ 95.4 97.8 92.4 92.5 97.5 98.4 98.2 98.3 97.7 78.1
(946) TABLE-US-00060 TABLE 53 FIG. 57: CD4+TIM-3+ cells and FIG. 31 CD8+TIM-3+ cells M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 TIM3+ 89.7 nd nd nd 98.3 87.6 nd 43.2 CD8 TIM3+ 99 nd nd nd 99.4 88.1 nd 47 M1061 M1062 M1063 M1064 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 TIM3+ 95.3 98 94.5 96.9 90.8 90.2 94.2 82.6 CD8 TIM3+ 98.9 98.9 97.3 96.7 97.1 97.7 98.2 95.7 M1065 EP11001 M1056 M1058 M1203 T cell Markers Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed CD4 TIM3+ 95 78.8 96.9 91.5 96.4 92.5 88.7 80.1 89.9 82.3 CD8 TIM3+ 96.9 50.6 98.8 83 98.3 92.9 96.5 73.6 98.2 88.5 M1065 EP11001 M1056 M1058 M1203 Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed Fresh Thawed T cell Markers Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP Re-REP CD4 TIM3+ 91.1 95.4 94.3 98.7 74 75.4 86.5 87.3 94.4 90.6 CD8 TIM3+ 94.9 96.5 96.3 98.3 98 99 97.3 98.6 99 97.7
(947) TABLE-US-00061 TABLE 54 FIG. 61: qPCR and Flow-FISH determination of telomere length repeat Tumor ID M1061 M1062 M1063 M1064 M1065 EP11001 M1056 M1058 M1023 qPCR 0.111878 0.135842 0.149685 0.179244 0.151774 0.137738 0.134904 0.124137 0.086569 Flow-FISH 9.330236 1215041 8.782231 7.174627 8.961553 6112918 9.010615 7.944534 5.766692
Example 20: Novel Cryopreserved Tumor Infiltrating Lymphocytes (LN-144) Administered to Patients with Metastatic Melanoma
(948) Novel cryopreserved tumor infiltrating lymphocytes (LN-144) administered to patients with metastatic melanoma demonstrates efficacy and tolerability in a multicenter Phase 2 clinical trial
(949) Introduction
(950) The safety and efficacy of adoptive cell therapy (ACT) with non-cryopreserved tumor infiltrating lymphocytes (TIL) has been studied in hundreds of patients with metastatic melanoma. This multicenter clinical trial was initiated with centrally manufactured TILs (LN-144) as non-cryopreserved and cryopreserved infusion products. Our novel manufacturing process for the non-cryopreserved LN-144 is used in Cohort 1, and a shortened 3 weeks, cryopreserved LN-144 is used in Cohort 2. The Cohort 2 manufacturing offers a significantly shorter process, coupled with a cryopreserved TIL product which allows for flexibility of patient scheduling and dosing. The shorter manufacturing process reduces the wait time for the patient to receive their TIL product and cryopreservation adds convenience to logistics and delivery to the clinical sites.
(951) Methods:
(952) C-144-01 is a prospective, multicenter study evaluating metastatic melanoma patients who receive LN-144. Following a non-myeloablative lymphodepletion with Cy/Flu preconditioning regimen, patients receive a single infusion of LN-144 followed by the administration of IL-2 (600,000 IU/kg) up to 6 doses. Patients are evaluated for objective response as a primary endpoint for up to 24 months.
(953) Results:
(954) We characterize the cryopreserved LN-144 administered to a second cohort of patients, Cohort 2 (N=10) following the same pre- and post-TIL infusion treatment regimen as used for Cohort 1.
(955) Cohort 2 patients were heavily pretreated with increased number of prior lines with all patients having anti-CTLA-4 and anti-PD-1 therapies, and larger tumor burden (mean SOD: 15.3, 10.9 cm for Cohorts 2, 1). Median number of prior systemic therapies is 4, 3 for Cohorts 2, 1, respectively. An initial analysis of safety data demonstrates comparable tolerability of cryopreserved LN-144. The safety profile for Cohort 1 patients receiving the non-cryopreserved LN-144 continues to be acceptable for this late stage patient population. The most common TEAEs observed in both cohorts by frequency are nausea, anaemia, febrile neutropenia, neutrophil count decreased, platelet count decreased. Early review of efficacy data indicates anti-tumor activity, including PR, to the TIL therapy observed in patients treated in Cohort 2.
Conclusions
(956) This represents the first clinical trial in a multicenter setting with centrally manufactured TIL assessing a novel process for cryopreserved autologous product with a significantly shorter process (approximately 3 weeks). Preliminary results indicate the cryopreserved LN-144 as a safe and tolerable therapeutic option for patients with metastatic melanoma who've failed multiple prior therapies, including checkpoint inhibitors. The cryopreserved LN-144 provides greater flexibility for patients and caregivers and allows for more immediate treatment for patients with such high unmet medical need. NCT02360579.
Example 21: Evaluation of Serum-Free Media for Use in the 2A Process
(957) This example provides data showing the evaluation of the efficacy of serum-free media as a replacement for the standard CM1, CM2, and CM4 media that is currently used in the 2A process. This study tested efficacy of available serum-free media (SFM) and serum free alternatives as a replacement in three phases;
(958) Phase ?1: Compared the efficacy of TIL expansion (n=3) using standard vs CTS Optimizer or Prime T CDM or Xvivo-20 serum free media with or without serum replacement or platelet lysate.
(959) Phase-2: Tested the candidate serum free media condition in mini-scale 2A process using G-Rex 5M (n=3).
(960) Background Information
(961) Though the current media combination used in Pre and Post REP culture has proven to be effective, REP failures may be occurred with the AIM-V. If an effective serum-free alternative were identified, it would be make the process more straight-forward and simple to be performed in CMOs by reducing the number of media types used from 3 to 1. Additionally, SFM reduces the chance of adventitious disease by eliminating the use of human serum. This example provides data that showed supports the use of serum free media in the 2A processes.
Abbreviations
(962) ?l microliter CM1,2,4 Complete Media 1,2,4 CTS OpTimizer SFM Cell Therapy System OpTimizer Serum Free Media g Grams Hr Hour IFU Instructions for Use IL-2 Interleukin-2 Cytokine Min Minute mL Milliliter ? C. degrees Celsius PreREP Pre-Rapid Expansion Protocol REP Rapid Expansion Protocol RT Room Temperature SR Serum Replacement TIL Tumor Infiltrating Lymphocytes
Experiment Design
(963) The Pre-REPs and REPs were initiated as mentioned in LAB-008. The overview of this 3 phases of experiment is shown
(964) As provide in
(965) Step 1. Selection of serum-free media purveyor. preREP and postREP were set up to mimic 2A process in G-Rex 24 well plate. PreREP were initiated by culturing each fragment/well of G-Rex 24 well plate in triplicates or quatraplicates per conditions. REP were initiated on Day 11 by culturing 4?10e5 TIL/well of G-Rex 24 well, split on Day 16, harvest on Day 22. CTS OpTimizer, X-Vivo 20, and Prime T-CDM were used as potential serum-free media alternatives for use in the PreREP and REP. CTS Immune SR Serum replacement (Life Technologies) or Platelet lysate serum (SDBB) were added at 3% to SFM. Each conditions were planned to test with at least 3 tumors in both preREP and postREP to mimic 2A process.
(966) Step 2. Identified candidates were further tested on mini-scale 2A processes per protocol (TP-17-007). Briefly, preREP were initiated by culturing 2 fragments/G-Rex 5M flask in triplicates per condition. REP were initiated on Day 11 using 2?10e6/G-Rex 5M flask, split on Day 16, harvest on Day 22.
(967) Note: Some tumors were processed and setup to measure multiple parameters in one experiment
(968) Observations
(969) Observed equivalent or statistically better results in cell growth when comparing a serum-free media to the standard used in the 2A process
(970) Observed similar phenotype, IFN-? production, and metabolite analysis from the TIL grown in serum-free media when compared to the TIL grown in the standard media used in the 2A process.
(971) Results
(972) Testing the Efficacy of Serum Free Media on Pre and Post REP TIL Expansion.
(973) CTS Optimizer+SR (Serum Replacement) showed enhanced preREP TIL expansion and comparable REP TIL expansion. CTS OpTimizer, X-Vivo 20, and Prime T-CDM were added with or without 3% CTS Immune CTS SR, were tested against standard condition. In M1079 and L4026, CTS OpTimizer+CSR condition showed significantly enhanced preREP TIL expansion (p<0.05) when compared with standard conditions (CM1, CM2, CM4) (
(974) Testing candidate condition in the G-Rex 5M mini scale (see
(975) Phenotypic analysis of Post REP TIL. See
(976) TABLE-US-00062 TABLE 56 CD8 skewing with CTS OpTimizer Average % CD8+ Standard CTS M1078 11 34 M1079 29.3 43.85 M1080 33.67 54.37 L4020 0.02 0.17 EPl1020 28.67 25.07 L4030 0.13 0.09 L4026 9.45 34.06 Ml 092 5.75 52.47 T6030 66 52.6
(977) Interferon-Gamma Comparability
(978) Interferon-gamma ELISA (Quantikine). Production of IFN-? was measured using Quantikine ELISA kit by R&D systems. CTS+SR produced comparable amounts of IFN-? when compared to our standard condition. See,
Example 22: T-Cell Growth Factor Cocktail IL-2/IL-15/IL-21 Enhances Expansion and Effector Function of Tumor-Infiltrating T Cells
(979) Adoptive T cell therapy with autologous tumor infiltrating lymphocytes (TIL) has demonstrated clinical efficacy in patients with metastatic melanoma and cervical carcinoma. In some studies, better clinical outcomes have positively correlated with the total number of cells infused and/or percentage of CD8+ T cells. Most current production regimens solely utilize IL-2 to promote TIL growth. Enhanced lymphocyte expansion has been reported using IL-15 and IL-21-containing regimens. This study describes the positive effects of adding IL-15 and IL-21 to the second generation IL-2-TIL protocol recently implemented in the clinic.
(980) Materials and Methods
(981) The process of generating TIL includes a pre-Rapid Expansion Protocol (pre-REP), in which tumor fragments of 1-3 mm.sup.3 size are placed in media containing IL-2. During the pre-REP, TIL emigrate out of the tumor fragments and expand in response to IL-2 stimulation.
(982) To further stimulate TIL growth, TIL are expanded through a secondary culture period termed the Rapid Expansion Protocol (REP) that includes irradiated PBMC feeders, IL-2 and anti-CD3. In this study, a shortened pre-REP and REP expansion protocol was developed to expand TIL while maintaining the phenotypic and functional attributes of the final TIL product.
(983) This shortened TIL production protocol was used to assess the impact of IL-2 alone versus a combination of IL2/IL-15/IL-21. These two culture regimens were compared for the production of TIL grown from colorectal, melanoma, cervical, triple negative breast, lung and renal tumors. At the completion of the pre-REP, cultured TIL were assessed for expansion, phenotype, function (CD107a+ and IFN?) and TCR VO repertoire.
(984) pre-REP cultures were initiated using the standard IL-2 (600 IU/ml) protocol, or with IL-15 (180 IU/ml) and IL-21 (IU/ml) in addition to IL-2. Cells were assessed for expansion at the completion of the pre-REP. A culture was classified as having an increase expansion over the IL-2 if the overall growth was enhanced by at least 20%. The melanoma and lung phenotypic and functional studies are presented herein. See, Table 57 below.
(985) TABLE-US-00063 TABLE 57 Enhancement in expansion during the pre-REP with IL-2/IL-15/IL-21 in multiple indications # of studies demonstrating >20% enhancement of # of IL-2 versus growth using IL- IL-2/IL-15/IL-21 2/IL-15/IL-21 Tumor Histology studies (compared to IL-2) Melanoma 5 1/5 (20%) Lung 8 3/8 (38%) Colorectal 11 7/11 (63%) Cervical 1 1/1 (100%) Pancreatic 2 2/2 (100%) Glioblastoma 1 1/1 (100%) Triple Negative Breast 1 1/2 (50%)
(986) These data demonstrate an increased TIL product yield when TIL were cultured with IL-2/IL15/IL-21 as compared to IL-2 alone, in addition to phenotypic and functional differences in lung.
(987) The effect of the triple cocktail on TIL expansion was indication-specific and benefited most the low yield tumors.
(988) The CD8+/CD4+ T cell ratio was increased by the treatment in NSCLC TIL product.
(989) T cell activity appeared enhanced by the addition of IL-15 and IL-21 to IL-2, as assessed by CD107a expression levels in both melanoma and NSCLC.
(990) The data provided here shows that TIL expansion using a shorter, more robust process, such as the 2A process described herein in the application and other examples, can be adapted to encompassing the IL-2/IL-15/IL-21 cytokine cocktail, thereby providing a means to further promote TIL expansion in particularly in specific indications.
(991) Ongoing experiments are further evaluating the effects of IL-2/IL-15/IL-21 on TIL function.
(992) Additional experiments will evaluate the effect of the triple cocktail during the REP (first expansion).
(993) These observations are especially relevant to the optimization and standardization of TIL culture regimens necessary for large-scare manufacture of TIL with the broad applicability and availability required of a main-stream anti-cancer therapy.
Example 23: A Cryopreserved TIL Generated with an Abbreviated Method
(994) Background
(995) This example provides data related to a cryopreserved tumor infiltrating lymphocyte (TIL) product for LN-144, generated with an abbreviated method suitable for high throughput commercial manufacturing exhibits favorable quality attributes for adoptive cell transfer (ACT).
(996) Existing methods for generating clinical TIL products involve open operator interventions followed by extended incubation periods to generate a therapeutic product. The Generation 1 process takes approximately 6 weeks and yields a fresh product. To bring TIL therapy to all patients that may benefit from its potential, an abbreviated 22 day culture method, Generation 2, suitable for centralized manufacturing with a cryopreserved drug product capable of shipment to distant clinical sites was developed. Generation 2 represents a flexible, robust, closed, and semi-automated cell production process that is amenable to high throughput manufacturing on a commercial scale. Drug products generated by this method have comparable quality attributes to those generated by the Generation 1 process.
(997) Study Objectives:
(998) Drug products generated by Generation 1 (a process 1C embodiment) and Generation 2 (a process 2A embodiment) processes were assayed to determine comparability in terms of the following quality attributes:
(999) Dose and fold expansion.
(1000) T-cell purity and proportions of T-cell subsets.
(1001) Phenotypic expression of co-stimulatory molecules on T-cell subsets.
(1002) Average relative length of telomere repeats.
(1003) Ability to secrete cytokine in response to TCR reactivation.
(1004) T-cell receptor diversity.
(1005) Overview of TIL Therapy Process:
(1006) EXTRACTION: Patient's TIL are removed from suppressive tumor microenvironment (via surgical resection of a lesion)
(1007) EXPANSION: TIL expanded exponentially in culture with IL-2 to yield 10.sup.9-10.sup.11 TIL, before infusing them into the patient
(1008) PREPARATION: Patient receives NMA-LD (non-myeloablative lymphodepletion, cyclophosphamide: 60 mg/kg, IV?2 doses and fludarabine: 25 mg/m.sup.2?5 doses) to eliminate potentially suppressive tumor microenvironment and maximize engraftment and potency of TIL therapy
(1009) INFUSION: Patient is infused with their expanded TIL (LN-144) and a short duration of high-dose of IL-2 (600,000 lU/kg for up to 6 doses) to promote activation, proliferation, and anti-tumor cytolytic activity of TIL
(1010) TABLE-US-00064 TABLE 58 Summary of Process Improvements in Generation 2 Manufacturing Process Step Gen 1 Gen 2 Impact Fragment ?21 days, multiple ?11 days, single closed Shortens culture, Culture bioreactors, multiple bioreactor, no intervention reduces operator interventions interventions, amenable to automation. TIL selection IL-2 expanded TIL ?200 ?10.sup.6 Bulk TIL direct Shorten process by cryopreserved, tested, to co-culture allowing increased selection based on seeding of co- phenotype, thaw, ?30 ? 106 culture, reduces TIL to co-culture steps, eliminates testing Rapid ?36 Bioreactors, 14 days ?5 Bioreactors, 11 days Reduces operator Expansion interventions, closed system, shortens process, amenable to automation. Harvest/Wash Manual open volume Closed semi-automated Reduces operator reduction and harvest. volume reduction and interventions, Manual wash and harvest. Automated wash automated, concentration by and concentration. maintains closed centrifugation. system. Formulation Fresh hypothermic product Cryopreserved product Shipping flexibility, (2-8? C.) (??150? C.) patient scheduling, easier release testing, global trials Manufacturing 38 day process time 22 day process time Turnaround to Time patient, clean room throughput, COGs
Analytical Methods and Instrumentation:
(1011) Dose and Viability: Final formulated products were sampled and assayed for total nucleated cells, total viable cells, and viability determined by acridine orange/DAPI counterstain using the NC-200 automated cell counter.
(1012) Flow cytometry: Formulated drug products were sampled and assayed for identity by FACS. Percent T-cells was determined as the CD45, CD3 double positive population of viable cells. Frozen satellite or sentinel vials for each process were thawed and assayed for extended phenotypic markers including CD3, CD4, CD8, CD27, and CD28.
(1013) Average relative length of telomere repeats: Flow-FISH technology was used to measure average length of telomere repeat. This assay was completed as described in the DAKO? Telomere PNA Kit/FITC for Flow Cytometry protocol. Briefly, 2?10.sup.6 TIL cells were combined with 2?10.sup.6 1301 leukemia cells. The DNA was denatured at 82? C. for 10 minutes and the PNA-FITC probe was hybridized in the dark overnight at room temperature. Propidium Iodide was used to identify the cells in GO/1 phase.
(1014) Immunoassays: The ability of the drug product to secrete cytokine upon reactivation was measured following co-culture with mAb-coated beads (Life Technologies, anti-CD3, anti-CD28 & anti-CD137). After 24 hrs culture supernatants were harvested frozen, thawed, and assayed by ELISA using Quantikine IFN? ELISA kit (R&D systems) according to manufacturer's instructions.
(1015) T-cell receptor diversity: RNA from final formulated products was isolated and subjected to a multiplex PCR with VDJ specific primers. CDR3 sequences expressed within the TIL product were semi-quantitatively amplified to determine the frequency and prevalence of unique TIL clones. Sequencing was performed on the Illumina MiSeq benchtop sequencer. Values were indexed to yield a score representative of the relative diversity of T-cell receptors in the product.
(1016) Results and Conclusions:
(1017) Results are provided in
(1018) The Generation 2 process produces a TIL product with comparable quality attributes to Generation 1.
(1019) Generation 2 produces similar quantities of highly pure TIL products that are composed similar proportions of T-cell subsets expressing comparable levels of co-stimulatory molecules relative to Gen 1.
(1020) Generation 2 TIL display increased diversity of TCR receptors which, when engaged, initiate robust secretion of cytokine.
(1021) The cryopreserved drug product introduces critical logistical efficiencies allowing flexibility in distribution.
(1022) Unlike prior processes, the Generation 2 abbreviated 22-day expansion platform presents a scalable and logistically feasible TIL manufacturing platform that allows for the rapid generation of clinical scale doses for patients in urgent need of therapy.
(1023) The Generation 2 TIL manufacturing protocol addresses many of the barriers that have thus far hindered the wider application of TIL therapy.
Example 24: Evaluating a Range of Allogeneic Feeder Cell:TIL Ratios from 100:1 to 25:1
(1024) This study tested the proliferation of TIL at 25:1 and 50:1 against the control of 100:1 allogeneic feeder cells to TIL currently utilized in Process 1C.
(1025) Studies published by the Surgery Branch at the National Cancer Institute have shown the threshold for optimal activation of TIL in the G-Rex 100 flask at 5?10.sup.6 allogeneic feeder cells per cm.sup.2 at the initiation of the REP.sup.(1). This has been verified through mathematical modeling, and, with the same model, predicted that with a feeder layer optimized for cell:cell contact per unit area the proportion of allogeneic feeder cells relative to TIL may be decreased to 25:1 with minimal effect on TIL activation and expansion.
(1026) This study established an optimal density of feeder cells per unit area at REP onset, and validated the effective range of allogeneic feeder ratios at REP initiation needed to decrease and normalize the amount of feeder cells used per clinical lot. The study also validated the initiation of the REP with less than 200?10.sup.6 TIL co-cultured with a fixed number of feeder cells.
(1027) A. Volume of a T-cell (10 ?m diameter): V=(4/3) ?.sup.3=523.6 ?m.sup.3
(1028) B. Columne of G-Rex 100 (M) with a 40 ?m (4 cells) height: V=(4/3) ?r.sup.3=4?10.sup.12 m.sup.3
(1029) C. Number cell required to fill column B: 4?10.sup.12 ?m.sup.3/523.6 ?m.sup.3=7.6?10.sup.8 ?m.sup.3*0.64=4.86?10.sup.8
(1030) D. Number cells that can be optimally activated in 4D space: 4.86?10.sup.8/24-20.25?10.sup.6
(1031) E. Number of feeders and TIL extrapolated to G-Rex 500: TIL: 100?10.sup.6 and Feeder: 2.5?10.sup.9
(1032) Equation 1. Approximation of the number of mononuclear cells required to provide an icosahedral geometry for activation of TIL in a cylinder with a 100 cm.sup.2 base. The calculation derives the experimental result of 5?10.sup.8 for threshold activation of T-cells which closely mirrors NCI experimental data..sup.(1) (C) The multiplier (0.64) is the random packing density for equivalent spheres as calculated by Jaeger and Nagel in 1992.sup.(2). (D) The divisor 24 is the number of equivalent spheres that could contact a similar object in 4 dimensional space the Newton number..sup.(3).
REFERENCES
(1033) .sup.(1) Jin, Jianjian, et. al., Simplified Method of the Growth of Human Tumor Infiltrating Lymphocytes (TIL) in Gas-Permeable Flasks to Numbers Needed for Patient Treatment. J Immunother. 2012 April; 35(3): 283-292. .sup.(2) Jaeger HM, Nagel SR. Physics of the granular state. Science. 1992 Mar. 20; 255(5051):1523-31. .sup.(3) O. R. Musin (2003). The problem of the twenty-five spheres. Russ. Math. Surv. 58 (4): 794-795.
Example 25: Studies of Key Quality Attributes for TIL Product
(1034) Background
(1035) Adoptive T-cell therapy with autologous tumor infiltrating lymphocytes (TIL) has demonstrated clinical efficacy in patients with metastatic melanoma and other tumors.sup.1-3.
(1036) Most reports from clinical studies have included exploratory analyses of the infused TIL products with the intention of identifying quality attributes such as sterility, identity, purity, and potency that could relate to product efficacy and/or safety..sup.4,5
(1037) Here we present the evaluation of three key product parameters from the TIL product that may contribute to a future quality control platform for use in the commercial manufacture of TIL.
(1038) Overview of TIL Therapy Process
(1039) 1. The tumor was excised from the patient and transported to the GMP Manufacturing facility.
(1040) 2. Upon arrival the tumor is fragmented and placed in flasks with IL-2 for a pre-Rapid Expansion Protocol (REP).
(1041) 3. pre-REP TIL were further propagated in a REP protocol in the presence of irradiated PBMCs, anti-CD3 antibody (30 ng/mL), and IL-2 (3000 IU/mL).
(1042) 4. TIL products were assessed for critical quality attributes including: (1) Identity (2) Purity, and (3) Potency.
(1043) 5. Prior to infusion of expanded TIL (LN-144), patient received a non-myeloablative lymphodepletion regimen consisting of cyclophosphamide and fludarabine. Following infusion of TIL, patients received a short duration (up to 6 doses) of high-dose IL-2 (600,000 IU/kg) to support growth and engraftment of transferred TIL.
(1044) Study Objectives
(1045) Goal: To fully characterize TIL products for identity, purity, and potency, and thereby (a) guide the definition of critical quality attributes and (b) support the establishment of formal release criteria to be implemented in commercial production of TIL products.
(1046) Strategy: To develop the following analytical methodologies to support TIL product characterization. In particular, the following methods were performed: phenotypic analysis by flow cytometry for an identity and purity assessment, residual tumor cell detection assay for a measure of purity, and interferon-gamma release assay for assessment of potency.
(1047) Materials & Methods
(1048) Identity and Purity
(1049) Phenotypic characterization: TIL products were stained with anti-CD45, anti-CD3, anti-CD8, anti-CD4, anti-CD45RA, anti CCR7, anti CD62L, anti-CD19, anti-CD16, and anti-CD56 antibodies and analyzed by flow cytometry for the quantification of T and non-T cell subsets.
(1050) Purity
(1051) Residual tumor detection assay: TIL products were stained with anti-MCSP (melanoma-associated chondroitin sulfate proteoglycan) and anti-CD45 antibodies, as well as a Live/Dead fixable Aqua dye, then analyzed by flow cytometry for the detection of melanoma cells. Spiked controls were used to assess accuracy of tumor detection and to establish gating criteria for data analysis.
(1052) Potency
(1053) IFN? release assay: TIL products were re-stimulated with anti-CD3/CD28/CD137 coated beads for 18 to 24 hours after which supernatants were harvested for assessment of IFN? secretion using an ELISA assay.
(1054) Results
(1055) Identity: The majority (>99%) of melanoma TIL product was composed of CD45.sup.+CD3.sup.+ cells
(1056)
(1057) Identity: The majority of melanoma TIL product exhibited effector or memory T-cell phenotype, associated with T-cell cytotoxic function.
(1058)
(1059) Purity: MCSP represents an appropriate melanoma tumor marker for purity assay.
(1060)
(1061) Purity: Development of a flow cytometry-based assay for detection of residual tumor cells in TIL products.
(1062)
(1063) Purity: Qualification of residual tumor detection assay using spiked controls
(1064)
(1065) Purity: Melanoma tumor cell contaminants were below the limits of assay detection in final TIL product.
(1066)
(1067) Potency: IFN? secretion by TIL (consistently >1000 pg/ml) demonstrated effector function of TIL product.
(1068)
Conclusion
(1069) Key product parameters of identity, purity, and potency of TIL products were evaluated. TIL products manufactured according to the methods described herein consisted of greater than 99% CD45+CD3+ T cells. The majority of CD4+ and CD8+ TIL subsets exhibited an effector-memory phenotype, associated with T-cell cytotoxic function. A flow cytometry-based assay to detect contaminant melanoma tumor cells in final TIL product was successfully developed and qualified. Applying this assay, contaminant melanoma tumor cells in final TIL product were shown to be below the limits of assay detection. IFN? secretion by final TIL product following anti-CD3/CD28/CD137 re-stimulation may serve as a potency assay for commercially manufactured TIL. These data provide the foundation of a quality control platform that will support further development of critical quality attributes for commercial production of TIL products.
Example 26: A Cryopreserved TIL Product Generated with an Abbreviated Method Suitable for High Throughput Commercial Manufacturing Exhibits Favorable Quality Attributes for Adoptive Cell Transfer
(1070) Background
(1071) Classical methods of generating tumor infiltrating lymphocytes (TIL) for adoptive cell transfer (ACT) involve multiple ex vivo incubation steps to yield a fresh (non-cryopreserved) infusion product.
(1072) The first generation (Gen 1) process produced a dose of fresh TIL in approximately 6 weeks. A second generation (Gen 2) TIL manufacturing process which abbreviates the ex vivo culture duration to 22 days was developed (
(1073) The Gen 2 process is suitable for centralized manufacturing and yields a cryopreserved TIL infusion product that brings convenience in scheduling, logistics, and delivery to the clinical sites. The cryopreserved TIL infusion product for LN-144 produced by the Gen 2 process has comparable quality attributes to the non-cryopreserved TIL infusion product for TILs generated by the Gen 1 method. The Gen 2 TIL manufacturing method represents a flexible, robust, closed, and semi-automated cell production process that is amenable to high throughput TIL manufacturing on a commercial scale.
(1074) Study Objective
(1075) TIL infusion products generated by Gen 1 and Gen 2 manufacturing processes were assessed to determine comparability in terms of the following quality attributes: (1) Cell count (dose), viability, growth rate of REP phase, (2) T-cell purity and phenotypic expression of co-stimulatory molecules on T-cell subsets, (3) Average relative length of telomere repeats, (4) Ability to secrete IFN? in response to CD3, CD28, CD137 engagement, and (5) Diversity of T-cell receptors present in the final infusion product (
(1076) Analytical Methods & Instrumentation
(1077) Cell Count and Viability: Final formulated infusion products were sampled and assayed for total nucleated cells, total viable cells, and viability determined by acridine orange/DAPI counterstain using the NC-200 automated cell counter. Process Development lots were assayed on the Nexcellom Cellometer K2 Cell Viability Counter using acridine orange/propidium iodine dual florescent staining.
(1078) Phenotypic markers: Formulated infusion products were sampled and assayed for identity by immunofluorescent staining. Percent T-cells was determined as the CD45+, CD3+(double positive) population of viable cells. Frozen satellite or sentinel vials for each process were thawed and assayed for extended phenotypic markers including CD3, CD4, CD8, CD27, and CD28. Fresh infusion products were acquired on the BD FACS Canto II, and extended phenotypic markers on thawed infusion products were acquired on the Bio-Rad ZE5 Cell Analyzer.
(1079) Average relative length of telomere repeats: Flow-FISH technology was used to measure average length of telomere repeat. This assay was completed as described in the DAKO? Telomere PNA Kit/FITC for Flow Cytometry protocol. Briefly, 2.0?10.sup.6 TIL cells were combined with 2.0?10.sup.6 human cell line (1301) leukemia T-cells. The DNA was denatured at 82? C. for 10 minutes and the PNA-FITC probe was hybridized in the dark overnight at room temperature. Propidium Iodide was used to identify the cells in GO/1 phase.
(1080) Immune function: The ability of the infusion product to secrete IFN? upon reactivation was measured following co-culture with antibody coated beads (Life Technologies, anti-CD3, anti-CD28 & anti-CD137). After 24 hours culture supernatants were harvested, frozen, thawed, and assayed by ELISA using the Quantikine IFN? ELISA kit (R&D systems) according to manufacturer's instructions.
(1081) T-cell receptor diversity: RNA from infusion products was isolated and subjected to a multiplex PCR with VDJ specific primers. CDR3 sequences expressed within the TIL product were semi-quantitatively amplified and deep sequenced to determine the frequency and prevalence of unique TIL clones. Sequencing was performed on the Illumina MiSeq benchtop sequencer. Values were indexed to yield a score representative of the relative diversity of T-cell receptors in the product.
(1082) Results
(1083) On Day 22 the volume reduced cell product was pooled and sampled to determine culture performance prior to wash and formulation.
(1084)
(1085)
(1086)
(1087)
Conclusions
(1088) The Gen 2 manufacturing process produced a TIL infusion product (LN-144) with comparable quality attributes to Gen 1. Gen 2 produced similar doses of highly pure TIL. T-cell subsets were in similar proportions and expressed costimulatory molecules at comparable levels of relative to Gen 1. Gen 2 TIL trended toward longer relative telomere length commensurate with reduced ex vivo culture period. Gen 2 TIL displayed an increased diversity of TCR receptors which, when engaged, initiated robust secretion of IFN-?, a measure of cytolytic effector function. Thus, the Gen 2 abbreviated 22-day closed expansion process with cryopreserved infusion product presents a scalable and logistically feasible TIL manufacturing platform that allows for the rapid generation of clinical scale doses for cancer patients in immediate need of a novel therapy option.
REFERENCES
(1089) .sup.1 Dudley, M. E. et al. Adoptive cell transfer therapy following non-myeloablative but lymphodepleting chemotherapy for the treatment of patients with refractory metastatic melanoma. J. Clin Oncol 23, 2346-2357, doi:10.1200/JCO.2005.00.240 (2005). .sup.2 Chandran, S. S. et al. Treatment of metastatic uveal melanoma with adoptive transfer of tumour-infiltrating lymphocytes: a single-centre, two-stage, single-arm, phase 2 study. Lancet Oncol, doi:10.1016/SI470-2045(17)30251-6 (2017). .sup.3 Stevanovic, S. et al. Complete regression of metastatic cervical cancer after treatment with human papillomavirus-targeted tumor-infiltrating T cells. J Clin Oncol 33, doi:10.1200/jco.2014.58.9093 (2015). .sup.4 FDA Reviewers and Sponsors: Content and Review of Chemistry, Manufacturing, and Control (CMC) Information for Human Gene Therapy Investigational New Drug Applications (INDs), 21 CFR 610.3(r), 2008. .sup.5 Richards J O, Treisman J, Garlie N, Hanson J P, Oaks M K. Flow cytometry assessment of residual melanoma cells in tumor-infiltrating lymphocyte cultures. Cytometry A 2012; 81:374-81.
Example 27: The T-Cell Growth Factor Cocktail IL-2/IL-15/IL-21 Enhanced Expansion and Effector Function of Tumor-Infiltrating T Cells in a Novel Process Described Herein
(1090) Background
(1091) Adoptive T cell therapy with autologous TILs has demonstrated clinical efficacy in patients with metastatic melanoma and cervical carcinoma. In some studies, better clinical outcomes have positively correlated with the total number of cells infused and/or percentage of CD8+ T cells. Most current production regimens solely utilize IL-2 to promote TIL growth. Enhanced lymphocyte expansion has been reported using IL-15 and IL-21-containing regimens. This study describes the positive effects and synergies of adding IL-15 and IL-21 to embodiments of process 2A and Generation 2 TIL manufacturing processes.
(1092) Generation of TIL Using a Novel Process Described Herein
(1093) The tumor is excised from the patient and transported to the GMP manufacturing facility or a laboratory for research purposes. Upon arrival the tumor was fragmented, and placed into flasks with IL-2 for pre-Rapid Expansion Protocol (pre-REP) for 11 days. For the triple cocktail studies, IL-2, IL-15, and IL-21 (IL-2/IL-15/IL-21) was added at the initiation of the pre-REP. For the Rapid Expansion Protocol (REP), TIL were cultured with feeders and anti-CD3 antibody for an additional 11 days (
(1094) Materials and Methods
(1095) The process of generating TIL included a pre-Rapid Expansion Protocol (pre-REP), in which tumor fragments of 1-3 mm3 size were placed in media containing IL-2. During the pre-REP, TIL emigrated out of the tumor fragments and expand in response to IL-2 stimulation.
(1096) To further stimulate TIL growth, TIL were expanded through a secondary culture period termed the Rapid Expansion Protocol (REP) that included irradiated PBMC feeders, IL-2 and anti-CD3 antibody. A shortened pre-REP and REP expansion protocol was developed to expand TIL while maintaining the phenotypic and functional attributes of the final TIL product. This shortened TIL-generation protocol was used to assess the impact of IL-2 alone versus a combination of IL2/IL-15/IL-21 added to the pre-REP step. These two culture regimens were compared for the generation of TIL grown from colorectal, melanoma, cervical, triple negative breast, lung and renal tumors. At the completion of the pre-REP, cultured TIL were assessed for expansion, phenotype, function (CD107a+ and IFN?) and TCR V? repertoire.
(1097) The study shows enhancement in expansion during the pre-REP with IL-2/IL-15/IL-21 in multiple tumor histologies. Pre-REP cultures were initiated using the standard IL-2 (6000 IU/mL) protocol, or with IL-15 (180 IU/mL) and IL-21 (1 IU/mL) in addition to IL-2 (
(1098) IL-2/IL-15/IL-21 enhanced the percentage of CD8+ cells in lung carcinoma, but not in melanoma. In
(1099) Expression of CD27 was slightly enhanced in CD8+ cells in cultures treated with IL-2/IL-15/IL-21. In
(1100) T cell subsets were unaltered with the addition of IL-15/IL-21. In
(1101) The functional capacity of TIL was differentially enhanced with IL-2/IL-15/IL-21. In
(1102) The relative frequency of the TCR?? repertoire was altered in response to IL-2/IL-15/IL-21 in lung, but not in melanoma. In
(1103) Summary
(1104) This work demonstrates the ability of the IL-2/IL-15/IL-21 cocktail to enhance TIL numbers compared to IL-2 alone (>20%) in the Generation 2 process, in addition to impacting phenotypic and functional characteristics.
(1105) The effect of the triple cocktail on TIL expansion was histology dependent. The CD8+/CD4+ T cell ratio was increased with the addition of IL-2/IL-15/IL-21 in lung tumors. Addition of IL-15 and IL-21 enhanced CD107a expression and IFN? production in TIL derived from lung tumors. The addition of IL-2/IL-15/IL-21 altered the TCR?? repertoire in the lung. The Generation 2 TIL expansion process was used to encompass the IL-2/IL-15/IL-21 cytokine cocktail, thereby providing a means to further promote TIL expansion in specific tumor histologies, such as lung and colorectal tumors. These observations are especially relevant to the optimization and standardization of TIL culture regimens necessary for large-scare manufacture of TIL with the broad applicability and availability required of a main-stream anti-cancer therapy.
Example 28: Novel Cryopreserved Tumor Infiltrating Lymphocytes (LN-144) Administered to Patients with Metastatic Melanoma Demonstrated Efficacy and Tolerability in a Multicenter Phase 2 Clinical Trial
(1106) Background
(1107) The safety and efficacy of adoptive cell therapy (ACT) utilizing tumor infiltrating lymphocytes (TIL) has been studied in hundreds of patients with metastatic melanoma, and has demonstrated meaningful and durable objective response rates (ORR)..sup.1 In an ongoing Phase 2 trial, C-144-01 utilizing centralized GMP manufacturing of TIL, both non-cryopreserved Generation 1 (Gen 1) and cryopreserved Generation 2 (Gen 2) TIL manufacturing processes were assessed.
(1108) Gen 1 is approximately 5-6 weeks in duration of manufacturing (administered in Cohort 1 of C-144-01 study), while Gen 2 is 22 days in duration of manufacturing (process 2A, administered in Cohort 2 of C-144-01 study). Preliminary data from Cohort 1 patients infused with the Gen 1 LN-144 manufactured product, was encouraging in treating post-PD-1 metastatic melanoma patients as the TIL therapy produced responses..sup.2 Benefits of Gen 2 included: (A) reduction in the time patients and physicians wait to infuse TIL to patient; (B) cryopreservation permits flexibility in scheduling, distribution, and delivery; and (C) reduction of manufacturing costs. Preliminary data from Cohort 2 is presented herein.
(1109) Study Design: C-144-01 Phase 2 Trial in Metastatic Melanoma
(1110) Phase 2, Multicenter, 3-Cohort Study to Assess the Efficacy and Safety of Autologous Tumor Infiltrating Lymphocytes (LN-144) for Treatment of Patients with Metastatic Melanoma.
(1111) Key Inclusion Criteria: (1) Measurable metastatic melanoma and >1 lesion resectable for TIL generation; (2) Progression on at least one prior line of systemic therapy; (3) Age?18; and (4) ECOG PS 0-1.
(1112) Treatment Cohorts: (1) Non-Cryopreserved LN-144 product; (2) Cryopreserved LN-144 product; and (3) Retreatment with LN-144 for patients without response or who progress after initial response.
(1113) Endpoints: (1) Primary: Efficacy defined as ORR and (2) Secondary: Safety and Efficacy.
(1114) Methods
(1115) Cohort 2 Safety Set: 13 patients who underwent resection for the purpose of TIL generation and received any component of the study treatment.
(1116) Cohort 2 Efficacy Set: 9 patients who received the NMA-LD preconditioning, LN-144 infusion and at least one dose of IL-2, and had at least one efficacy assessment. 4 patients did not have an efficacy assessment at the time of the data cut.
(1117) Biomarker data has been shown for all available data read by the date of the data cut.
(1118) Results
(1119)
(1120) For Cohort 2 (cryopreserved LN-144), the infusion product and TIL therapy characteristics were (1) mean number of TIL cells infused: 37?10.sup.9, and (2) median number of IL-2 doses administrations was 4.5.
(1121)
(1122) Of the 9 patients in the efficacy set, one patient (Patient 9) was not evaluable (NE) due to melanoma-related death prior to first tumor assessment not represented on
(1123)
(1124) Upon TIL treatment, an increase of HMGB1 was observed (
(1125) Plasma IP-10 levels were measured using Luminex assay. Data shown in
(1126) Updated data from Cohort 2 (n=17 patients) is reported in
Conclusions
(1127) Preliminary results from the existing data demonstrate comparable safety between Gen 1 and Gen 2 LN-144 TIL products. Administration of TILs manufactured with the Gen 2 process (process 2A, as described herein) leads to surprisingly increased clinical responses seen in advanced disease metastatic melanoma patients, all had progressed on anti-PD-1 and anti-CTLA-4 prior therapies. The DCR for cohort 2 was 78%.
(1128) Preliminary biomarker data is supportive of the cytolytic mechanism of action proposed for TIL therapy.
(1129) The embodiment of the Gen 2 manufacturing process described herein takes 22 days. This process significantly shortens the duration of time a patient has to wait to receive their TIL, offers flexibility in the timing of dosing the patients, and leads to a reduction of cost of manufacturing, while providing other advantages over prior approaches that allow for commercialization and registration with health regulatory agencies. Preliminary clinical data in metastatic melanoma using an embodiment of the Gen 2 manufacturing process also indicates a surprising improvement in clinical efficacy of the TILs, as measured by DCR, ORR, and other clinical responses, with a similar time to response and safety profile compared to TILs manufactured using the Gen 1 process. The unexpectedly improved efficacy of Gen 2 TIL product is also demonstrated by a more than five-fold increase in IFN-? production (
REFERENCES
(1130) .sup.1Goff, et al. Randomized, Prospective Evaluation Comparing Intensity of Lymphodepletion Before Adoptive Transfer of Tumor-Infiltrating Lymphocytes for Patients With Metastatic Melanoma. J. Clin Oncol. 2016 Jul. 10; 34(20):2389-97. .sup.2Sarnaik A, Kluger H, Chesney J, et al. Efficacy of single administration of tumor-infiltrating lymphocytes (TIL) in heavily pretreated patients with metastatic melanoma following checkpoint therapy. J Clin Oncol. 2017; 35 [suppl; abstr 3045].
Example 29: HNSCC and Cervical Carcinoma Phase 2 Studies
(1131) Enrollment for the HNSCC (head and neck squamous cell carcinoma; C-145-03) phase 2 study. 13 patients consented to the study, TILs were harvested from 10 patients and ultimately 7 patients were infused with 1 more in progress.
(1132) Enrollment in the cervical carcinoma phase 2 study (C-145-04). 8 patients consented to the study, TILs were harvested from 4 patients and ultimately 2 patients were infused and 2 more in process.
(1133) The initial data from the ongoing study is provided in
Example 30: Production of a Cryopreserved TIL Cell Therapy
(1134) This examples describes the the cGMP manufacture of ovance Biotherapeutics, Inc. TIL Cell Therapy Process in G-Rex Flasks according to current Good Tissue Practices and current Good Manufacturing Practices.
(1135) This material will be manufactured under US FDA Good Manufacturing Practices Regulations (21 CFR Part 210, 211, 1270, and 1271), and applicable ICH Q7 standards for Phase I through Commercial Material.
(1136) 4.0 Process Reference Expansion Plan
(1137) TABLE-US-00065 Estimated Day Esti (post-seed) Activity Target Criteria Anticipated Vessels Vo 0 Tumor Dissection ?50 desirable tumor fragments per G- G-Rex100MCS 1 flask Rex100MCS 11 REP Seed 5-200 ? 10.sup.6 viable cells per G- G-Rex500MCS 1 flasks Rex500MCS 16 REP Split 1 ? 10.sup.9 viable cells per G-Rex500MCS G-Rex500MCS <5 flasks 22 Harvest Total available cells 3-4 CS-750 bags
(1138) 4.2 Flask Volumes:
(1139) TABLE-US-00066 Working Volume/Flask Flask Type (mL) G-Rex100MCS 1000 G-Rex500MCS 5000
(1140) 4.3 Inspection Procedure 4.3.1 Manufacturing personnel will perform 100% inspection of the final product bags during the fill process. 4.3.2 Prepare a container labeled Failing Final Product Inspection. 4.3.3 Inspect for the following rejectable attributes: 4.3.3.1 Gross visible particulates (fibers, particles not the same color as the suspension, etc.) (NOTE: Cellular/Tissue Agglomerations are not to be considered particulate rejects). 4.3.3.2 Defects in the bag integrity, such as leaky seams/ports. 4.3.3.3 Incomplete overwrap bag seal. 4.3.3.4 Leaky seal. 4.3.3.5 Sign of clumps. 4.3.4 Inspect for the following acceptable appearance attributes: 4.3.4.1 Intact Bag 4.3.4.2 No signs of clumps 4.3.5 If no rejectable attributes are observed, return the final product bag to the lot. 4.3.6 If any rejectable attributes are observed, label the bag with a Rejected Product label, place bag in the Rejected storage container.
(1141) 4.4 Process Flow Diagram (see,
(1142) 5.0 Process Notes 5.1 Printouts containing final reported data results are to be attached to this Batch Record in the designated area. Each printout must be labeled with the Lot Number, Step Number (if applicable), and Initials and Date. If printouts are unavailable, readings must be recorded manually in place of printout and with reference to comment in comment section. A second associate must verify data. 5.2 Process steps may be performed concurrently when obtaining materials, during setup, post-process activities or as otherwise noted in step description. 5.3 Throughout this Batch Record, assume 1.0 mL/L=1.0 g/kg, unless otherwise specified. 5.4 If a critical material/consumable must be substituted in section 7.1, a comment will be made in section 10.0 and appropriate individuals contacted. 5.5 Round all data to the nearest tenth of a decimal point (xx.x) or within the tolerance of the equipment used (excludes printout data) unless otherwise noted throughout the batch record. 5.6 If equipment requires calibration for more than one parameter, and those calibration due dates are different, the earliest due date will be recorded. 5.7 All CO2 measurements recorded in this batch record will be read from a Vaisala CO2 analyzer at League Island 1. All CO2 measurements recorded in this batch record will be read from the LED Display at Commerce Center 3. 5.8 All incubators for League Island 1 will be humidified. All incubators for Commerce Center 3 will not be humidified. 5.9 Once opened, the following expiries apply at 2-8? C.: Human Serum, type AB (HI) Gemini, 1 month; 2-mercaptoethanol, 1 month. Gentamicin Sulfate, 50 mg/ml stock may be kept at room temperature for 1 month. Bags containing 10 L of AIM-V media may be warmed at room temperature once only for up to 24 hours prior to use. 5.10 The Receipt Number and Lot Number in Great Plains will be recorded in Section 7.1 Critical Materials/Consumables in the event that the WuXi AppTec Lot Number is not assigned to the material(s). The combination of the Receipt Number and Lot Number will replace the WuXi AppTec Lot number for new materials procured moving forward, as part of the implementation and validation of the Great Plains system. 5.11 When using the TSCD welder for connections, follow the instructions printed on the front of the machine. Ensure tubing is inserted properly as indicated on the machine. When loading tubing, ensure tubing is inserted so that a previous weld is not placed under the clamps of the welder (where possible). Also, ensure enough tubing remains for Steps following the welding. A hemostat should be placed on either side of the tubing before beginning welding process. After welding is complete, inspect the weld to ensure it is sealed and uniform around the tubing. Pinch or roll fingers along the connection to pop open the weld, then remove hemostats. 5.12 Prior to using the SEBRA? Hand-Held Tube Sealer each day, clean and inspect sealing head to ensure proper function. When using the SEBRA? Hand-Held Tube Sealer to separate tubing, create three seals in close proximity to each other. Ensure exterior of tubing is dry to prevent electrical arcing. Separate or detach the tubing by breaking the middle seal, unless instructed otherwise. Do not apply opposing forces on the tubing to prevent premature separation of the tubing during sealing events. Do not attempt to reseal a seal if first attempt is unsuccessful. If needed, perform test welds using the hand-held sealer and assess the hand-held sealer as necessary. 5.13 Thoroughly inspect all clamps and hemostats for flaws or damage that may result in a compromised ability to adequately stop flow or a potential to damage tubing. 5.14 If the Nucelocounter notification shows that counts 1 and/or 2 are above the optimal counting range (5?104-5?106 before accounting for dilution), N/A the rest of the cell count page. Prepare another cell solution sample, diluted with an appropriate dilution factor ([new dilution factor]=[previous dilution factor]?[reported cell count]?[5?105]) to get the VCD or Live Cells inside of the optimal range. If cell counts 1 and/or 2 are below the optimal range (too dilute), contacted area management, recorded live cell counts, and proceeded with calculations. Ensure to document cell counts out of optimal range in a footnote in either situation. 5.15 When recording tumor receipt information ensure that the Time of Tumor Removal from the patient is converted to Eastern Standard Time (EST) if not already, recorded as such on the Tumor Shipping Batch record. The elapsed time from Tumor Removal from Patient to Tumor Receipt in the lab should be calculated in EST. 5.16 During the Day 22 harvest two Gatherex? may be used to harvest the TIL from the G-Rex500MCS flasks. Both units may be used to remove supernatant and one of the two unit used to collect the TIL. 5.17 During all processing steps the minimum number of personnel allowed within the Grade B processing suite is two and the maximum number is ten (including environmental processing personnel). 5.18 When aliquotting media reagents at volumes ?1.0 mL, rinse the pipet after dispensing. 5.19 Flasks will be re-incubated during media warming and in any other instance when not being actively processed. Incubation steps will only be recorded at the beginning and end of each section, when applicable. On non-scheduled processing days, flasks may be observed for information only, as per area management or client, without sanitizing the room or monitoring the equipment. 5.20 After the completion of processing Day 0, Tumor Dissection, seeding and flask incubation, all remaining fragments and pieces of the tumor are to be discarded appropriately.
6.0 Equipment
(1143) Equipment List: Day 0 CM1 Media Preparation/Tumor Wash Preparation/Tumor Dissection: Magnehelic Gauge Biological Safety Cabinet (BSC) Incubator CO2 Analyzer Micropipetter (100-1000 ?L) Pipet-Aid Baxa Repeater Pump Sebra Tube Sealer 2-8? C. Refrigerator ?80? C. Freezer ?20? C. Freezer Timer
(1144) Equipment List: CM2 Preparation/Day 11 REP Seed Magnehelic Gauge Biological Safety Cabinet (BSC) Incubator Incubator CO2 Analyzer Dry Bath Water Bath CytoTherm Welder Gatherex NC200 NucleoCounter Baxa Repeater Pump Sebra Tube Sealer Balance
(1145) Equipment List: CM2 Preparation/Day 11 REP Seed Centrifuge Micropipetter (100-1000 ?L) Pipet-Aid Timer 2-8? C. Refrigerator ?80? C. Freezer Controlled Rate Freezer LN2 Storage Freezer (Quarantine) ?20? C. Freezer
(1146) Equipment List: CM4 Preparation/Day 16 Magnehelic Gauge Biological Safety Cabinet (BSC) Incubator Incubator CO2 Analyzer Welder Welder Gatherex NC200 NucleoCounter Baxa Repeater Pump Sebra Tube Sealer Balance Micropipetter (100-1000 ?L) Pipet-Aid 2-8? C. Refrigerator ?80? C. Freezer
(1147) Equipment List: Day 22 Formulation, Fill, Cryopreservation Magnehelic Gauge Biological Safety Cabinet (BSC) Incubator Incubator CO2 Analyzer Welder Gatherex NC200 NucleoCounter Baxa Repeater Pump Sebra Tube Sealer Balance Micropipetter (20-200 ?L) Pipet-Aid
(1148) Equipment List: Day 22 Formulation, Fill, Cryopreservation Pipet-Aid 2-8? C. Refrigerator ?80? C. Freezer Controlled Rate Freezer LN2 Storage Freezer LN2 Storage Freezer (Quarantine) LOVO Cell Processing System
7.0 Bill of Materials
(1149) Materials: Day 0 CM1 Media Preparation/Tumor Wash Preparation/Tumor
(1150) Dissection Disposable Scalpels, Sterile 50 mL Serological Pipets, Sterile 1 mL Serological Plastic Pipet, Sterile 10 mL Serological Pipet, Sterile Centrifuge Tube, 50 mL, 28?114 mm, Conical Base, Screw Cap, PP, Sterile 25 mL Serological Pipet, Sterile 5 mL Serological Pipet, Sterile MF75 Series, Disposable Tissue Culture Filter, 1000 mL, aPES Filter, 0.2 ?m, Sterile Pipets, Serological 100 mL 2-mercaptoethanol 1000?, liquid, 55 mM in D-PBS Hank's Balanced Sodium Salt Solution (1?), Liquid, w/o Calcium Chloride, Magnesium Chloride, Magnesium Sulfate GlutaMAX 1-200 mM (100?), liquid ART Barrier Pipet Tips, 1000 ?L, Individually Wrapped, Sterile 150 mm Petri Dish, Extra-Depth, Sterile 6-well, Ultra-Low Attachment Plates, 9.5 cm2 Well Growth Area, PS, Sterile Thermo Scientific Samco General-Purpose Transfer Pipettes. 7.7 mL, Sterile Repeater Pump Fluid Transfer Set Male Luer Lock End Long Forceps 8, Sterile Gentamicin Sulfate, 50 mg/mL stock Scientific Disposable Forceps, 4.5, Stainless Steel, Sterile 100 mm petri dish, Sterile Extra Depth Pumpmatic Liquid-Dispensing System Gentamicin Sulfate, 50 mg/mL stock Syringe Cap Dual Function, Red RPMI-1640, 1 L Bottle G-Rex 100M Flask Closed System Sterile rulers Reconstituted IL-2 Human Tumor Sample, Head and Neck Q N/A Human Tumor Sample, Cervical Q N/A GemCell Human Serum AB, Heat Inactivated Q N/A Human Tumor Sample, Melanoma GemCell Human Serum AB, Heat Inactivated
(1151) Materials: CM2 Preparation/Day 11 REP Seed Luer-Lok Syringe, 60 mL Sterile Needle 16G?1.5 Sterile 50 mL Serological Pipets, Sterile 1 mL Serological Plastic, Pipet, Sterile Nunc Internally Threaded Cryotube Vials, Sterile 10 mL Serological Pipet, Sterile Centrifuge Tube, 15 mL Centrifuge Tube, 50 mL Pipets, Serological 100 mL Syringe, 1 cc Sterile Luer-Lok 3 mL Syringe, Luer-Lok Tip, Sterile 5 mL Serological Pipet, Sterile Nalgene *MF75* Series Filter Unit Receiver, 250 mL, Sterile Nalgene MF75 Series Filter Unit Receiver, 500 mL, Sterile 1000 mL Nalgene Rapid-Flow Sterile Dispoasable Filter Unit, 0.22 ?m PES CryoStor CS-10 2-mercaptoethanol 1000? Liquid, 55 mM in D-PBS GlutaMAX 1-200 mM (100?), liquid 1,000 ?L ART Barrier Sterile Pipet Tips, Individual Wrap VIA1 Cassettes Transfer Pack Container, 1000 mL w/Coupler, Sterile Transfer Pack 300 mL w/Coupler Sterile Alcohol Pads Repeater Pump Fluid Transfer Set Male Luer Lock Ends CTS AIM V 1 L Bottle MACS GMP CD3 pure (OKT-3) Gentamicin Sulfate, 50 mg/mL stock 4 Tubing w/Piercing Pin and Syringe Adapter Syringe Only Luer-Lok 10 mL Tubing, Four Spike Male Luer Manifold Gravity Blood Administration Set Y-type with No injection site, 170 ?m blood filter Pumpmatic Liquid-Dispensing System 10 L Labtainer 3 Port Bag Gentamicin Sulfate, 50 mg/mL stock 100 mL Syringe 3000 mL Culture Bag Origen Cell Connect CC2 Syringe Cap Dual Function Red RPMI-1640, 1 L Bottle G-Rex 500M Flask Closed System Reconstituted IL-2 Allogeneic Irradiated Feeder Cells Allogeneic Irradiated Feeder Cells Human Serum, type AB(HI) Gemini Human Serum, type AB(HI) Gemini
(1152) Materials: CM4 Preparation/Day 16 Luer-Lok Syringe, 60 mL Sterile 1 mL Serological Plastic Pipet, Sterile Nunc Internally Threaded Cyrotube Vials, Sterile 10 mL Serological Pipets, Sterile Centrifuge Tube, 15 mL Centrifuge Tube, 50 mL Pipets, Serological 100 mL Syringe with Luer-Lock, sterile, 3 mL 5 mL Serological Pipet, Sterile Syringe only Luer-Lok 10 mL Nalgene *MF75* Series Filter Unit Receiver, 250 mL, Sterile GlutaMAX1-200 mM (100?), liquid ART Barrier Pipet Tips, 1000 ?L, Individually Wrapped, Sterile VIA1 Cassettes
(1153) Materials: CM4 Preparation/Day 16 Transfer Pack Container, 1000 mL with Coupler, Sterile Sterile Alcohol Pads Repeater Pump Fluid Transfer Set Male Luer Lock Ends CTS AIM-V 1000 mL ?N/A Plasma Transfer Set 4 Tubing with Female Luer Adapter 30 mL Luer-Lok Sterile Syringe CTS AIM V 10 L bag Pumpmatic Liquid-Dispensing System 10 L Labtainer 3 Port Bag Syringe Cap Dual Function Red G-Rex500M Flask Closed System Reconstituted IL-2
(1154) Materials: Day 22 Formulation, Fill, Cryopreservation Luer-Lok Syringe, 60 mL Sterile Needle 16G?1.5 Sterile 50 mL Serological Pipets, Sterile Nunc Internally Threaded Cryotubes Vials, Sterile 10 mL Serological Pipet, Sterile Centrifuge Tube, 15 mL Centrifuge Tube, 50 mL Syringe, 1 cc Sterile Luer-Lok 3 mL Syringe, Luer-Lok Tip, Sterile 25 mL Serological Pipet, Sterile 5 mL Serological Pipet, Sterile Syringe only Luer-Lok 10 mL Pipets, Serological 100 mL ART Barrier Sterile Pipet Tips, 200 ?L Individual Wrap VIA1-Cassettes Plasma-Lyte A Injection 1L LOVO Cell Washing Disposable Set LOVO Ancillary Bag Kit Sterile Alcohol Pads Repeater Pump Fluid Transfer Set Male Luer Lock Ends CTS AIM V 1 L Bottle Human Albumin 25% Plasma Transfer Set 4 Tubing with Female Luer Adapter Tubing, Four Male Luer Manifold Gravity Blood Administration Set Y-type with No injection site, 170 ?m blood filter Pumpmatic Liquid-Dispensing System 10 L Labtainer 3 Port Bag 100 mL Syringe Cryo bag CS750 3 L Culture Bag Origen Cell Connect CC2 Syringe Cap Dual Function Red Cryostor CS10, 100 mL Bag Dispensing Spike, Vented Reconstituted IL-2
8.0 Process
(1155) Step Description Process Information Primary
(1156) 8.1 Day 0 CM1 Media Preparation 8.1.1 Checked room sanitization, line clearance, and materials. Confirmed room sanitization, 8.1.2 Ensured completion of pre-processing table. 8.1.3 Environmental Monitoring. Prior to processing, ensured pre-process environmental monitoring had been initiated. 8.1.4 Prepared RPMI 1640 Media In the BSC, using an appropriately sized pipette, removed 100.0 mL from 1000 mL RPMI 1640 Media and placed into an appropriately sized container labeled Waste. 8.1.5 In the BSC added reagents to RPMI 1640 Media bottle. Added the following reagents to the RPMI 1640 Media bottle as shown in in table. Recorded volumes added. Amount Added per bottle: Heat Inactivated Human AB Serum (100.0 mL); GlutaMax (10.0 mL); Gentamicin sulfate, 50 mg/mL (1.0 mL); 2-mercaptoethanol (1.0 mL) 8.1.6 Mixed Media. Capped RPMI 1640 Media bottle from Step 8.1.5 and swirled bottle to ensure reagents were mixed thoroughly. 8.1.7 Filtered RPMI media. Filtered RPMI 1640 Media from Step 8.1.6 through 1 L 0.22-micron filter unit. 8.1.8 Labeled filtered media. Aseptically capped the filtered media and labeled with the following information. 8.1.9 Removed unnecessary materials from BSC. Passed out media reagents from BSC, left Gentamicin Sulfate and HBSS in BSC for Formulated Wash Media preparation in Section 8.2. 8.1.10 Stored unused consumables. Transferred any remaining opened/thawed media reagents to appropriate storage conditions or disposed into waste. NOTE: Assigned the appropriate open expiry to media reagents per Process Note 5.9 and labeled with batch record lot number 8.1.11 Thawed IL-2 aliquot. Thawed one 1.1 mL IL-2 aliquot (6?106 IU/mL) (BR71424) until all ice had melted. Recorded IL-2: Lot # and Expiry (NOTE: Ensured IL-2 label was attached). 8.1.12 Transferred IL-2 stock solution to media. In the BSC, transferred 1.0 mL of IL-2 stock solution to the CM1 Day 0 Media Bottle prepared in Step 8.1.8. Added CM1 Day 0 Media 1 bottle and IL-2 (6?10.sup.6 IU/mL) 1.0 mL. 8.1.13 Mixed and Relabeled. Capped and swirled the bottle to mix media containing IL-2. Relabeled as Complete CM1 Day 0 Media and assigned new lot number. 8.1.14 Sample Media per Sample Plan. Removed 20.0 mL of media using an appropriately sized pipette and dispensed into a 50 mL conical tube. 8.1.15 Labeled and stored. Sample labeled with sample plan inventory label and stored Media Retain sample at 2-8? C. until submitted to Login for testing per Sample Plan. 8.1.16 Signed for Sampling. Ensured that LIMS sample plan sheet was completed for removal of the sample. 8.1.17 Prepared Tissue Pieces conical tube. In BSC, transferred 25.0 mL of Complete CM1 Day 0 Media (prepared in Step 8.1.13) to a 50 mL conical tube. Labeled the tube as Tissue Pieces and batch record lot number. 8.1.18 Passed G-Rex100MCS into BSC. Aseptically passed G-Rex100MCS (W3013130) into the BSC. 8.1.19 Prepared G-Rex100MCS. In the BSC, closed all clamps on the G-Rex100MCS, leaving vent filter clamp open. 8.1.20 Prepared G-Rex100MCS. Connected the red line of G-Rex100MCS flask to the larger diameter end of the repeater pump fluid transfer set (W3009497) via luer connection. 8.1.21 Prepared Baxa Pump. Staged Baxa pump next to BSC. Removed pump tubing section of repeater pump fluid transfer set from BSC and installed in repeater pump. 8.1.22 Prepared to pump media. Within the BSC, removed the syringe from Pumpmatic Liquid-Dispensing System (PLDS) (W3012720) and discarded. NOTE: Ensured to not compromise the sterility of the PLDS pipette. 8.1.23 Prepared to pump media. Connected PLDS pipette to the smaller diameter end of repeater pump fluid transfer set via luer connection and placed pipette tip in Complete CM1 Day 0 Media (prepared in Step 8.1.13) for aspiration. Opened all clamps between media and G-Rex100MCS. 8.1.24 Pumped Complete CM1 media into G-Rex100MCS flask. Set the pump speed to High and 9 and pumped all Complete CM1 Day 0 Media into G-Rex100MCS flask. Once all media was transferred, cleared the line and stopped pump. 8.1.25 Disconnected pump from flask. Ensured all clamps were closed on the flask, except vent filter. Removed the repeater pump fluid transfer set from the red media line, and placed a red cap (W3012845) on the red media line. 8.1.26 Heated seal. Removed G-Rex100MCS flask from BSC, heated seal (per Process Note 5.12) off the red cap from the red line near the terminal luer. 8.1.27 Labeled G-Rex100MCS. Labeled G-Rex100MCS flask with QA provided in-process Day 0 label. Attached sample Day 0 label below. 8.1.28 Monitored Incubator. Incubator parameters: Temperature LED Display: 37.0?2.0? C.; CO2 Percentage: 5.0?1.5% CO2 8.1.29 Warmed Media. Placed the 50 mL conical tube labeled Tissue Fragments prepared in Step 8.1.17 and the G-Rex100MCS prepared in Step 8.1.27 in incubator for ?30 minutes of warming. Recorded warming times below. Recorded if Warm Time was ?30 minutes (Yes/No). [Tissue Fragments Conical or GRex100MCS] 8.1.30 Reviewed Section 8.1.
(1157) 8.2 Day 0 Tumor Wash Media Preparation 8.2.1 Added Gentamicin to HBSS. In the BSC, added 5.0 mL Gentamicin (W3009832 or W3012735) to 1?500 mL HBSS Media (W3013128) bottle. Recorded volumes. Added per bottle: HBSS (500.0 mL); Gentamicin sulfate, 50 mg/ml (5.0 mL) 8.2.2 Capped HBSS bottle and swirled. Capped HBSS containing gentamicin prepared in Step 8.2.1 and swirled bottle to ensure reagents are mixed thoroughly. 8.2.3 Filtered Solution. Filtered HBSS containing gentamicin prepared in Step 8.2.1 through a 1 L 0.22-micron filter unit (W1218810). 8.2.4 Aseptically capped the filtered media and label. Aseptically capped the filtered media and labeled with the following information. Proceeded to SECTION 8.3. 8.2.5 Reviewed Section 8.2.
(1158) 8.3 Day 0 Tumor Processing 8.3.1 Obtained Tumor. Obtained tumor specimen from QAR and transferred into suite at 2-8? C. immediately for processing. Ensured all necessary information is recorded on the Tumor Shipping Batch Record. 8.3.2 Recorded Tumor Information. 8.3.3 Affixed Tumor Label. Affixed tumor Attachment. QAR release sticker below. Attached Tumor Shipping Batch Record as #5. 8.3.4 Passed in necessary materials for tumor dissection into the BSC. 8.3.5 Opened Materials. Opened all materials inside the BSC, ensuring not to compromise the sterility of the items. 8.3.6 Labeled Materials. Labeled three 50 ml conical tubes: the first as Forceps, the second as Scalpel, and the third as Fresh Tumor Wash Media. Labeled 5?100 mm petri dishes as Wash 1, Wash 2, Wash 3, Holding, and Unfavorable. Labeled one 6 well plate as Favorable Intermediate Fragments. 8.3.7 Aliquoted Tumor Wash Media. Using an appropriately sized pipette, transferred 5.0 mL of Tumor Wash Media prepared in Step 8.2.4 into each well of one 6-well plate for favorable intermediate tumor fragments (30.0 mL total). NOTE: The forceps and scalpels were stored in their respective tumor wash media conicals as needed during the tumor washing and dissection processes. 8.3.8 Aliquoted Tumor Wash Media. Using an appropriately sized pipette, transferred 50.0 mL of Tumor Wash Media prepared in Step 8.2.4 into each 100 mm petri dish for Wash 1, Wash 2, Wash 3, and Holding (200.0 mL total). 8.3.9 Aliquoted Tumor Wash Media. Using an appropriately sized pipette, transfer 20.0 mL of Tumor Wash Media prepared in Step 8.2.4 into each 50 mL conical (60.0 mL total). 8.3.10 Prepared Lids for Tumor Pieces. Aseptically removed lids from two 6-well plates. The lids were utilized for selected tumor pieces. NOTE: Throughout tumor processing, DID NOT cross over open tissue culture plates and lids. 8.3.11 Passed the tumor into the BSC. Aseptically passed the tumor into the BSC. Recorded processing start time. 8.3.12 Tumor Wash 1 Using 8 forceps (W3009771), removed the tumor from the specimen bottle and transferred to the Wash 1 dish prepared in Step 8.3.8. NOTE: Retained the solution in specimen bottle. 8.3.13 Tumor Wash 1 Using forceps, gently washed tumor time from timer below: specimen and allowed it to sit for ?3 minutes. Recorded wash time (MM:SS). 8.3.14 Prepared Bioburden Sample per Sample Plan. Transferred 20.0 mL (or available volume) of solution from the tumor specimen bottle into a 50 mL conical per sample plan. 8.3.15 Labeled and stored sample. Labeled with sample plan inventory label and stored bioburden sample collected in Step 8.3.14 at 2-8? C. until submitted for testing. 8.3.16 Signed for sampling. Ensured that LIMS sample plan sheet was completed for removal of the sample. 8.3.17 Tumor Wash 2. Using a new set of forceps removed the tumor from the Wash 1 dish and transferred to the Wash 2 dish prepared in Step 8.3.8. 8.3.18 Tumor Wash 2. Using forceps, washed tumor specimen by gently agitating for ?3 minutes and allowed it to sit. Recorded time. 8.3.19 Prepared drops of Tumor Wash Media for desired tumor pieces. Using a transfer pipette, placed 4 individual drops of Tumor Wash Media from the conical prepared in Step 8.3.9 into each of the 6 circles on the upturned lids of the 6-well plates (2 lids). Placed an extra drop on two circles for a total of 50 drops. 8.3.20 Tumor Wash 3. Using forceps, removed the tumor from the Wash 2 dish and transferred to the Wash 3 dish prepared in Step 8.3.8. 8.3.21 Tumor Wash 3. Using forceps, washed tumor specimen by gently agitating and allowed it to sit for ?3 minutes. Recorded time. 8.3.22 Prepared tumor dissection dish. Placed a ruler under 150 mm dish lid. 8.3.23 Transferred Tumor to Dissection Dish. Using forceps, aseptically transferred tumor specimen to the 150 mm dissection dish lid. 8.3.24 Measured Tumor. Arranged all pieces of tumor specimen end to end and recorded the approximate overall length and number of fragments. Took a clear picture of each tumor specimen. 8.3.25 Assessed Tumor. Assessed the tumor for necrotic/fatty tissue. Assessed whether ?30% of entire tumor area observed to be necrotic and/or fatty tissue; if yes, contacted area management to ensure tumor was of appropriate size, then proceeded to Step 8.3.26. Assessed whether <30% of entire tumor area were observed to be necrotic or fatty tissue; if yes, proceeded to Step 8.3.27 and clean-up dissection was NOT performed. 8.3.26 If applicable: Clean-Up Dissection. If tumor was large and >30% of tissue exterior was observed to be necrotic/fatty, performed clean up dissection by removing necrotic/fatty tissue while preserving tumor inner structure using a combination of scalpel and/or forceps. NOTE: To maintain tumor internal structure, used only vertical cutting pressure. Did not cut in a sawing motion with scalpel. NOTE: Fat, necrotic, and extraneous tissue were placed in unfavorable dish. 8.3.27 Dissect TumorUsing a combination of scalpel and/or forceps, cut the tumor specimen into even, appropriately sized fragments (up to 6 intermediate fragments). NOTE: To maintain tumor internal structure, use only vertical cutting pressure. Did not cut in a sawing motion with scalpel. NOTE: Ensured to keep non-dissected intermediate fragments completely submerged in Tumor Wash Media (prepared in Step 8.2.4). 8.3.28 Transferred intermediate tumor fragments. Transferred each intermediate fragment to the holding dish from Step 8.3.8. 8.3.29 Dissected Tumor Fragments. Manipulated one intermediate fragment at a time, dissected the tumor intermediate fragment in the dissection dish into pieces approximately 3?3?3 mm in size, minimizing the amount of hemorrhagic, necrotic, and/or fatty tissues on each piece. NOTE: To maintain tumor internal structure, used only vertical cutting pressure. Did not cut in a sawing motion with scalpel. 8.3.30 Selected Tumor Pieces. Selected up to eight (8) tumor pieces without hemorrhagic, necrotic, and/or fatty tissue. Used the ruler for reference. Continued dissection until 8 favorable pieces have been obtained, or the entire intermediate fragment has been dissected. Transferred each selected piece to one of the drops of Tumor Wash Media prepared in Step 8.3.19. 8.3.31 Stored Intermediate Fragments to Prevent Drying. After selecting up to eight (8) pieces from the intermediate fragment, placed remnants of intermediate fragment into a new single well of Favorable Intermediate Fragments 6-well plate prepared in Step 8.3.7. NOTE: Fatty or necrotic tissue was placed in the Unfavorable dish (prepared in step 8.3.6). 8.3.32 Repeated Intermediate Fragment Dissection. Proceeded to the next intermediate fragment, repeated Steps 8.3.29-8.3.31 until all intermediate fragments had been processed, obtained fresh scalpels and forceps as needed. 8.3.33 Determined number of pieces collected. If desirable tissue remains, selected additional Favorable Tumor Pieces from the favorable intermediate fragments 6-well plate to fill the drops for a maximum of 50 pieces. Recorded the total number of dissected pieces created. NOTE: Ensuring to keep the tumor intermediate fragments hydrated with Wash Medium as necessary throughout dissection. Recorded Total quantity of dissected pieces collected. 8.3.34 Removed Conical Tube from Incubator. Removed the Tissue Pieces 50 mL conical tube from the incubator. Recorded time in Step 8.1.29. Ensured conical tube was warmed for ?30 min. 8.3.35 Prepared Conical Tube. Passed Tissue Pieces 50 mL conical into the BSC, ensuring not to compromise the sterility of open processing surfaces. 8.3.36 Transferred Tumor Pieces to 50 mL Conical Tube. Using a transfer pipette, scapel, forceps or combination, transferred the selected 50 best tumor fragments from favorable dish lids to the Tissue Pieces 50 mL conical tube. NOTE: If a tumor piece was dropped during transfer and desirable tissue remains, additional pieces from the favorable tumor intermediate fragment wells were added. Recorded numbers of pieces. 8.3.37 Prepared BSC for G-REX100MCS. Removed all unnecessary items from BSC for vessel seed, retaining the favorable tissue plates if they contained extra fragments. 8.3.38 Removed G-REX100MCS from Incubator. Removed G-Rex100MCS containing media from incubator. Completed Step 8.1.29. 8.3.39 Passed flask into BSC. Aseptically passed G-Rex100MCS flask into the BSC. NOTE: When transferring the flask, did not hold from the lid or the bottom of the vessel. Transferred the vessel by handling the sides. NOTE: Only utilized IPA WIPES when handling G-Rex flasks. 8.3.40 Added tumor fragments to G-Rex100MCS flask. In the BSC, lifted G-Rex100MCS flask cap, ensuring that sterility of internal tubing was maintained. Swirled conical tube with tumor pieces to suspend and quickly poured the contents into the G-Rex100MCS flask. 8.3.41 Evenly distributed pieces. Ensured that the tumor pieces were evenly distributed across the membrane of the flask. Gently tilted the flask back and forth if necessary to evenly distribute the tumor pieces. 8.3.42 Recorded total number of tumor fragments in vessel. Recorded number of tumor fragments on bottom membrane of vessel and number of observed to be floating in vessel. NOTE: If the number of fragments seeded were NOT equivalent to number of collected in Step 8.3.36H, contacted Area Management, and document in Section 10.0. 8.3.43 Incubate G-Rex flask Incubated G-Rex100MCS at the following parameters: Incubated G-Rex flask: Temperature LED Display: 37.0?2.0? C.; CO2 Percentage: 5.0?1.5% CO2 8.3.44 Calculated incubation window. Performed calculations to determine the proper time to remove G-Rex100MCS incubator on Day 11. Calculations: Time of incubation; lower limite=time of incubation+252 hours; upper limit=time of incubation+276 hours 8.3.45 Environmental Monitoring. After processing, verified BSC and personnel monitoring were performed. 8.3.46 Discarded materials. Storeed remaining unwarmed media at 2-8? C. and labeled. After process was complete, discarded any remaining warmed media and thawed aliquots of IL-2. 8.3.47 Sample submission. Ensured all Day 0 samples were submitted to Login and transferred in LIMS. 8.3.48 Review Section 8.3.
(1159) 8.4 Day 11Media Preparation 8.4.1 Checked room, sanitization, line clearance, and materials. Confirmed room sanitization, line clearance, and that materials are within expiry. 8.4.2 Pre-processing table. Equipment list: BSC; Balance; Sebra Tube Sealer; Gatherex? Media Removal and Cell Recovery Device; Ensure QA provided placard is placed on the appropriate BSC; Ensure QA provided placard lot number and patient ID display matches the lot number and patient ID in this Batch Record. 8.4.3 Monitored Incubator. Monitored Incubator. Incubator parameters: Temperature LED Display: 37.0?2.0? C.; CO2 Percentage: 5.0?1.5% CO2. NOTE: Section 8.4 may be run concurrently with section 8.5. 8.4.4 Warmed media. Warmed 3?1000 mL RPMI 1640 Media (W3013112) bottles and 3?1000 mL AIM-V (W3009501) bottles in an incubator for ?30 minutes. Recorded time. Media: RPMI 1640 and AIM-V. NOTE: Placed an additional 1?1000 ml bottle of AIM-V Media (W3009501) at room temperature for use in Step 8.5.34. Labeled the bottle For Cell Count Dilutions Only and the batch record lot number. 8.4.5 Environmental monitoring. Prior to processing, ensured pre-process environmental monitoring was performed as per SOP-00344. 8.4.6 Removed RPMI 1640 Media from incubator. Removed the RPMI 1640 Media when time was reached. Record end incubation time in Step 8.4.4. Ensure media was warmed for ?30 min. 8.4.7 Prepared RPMI 1640 Media. In the BSC, removed 100.0 mL from each of the three pre-warmed 1000 mL RPMI 1640 Media bottles and placed into an appropriately sized container labeled Waste. 8.4.8 In BSC add reagents to RPMI 1640 Media bottle. In the BSC added the following reagents to each of the three RPMI 1640 Media bottles. Recorded volumes added to each bottle. GemCell Human serum, Heat Inactivated Type AB (100.0 mL), GlutaMax (10.0 mL), Gentamicin sulfate, 50 mg/ml (1.0 mL), 2-mercaptoethanol (1.0 mL) 8.4.9 Filter Media. Caped bottles from Step 8.4.8 and swirled to ensure reagents were mixed thoroughly. Filtered each bottle of media through a separate 1 L 0.22-micron filter unit. 8.4.10 Labeled filtered media. Aseptically capped the filtered media and labeled each bottle with CM1 Day 11 Media. 8.4.11 Thawed IL-2 aliquot. Thawed 3?1.1 mL aliquots of IL-2 (6?106 IU/mL) (BR71424) until all ice had melted Recorded IL 2 lot # and Expiry. NOTE: EnsureIL-2 label is attached. 8.4.12 Removed AIM-V Media from the incubator. Removed the three bottles of AIM-V Media from the incubator. Recorded end incubation time in Step 8.4.4. Ensured media had been warmed for ?30 minutes. 8.4.13 Add IL-2 to AIM-V. In the BSC, using a micropipette, added 3.0 mL of thawed IL-2 into one 1 L bottle of pre-warmed AIM-V media. Rinse micropipette tip with media after dispensing IL-2. Use a new sterile micropipette tip for each aliquot. Recorded the total volume added. Labeled bottle as AIM-V Containing IL-2. 8.4.14 Transferred materials. Aseptically transferred a 10 L Labtainer Bag and a repeater pump transferr set into the BSC. 8.4.15 Prepared 10 L Labtainer media bag. Closed all lines on a 10 L Labtainer bag. Attached the larger diameter tubing end of a repeater pump transfer set to the middle female port of the 10 L Labtainer Bag via luer lock connection. 8.4.16 Prepare Baxa pump. Staged the Baxa pump next to the BSC. Fed the transfer set tubing through the Baxa pump situated outside of the BSC. Set the Baxa Pump to High and 9. 8.4.17 Prepared 10 L Labtainer media bag. In BSC, removed syringe from Pumpmatic Liquid-Dispensing System (PLDS) and discarded. NOTE: Ensured to not compromise the sterility of the PLDS pipette. 8.4.18 Prepared 10 L Labtainer media bag. Connected PLDS pipette to smaller diameter end of repeater pump fluid transfer set via luer connection and placed pipette tip in AIM-V media containing IL-2 bottle (prepared in Step 8.4.13) for aspiration. Opened all clamps between media bottle and 10 L Labtainer. 8.4.19 Pumped media into 10 L Labtainer. In the BSC, using the PLDS, transfer pre-warmed AIM-V media containing IL-2 prepared in Step 8.4.13, as well as two additional AIM-V bottles into the 10 L Labtainer bag. Added the three bottles of filtered CM1 Day 11 Media fomr Step 8.4.10. After addition of final bottle, cleared the line to the bag. NOTE: Stopped the pump between addition of each bottle of media. 8.4.20 Removed pumpmatic from Labtainer bag. Removed PLDS from the transfer set and placed a red cap on the luer of the line in the BSC. 8.4.21 Mixed media. Gently massaged the bag to mix. 8.4.22 Labeled media. In the BSC, labeled the media bag with the following information. Expiration date was 24 hours from the preparation date. 8.4.23 Sample media per sample plan. In the BSC, attached a 60 mL syringe to the available female port of the Complete CM2 Day 11 Media bag prepared in step 8.4.22. Removed 20.0 mL of media and place in a 50 mL conical tube. Placed a red cap on the female port of the Complete CM2 Day 11 Media Bag. 8.4.24 Labeled and stored sample. Labeled with sample plan inventory label and stored Media Retain Sample at 2-8? C. until submitted to Login for testing. 8.4.25 Sign for Sampling. Ensured that LIMS sample plan sheet was completed for removal of the sample. 8.4.26 Sealed the transfer set line. Outside the BSC, heat sealed off (per Process Note 5.12) the red cap on the transfer set line, close to red cap. Kept the transfer set on the bag. 8.4.27 Prepared Cell Count Dilution Tubes In the BSC, added 4.5 mL of AIM-V Media that had been labelled with For Cell Count Dilutions and lot number to four 15 mL conical tubes. Labeled the tubes with the lot number and tube number (1-4). Labeled 4 cryovials Feeder and vial number (1-4). Kept vials under BSC to be used in Step 8.5.30. 8.4.28 Transferred reagents from the BSC to 2-8? C. Transferred any remaining 2-mercaptoethanol, GlutaMax, and human serum from the BSC to 2-8? C. Ensured all reagents were labeled with the batch record lot number, and the appropriate open expiry per Process Note 5.9. 8.4.29 Prepared 1 L Transfer Pack. Outside of the BSC weld (per Process Note 5.11) a 1 L Transfer Pack to the transfer set attached to the Complete CM2 Day 11 Media bag prepared in step 8.4.22. Labeled transfer pack as Feeder Cell CM2 Media and lot number. 8.4.30 Prepared 1 L Transfer Pack. Made a mark on the tubing of the 1L Transfer Pack tubing a few inches away from the bag. Placed the empty Transfer Pack onto the scale so that the tubing was on the scale to the point of the mark. 8.4.31 Tared scale. Tared the scale and left the empty Transfer Pack on the scale. 8.4.32 Prepared feeder cell transfer pack. Set the Baxa pump to Medium and 4. Pumped 500.0?5.0 mL of Complete CM2 Day 11 media prepared in Step 8.4.22 into Cell CM2 Media transfer pack. Measured by weight and recorded the volume of Complete CM2 media added to the Transfer Pack. 8.4.33 Heated seal line. Once filled, heated seal the line per Process Note 5.12. Separated CM2 Day 11 media bag with transfer set from feeder cell media transfer pack, kept weld toward 1 L transfer pack. 8.4.34 If applicable: Incubated feeder cell media transfer pack. When applicable, placed the Feeder Cell CM2 Media transfer pack in incubator until used in Step 8.6.6. 8.4.35 Incubated Complete CM2 Day 11 Media. Placed Complete CM2 Day 11 Media prepared in Step 8.4.22 in incubator untiluse in Step 8.7.2. 8.4.36 Reviewed Section 8.4.
(1160) 8.5 Day 11TIL Harvest 8.5.1 Preprocessing table. Monitored incubator. Incubator parameters: Temperature LED Display: 37.0?2.0? C.; CO2 Percentage: 5.0?1.5% CO2. NOTE: Section 8.5 may be run concurrently with Sections 8.4 and 8.6. 8.5.2 Removed G-Rex100MCS from incubator. Performed check below to ensure incubation parameters are met before removing G-Rex100MCS from incubator. Lower limited from Step 8.3.44 B. Upper limit from Step 8.3.44 C. Recored Time of Removal from incubator. Determined: Is 8.3.44 B?Time of Removal from incubator <Step 8.3.44 C? *IF NO CONTACT AREA MANAGEMENT. Carefully removed G-Rex100MCS from incubator and ensured all clamps were closed except large filter line. Recorded processing start time. 8.5.3 Prepared 300 mL Transfer Pack. Labeled a 300 mL Transfer pack as TIL Suspension. 8.5.4 Prepared 300 mL Transfer Pack. Sterile welded (per Process Note 5.11) the TIL Suspension transfer (single line) of a Gravity Blood Filter. See, for example,
(1161) TABLE-US-00067 Parameter Formula Result Total Viable TIL Step 8.5.51 C A. cells TIL removed for Flow 1 ? 10.sup.7 cells B. 1 ? 10.sup.7 cells Cytometry Remaining Total C = A ? B C. cells Viable TIL Volume of TIL Step 8.5.50C D. mL Volume of TIL Step 8.5.52 C E. mL removed Remaining Volume of F = D ? E F. mL TIL 8.5.58 If Applicable: Calculated TIL volume. Calculated the volume of TIL suspension equal to 2.0?10.sup.8 viable cells.
(1162) TABLE-US-00068 Volume of TIL Suspension containing Total Viable Cells Viable Cell Concentration 2.0 ? 10.sup.8 viable cells Required from Step 8.5.51 A C = A ? B A. 2.0 ? 10.sup.8 cells B. cells/mL C. mL 8.5.59 If Applicable: Calculated TIL volume to remove Calculate the excess volume of TIL cells to remove.
(1163) TABLE-US-00069 Volume of suspension Volume of Total Volume of TIL containing 2.0 ? 10.sup.8 excess TIL to Suspension from Step TIL from Step Remove 8.5.57F 8.5.58C C = A ? B A. mL B. 8.5.60 If Applicable: Removed excess TIL. In the BSC, using an appropriately sized syringe, remove the calculated volume (Step 8.5.59C) from the TIL Suspension transfer pack. NOTE: Do not use a syringe more than once. Use multiple syringes if applicable. Placed in appropriately sized sterile container and label as date, and lot number. Placed a red cap on the TIL Suspension transfer pack line. 8.5.61 If Applicable: Placed TIL in Incubator. Placed TIL Suspension Transfer Pack in incubator until needed. Recorded time. 8.5.62 If Applicable: Calculations. Calculated total excess TIL removed. Step 8.5.51A Volume of TIL to Remove from Step 8.5.59C. Calcualted Total Excess TIL removed.
(1164) TABLE-US-00070 Viable Cell Volume of TIL Total Excess TIL Concentration from to Remove C = A ? B Step 8.5.51A from Step 8.5.59C removed A. cells/mL B. mL C. cells 8.5.63 If Applicable: Calculations. Calculated amount of CS-10 media to add to excess TIL cells from Step 8.5.62C. Target cell concentration for freezing is 1.0?10.sup.8 cells/ml.
(1165) TABLE-US-00071 Volume of CS-10to Total Excess TIL Add Removed Target Concentration to (mL) Step 8.5.62C Freeze C = A ? B A. cells B. 1.0 ? 10.sup.8 cells/mL C. mL 8.5.64 If Applicable: Centrifuged excess TIL. Centrifuged the excess TIL cell suspension. Speed: 350?g. Time: 10:00 minutes. Temperature: Ambient Brake: Full (9). Acceleration: Full (9). 8.5.65 If Applicable: Observed conical tube. Recorded observations: Pellet observed? Supernatant was clear? *NOTE: If either answer was no, contact Area Management. 8.5.66 If Applicable: Added CS-10. In BSC, aseptically aspirate supernatant. Gently tap bottom of tube to resuspend cells in remaining fluid. 8.5.67 If Applicable: Added CS10. Slowly add the volume of CS10 calculated in Step 8.5.63C 8.5.68 If Applicable: Labeled vials. Labeled vials with QA provided labels. Attached a sample label. 8.5.69 If Applicable: Filled Vials. Aliquoted 1.0 mL cell suspension, into appropriately sized cryovials. NOTE: Did not fill more than 10 vials of Excess TIL. 8.5.70 If Applicable: Filled Vials. Aliquoted residual volume into appropriately sized cryovial per SOP-00242. If volume is ?0.5 mL, add CS10 to vial until volume is 0.5 mL. 8.5.71 If Applicable: Filled Vials. Filled one vial with 1.0 mL of CS10 and label as Blank. 8.5.72 If Applicable: Recorded number of vials filled. Recorded number of vials filled below, not including blank. 8.5.73 If Applicable: Environmental Monitoring. After processing, verified BSC and personnel monitoring had been performed
(1166) TIL Cryopreservation of Sample 8.5.74 If Applicable: Calcualted Colume for Cryopreservation. Calculated the volume of cells required to obtain 1?10.sup.7 cells for cryopreservation.
(1167) TABLE-US-00072 Volume of Cells Total Viable TIL Viable Cell required for required for Concentration From cryopreservation cryopreservation Step 8.5.51A C = A ? B A. 1 ? 10.sup.7 cells B. cells/mL C. mL 8.5.75 If Applicable: Removed sample for Cryopreservation. In the BSC, using the appropriately sized syringe, removed the calculated volume (Step 8.5.74C) from the TIL Suspension transfer pack. Placed in appropriately sized conical tube and label as Cryopreservation Sample 1?10.sup.7 cells, dated, and lot number. Placed a red cap (W3012845) on the TIL Suspension transfer pack. 8.5.76 If Applicable: Placed TIL in Incubator. Placed TIL SuspensionTransfer Pack in incubator until needed. 8.5.77 If Applicable: Cryopreservation sample. Centrifuged the Cryopreservation Sample 1?10.sup.7 cells according to the following parameters: Speed: 350?g, Time: 10:00 minutes, Temperature: Ambient, Brake: Full (9) Acceleration: Full (9). NOTE: Ensure proper units are set for speed and time on the centrifuge. 8.5.78 If Applicable: Observed conical tube. Recorded observations: Pellet observed? Supernatant is clear? *NOTE: If either answer is no, contact Area Management. 8.5.79 If Applicable: Added CS-10. In BSC, aseptically aspirate supernatant. Gently tap bottom of tube to resuspend cells in remaining fluid. 8.5.80 If Applicable: Added CS-10. Slowly added. 0.5 mL of CS10. Record edvolume added. 8.5.81 If Applicable: Labeled vial. Labeled vial with QA issued label. 8.5.82 If Applicable: Filled Vials. Aliquoted resuspended volume into labeled cryovial. 8.5.83 If Applicable: Filled blank. Filled another vial with 0.5 mL of CS10 and label as Blank. 8.5.84 If Applicable: Recorded number of vials filled, not including blank. Cryopreservation Sample Vials Filled at ?0.5 mL 8.5.85 If Applicable: Environmental Monitoring. After processing, verify BSC and personnel monitoring have been performed. 8.5.86 Review Section 8.5
(1168) 8.6 Day 11Feeder Cells 8.6.1 Obtained feeder cells. Obtained 3 bags of feeder cells with at least two different lot numbers from LN2 freezer. Kept cells on dry ice until ready to thaw. NOTE: Section 8.6 could be performed concurrently with Section 8.5. 8.6.2 Obtained feeder cells. Recorded feeder cell information. Confirmed that at least two different lots of feeder cells were obtained. 8.6.3 Prepared waterbath or Cryotherm. Prepared water bath or Cytotherm for Feeder Cell thaw. 8.6.4 Thawed Feeder Cells. Placed the Feeder Cell bags into individual zip top bags, based on Lot number, and thawed 37.0?2.0? C. water bath or cytotherm for ?3-5 minutes or until ice has just disappeared. Recorded thaw times below from timer. 8.6.5 Feeder cell harness preparation. Welded (per Process Note 5.11) 4S-4M60 to a CC2 Cell Connect (W3012820), replacing a single spike of the Cell Connect apparatus (B) with the 4-spike end of the 4S-4M60 manifold at (G). Welded H to G (see, for example,
(1169) TABLE-US-00073 Parameter Formula Result Total cell count 8.6.21 A + 8.6.21 B C. ?L sample Volume Multiplication C ? 8.6.21A D. Factor 8.6.23 Selected protocols and entered multiplication factors. Ensured the Viable Cell Count Assay protocol had been selected, all multiplication factors, and sample and diluent volumes had been entered. 8.6.24 Recorded File Name, Viability and Cell Counts from Nucleoview. 8.6.25 Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1170) TABLE-US-00074 Parameter Formula Result Viability (8.6.24A + 8.6.24B) ? 2 E. % Viable Cell (8.6.24C + 8.6.24D) ? 2 F. cells/mL Concentration 8.6.26 Determined Upper and Lower Limit for counts.
(1171) TABLE-US-00075 Parameter Formula Result Lower Limit 8.6.25F ? 0.9 G. cells/mL Upper Limit 8.6.25F ? 1.1 H. cells/mL 8.6.27 Were both counts within acceptable limits?
(1172) TABLE-US-00076 Parameter Formula Result (Yes/No) Lower Limit 8.6.24 C and D ? 8.6.26G Upper Limit 8.6.24 C and D ? 8.6.26H NOTE: If either result was No performed second set of counts in steps 8.6.28-8.6.35. 8.6.28 If Applicable: Performed cell counts Perform cell counts and calculations in utilizing NC-200 per SOP-00314 and Process Note 5.14 NOTE: Dilution could be adjusted according based off the expected concentration of cells. 8.6.29 If Applicable: Recorded Cell Count, sample volumes. NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0. 8.6.30 If Applicable: Determined Multiplication Factor.
(1173) TABLE-US-00077 Parameter Formula Result Total cell count 8.6.29A + 8.6.29B C. mL sample Volume Multiplication C ? 8.6.29A D. Factor 8.6.31 Select protocols and enter multiplication factors. Ensure the Viable Cell Count Assay protocol was selected, all multiplication factors, and sample and diluent volumes were entered. NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0. 8.6.32 If Applicable: Recorded Cell Counts from Nucleoview 8.6.33 If Applicable: Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1174) TABLE-US-00078 Parameter Formula Result Viability (8.6.32A + 8.6.32B) ? 2 E. % Viable Cell (8.6.32C + 8.6.32D) ? 2 F. cells/mL Concentration 8.6.34 If Applicable: Determined Upper and Lower Limit for counts.
(1175) TABLE-US-00079 Parameter Formula Result Lower Limit 8.6.33F ? 0.9 G. cells/mL Upper Limit 8.6.33F ? 1.1 H. cells/mL 8.6.35 If Applicable: Were counts within acceptable limits?
(1176) TABLE-US-00080 Parameter Formula Result (Yes/No) Lower Limit 8.6.32 C and D ? 8.6.34G Upper Limit 8.6.32 C and D ? 8.6.34H NOTE: If either result was No, continued to step 8.6.36 to find a total Average Viable Cell Concentration and proceed with calculations. 8.6.36 If Applicable: Determined an average Viable Cell Concentration from all four counts performed. 8.6.37 Adjusted Volume of Feeder Cell Suspension. Calculated the adjusted volume of Feeder Cell suspension after removal of cell count samples. Total Feeder Cell Volume from Step 8.6.18C minutes 4.0 ml removed. 8.6.38 Calculate dTotal Viable Feeder Cells.
(1177) TABLE-US-00081 Parameter Formula Result Average Viable Cell 8.6.25 F* A. cells/mL Concentraion* -or- 8.6.33 F* -or- 8.6.36 E* Total Volume 8.6.37 C B. mL Total Viable Cells A ? B C. cells If Total Viable Cells are <5?10.sup.9, proceed to Step 8.6.39. If Total Viable Cells are ?5?10.sup.9, proceed to Step 8.5.70. 8.6.39 If Applicable: Obtained additional Feeder Cells. Obtained an additional bag of feeder cells from LN2 freezer. Kept cells on dry ice until ready to thaw. 8.6.40 If Applicable: Obtained additional Feeder Cells. Recorded feeder cell information. 8.6.41 If Applicable: Thawed Additional Feeder Cells. Placed the 4th Feeder Cell bag into a zip top bag and thaw in a 37.0?2.0? C. water bath or cytotherm for ?3-5 minutes or until ice has just disappeared. Recorded thaw time. 8.6.42 If applicable: Pooled additional feeder cells. In the BSC, pulled 10 mL of air into a new 100 mL syringe. Used this to replace the syringe on the harness. 8.6.43 If applicable: Pooled additional feeder cells Wiped the port of the feeder cell bag with an alcohol pad prior to removing the cover. Spiked the feeder cell bag using one of the remaining spikes of the harness prepared in Step 8.6.7 NOTE: Maintained constant pressure while turning the spike in one direction. Ensured to not puncture the side of the port. 8.6.44 If applicable: Pooled additional feeder cells. Opened the stopcock so that the line from the feeder cell bag was open and the line to the needless injection port was closed. 8.6.45 If applicable: Pooled additional feeder cells. Drew up the contents of the feeder cell bag into the syringe. Recorded volume. 8.6.46 If Applicable: Measured Volume. Measured the volume of the feeder cells in the syringe and recorded below (B). Calculated the new total volume of feeder cells.
(1178) TABLE-US-00082 Feeder Cell Feeder Cell Total Feeder Cell Volume from Volume from C = A + B Step 8.6.37C Step 8.6.45 Volume A. mL B. mL C. mL 8.6.47 If Applicable: Added Feeder Cells to Transfer Pack. Turned the stopcock so the line to the feeder cell bag was closed and the line to the Feeder Cell Suspension transfer pack was open. Ensured the line to the transfer pack was unclamped. Dispensed the feeder cells from the syringe into the Feeder Cell Suspension transfer pack. Clamped the line to the transfer pack and left the syringe attached to the harness. 8.6.48 If Applicable: Added Feeder Cells to Transfer Pack. Massaged bag to mix the pooled feeder cells in the Feeder Cell Suspension transfer pack. 8.6.49 If Applicable: Prepared dilutions. In the BSC, add 4.5 mL of AIM-V Media that has been labelled with For Cell Count Dilutions and lot number to four 15 mL conical tubes. Label the tubes with the lot number and tube number (1-4). Labeled 4 cryovials Additional Feeder and vial number (1-4). 8.6.50 If Applicable: Prepared cell counts. Using a separate 3 mL syringe for each sample, removed 4?1.0 mL cell count samples from Feeder Cell Suspension transfer pack, using the needless injection port. Aliquoted each sample into cryovials labeled in Step 8.6.49. NOTE: Wiped the needless injection port with a sterile alcohol pad and mix Feeder Cell Suspension between each sampling for cell counts. 8.6.51 If Applicable: Performed Cell Counts. Performed cell counts and calculations utilizing NC-200 and Process Note 5.14. Diluted cell count samples by adding 0.5 mL of cell suspension into 4.5 mL of AIM-V media labelled with the lot number and For Cell Count Dilutions. This will give a 1:10 dilution. Adjusted if necessary. 8.6.52 If Applicable: Recorded Cell Count sample volumes. 8.6.53 If Applicable: Determined Multiplication Factor
(1179) TABLE-US-00083 Parameter Formula Result Total cell count 8.6.52A + 8.6.52B C. ?L sample Volume Multiplication C ? 8.6.52A D. 8.6.54 If Applicable: Selected protocols and entered multiplication factors. Ensured the Viable Cell Count Assay protocol had been selected, all multiplication factors, and sample and diluent volumes had been entered. 8.6.55 If Applicable: Recorded File Name, Viability and Cell Counts from Nucleoview. 8.6.56 If Applicable: Determine the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1180) TABLE-US-00084 Parameter Formula Result Viability (8.6.55A + 8.6.55B) ? 2 E. % Viable Cell (8.6.55C + 8.6.55D) ? 2 F. cells/mL Concentration 8.6.57 If Applicable: Determine Upper and Lower Limit for counts.
(1181) TABLE-US-00085 Parameter Formula Result Lower Limit 8.6.56F ? 0.9 G. cells/mL Upper Limit 8.6.56F ? 1.1 H. cells/mL Are both counts within acceptable limits? NOTE: If either result is No perform second set of counts in Steps 8.5.59-8.5.65 8.6.59 If Applicable: Performed cell counts. Performed cell counts and calculations in utilizing NC-200 and Process Note 5.14. NOTE: Dilution could be adjusted according based off the expected concentration of cells. 8.6.60 If Applicable: Recorded Cell Count sample volumes. NOTE: If no dilution was needed, entered Sample [?L]=200, Dilution [?L]=0 8.6.61 If Applicable: Determined Multiplication Factor.
(1182) TABLE-US-00086 Parameter Formula Result Total cell count 8.6.60A + 8.6.60B C. ?L sample Volume Multiplication C ? 8.6.60A D. Factor 8.6.62 If Applicable: Select protocols and enter multiplication factors. Ensured the Viable Cell Count Assay protocol has been selected, all multiplication factors, and sample and diluent volumes had been entered. NOTE: If no dilution was needed, entered Sample [?L]=200, Dilution [?L]=0 8.6.63 If Applicable: Recorded Cell Counts from Nucleoview. 8.6.64 If Applicable: Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1183) TABLE-US-00087 Parameter Formula Result Viability (8.6.63A + 8.6.63B) ? 2 E. % Viable Cell (8.6.63C + 8.6.63D) ? 2 F. cells/mL Concentration 8.6.65 If Applicable: Determined Upper and Lower Limit for counts
(1184) TABLE-US-00088 Parameter Formula Result Lower Limit 8.6.64F ? 0.9 G. cells/mL Upper Limit 8.6.64F ? 1.1 H. cells/mL 8.6.66 If Applicable: Were counts within acceptable limits?
(1185) TABLE-US-00089 Parameter Formula Result (Yes/No) Lower Limit 8.6.63 C and D ? 8.6.65G Upper Limit 8.6.63 C and D ? 8.6.65H NOTE: If either result was No, continue to Step 8.6.67 to find a total Average Viable Cell Concentration and proceeded with calculations. 8.6.67 If Applicable: Determined an average Viable Cell Concentration from all four counts performed. 8.6.68 If Applicable: Adjusted Volume of Feeder Cell Suspension. Calculated the adjusted volume of Feeder Cell suspension after removal of cell count samples. Total Feeder Cell Volume from Step 8.6.46C minutes 4.0 mL removed. 8.6.69 If Applicable: Calculated Total Viable Feeder Cells.
(1186) TABLE-US-00090 Parameter Formula Result Average Viable Cell 8.6.56 F* A. cells/mL Concentraion* -or- 8.6.64 F* -or- 8.6.67 E* Total Volume 8.6.68 C B. mL Total Viable Cells A ? B C. cells *Circled step reference used to determine Viable Cell Concentration. 8.6.70 Calculated Volume of Feeder Cells. Calculated the volume of Feeder Cell Suspension that was required to obtain 5?10.sup.9 viable feeder cells.
(1187) TABLE-US-00091 Viable Cell Volume of Feeder Concentration from Cells = 5 ? 10.sup.9 Step 8.6.38A* viable cells Number of Feeder or C = A ? B Cells Required Step 8.6.69A* A. 5 ? 10% Viable Cells B. cells/mL C. mL *Circle applicable step 8.6.71 Calculated excess feeder cell volume. Calculated the volume of excess feeder cells to remove. Round down to nearest whole number.
(1188) TABLE-US-00092 Total Volume of Feeder Cells in Transfer Pack from Volume of Excess Step 8.6.46C* Volume of Feeder Cells = Feeder Cells to or 5 ? 10.sup.9 viable cells from Step remove, viable cells Step 8.6.68C* 8.6.70C C = A ? B A. mL B. mL C.mL *Circle applicable step 8.6.72 Removed excess feeder cells. In a new 100 mL syringe, pulled up 10 mL of air and attached the syringe to the harness. 8.6.73 Removed excess feeder cells. Opened the line to the Feeder Cell Suspension transfer pack. Using the syringe drew up the volume of feeder cells calculated in Step 8.6.71C plus an additional 10.0 mL from the Transfer Pack into a 100 mL syringe. Closed the line to the Feeder Cell Suspension transfer pack once the volume of feeder cells is removed. Did not remove final syringe. NOTE: Once a syringe has been filled, replaced it with a new syringe. Multiple syringes could be used to remove total volume. With each new syringe, pulled in 10 mL of air. 8.6.74 Recorded volume. Recorded the total volume (including the additional 10 mL) of feeder cells removed. 8.6.75 Added OKT3. In the BSC, using a 1.0 mL syringe and 16G needle, drew up 0.15 mL of OKT3. 8.6.76 Added OKT3. Aseptically removed the needle from the syringe and attach the syringe to the needless injection port. Injected the OKT3. 8.6.77 Added OKT3. Opened the stopcock to the Feeder Cell Suspension transfer pack and added 10 mL of feeder cells removed in Step 8.6.73 to flush OKT3 through the line. 8.6.78 Added OKT3. Turned the syringe upside down and push air through to clear the line to the Feeder Cell Suspension transfer pack. 8.6.79 Added OKT3. Left the remaining feeder cell suspension in the syringe. Closed all clamps and remove the harness from the BSC. 8.6.80 Heat Sealed. Heat sealed (per Process Note 5.12) the Feeder Cell Suspension transfer pack, leaving enough tubing to weld. Discarded the harness. 8.6.81 Review Section 8.6
(1189) 8.7 Day 11 G-Rex Fill and Seed 8.7.1 Set up G-Rex500MCS. Outside the BSC, removed a G-Rex500MCS from packaging and inspected the flask for any cracks or kinks in the tubing. Ensured all luer connections and closures were tight. Closed all clamps on the G-Rex500MCS lines except for the vent filter line. Using a marker drew a line at the 4.5 L gradation. 8.7.2 Removed media from incubator. Removed the Complete CM2 Day 11 Media, prepared in Step 8.4.35, from the incubator. 8.7.3 Prepared to pump media. Welded (per Process Note 5.11) the red line of the G-Rex500MCS to the repeater pump transfer set attached to the complete CM2 Day 11 Media. 8.7.4 Prepare to pump media. Hung the Complete CM2 Day 11 Media bag on an IV pole. Fed the pump tubing through the Baxa pump. 8.7.5 Pumped media into G-Rex500MCS. Set the Baxa pump to High and 9. Pumped 4.5 L of media into the G-Rex500MCS, filling to the line marked on the flask in Step 8.7.1. 8.7.6 Heat sealed. Heat sealed the red line (per Process Note 5.12) of the G-Rex500MCS near the weld created in Step 8.7.3. 8.7.7 Labeled Flask. Labeled the flask with the Attach a sample Day 11 QA provided in-process Day 11 label. 8.7.8 If applicable: Incubated flask. Held flask in incubator while waiting to seed with TIL. 8.7.9 Welded the Feeder Cell: Suspension transfer pack to the flask Sterile welded (per Process Note 5.11) the red line of the G-Rex500MCS to the Feeder Cell Suspension transfer pack. 8.7.10 Added Feeder Cells to G-Rex500MCS. Opened all clamps between Feeder Cell Suspension and G-Rex500MCS and added Feeder Cell Suspension to flask by gravity feed. Ensured the line has been completely cleared. 8.7.11 Heat sealed. Heat sealed (per Process Note 5.12) the red line near the weld created in Step 8.7.9. 8.7.12 Welded the TIL Suspension transfer pack to the flask. Sterile weld (per Process Note 5.11) the red line of the G-Rex500MCS to the TIL Suspension transfer pack. 8.7.13 Added TIL to G-Rex500MCS. Opened all clamps between TIL Suspension and G-Rex500MCS and added TIL Suspension to flask by gravity feed. Ensured the line has been completely cleared. 8.7.14 Heat sealed. Heat sealed (per process note 5.12) the red line near the weld created in Step 8.7.12 to remove the TIL suspension bag. 8.7.15 Incubated G-Rex500MCS. Checked that all clamps on the G-Rex500MCS were closed except the large filter line and place in the incubator. Incubator parameters: Temperature LED Display: 37.0?2.0? C., CO2 Percentage: 5.0?1.5% CO2. 8.7.16 Calculated incubation window. Performed calculations to determine the proper time to remove G-Rex500MCS from incubator on Day 16. Time of incubation (Step 8.7.15). Lower limit: Time of incubation+108 hours. Upper limit: Time of incubation+132 hours. 8.7.17 Environmental Monitoring. After processing, verified BSC and personnel monitoring had been performed. 8.7.18 Submit Samples. Submit samples to Login. 8.7.19 Review Section 8.7
(1190) 8.8 Day 11 Excess TIL Cryopreservation 8.8.1 If Applicable: Froze Excess TIL Vials. Verified the CRF has been set up prior to freeze. Perform Cryopreservation. 8.8.2 If Applicable: Started CRF. Recorded the total number of vials placed into the CRF (not including blank). Verify number of vials transferred into the CRF matches total number of vials prepared in Step 8.5.72 or Step 8.5.84 Step 8.5.72C or Step 8.5.84 8.8.3 If applicable: Initiated automated portion of the freezing profile. Recorded START TIME for the initiation of the automated portion of the freezing profile. 8.8.4 If Applicable: Transferred vials from Controlled Rate Freezer to the appropriate storage. Upon completion of freeze, transfer vials from CRF to the appropriate storage container. 8.8.5 If applicable: Transferred vials to appropriate storage. Recorded storage location in LN2. 8.8.6 Review Section 8.8
(1191) 8.9 Day 16 Media Preparation 8.9.1 Pre-warmed AIM-V Media. Removed three CTS AIM V 10 L media bags from 2-8? C. at least 12 hours prior to use and place at room temperature protected from light. Verify each bag is within expiry. Labeled each bag with Bag Number (1-3), lot number, date, and warming start time HHMM. Record warming start time and date. 8.9.2 Calculated time Media from step 8.9.1 was warmed. Calculated the warming time of media bags 1, 2, and 3 from step 8.9.1. Ensured all bags have been warmed for a duration between 12 and 24 hours. 8.9.3 Checked room sanitization, line clearance, and materials. Confirmed room sanitization, line clearance, and materials. 8.9.4 Ensured completion of pre-processing table. 8.9.5 Environmental Monitoring. Prior to processing, ensured pre-process environmental monitoring had been initiated. 8.9.6 Setup 10 L Labtainer for Supernatant. In the BSC attached the larger diameter end of a fluid pump transfer set to one of the female ports of a 10 L Labtainer bag using the Luer connectors. 8.9.7 Setup 10 L Labtainer for Supernatant Label as Supernatant and Lot number. 8.9.8 Setup 10 L Labtainer for Supernatant Ensure all clamps were closed prior to removing from the BSC. NOTE: Supernatant bag was used during TIL Harvest (Section 8.10), which may be performed concurrently with media preparation. 8.9.9 Thawed IL-2. Thawed 5?1.1 mL aliquots of IL-2 (6?10.sup.6 IU/mL) (BR71424) per bag of CTS AIM V media until all ice had melted. Recorded IL-2 Lot number and Expiry. Attahed IL-2 labels. 8.9.10 Aliquoted GlutaMax. In BSC, aliquoted 100.0 mL of Glutamax into an appropriately sized receiver. Recorded the volume added to each reciever NOTE: Initially prepared one bag of AIM-V media following Step 8.9.10-Step 8.9.28. Additional bags required were determined in Step 8.10.59. 8.9.11 Labeled receivers. Labeled each receiver as GlutaMax. 8.9.12 Added IL-2 to GlutaMax. Using a micropipette, added 5.0 mL of IL-2 to each GlutaMax receiver. Ensured to rinse the tip per process note 5.18 and used a new pipette tip for each mL added. Recorded volume added to each Glutamax receiver below. 8.9.13 Labeled receivers. Labeled each receiver as GlutaMax+IL-2 and receiver number. 8.9.14 Prepared CTS AIM V media bag for formulation. Ensured CTS AIM V 10 L media bag (W3012717) was warmed at room temperature and protected from light for 12-24 hours prior to use. Recorded end incubation time in Step 8.9.2. 8.9.15 Prepared CTS AIM V media bag for formulation. In the BSC, closed clamp on a 4 plasma transfer set, then connected to the bag using the spike ports. NOTE: Maintained constant pressure while turning the spike in one direction. Ensured to not puncture the side of the port. 8.9.16 Prepared CTS AIM V media bag for formulation. Connected the larger diameter end of a repeater pump fluid transfer set to the 4 plasma transfer set via luer. 8.9.17 Stage Baxa Pump. Stage Baxa pump next to BSC. Removed pump tubing section of repeater pump fluid transfer set from BSC and installed in repeater pump. 8.9.18 Prepared to formulate media. In BSC, removed syringe from Pumpmatic Liquid-Dispensing System (PLDS) and discarded. NOTE: Ensured to not compromise the sterility of the PLDS pipette. 8.9.19 Prepared to formulate media. Connected PLDS pipette to smaller diameter end of repeater pump fluid transfer set via luer connection and placed pipette tip in GlutaMax+IL-2 prepared in Step 8.9.13 for aspiration Open all clamps between receiver and 10 L bag. 8.9.20 Pumped GlutaMax+IL-2 into bag. Set the pump speed to Medium and 3 and pump all GlutaMax+IL-2 into 10 L CTS AIM V media bag. Once no solution remains, clear line and stop pump. Recorded the volume of GlutaMax containing IL-2 added to each Aim V bag below. Recorded/ 8.9.21 Removed PLDS. Ensured all clamps were closed, and removed the PLDS pipette from the repeater pump fluid transfer set. Removed repeater pump fluid transfer set and red cap the 4 plasma transfer set. 8.9.22 Labeled Bags. Labeled each bag of Complete CM4 Day 16 media prepared. 8.9.23 Removee Media Retain per Sample Plan. Using a 30 mL syringe, removed 20.0 mL of Complete CM4 Day 16 media by attaching syringe to the 4 plasma transfer set and dispensed sample into a 50 mL conical tube. NOTE: Only removed the Media Retain Sample from the first bag of media prepared. NOTE: Ensure 4 plasma transfer set was either clamped or red capped after removal of syringe. 8.9.24 Attached new repeater pump fluid transfer set. Attached the larger diameter end of a new fluid pump transfer set onto the 4 plasma transfer set that was connected to the Complete CM4 Day 16 media bag. 8.9.25 Labeled and stored sample. Labeled with sample plan inventory label and stored media retain sample at 2-8? C. until submitted to Login for testing per Sample Plan. 8.9.26 Signed for Sampling. Ensured that LIMS sample plan sheet was completed for removal of the sample. 8.9.27 Monitor Incubator. Monitored Incubator. If applicable, per Step 8.9.10, monitor for additional bags prepared. Incubator parameters: Temperature LED Display: 37.0?2.0? C., CO2 Percentage: 5.0?1.5% CO2. 8.9.28 Warmed Complete CM4 Day 16 Media. Warmed the first bag of Complete CM4 Day 16 Media in incubator for ?30 minutes until ready for use. If applicable, per Step 8.10.59, warmed additional bags. 8.9.29 Prepared Dilutions. In the BSC, added 4.5 mL of AIM-V Media that had been labelled with Batch record Lot Number and For Cell Count Dilutions to each 4?15 mL conical tube. Labeled the conical tubes with the lot number and tube number (1-4). Labeled 4 cryovials with vial number (1-4). Kept vials under BSC to be used in Step 8.10.31. 8.9.30 Reviewed Section 8.9
(1192) 8.10 Day 16 REP Spilt 8.10.1 Pre-processing table. 8.10.2 Monitored Incubator. Monitored Incubator. Incubator parameters: Temperature LED Display: 37.0?2.0? C., CO2 Percentage: 5.0?1.5% CO2 8.10.3 Removed G-Rex500MCS from Incubator. Performed check below to ensure incubation parameters are met before removing G-Rex500MCS from incubator.
(1193) TABLE-US-00093 Lower limit from Upper limit from Time of is 8.7.16B < Time Step 8.7.16B Step 8.7.16C Removal of Removal from (DDMMMYY (DDMMMYY from incubator < Step HHMM) HHMM) incubator 8.7.16C (DDMMMYY Yes/No* HHMM) Removed G-Rex500MCS from the incubator. 8.10.4 Setup 1 L Transfer Pack. Heat sealed a 1 L transfer pack (W3006645) per Processed Note 5.12, leaving ?12 of line. 8.10.5 Prepared 1 L Transfer Pack. Labeled 1 L transfer pack as TIL Suspension. 8.10.6 Weighed 1 L Transfer Pack Place 1 L transfer pack, including the entire line, on a scale and record dry weight. 8.10.7 GatheRex Setup. Sterile welded (per Process Note 5.11) the red media removal line from the G-Rex500MCS to the repeater pump transfer set on the 10 L labtainer bag Supernatant prepared in Step 8.9.8. Sterile welded the clear cell removal line from the G-Rex500MCS to the TIL Suspension transfer pack prepared in Step 8.10.5. 8.10.8 GatheRex Setup. Placed G-Rex500MCS flask on the left side of the GatheRex. Placed the supernatant labtainer bag and TIL suspension transfer pack to the right side. 8.10.9 GatheRex Setup. Installed the red media removal line from the G-Rex500MCS to the top clamp (marked with a red line) and tubing guides on the GatheRex. Installed the clear harvest line from the G-Rex500MCS to the bottom clamp (marked with a blue line) and tubing guids on the GatheRex. 8.10.10 GatheRex Setup. Attached the gas line from the GatheRex to the sterile filter of the G-Rex500 MCS. NOTE: Before removing the supernatant from the G-Rex500MCS, ensured all clamps on the cell removal lines were closed. 8.10.11 Volume Reduction of G-Rex500MCS. Transferred ?4.5 L of culture supernatant from the G-Rex500MCS to the 10 L Labtainer per SOP-01777. Visually inspect G-Rex500MCS to ensure flask as level and media had been reduced to the end of the aspirating dip tube. NOTE: If the GatheRex stops prematurely, it could be restarted by pressing the button with the arrow pointing to the right again. 8.10.12 Prepared flask for TIL Harvest. After removal of the supernatant, closed all clamps to the red line. 8.10.13 Initiation of TIL Harvest. Recorded the start time of the TIL harvest. 8.10.14 Initiation of TIL Harvest. Vigorously tap flask and swirl media to release cells. Performed an inspection of the flask to ensure all cells have detached. NOTE: Contact area management if cells did not detach. 8.10.15 Initiation of TIL Harvest. Tilted the flask to ensure hose is at the edge of the flask. Note: If the cell collection straw is not at the junction of the wall and bottom membrane, rapping the flask while tilted at a 450 angle is usually sufficient to properly position the straw. 8.10.16 TIL Harvest. Released all clamps leading to the TIL suspension transfer pack. 8.10.17 TIL Harvest. Using the GatheRex transferred the cell suspension into the TIL Suspension transfer pack. NOTE: Be sure to maintain the tilted edge until all cells and media are collected. 8.10.18 TIL Harvest. Inspected membrane for adherent cells. 8.10.19 Rinsee flask membrane. Rinsee the bottom of the G-Rex500MCS. Cover ?? of gas exchange membrane with rinse media. 8.10.20 Closed clamps on G-Rex500MCS. Ensured all clam ps are closed on the G-Rex500MCS. 8.10.21 Heat sealed. Heat sealed (per Process Note 5.12) the Transfer Pack containing the TIL as close to the weld as possible so that the overall tubing length remained approximately the same. 8.10.22 Heat sealed. Heat sealed the 10 L Labtainer containing the supernatant (per Process Note 5.12) and passed into the BSC for sample collection in Step 8.10.25. 8.10.23 Calculated volume of TIL suspension. Recorded weight of Transfer Pack with cell suspension and calculate the volume suspension. 8.10.24 Prepared transfer pack for sample removal. Welded (per Process Note 5.11) a 4 Plasma Transfer Set, to the TIL Suspension transfer pack from Step 8.10.21, leaving the female luer end attached as close to the bag as possible. 8.10.25 Removed testing samples from cell supernatant. In the BSC, remove 10.0 mL of supernatant from 10 L labtainer using female luer port and appropriately sized syringe. Placed into a 15 mL conical tube and label as BacT Retain the tube for BacT sample in Step 8.10.28. 8.10.26 Removed testing samples from cell supernatant. Using a separate syringe, removed 10.0 mL of supernatant and placed into a 15 mL conical tube. Retained the tube for mycoplasma sample for use in Step 8.10.32. Labeled tube as Mycoplasma diluent 8.10.27 Closed supernatant bag. Placed a red cap on the luer port to close the bag, and pass out of BSC. 8.10.28 Sterility & BacT Testing Sampling. In the BSC, removed a 1.0 mL sample from the 15 mL conical labeled BacT prepared in Step 8.10.25 using an appropriately sized syringe and inoculate the anaerobic bottle. Repeat the above for the aerobic bottle. NOTE: This step may be performed out of sequence. 8.10.29 Labeled and store samples. Labeled with sample plan inventory label and store BacT sample at room temperature, protected from light, until submitted to Login for testing per Sample Plan. NOTE: Did not cover barcode on bottle with label. 8.10.30 Signed for Sampling. Ensured that LIMS sample plan sheet is completed for removal of the sample. 8.10.31 Removed Cell Count Samples. In the BSC, using separate 3 mL syringes for each sample, removed 4?1.0 mL cell count samples from TIL Suspension transfer pack using the luer connection. Placed samples in cryovials prepared in Step 8.9.29. 8.10.32 Removed Mycoplasma Samples. Using a 3 mL syringe, removed 1.0 mL from TIL Suspension transfer pack and place into 15 mL conical labeled Mycoplasma diluent prepared in Step 8.10.26. 8.10.33 Label and store sample. Labeled with sample plan inventory label and stored Mycoplasma sample at 2-8? C. until submitted to Login for testing per Sample Plan. 8.10.34 Signed for Sampling. Ensured that LIMS sample plan sheet was completed for removal of the sample. 8.10.35 Prepared Transfer Pack for Seeding. In the BSC, attached the large diameter tubing end of a Repeater Pump Fluid Transfer Set set to the Luer adapter on the transfer pack containing the TIL. Clamped the line close to the transfer pack using a hemostat. Placed a red cap onto the end of the transfer set. 8.10.36 Placed TIL in Incubator. Removed cell suspension from the BSC and place in incubator until needed. Recorded time. 8.10.37 Performed Cell Counts. Performed cell counts and calculations utilizing NC-200 and Process Note 5.14. Diluted cell count samples initially by adding 0.5 mL of cell suspension into 4.5 mL of AIM-V media prepared in Step 8.9.29. This gave a 1:10 dilution. 8.10.38 Recorded Cell Count sample volumes 8.10.39 Determined Multiplication Factor.
(1194) TABLE-US-00094 Parameter Formula Result Total cell count 8.10.38A + 8.10.38B C. ?L sample Volume Multiplication C ? 8.10.38A D. Factor 8.10.40 Selected protocols and enter multiplication factors. Ensured the Viable Cell Count Assay protocol had been selected, all multiplication factors, and sample and diluent volumes had been entered. 8.10.41 Recorded File Name, Viability and Cell Counts from Nucleoview. 8.10.42 Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1195) TABLE-US-00095 Parameter Formula Result Viability (8.10.41A + 8.10.41B) 2 E. % Viable Cell (8.10.41C + 8.10.41D) 2 F. cells/mL Concentration 8.10.43 Determined Upper and Lower Limit for counts.
(1196) TABLE-US-00096 Parameter Formula Result Lower Limit 8.10.42F ? 0.9 G. cells/mL Upper Limit 8.10.42F ? 1.1 H. cells/mL 8.10.44 Were both counts within acceptable limits?
(1197) TABLE-US-00097 Parameter Formula Result (Yes/No) Lower Limit 8.10.41C and D ? 8.10.43G Upper Limit 8.10.41 C and D ? 8.10.43H 8.10.45 If Applicable: Performed cell counts. Performed cell counts and calculations in utilizing NC-200 and Process Note 5.14. NOTE: Dilution may be adjusted according based off the expected concentration of cells. 8.10.46 If Applicable: Recorded Cell Count sample volumes. NOTE: If no dilution was needed, enter Sample [?L]=200, Dilution [?L]=0 8.10.47 If Applicable: Determined Multiplication Factor.
(1198) TABLE-US-00098 Parameter Formula Result Total cell count 8.10.46A + 8.10.46B C.mL sample Volume Multiplication C ? 8.10.46A D. Factor 8.10.48 If Applicable: Select protocols and enter multiplication factors. Ensure the Viable Cell Count Assay protocol has been selected, all multiplication factors, and sample and diluent volumes have been entered. NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0 8.10.49 If Applicable: Recorded Cell Counts from Nucleoview 8.10.50 If Applicable: Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1199) TABLE-US-00099 Parameter Formula Result Viability (8.10.49A ? 8.10.49B) ? 2 E. % Viable Cell (8.10.49C ? 8.10.49D) ? 2 F. cells/mL Concentration 8.10.51 If Applicable: Determined Upper and Lower Limit for counts.
(1200) TABLE-US-00100 Parameter Formula Result Lower Limit 8.10.50F ? 0.9 G. cells/mL Upper Limit 8.10.50F ? 1.1 H. cells/mL 8.10.52 If Applicable: Were counts within acceptable limits?
(1201) TABLE-US-00101 Parameter Formula Result (Yes/No) Lower Limit 8.10.49 C and D ? 8.10.51G Upper Limit 8.10.49 C and D ? 8.10.51H NOTE: If either result is No continue to Step 8.10.53 to determine an average of all cell counts collected. 8.10.53 If Applicable: Determined an average Viable Cell Concentration from all four counts performed. 8.10.54 Adjusted Volume of TIL Suspension. Calculated the adjusted volume of TIL suspension after removal of cell count samples. Total TIL Cell Volume from Step 8.10.23C minus 5.0 mL removed for testing. 8.10.55 Calculated Total Viable TIL Cells.
(1202) TABLE-US-00102 Parameter Formula Result Average Viable Cell 8.10.42 F* A. cells/mL Concentraion* -or- 8.10.50 F* -or- 8.10.53E* Total Volume 8.10.54 C B. Total Viable Cells A ? B C. cells 8.10.56 Calculated flasks for subculture. Calculated the total number of flasks to seed. NOTE: Rounded the number of G-Rex500MCS flasks to see up to the neared whole number.
(1203) TABLE-US-00103 Number Total Viable Cell Count Target of G-Rex500MCS from Step 8.10.55C Cells Required per Flask Flasks to Seed A B C = A ? B cells 1.0 ? 10.sup.9 cells/flask flasks NOTE: The maximum number of G-Rex500MCS flasks to seed was five. If the calculated number of flasks to seed exceeded five, only five were seeded USING THE ENTIRE VOLUME OF CELL SUSPENSION AVAILABLE 8.10.57 Calculate number of flasks for subculture
(1204) TABLE-US-00104 Criteria Yes/No Number of G-Rex500MCS Flasks to Seed Step 8.10.56C ? 5 If yes, seed number of flasks calculated in Step 8.10.58. Number of G-Rex500MCS Flasks to Seed Step 8.10.56C > 5 If yes, seed 5 flasks with ALL available cells. 8.10.58 QA Review of Cell Count calculations performed in steps 8.10.38-8.10.57. 8.10.59 Determined number of additional media bags needed. Calculated the number of media bags required in addition to the bag prepared in Step 8.9.28.
(1205) TABLE-US-00105 Number of G-Rex500MCS Number of Number of Bags Number of Flasks to Seed Media Bag Prepared in Additional Bags (Step 8.10.56C) Required Step 8.9.22 to Prepare A B = A ? 2* C D = B ? C 1 *Round the number of media bags required up to the next whole number. 8.10.60 If Applicable: Prepared additional media. Prepared one 10 L bag of CM4 Day 16 Media for every two G-Rex-500M flask needed calculated in Step 8.10.59D. Proceeded to Step 8.10.62 and seeded the first GREX-500M flask(s) while additional media is prepared and warmed. 8.10.61 If Applicable: Prepared additional media bags. Prepared and warmed the calculated number of additional media bags determined in Step 8.10.59D, repeating Step 8.9.10Step 8.9.28. 8.10.62 Filled G-Rex500MCS. Opened a G-Rex500MCS on the benchtop and inspected for cracks in the vessel or kinks in the tubing. Ensured all luer connections and closures were tight. Made a mark at the 4500 mL line on the outside of the flask with a marker. Closed all clamps on the G-Rex500MCS except the large filter line. 8.10.63 Filled G-Rex500MCS. Sterile welded (per Process Note 5.11) the red media line of a G-Rex500MCS to the fluid transfer set on the media bag prepared in Step 8.9.28. 8.10.64 Prepared to pump media. Hung CM4 Day 16 Media on an IV pole. Fed the pump tubing through the Baxa pump. 8.10.65 Pump media into G-Rex500MCS. Set the Baxa pump on High and 9 and pump 4500 mL of media into the flask. Pumped 4.5 L of CM4 Day 16 Media into the G-Rex500MCS, filling to the line marked on the flask in Step 8.10.62. Once 4.5 L of media had been transferred, stopped the pump. 8.10.66 Heat Sealed. Heat sealed (per Process Note 5.12) the red media line of G-Rex500MCS, near the weld created in Step 8.10.63, removing the media bag. 8.10.67 Repeated Fill. Repeat Steps 8.10.62-8.10.66 for each flask calculated in Step 8.10.56C as media is warmed and prepared for use. NOTE: Multiple flasks may be filled at the same time using gravity fill or multiple pumps. NOTE: Fill only two flasks per bag of media. 8.10.68 Recorded and labelled flask(s) filled. Labeled each flask alphabetically as it is filled and with QA provided in-process Day 16 labels. 8.10.69 Sample Labeled. Attached a sample Day 16 label below. 8.10.70 If applicable: Incubated flask. Held flask in incubator while waiting to seed with TIL. 8.10.71 Verified Number of Flasks Filled. Recorded the total number of flasks filled. 8.10.72 Calculated volume of cell suspension to add. Calculated the target volume of TIL suspension to add to the new G-Rex500MCS flasks.
(1206) TABLE-US-00106 Target Volume of cell Total Volume of TIL suspension to transfer suspension from Step Number of flask(s) filled to each flask 8.10.54C A from Step 8.10.71 C = A ? B mL mL 8.10.56C exceeds five only five will be seeded, USING THE ENTIRE VOLUME OF CELL SUSPENSION. 8.10.73 Prepared Flasks for Seeding. Removed G-Rex500MCS from Step 8.10.70 from the incubator. 8.10.74 Prepared for pumping. Closed all clamps on G-Rex500MCS except large filter line. Fed the pump tubing through the Baxa pump. 8.10.75 Removed TIL from incubator. Removed TIL Suspension transfer pack from the incubator and record incubation end time in Step 8.10.36. 8.10.76 Prepared cell suspension for seeding. Sterile welded (per Process Note 5.11) TIL Suspension transfer pack from Step 8.10.75 to pump inlet line. 8.10.77 Tared scale. Placed TIL suspension bag on a scale. Primed the line from the TIL suspension bag to the weld using the Baxa pump set to Low and 2. Tared the scale. 8.10.78 Seeded flask with TIL Suspension. Set Baxa pump to Medium and 5. Pump the volume of TIL suspension calculated in Step 8.10.72C into flask. Record the volume of TIL Suspention added to each flask. 8.10.79 Heat sealed. Heat sealed (per Process Note 5.12) the TIL Suspension transfer pack, leaving enough tubing to weld on the next flask. Used the line stripper to clear the residual TIL suspension in the G-Rex flask line into the vessel. 8.10.80 Filled remaining flasks. Between each flask seeded, ensured to mix TIL Suspension transfer pack and repeat Steps 8.10.76-8.10.79 to seed all remaining flaks. Filled flask(s) in alphabetical order. 8.10.81 Monitored Incubator. NOTE: If flasks must be split among two incubators, ensure to monitor both. Incubator parameters: Temperature LED Display: 37.0?2.0? C., CO2 Percentage: 5.0?1.5% CO2. 8.10.82 Incubated Flasks. Recorded the time each flask is placed in the incubator. 8.10.83 Calculated incubation window. Performed calculations below to determine the time range to remove G-Rex500MCS from incubator on Day 22.
(1207) TABLE-US-00107 Flask 8.10.83A 8.10.83B 8.10.83C Time of incubation Lower limit: Upper limit: (Step 8.10.82) Time of Time of (DDMMMYY incubation + 132 incubation + 156 HHMM) hours hours (DDMMMYY (DDMMMYY HHMM) HHMM) 8.10.84 Environmental Monitoring. After processing, verified BSC and personnel monitoring had been performed. 8.10.85 Sample Submission. Ensured all Day 16 Samples were submitted to Login. 8.10.86 Reviewed Section 8.10.
(1208) 8.11 Day 22 Wash Buffer Preparation 8.11.1 Checked room sanitization, line clearance, and materials. 8.11.2 Ensured completion of pre-processing checklist. 8.11.3 Environmental monitoring. Prior to processing, ensured pre-process environmental monitoring had been performed. 8.11.4 Prepared 10 L Labtainer Bag In BSC, attach a 4 plasma transfer set to a 10 L Labtainer Bag via luer connection. 8.11.5 Prepared 10 L Labtainer Bag Label as Supernatant, lot number, and initial/date. 8.11.6 Prepared 10 L Labtainer Bag. Closed all clamps before transferring out of the BSC. NOTE: Prepared one 10 L Labtainer Bag for every two G-Rex500MCS flasks to be harvested. NOTE: Supematant bag(s) were used in Section 8.12, which could be run concurrently with Section 8.11. 8.11.7 Welded fluid transfer set. Outside the BSC, closed all clamps on 4S-4M60. Welded (per Process Note 5.11) repeater fluid transfer set to one of the male luer ends of 4S-4M60. (See, for example,
(1209) TABLE-US-00108 Component Description Amount Needed Plasmalyte-A 3000.0 mL Human Albumin 25% 120.0 mL 4S-4M60 with Repeater 1 Apparatus Fluid Transfer Set Step 8.11.7 8.11.9 Pumped Plasmalyte into 3000 mL bag. Spiked three bags of Plasmalyte-A to the 4S-4M60 Connector set. NOTE: Wipe the port cover with an alcohol swab (W3009488) prior to removing. NOTE: Maintain constant pressure while turning the spike in one direction. Ensure to not puncture the side of the port. 8.11.10 Pumped Plasmalyte into 3000 mL bag. Connected an Origen 3000 mL collection bag via luer connection to the larger diameter end of the repeater pump transfer set. 8.11.11 Pumped Plasmalyte into 3000 mL bag. Closed clamps on the unused lines of the 3000 mL Origen Bag. 8.11.12 Pumped Plasmalyte into 3000 mL bag. Staged the Baxa pump next to the BSC. Fed the transfer set tubing through the Baxa pump situated outside of the BSC. Set pump to High and 9. 8.11.13 Pumped Plasmalyte into 3000 mL bag. Opened all clamps from the Plasmalyte-A to the 3000 mL Origen Bag. 8.11.14 Pump Plasmalyte into 3000 mL bag. Pumped all of the Plasmalyte-A into the 3000 mL Origen bag. Once all the Plasmalyte-A had been transferred, stopped the pump. 8.11.15 Pumped Plasmalyte into 3000 mL bag. If necessary, removed air from 3000 mL Origen bag by reversing the pump and manipulating the position of the bag. 8.11.16 Pumped Plasmalyte into 3000 mL bag. Closed all clamps. Remove the 3000 mL bag from the repeater pump fluid transfer set via luer connection and placed a red cap (W3012845) on the line to the bag. 8.11.17 Added Human Albumin 25% to 3000 mL Bag. Opened vented mini spike. Without compromising sterility of spike, ensured blue cap is securely fastened. 8.11.18 Added Human Albumin 25% to 3000 mL Bag. Spiked the septum of a Human Albumin 25% bottle with the vented mini spike. NOTE: Ensured to not compromise the sterility of the spike. 8.11.19 Added Human Albumin 25% to 3000 mL Bag. Repeated Step 8.11.17Step 8.11.18 two times for a total of three (3) spiked Human Albumin 25% bottles. 8.11.20 Added Human Albumin 25% to 3000 mL Bag. Removed the blue cap from one vented mini spike and attach a 60 mL syringe to the Human Serum Albumin 25% bottle. 8.11.21 Added Human Albumin 25% to 3000 mL Bag. Draw up 60 mL of Human Serum Albumin 25%. NOTE: It may be necessary to use more than one bottle of Human Serum Albumin 25%. If necessary, disconnect the syringe from the vented mini spike and connect it to the next vented mini spike in a Human Serum Albumin 25% bottle. Do not remove vented mini spike from the Human Serum Albumin 25% bottle. 8.11.22 Added Human Albumin 25% to 3000 mL Bag. Once 60 mL has been obtained, remove the syringe from the vented mini spike. 8.11.23 Added Human Albumin 25% to 3000 mL Bag. Attach syringe to needleless injection port on 3000 mL Origen bag filled with Plasmalyte-A in Step 8.11.16. Dispensed all of the Human Albumin 25%. NOTE: Wiped needless injection port with an alcohol pad before each use. 8.11.24 Added Human Albumin 25% to 3000 mL Bag. Repeated Step 8.11.20-Step 8.11.23 to obtain a final volumeof 120.0 mL of Human Albumin 25%. 8.11.25 Mixed Bag. Gently mixed the bag after all of the Human Albumin 25% had been added. 8.11.26 Labeled Bag. Labeled as LOVOWash Buffer and lot number, and assign a 24 hour expiry. 8.11.27 Prepared IL-2 Diluent. Using a 10 mL syringe, removed 5.0 mL of LOVO Wash Buffer using the needleless injection port on the LOVO Wash Buffer bag. Dispensed LOVO wash buffer into a 50 mL conical tube and label as IL-2 Diluent and the lot number. NOTE: Wiped the needless injection port with an alcohol pad before each use. 8.11.28 CRF Blank Bag LOVO Wash Buffer Aliquotted. Using a 100 mL syringe, drew up 70.0 mL of LOVO Wash Buffer from the needleless injection port. NOTE: Wiped the needless injection port with an alcohol pad before each use. 8.11.29 CRF Blank Bag LOVO Wash Buffer Aliquotted. Placed a red cap on the syringe and label as blank cryo bag and lot number. NOTE: Held the syringe at room temp until needed in Step 8.14.3 8.11.30 Completed Wash Buffer Prep. Closed all clamps on the LOVO Wash Buffer bag. 8.11.31 Thawed IL-2. Thawed one 1.1 mL of IL-2 (6?10.sup.6 IU/mL)), until all ice has melted. Record IL-2 Lot number and Expiry. NOTE: Ensured IL-2 label is attached. 8.11.32 IL-2 Preparation. Added 50 ?L IL-2 stock (6?10.sup.6 IU/mL) to the 50 mL conical tube labeled IL-2 Diluent. 8.11.33 IL-2 Preparation. Relabeled conical as IL-2 6?10.sup.4, the date, lot number, and 24 hour expiry. Cap and store at 2-8? C. 8.11.34 Cryopreservation Prep. Placed 5 cryo-cassettes at 2-8? C. to precondition them for final product cryopreservation. 8.11.35 Prepared Cell Count Dilutions. In the BSC, added 4.5 mL of AIM-V Media that has been labelled with lot number and For Cell Count Dilutions to 4 separate 15 mL conical tubes. Labeled the tubes with the batch record lot number and tube number (1-4). Set aside for use in Step 8.12.34 8.11.36 Prepared Cell Counts. Labeled 4 cryovials with vial number (1-4). Kept vials under BSC to be used in Step 8.12.33. 8.11.37 Reviewed Section 8.11
(1210) 8.12 Day 22 TIL Harvest 8.12.1 Monitor Incubator. Monitored the incubator. Incubator Parameters Temperature LED display: 37?2.0? C., CO2 Percentage: 5%+1.5%. NOTE: Section 8.12 could be run concurrently with Section 8.11. 8.12.2 Removed G-Rex500MCS Flasks from Incubator. Performed check below to ensure incubation parameters were met before removing G-Rex500MCS from incubator.
(1211) TABLE-US-00109 Flask Shelf Lower limit Upper limit Time of Is 8.10.83 B < from Step from Step Removal from Time of 8.10.83 B 8.10.83 C Incubator Removal from (DDMMMYY (DDMMMYY (DDMMMYY Incubator < HHMM) HHMM) HHMM) Step 8.10.83 C Yes/No* NOTE: This step must was performed as each flask is removed from the incubator. 8.12.3 Prepared TIL collection bag Labeled a 3000 mL collection bag as TIL Suspension, lot number, and initial/date. 8.12.4 Sealed off extra connections. Heat sealed off two leur connections on the collection bag near the end of each connection per Process Note 5.12. 8.12.5 GatheRex Setup. Sterile welded (per Process Note 5.11) the red media removal line from the G-Rex500MCS to the 10 L labtainer bag prepared in Step 8.11.5. NOTE: Referenced Process Note 5.16 for use of multiple GatheRex devices. 8.12.6 GatheRex Setup. Sterile welded (per Process Note 5.11) the clear cell removal line from the G-Rex500MCS to the TIL Suspension collection bag prepared in Step 8.12.3. NOTE: Reference Process Note 5.16 for use of multiple GatheRex devices. 8.12.7 GatheRex Setup. Placed the G-Rex500MCS flask on the left side of the GatheRex. Placed the supernatant Labtainer bag and pooled TIL suspension collection bag to the right side. 8.12.8 GatheRex Setup. Installed the red media removal line from the G-Rex500MCS to the top clamp (marked with a red line) and tubing guides on the GatheRex. Installed the clear harvest line from the G-Rex500MCS to the bottom clamp (marked with a blue line) and tubing guides on the GatheRex. 8.12.9 GatheRex Setup. Attached the gas line from the GatheRex to the sterile filter of the G-Rex500MCS. NOTE: Before removing the supernatant from the G-Rex500MCS, ensured all clamps on the cell removal lines were closed. 8.12.10 Volume Reduction. Transferred ?4.5 L of supernatant from the G-Rex500MCS to the Supernatant bag. Visually inspected G-Rex500MCS to ensure flask is level and media had been reduced to the end of the aspirating dip tube. Repeat step if needed. NOTE: If the GatheRex stopped prematurely, it may be restarted by pressing the button with the arrow pointing to the right again. 8.12.11 Prepared flask for TIL Harvest. After removal of the supernatant, closed all clamps to the red line. 8.12.12 Initiated collection of TIL. Recorded the start time of the TIL harvest. 8.12.13 Initiated collection of TIL. Vigorously tap flask and swirl media to release cells. Performed an inspection of the flask to ensure all cells have detached. Placed TIL Suspension 3000 mL collection bag on dry wipes on a flat surface. NOTE: Contacted area management if cells did not detach. 8.12.14 Initiated collection of TIL. Tilted the flask to ensure hose is at the edge of the flask. NOTE: If the cell collection hose was not at the junction of the wall and bottom membrane, rapping the flask while tilted at a 450 angle is usually sufficient to properly position the hose. 8.12.15 TIL Harvest. Released all clamps leading to the TIL suspension collection bag. 8.12.16 TIL Harvest. Using the GatheRex, transferred the TIL suspension into the 3000 mL collection bag. NOTE: Maintained the tilted edge until all cells and media were collected. 8.12.17 TIL Harvest. Inspect membrane for adherent cells. 8.12.18 Rinsed flask membrane. Rinsed the bottom of the G-Rex500MCS. Covered ?? of gas exchange membrane with rinse media. 8.12.19 Close dclamps on G-Rex500MCS. Ensure all clamps are closed. 8.12.20 Heat sealed. Heat seal (per Process Note 5.12) the collection bag containing the TIL as close to the weld as possible so that the overall tubing length remained approximately the same. 8.12.21 Heat Sealed. Heat sealed (per Process Note 5.12) the Supematant bag. 8.12.22 Completed harvest of remaining G-Rex 500 MCS flasks. Repeat Steps 8.12.2 and 8.12.5-8.12.21, pooling all TIL into the same collection bag. NOTE: IT WAS NECESSARY TO REPLACE THE 10 L UPERNATANT BAG AFTER EVERY 2ND FLASK. NOTE: Reference Process Note 5.16 for use of multiple GatheRex devices. 8.12.23 Prepared LOVO source bag. Obtained a new 3000 mL collection bag. Labeled as LOVO Source Bag, lot number, and Initial/Date. 8.12.24 Prepared LOVO source bag. Heat sealed (per Process Note 5.12) the tubing on the LOVO Source bag, removing the female luers, leaving enough line to weld. 8.12.25 Weighed LOVO Source Bag. Placed an appropriately sized plastic bin on the scale and tare. Place the LOVO Source Bag, including ports and lines, in the bin and record the dry weight 8.12.26 Transferred cell suspension into LOVO source bag. Closed all clamps of a 170 ?m gravity blood filter. 8.12.27 Transferred cell suspension into LOVO source bag. Sterile welded (per Process Note 5.11) the long terminal end of the gravity blood filter to the LOVO source bag. 8.12.28 Transferred cell suspension into LOVO source bag. Sterile welded (per Process Note 5.11) one of the two source lines of the filter to pooled TIL suspension collection bag. 8.12.29 Transferred cell suspension into LOVO source bag. Once weld was complete, heat sealed (per Process Note 5.12) the unused line on the filter to remove it. 8.12.30 Transferred cell suspension into LOVO source bag. Opened all necessary clamps and elevate the TIL suspension by hanging the collection bag on an IV pole to initiate gravity-flow transfer of TIL through the blood filter and into the LOVO source bag. Gently rotated or knead the TIL Suspension bag while draining in order to keep the TIL in even suspension. Note: Did not allow the LOVO source bag to hang from the filtration apparatus. Laid LOVO source bag on dry wipes on a flat surface. 8.12.31 Closed all clamps. Once all TIL were transferred to the LOVO source bag, closed all clamps. 8.12.32 Heat Sealed. Heat sealed (per Process Note 5.12) as close to weld as possible to remove gravity blood filter. 8.12.33 Removed Cell Counts Samples. In the BSC, using separate 3 mL syringes for each sample, removed 4?1.0 mL cell count samples from the LOVO source bag using the needless injection port. Placed samples in the cryovials prepared in Step 8.11.36. NOTE: Wiped needless injection port with an alcohol pad and mix LOVO source bag between each sample. 8.12.34 Performed Cell Counts. Performed cell counts and calculations utilizing NC-200 and Process Note 5.14. Diluted cell count samples initially by adding 0.5 mL of cell suspension into 4.5 mL of AIM-V media prepared in Step 8.11.35. This gave a 1:10 dilution. 8.12.35 Recorded Cell Count sample volumes. 8.12.36 Determined Multiplication Factor
(1212) TABLE-US-00110 Parameter Formula Result Total cell count 8.12.35A + 8.12.35B C. ?L sample Volume Multiplication C ? 8.12.35A D. Factor 8.12.37 Selected protocols and enter multiplication actors. Ensure the Viable Cell Count Assay protocol had been selected, all multiplication factors, and sample and diluent volumes had been entered. NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0 8.12.38 Record Cell Counts from Nucleoview 8.12.39 Determined the Average Viability, Viable Cell Concentration, and Total Nucleated Cell concentration of the cell counts performed.
(1213) TABLE-US-00111 Parameter Formula Result Viability (8.12.38A + 8.12.38B) ? 2 G. Viable Cell (8.12.38C + 8.12.38D) ? 2 H. cells/mL Concentration Total Nucleated Cell (8.12.38E + 8.12.38F) ? 2 I. cells/mL Concentration 8.12.40 Determined Upper and Lower Limit for counts
(1214) TABLE-US-00112 Parameter Formula Result Lower Limit 8.12.39H ? 0.9 J. cells/mL Upper Limit 8.12.39I ? 1.1 K. cells/mL 8.12.41 Were both counts within acceptable limits?
(1215) TABLE-US-00113 Parameter Formula Result (Yes/No) Lower Limit 8.12.38 C and D ? 8.12.40J Upper Limit 8.12.38 C and D ? 8.12.40K NOTE: If either result was No performed second set of counts in steps 8.12.42-8.12.49. NOTE: If either result was No performed second set of counts in steps 8.12.42-8.12.49. 8.12.42 If Applicable: Performed cell counts. Performed cell counts and calculations in utilizing NC-200 and Process Note 5.14. NOTE: Dilution may be adjusted according based off the expected concentration of cells. 8.12.43 If Applicable: Recorded Cell Count sample volumes 8.12.44 If Applicable: Determined Multiplication Factor
(1216) TABLE-US-00114 Parameter Formula Result Total cell count 8.12.43A + 8.12.43B C. ?L sample Volume Multiplication C ? 8.12.43A D. Factor 8.12.45 If Applicable: Selected protocols and enter multiplication factors. Ensure the Viable Cell Count Assay protocol had been selected, all multiplication factors, and sample and diluent volumes had been entered. NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0 8.12.46 If Applicable: Record Cell Counts from Nucleoview 8.12.47 If Applicable: Determine the Average Viability, Viable Cell Concentration, and Total Nucleated Cell concentration of the cell counts performed.
(1217) TABLE-US-00115 Parameter Formula Result Viability (8.12.46A + 8.12.46B) ? 2 G. Viable Cell (8.12.46C + 8.12.46D) ? 2 H. cells/mL Concentration Total Nucleated Cell (8.12.46E + 8.12.46F) ? 2 I. cells/mL Concentration 8.12.48 If Applicable: Determined Upper and Lower Limit for counts
(1218) TABLE-US-00116 Parameter Formula Result Lower Limit 8.12.47 H ? 0.9 J. cells/mL Upper Limit 8.12.47 H ? 1.1 K. cells/mL 8.12.49 If Applicable: Were counts within acceptable limits?
(1219) TABLE-US-00117 Parameter Formula Result (Yes/No) Lower Limit 8.12.46 C and D ? 8.12.48J Upper Limit 8.12.46 C and D ? 8.12.48K NOTE: If either result was No continue to Step 8.12.50 to determine an average 8.12.50 If Applicable: Determined an average Viable Cell Concentration and average Total Nucleated Cell Concentration from all four counts performed. 8.12.51 QA Review of Cell Counts. QA personnel review calculations performed in steps 8.12.38-8.12.50. 8.12.52 Weighed LOVO Source Bag. Placed an appropriately sized plastic bin on the scale and tare. Placed the full LOVO source bag in the bin and record the weight. Calculated the volume of cell suspension. 8.12.53 Calculate Total Viable TIL Cells.
(1220) TABLE-US-00118 Parameter Formula Result Average Viable Cell 8.12.39 H* -or- A. cells/mL Concentraion* 8.12.47 H* -or- 8.12.50 E* Total Volume 8.12.52 C B. mL Total Viable Cells A ? B C. cells Is C ? 1.5 ? 10.sup.9? Yes/No** *Circled step reference used to determine Viable Cell Concentration. **If Yes, proceeded. If No, contacted Area Management. 8.12.54 Calculate Total Nucleated Cells.
(1221) TABLE-US-00119 Parameter Formula Result Average Total 8.12.39 I* -or- A. cells/mL Nucleated Cell 8.12.47 I* -or- Concentraion* 8.12.50 J* Total Volume 8.5.52 C B. mL Total Nucleated A ? B C. cells Cells *Circled step reference used to determine Total Nucleated Cell Concentration. 8.12.55 Prepared Mycoplasma Diluent. In the BSC, removed 10.0 mL from one supernatant bag via luer sample port and placed in a 15 mL conical. Label 15 mL conical Mycoplasma Diluent and keep in the BSC for use in Step 8.14.69. 8.12.56 Review Section 8.12
(1222) 8.13 LOVO 8.13.1 Turned on the LOVO using the switch on the back left of the instrument. NOTE: Steps 8.13.1-8.13.13 may be performed concurrently with Sections 8.11-8.12. 8.13.2 Checked weigh scales and pressure sensor. 8.13.3 Made sure there was nothing hanging on any of the weigh scales and reviewed the reading for each scale. Recorded values in Step 8.13.5. Note: If any of the scales read outside of a range of 0+/?2 g, performed weigh scale calibration 8.13.4 If all scales were in tolerance with no weight hanging, proceeded to hang a 1-kg weight on each scale (#1-4) and reviewed the reading. Recorded Values in Step 8.13.5. 8.13.5 Scale Checked. Recorded the displayed values for each scale. If values were in range, continue processing. If values were not in range, perform Calibration. 8.13.6 Reviewed the pressure sensor reading on the Instrument Operation Profile Screen and recorded. The acceptable range for the pressure reading was 0+/?10 mmHg. If displayed value was out of this range, stored a new atmospheric pressure setting, per the machine instructions. 8.13.7 Repeated steps. If a new weigh scale calibration had been performed or a new atmospheric pressure setting had been stored, repeated Steps 8.13.3-8.13.6. 8.13.8 Started the TIL G-Rex Harvest protocol from the drop-down menu. 8.13.9 The Solution 1 Screen displayed: Buffer type read PlasmaLyte 8.13.10-8.13.16 Followed the LOVO touch screen prompts. 8.13.17 Determined the final product target volume. NOTE: Using the total nucleated cells (TNC) value from Step 8.12.54 C and the chart below, determined the final product target volume. Recorded the Final Product Volume (mL)
(1223) TABLE-US-00120 Final Product (Retentate) Volume to Cell Range Target (mL) 0 < Total (Viable + Dead) 165 Cells ? 7.1 ? 10.sup.10 7.1 ? 10.sup.10 < Total 215 (Viable + Dead) Cells ? 1.1 ? 10.sup.11 1.1 ? 10.sup.11 < Total 265 (Viable + Dead) Cells ? 1.5 ? 10.sup.11 Note: If TVC from Step 8.12.53 C was >1.5 ? 10.sup.11 contacted Area Management. 8.13.18-8.13.22 Followed the LOVO touch screen prompts. 8.13.23 Loaded disposable kit. Prior to loading the disposable kit, wipe pressure sensor port with an alcohol wipe followed followed by a lint-free wipe. Load the disposable kit. Follow screen directions on loading the disposable kit. 8.13.24 Removed filtrate bag. When the standard LOVO disposable kit had been loaded, touched the Next button. The Container Information and Location Screen displayed. Removed filtrate bag from scale 8.13.25 Ensured Filtrate container was New and Off-Scale 8.13.26 Entered Filtrate capacity. Sterile welded a LOVO Ancillary Bag onto the male luer line of the existing Filtrate Bag. Ensured all clamps are open and fluid path is clear. Touch the Filtrate Container Capacity entry field. A numeric keypad displatys. Enter the total new Filtrate capacity (5,000 mL). Touch the button to accept the entry. NOTE: Estimated Filtrate Volume should not exceed 5000 mL. 8.13.27 Placed Filtrate container on benchtop. NOTE: If tubing was removed from the F clamp during welding, placed the tubing back into the clamp. Placed the new Filtrate container on the benchtop. DID NOT hang the Filtrate bag on weigh scale #3. Weigh scale #3 will be empty during the procedure. 8.13.28 Followed the LOVO touch screen prompts after changes to the filtrate container. 8.13.29 Ensured kit was loaded properly. The Disposable Kit Dry Checks overlay displays. Checked that the kit was loaded properly and all clamps were open. Checked all tubing for kinks or other obstructions and correct if possible. Ensured kit was properly installed and check all Robert's clamps. Pressed the Yes button. All LOVO mechanical clamps closed automatically and the Checking Disposable Kit Installation screen displays. The LOVO went through a series of pressurizing steps to check the kit. 8.13.30 Kit Check Results. If the Kit check passed, proceeded to the next step. *If No, a second Kit Check could be performed after checks have been complete. *If No, Checked all tubing for kinks or other obstructions and correct *If No, Ensured kit was properly installed and check all Robert's clamps. If the 2nd kit check failed: Contact area management and prepare to installation of new kit in Section 10.0. Repeat Step 8.13.23-Step 8.13.30 needed. 8.13.31 Attached PlasmaLyte. The Connect Solutions screen displayed. The wash value would always be 3000 mL. Entered this value on screen. Sterile welded the 3000 mL bag of PlasmaLyte to the tubing passing through Clamp 1 per Process Note 5.11. Hung the PlasmaLyte bag on an IV pole placing both corner bag loops on the hook. 8.13.32 Verified that the PlasmaLyte was attached. Opened any plastic clamps. Verified that the Solution Volume entry was 3000 mL. Touched the Next button. The Disposable Kit Prime overlay displayed. Verified that the PlasmaLyte was attached and any welds and plastic clamps on the tubing leading to the PlasmaLyte bag were open, then touched the Yes button 8.13.33 Observed that the PlasmaLyte is moving. Disposable kit prime starts and the Priming Disposable Kit Screen displays. Visually observed that PlasmaLyte moving through the tubing connected to the bag of PlasmaLyte. If no fluid was moving, pressed the Pause Button on the screen and determined if a clamp or weld was still closed. Once the problem had been solved, pressed the Resume button on the screen to resume the Disposable Kit Prime. When disposable kit prime finished successfully, the Connect Source Screen displayed. 8.13.34-8.13.35 Followed the LOVO touch screen prompts. 8.13.36 Attached Source container to tubing. Sterile weld the LOVO Source Bag prepared in Step 8.12.31 to the tubing passing through Clamp S per Process Note 5.11. It could be necessary to remove the tubing from the clamp. Note: Made sure to replace source tubing into the S clamp if removed. 8.13.37 Hung Source container. Hung the Source container on the IV pole placing both corner bag loops on the hook. DID NOT hang the Source on weigh scale #1. Opened all clamps to the source bag. 8.13.38 Verified Source container was attached. Touched the Next button. The Source Prime overlay displayed. Verified that the Source wasattached to the disposable kit, and that any welds and plastic clamps on the tubing leading to the Source were open. Touched the Yes button. 8.13.39 Confirm PlasmaLyte was moving. Source prime started and the Priming Source Screen displayed. Visually observed that PlasmaLyte is moving through the tubing attached to the Source bag. If no fluid is moving, press the Pause Button on the screen and determine if a clamp or weld is still closed. Once the problem was solved, pressed the Resume button on the screen to resume the Source Prime. 8.13.40 Started Procedure Screen. When the Source prime finishes successfully, the Start Procedure Screen displays. Pressed Start, the Pre-Wash Cycle 1 pause screen appears immediately after pressing start. 8.13.41 Inverted In Process Bag. Removed the In Process Bag from weigh scale #2 (can also remove tubing from the In Process top port tubing guide) and manually invert it to allow the wash buffer added during the disposable kit prime step to coat all interior surfaces of the bag. Re-hang the In Process Bag on weigh scale #2 (label on the bag was facing to the left). Replace the top port tubing in the tubing guide, if it was removed. 8.13.42 Inverted Source bag. Before pressing the Start button, mixed the Source bag without removing it from the IV pole by massaging the bag corners and gently agitating the cells to create a homogeneous cell suspension. Pressed the Resume button. The LOVO started processing fluid from the Source bag and the Wash Cycle 1 Screen displays. 8.13.43 Source Rinse Pause. The Rinse Source Pause screen displayed once the source container is drained and the LOVO had added wash buffer to the Source bag. Without removing the Source bag from IV pole, massaged the corners and mixed well. Pressed Resume. 8.13.44 Mix In Process Bag Pause. To prepare cells for another pass through the spinner, the In Process Bag was diluted with wash buffer. After adding the wash buffer to the In Process Bag, the LOVO pauses automatically and displays the Mix In Process Bag Pause Screen. Without removing the bag from the weigh scale, mixed the product well by gently squeezing the bag. Press Resume. 8.13.45 Massage In Process Corners Pause. When the In Process Bag was empty, wash buffer was added to the bottom port of the In Process Bag to rinse the bag. After adding the rinse fluid, the LOVO paused automatically and displayed the Massage IP corners Pause Screen. When the Massage IP corners Pause Screen displayed, DO NOT remove the bag from weigh scale #2. With the In Process Bag still hanging on weigh scale #2, massage the corners of the bag to bring any residual cells into suspension. Ensured the bag was not swinging on the weigh scale and pressed the Resume button. 8.13.46 Wait for Remove Products Screen. At the end of the LOVO procedure, the Remove Products Screen screen displayed. When this Screen displays, all bags on the LOVO kit could be manipulated. Note: Did not touch any bags until the Remove Products displayed. 8.13.47 Removed retentate bag. Placed a hemostat on the tubing very close to the port on the Retentate bag to keep the cell suspension from settling into the tubing. Heat sealed (per Process Note 5.12) below the hemostat, making sure to maintain enough line to weld in Step 8.13.48. Removed the retentate bag. 8.13.48 Prepared retentate bag for formulation. Welded (per Process Note 5.11) the female luer lock end of a 4 Plasma Transfer Set to the retentate bag. Transfered the retentate bag to the BSC for use in Step 8.14.11. 8.13.49 Removed Products. Followed the instructions on the Remove Products Screen. Closed all clamps on the LOVO kit to prevent fluid movement. 8.13.50 Removed Products. Touched the Next button. All LOVO mechanical clamps opened and the Remove Kit Screen displayed. 8.13.51 Recorded Data. Followed the instructions on the Remove Kit screen. Touched the Next button. All LOVO mechanical clamps close and the Results Summary Screen displays. Recorded the data from the results summary screen in table exactly as they are displayed. Closed all pumps and filter support. Removed the kit when prompted to do so by the LOVO. NOTE: All Times recorded were recorded directly from the LOVO Results Summary Screen in HH:MM:SS format and (HH:MM:SS) format when applicable 8.13.52-8.13.54 Protocol Selection through LOVO shutdown. Follow the LOVO screen prompts. 8.13.55 Review Section 8.13
(1224) 8.14 Final Formulation and Fill 8.14.1 Target volume/bag calculation. From the table below, selected the number of CS750 bags to be filled, target fill volume per bag, volume removed for retain per bag, and final target volume per bag that corresponded to the Volume of LOVO Retentate from Step 8.13.22.
(1225) TABLE-US-00121 Final Volume Volume Predicted Number Target Volume Final of of CS10 Volume of of bags Fill removed Target LOVO to add to formulated to be Volume for retain Volume product product product filled per bag per bag per bag 165 mL 165 mL 330 mL 3 107 mL 7 mL 100 mL 215 mL 215 mL 430 mL 4 105 mL 5 mL 100 mL 265 mL 265 mL 530 mL 4 130 mL 5 mL 125 mL 8.14.2 Prepared CRF Blank. CalculateD volume of CS-10 and LOVO wash buffer to formulate blank bag.
(1226) TABLE-US-00122 Final Target Volume per Bag Blank LOVO Wash Blank CS-10 8.14.1E Buffer Volume Volume (mL) A B = A/2 C = B mL mL mL 8.14.3 Prepared CRF Blank. Outside of the BSC, using the syringe of LOVO Wash Buffer prepared in Step 8.11.29, added volume calculated in Step 8.14.2 B to an empty CS750 bag via luer connection. Note: Blank CS750 bag formulation does not need to be done aseptically. 8.14.4 Prepared CRF Blank Using an appropriately sized syringe, added the volume of CS-10 calculated in Step 8.14.2 to the same CS750 bag prepared in Step 8.14.3. Placed a red cap on the CS750 bag. 8.14.5 Prepared CRF Blank. Removed as much air as possible from the CS-750 bag as possible. Heat sealed (per Process Note 5.12) the CS750 bag as close to the bag as possible, removing the tubing. 8.14.6 Prepared CRF Blank.Label CS750 bag with CRF Blank, lot number, and initial/date. Placed the CRF Blank on cold packs until it was placed in the CRF. 8.14.7 Calculated required volume of IL-2. Calculated the volume of IL-2 to add to the Final Product
(1227) TABLE-US-00123 Parameter Formula Result Final Retentate Volume Step 8.13.51 A. mL Final Formulated Volume B = A ? 2 B. mL Final IL-2 Concentration 300 IU/mL C. 300 IU/mL desired (IU/mL) IU of IL-2 Required D = B ? C D. IU IL-2 Working Stock from 6 ? 10.sup.4 IU/mL E. 6 ? 10.sup.4 IU/mL Step 8.11.33 Volume of IL-2 to Add to F = D ? E F. mL Final Product 8.14.8 Assembled Connect apparatus. Sterile welded (per Process Note 5.11) a 4S-4M60 to a CC2 Cell Connect replacing a single spike of the Cell Connect apparatus (B) with the 4-spike end of the 4S-4M60 manifold at (G). (See, for example,
(1228) TABLE-US-00124 Item # or Step Item Reference Quantity 4 plasma transfer set 1 IL-2 (6.0 ? 10.sup.4) aliquot 8.11.33 1 Appropriate size syringe to add IL2 8.14.7F 1 LOVO retentate bag 8.13.48 1 Red Caps 5 8.14.12 Prepared TIL with IL-2. Using an appropriately sized syringe, removed amount of IL-2 determined in Step 8.14.7 from the IL-2 6?10.sup.4 aliquot. 8.14.13 Prepared TIL with IL-2. Connect the syringe to the retentate bag prepared in Step 8.13.48 via the Luer connection and inject IL-2. 8.14.14 Prepare TIL with IL-2Clear the line by pushing air from the syringe through the line. 8.14.15 Labeled Formulated TIL Bag. Closed the clamp on the transfer set and label bag as Formulated TIL and passed the bag out of the BSC. 8.14.16 If applicable: Sample per sample plan. If there was remaining IL-2 6?10.sup.4 aliquot prepared in step 8.11.33, remove a ?5 mL sample retain according to the sample plan using an appropriately sized syringe and dispense into a 50 mL conical tube. 8.14.17 If applicable: Sampled per sample plan. Labeled with sample plan inventory label and stored at 2-8? C. until submitted to Login for testing per Sample Plan. 8.14.18 If applicable: Sampled per sample plan. Ensured that LIMS sample plan sheet was filled out for removal of the sample. 8.14.19 Added the Formulated TIL bag to the apparatus. Once IL-2 had been added, welded (per Process Note 5.11) the Formulated TIL bag to the remaining spike (A) on the apparatus prepared in Step 8.14.10. (See, for example,
(1229) TABLE-US-00125 Parameter Formula Result Total cell count 8.14.49A + 8.14.49B C. ?L sample Volume Multiplication C ? 8.14.49A D. Factor 8.14.51 Select protocols and enter multiplication actors. Ensure the Viable Cell Count Assay protocol has been selected, all multiplication factors, and sample and diluent volumes have been entered per SOP00314 NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0 8.14.52 Recorded File Name, Viability and Cell Counts from Nucleoview. 8.14.53 Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1230) TABLE-US-00126 Parameter Formula Result Viability (8.14.52A + 8.14.52B) ? 2 E. % Viable Cell (8.14.52C + 8.14.52D) ? 2 F. cells/mL Concentration 8.14.54 Determined Upper and Lower Limit for counts.
(1231) TABLE-US-00127 Parameter Formula Result Lower Limit 8.14.53F ? 0.9 G. cells/mL Upper Limit 8.14.53F ? 1.1 H. cells/mL 8.14.55 Were both counts within acceptable limits?
(1232) TABLE-US-00128 Parameter Formula Result (Yes/No) Lower Limit 8.14.52 C and D ? 8.14.54G Upper Limit 8.14.52 C and D ? 8.14.54H NOTE: If either result is No perform second set of counts in steps 8.14.56-8.14.63 8.14.56 If Applicable: Performed cell counts. Performed cell counts and calculations in utilizing NC-200 per SOP-00314 and Process Note 5.14. NOTE: Dilution may be adjusted according based off the expected concentration of cells. 8.14.57 If Applicable: Recorded Cell Count sample volumes. 8.14.58 If Applicable: Determined Multiplication Factor
(1233) TABLE-US-00129 Parameter Formula Result Total cell count 8.14.57A + 8.14.57B C. mL sample Volume Multiplication C ? 8.14.57A D. Factor 8.14.59 If Applicable: Selected protocols and entered multiplication factors. Ensured the Viable Cell Count Assay protocol had been selected, all multiplication factors, and sample and diluent volumes had been entered. NOTE: If no dilution needed, enter Sample [?L]=200, Dilution [?L]=0 8.14.60 If Applicable: Recorded Cell Counts from Nucleoview 8.14.61 If Applicable: Determined the Average of Viable Cell Concentration and Viability of the cell counts performed.
(1234) TABLE-US-00130 Parameter Formula Result Viability (8.14.60A + 8.14.60B) ? 2 E. % Viable Cell (8.14.60C + 8.14.60D) ? 2 F. cells/mL Concentration 8.14.62 If Applicable: Determined Upper and Lower Limit for counts.
(1235) TABLE-US-00131 Parameter Formula Result Lower Limit 8.14.61F ? 0.9 G. cells/mL Upper Limit 8.14.61F ? 1.1 H. cells/mL 8.14.63 If Applicable: Were counts within acceptable limits?
(1236) TABLE-US-00132 Parameter Formula Result (Yes/No) Lower Limit 8.14.60 C and D ? 8.14.62G Upper Limit 8.14.60 C and D ? 8.14.62H NOTE: If either result is No continue to Step 8.14.64 to determine an average. 8.14.64 If Applicable: Determined an average Viable Cell Concentration from all four counts performed. 8.14.65 Calculated Flow. Cytometry Sample. Performed calculation to ensure sufficient cell concentration for flow cytometry sampling.
(1237) TABLE-US-00133 Viable Cell Concentration From Step 8.14.53 F* Or Step 8.14.61 F* Or Target Volume Required Step 8.14.64 E* for 6 ? 10.sup.7 TVC Is B ? 1.0 mL? A B = 6 ? 10.sup.7 cells/A (Yes/No**) cells/mL mL *Circle step reference used to determine Viable Cell Concentration **NOTE: If No, contact area management. 8.14.66 Calculated IFN-?. Sample Performed calculation to ensure sufficient cell concentration for IFN-? sampling.
(1238) TABLE-US-00134 Viable Cell Concentration From Step 8.14.53 F* Or Step 8.14.61 F* Or Volume Required for Step 8.14.64 E* Minimum 1.5 ? 10.sup.7 TVC Is B ? 1.0 mL? A B = 1.5 ? 10.sup.7 cells/A (Yes/No**) cells/mL mL *Circle step reference used to determine Viable Cell Concentration **NOTE: If No, contact area management. 8.14.67 Reported Results. Completed forms for submission with samples. 8.14.68 Heat Sealed. Once sample volumes had been determined, heat sealed (per Process Note 5.12) Final Product Bags as close to the bags as possible to remove from the apparatus. 8.14.69 Labeled and Collected Samples per Sample Plan.
(1239) TABLE-US-00135 Sample Volume to Number of Add to Container Sample Containers Each Type Destination *Mycoplasma 1 1.0 mL 15 mL Login Conical Endotoxin 2 1.0 mL 2 mL Cryovial Login Gram Stain 1 1.0 mL 2 mL Cryovial Login IFN-g 1 1.0 mL 2 mL Cryovial Login Flow 1 1.0 mL 2 mL Cryovial Login Cytometry **Bac-T 2 1.0 mL Bac-T Bottle Login Sterility QC Retain 4 1.0 mL 2 mL Cryovial CRF Satellite Vials 10 0.5 mL 2 mL Cryovial CRF *NOTE: For the Mycoplasma sample, add formulated cell suspension volume to the 15 mL conical labelled Mycoplasm a Diluent from Step 8.12.55. **NOTE: Proceed to Step 8.14.70 for Bac -T inoculation. 8.14.70 Sterility & BacT. Testing Sampling. In the BSC, remove a 1.0 mL sample from the retained cell suspension collected in Step 8.14.38 using an appropriately sized syringe and inoculate the anaerobic bottle. Repeat the above for the aerobic bottle. NOTE: Store Bac-T bottles are room temperature and protect from light. 8.14.71 Labeled and stored samples. Labeled all samples with sample plan inventory labels and store appropriately until transfer to Login. NOTE: Proceeded to Section 8.15 for cryopreservation of final product and samples. 8.14.72 Signed for sampling. Ensured that LIMS sample plan sheet is completed for removal of the samples. 8.14.73 Sample Submission. Submitted all Day 22 testing samples to Login. 8.14.74 Environmental Monitoring. After processing, verified BSC and personnel monitoring had been performed. 8.14.75 Review Section 8.14
(1240) 8.15 Final Product Cryopreservation 8.15.1 Prepared Controlled Rate Freezer. Verified the CRF had been set up prior to freeze. Record CRF Equipment. Cryopreservation is performed. 8.15.2 Set up CRF probes. Punctured the septum on the CRF blank bag. Inserted the 6 mL vial temperature probe. 8.15.3 Placed final product and samples in CRF. Placed blank bag into preconditioned cassette and transferred into the approximate middle of the CRF rack. Transferred final product cassettes into CRF rack and vials into CRF vial rack. 8.15.4 Placed final product and samples in CRF. Transferred product racks and vial racks into the CRF. Recorded the time that the product is transferred into the CRF and the chamber temperature in Step 8.15.5. NOTE: Evenly distributed the cassettes and vial rack in the CRF, allowed as much space as possible between each shelf. 8.15.5 Determined the time needed to reach 4? C.?1.5? C. and proceed with the CRF run. Once the chamber temperature reached 4? C.?1.5? C., started the run. Recorded time.
(1241) TABLE-US-00136 Parameter Formula Value Time Final Product is transferred to CRF (HHMM) Temperature Final Product is transferred into From ? C. CRF monitor B. CRF Start Time (HHMM) Elapsed Time from Formulation to CRF Start C = B ? Step min 8.14.25A 8.15.6 CRF Completed and Stored. Stopped the CRF after the completion of the run. Remove cassettes and vials from CRF. Transferred cassettes and vials to vapor phase LN2 for storage. Recorded storage location
Post Processing Summary Post-Processing: Final Drug Product (Day 22) Determination of CD3+ Cells on Day 22 REP by Flow Cytometry (Day 22) Gram Staining Method (GMP) (Day 22) Bacterial Endotoxin Test by Gel Clot LAL Assay (GMP) (Day 16) BacT Sterility Assay (GMP) (Day 16) Mycoplasma DNA Detection by TD-PCR (GMP) Acceptable Appearance Attributes (Step 8.14.43) (Day 22) BacT Sterility Assay (GMP) (Day 22) IFN-gamma Assay
(1242) The examples set forth above are provided to give those of ordinary skill in the art a complete disclosure and description of how to make and use the embodiments of the compositions, systems and methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention. Modifications of the above-described modes for carrying out the invention that are obvious to persons of skill in the art are intended to be within the scope of the following claims. All patents and publications mentioned in the specification are indicative of the levels of skill of those skilled in the art to which the invention pertains.
(1243) All headings and section designations are used for clarity and reference purposes only and are not to be considered limiting in any way. For example, those of skill in the art will appreciate the usefulness of combining various aspects from different headings and sections as appropriate according to the spirit and scope of the invention described herein.
(1244) All references cited herein are hereby incorporated by reference herein in their entireties and for all purposes to the same extent as if each individual publication or patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety for all purposes.
(1245) Many modifications and variations of this application can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. The specific embodiments and examples described herein are offered by way of example only, and the application is to be limited only by the terms of the appended claims, along with the full scope of equivalents to which the claims are entitled.
SEQUENCES
(1246) SEQ ID NO:1 is the amino acid sequence of the heavy chain of muromonab.
(1247) SEQ ID NO:2 is the amino acid sequence of the light chain of muromonab.
(1248) SEQ ID NO:3 is the amino acid sequence of a recombinant human IL-2 protein.
(1249) SEQ ID NO:4 is the amino acid sequence of aldesleukin.
(1250) SEQ ID NO:5 is the amino acid sequence of a recombinant human IL-4 protein.
(1251) SEQ ID NO:6 is the amino acid sequence of a recombinant human IL-7 protein.
(1252) SEQ ID NO:7 is the amino acid sequence of a recombinant human IL-15 protein.
(1253) SEQ ID NO:8 is the amino acid sequence of a recombinant human IL-21 protein.
(1254) Amino Acid Sequences of Muromonab.
(1255) TABLE-US-00137 Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:1 QVQLQQSGAELARPGASVKMSCKASGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNY 60 Muromonab NQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSA 120 heavychain KTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDL 180 YTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRPKSCDKTHTCPPCPAPELLGG 240 PSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYN 300 STYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE 360 LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW 420 QQGNVFSCSVMHEALHNHYTQKSLSLSPGK 450 SEQIDNO:2 QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMNWYQQKSGTSPKRWIYDTSKLASGVPAH 60 Muromonab FRGSGSGTSYSLTISGMEAEDAATYYCQOWSSNPFTFGSGTKLEINRADTAPTVSIFPPS 120 lightchain SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL 180 TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 213
Amino Acid Sequences of Interleukins.
(1256) TABLE-US-00138 Identifier Sequence(One-LetterAminoAcidSymbols) SEQIDNO:3 MAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCL 60 recombinant EEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLN 120 humanIL-2 RWITFCQSIISTLT 134 (rhIL-2) SEQIDNO:4 PTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEE 60 Aldesleukin ELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRW 120 ITFSQSIISTLT 132 SEQIDNO:5 MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHH 60 recombinant EKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTI 120 humanIL-4 MREKYSKCSS 130 (rhIL-4) SEQIDNO:6 MDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRA 60 recombinant ARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSL 120 humanIL-7 KEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH 153 (rhIL-7) SEQIDNO:7 MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASI 60 recombinant HDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS 115 humanIL-15 (rhIL-15)