METHODS FOR REPROGRAMMING FIBROBLASTS INTO LIMB PROGENITORS
20240093156 ยท 2024-03-21
Assignee
- President And Fellows Of Harvard College (Cambridge, MA)
- The Brigham And Women's Hospital, Inc. (Boston, MA)
Inventors
- Clifford J. Tabin (Cambridge, MA)
- Yuji Atsuta (Cambridge, MA, US)
- Alan R. Rodrigues (Cambridge, MA, US)
- ChangHee Lee (Cambridge, MA, US)
- Olivier Pourquie (Boston, MA, US)
Cpc classification
C12N2740/15043
CHEMISTRY; METALLURGY
C12N2506/13
CHEMISTRY; METALLURGY
C12N2533/90
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
International classification
Abstract
The disclosure provides methods and compositions for reprogramming fibroblasts into limb progenitors.
Claims
1. A method for producing limb progenitors, comprising: delivering a set of factors to fibroblasts, wherein the factors are selected from PRDM16, ZBTB16, LIN28, and LIN41; and optionally culturing the fibroblasts to produce limb progenitors.
2. The method of claim 1, wherein the set of factors comprise or consist of two or more factors selected from PRDM16, ZBTB16, LIN28, and LIN41.
3. The method of claim 2, wherein the two or more factors comprise or consist of LIN28 and PRDM16.
4. The method of claim 2, wherein the two or more factors comprise or consist of LIN28 and ZBTB16.
5. The method of claim 1, wherein the set of factors comprise or consist of three or more factors selected from PRDM16, ZBTB16, LIN28, and LIN41.
6. The method of claim 5, wherein the three or more factors comprise or consist of PRDM16, ZBTB16, and LIN28.
7. The method of claim 1, wherein the set of factors comprise or consist of PRDM16, ZBTB16, LIN28, and LIN41.
8. The method of claim 1, wherein the fibroblasts are mouse fibroblasts, optionally non-limb Prx-negative fibroblasts, and wherein the mouse fibroblasts are obtained from mouse embryos, optionally from about embryonic day 10 (E10) to about embryonic day 15 (E15), preferably about E13.5.
9. The method of claim 1, wherein the fibroblasts are human fibroblasts.
10. The method of claim 1, wherein the fibroblasts are cultured in a hydrogel scaffold comprising high molecular weight hyaluronic acid (HA) and adipic acid dihydrazide crosslinkers.
11. The method of claim 1, wherein the fibroblasts are cultured in the presence of CHIR99021, Fgf8, RA, SB431542 and/or Y-27632.
12. The method of claim 1, wherein the set of factors is delivered via a retrovirus or via pooled retroviruses.
13. The method of claim 1, wherein the fibroblasts are cultured for at least 7 days, at least 14 days, or at least 21 weeks.
14. The method of claim 1, wherein the fibroblasts are cultured for about 7 to about 21 days, optionally about 14 days.
15. A composition comprising: a set of factors selected from PRDM16, ZBTB16, LIN28, and LIN41; and optionally fibroblasts.
16. The composition of claim 15, wherein the set of factors comprise or consist of two or more factors selected from PRDM16, ZBTB16, LIN28, and LIN41.
17. The composition of claim 16, wherein the two or more factors comprise or consist of LIN28 and PRDM16, or LIN28 and ZBTB16.
18. (canceled)
19. The composition of claim 15, wherein the set of factors comprise or consist of three or more factors selected from PRDM16, ZBTB16, LIN28, and LIN41.
20. The composition of claim 19, wherein the three or more factors comprise or consist of PRDM16, ZBTB16, and LIN28.
21. The composition of claim 15, wherein the set of factors comprise or consist of PRDM16, ZBTB16, LIN28, and LIN41.
22.-27. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
DETAILED DESCRIPTION
[0021] Limb bud progenitors originate from the somatopleural layer of the LPM, a continuous epithelium lining the embryonic coelom. Limb progenitors emerge through localized epithelial-to-mesenchymal transition (EMT) at limb forming levels (Gros and Tabin, 2014). Limb progenitors will ultimately give rise to the majority of tissues present in the mature patterned limb including cartilage, bone, tendon, ligament, muscle connective tissue and dermis; whereas somatopleural LPM at other axial levels, such as neck and flank mesenchyme, will only form dermis. Moreover, limb progenitors are organized within the limb bud in response to limb-patterning morphogenic signals, while LPM-derived cells from other axial levels are refractory to them (Takeuchi et al., 2003). It has, however, remained unclear what gene, or genes, are responsible for specifying limb progenitors and imparting them with limb-specific traits.
[0022] In previous studies, direct cellular reprogramming has been used to induce a variety of tissue progenitor populations, such as neural progenitors, cardiomyocytes and hepatocytes, from terminally differentiated fibroblasts (Vierbuchen et al., 2010). These studies not only set the stage for future therapeutic applications, but they have also proven important, in and of themselves, for identifying developmental regulators of embryonic progenitor states (Takahashi and Yamanaka, 2015). For example, the reprogramming factors first shown to be capable of inducing pluripotent stem cells (Oct3/4, Sox2, Klf4 and c-Myc) were subsequently shown to regulate the endogenous developmental signaling network defining mouse embryonic stem cells (Lin et al., 2008).
[0023] To understand what it really means to be a limb progenitor, the inventors set out to identify a set of factors expressed ubiquitously in the early limb field, that might be capable of establishing and maintaining the unique transcriptional characteristics and differentiation potential of limb progenitors. To that end, a reprogramming approach was taken, reasoning that a full set of the factors giving early limb progenitors their unique properties might be sufficient to convert non-limb mouse embryonic fibroblasts into cells with properties of limb progenitors.
[0024] The inventors started with 18 candidate factors expressed in early limb progenitors. They overexpressed these factors via viral vectors in three-dimensional (3D) culture conditions optimized for maintaining legitimate limb progenitors. This pool of 18 factors was, indeed, able to robustly induce expression of limb progenitor marker genes in mouse embryonic non-limb fibroblasts. Winnowing the candidates responsible for this activity, the inventors ultimately found that, a combination of two transcription factors, Prdm16 and Zbtb16, plus an RNA-binding protein, Lin28a, suffice to reprogram non-limb fibroblasts into a limb progenitor-like state (reprogrammed limb progenitor-like cells, hereafter rLPCs). Moreover, the further addition of Lin41 (also known as Trim71), boosts proliferation of rLPCs, by antagonizing translation of Egr1, a pro-differentiation factor for limb progenitors. The limb progenitor-like state of the rLPCs was validated at a transcriptional level, and through in vitro and in vivo differentiation assays. While the initial analysis was carried out with murine cells, the inventors further show that adult human fibroblasts can similarly be converted to rLPCs with the same set of factors used for mouse cell reprogramming, suggestive of conservation of the genetic program for limb bud initiation across vertebrates. Taken together, the reprogramming factors identified herein are capable of conferring non-limb cells with limb progenitor specific traits, suggesting that these factors might similarly initiate developmental networks that define the endogenous early limb progenitors as they emerge from the LPM.
[0025] PRDM16 (PR/SET Domain 16; UniProt Q9HAZ2) binds DNA and functions as a transcriptional regulator.
TABLE-US-00001 ExemplaryPRDM16proteinsequence: (SEQIDNO:1) MRSKARARKLAKSDGDVVNNMYEPNRDLLASHSAEDEAEDSAMSPIPVGPPSPFPTSEDF TPKEGSPYEAPVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERLGPCVVVPRAA AKETDFGWEQILTDVEVSPQEGCITKISEDLGSEKFCVDANQAGAGSWLKYIRVACSCDD QNLTMCQISEQIYYKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQ SKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYSLEQHM VIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQH VGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCR TQIKCKDCGQMESTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSINH ASLGFNEYFPSRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPLN HTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMSD GSDFEDVNITTGTDLDTTTGTGSDLDSDVDSDPDKDKGKGKSAEGQPKFGGGLAPPGAPN SVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIAEKYFGPGEMGMQEKKLGSLP YHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLITKPK DVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLP QVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSA IETMTEKLESFAAMKADSGSSLOPLPHHPFNFRSPPPILSDPILRKGKERYTCRYCGKIF PRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQ TNLDRHLKKHEHENAPVSQHPGVLINHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFI ANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQD DTVSPAPEPQAAYEDEEDEEPAASLAVGEDHTRRCAEDHEGGLLALEPMPTFGKGLDLRR AAEEAFEVKDVINSTLDSEALKHTLCROAKNOAYAMMLSLSEDTPLHTPSQGSLDAWLKV TGATSESGAFHPINHL
[0026] ZBTB16 (Zinc Finger And BTB Domain Containing 16; UniProt Q05516) acts as a transcriptional repressor.
TABLE-US-00002 ExemplaryZBTB16proteinsequence: (SEQIDNO:2) MDLTKMGMIQLONPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGOSLPGPM VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLOGTLQPPAGPEEPTLAGGGRHPGVAE VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHOLETHYRVHTGEK PFECKLCHORSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD WRIEKTYLYLCYV
[0027] LIN28 (UniProt Q9H9Z2) is an RNA-binding protein that inhibits processing of pre-let-7 miRNAs and regulates translation of mRNAs that control developmental timing, pluripotency and metabolism.
TABLE-US-00003 ExemplaryLIN28proteinsequence: (SEQIDNO:3) MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPOLLHGAGICKWENVRMGFGFLSMTA RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCOSISHMVASCPLKAQQ GPSAQGKPTYFREEEEEIHSPTLLPEAQN
[0028] LIN41 (also known as TRIM71 (Tripartite Motif Containing 71); UniProt Q2Q1W2) is an E3 ubiquitin-protein ligase that cooperates with the microRNAs (miRNAs) machinery and promotes embryonic stem cells proliferation and maintenance.
TABLE-US-00004 ExemplaryLIN41proteinsequence: (SEQIDNO:4) MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLP CLHAFCRPCLEAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLL DAVVATADEPPPKNGRAGAPAGAGGHSNHRHHAHHAHPRASASAPPLPQAPOPPAPSRSA PGGPAASPSALLLRRPHGCSSCDEGNAASSRCLDCQEHLCDNCVRAHQRVRLTKDHYIER GPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQHHDDEVLHLYCDTCSVPICRE CTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGROAIQLSIEQAQTVAEQVEMKAKVV QSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRONLNKLESTISAVOQ VLEEGRALDILLARDRMLAQVQELKTVRSLLOPQEDDRVMFTPPDQALYLAIKSFGFVSS GAFAPLIKATGDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEV SDQQNGTYVVSYRPQLEGEHLVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEG DSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGAFHHKFGTLGSRPGQFDRPAGVA CDASRRIVVADKDNHRIQIFTFEGOFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTR NHRIQLFGPDGVFLNKYGFEGALWKHEDSPRGVAFNHEGHLVVTDENNHRLLVIHPDCQS ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVOMFESNGSFLCKFGAQGSGFGQ MDRPSGIAITPDGMIVVVDFGNNRILVF
Optimized 3D Culture Conditions for Long-Term Maintenance of Limb Progenitors
[0029] Identifying adequate culture conditions for maintaining stem cells being targeted is known to have been a key factor in the success of other reprogramming studies. For instance, the Yamanaka factors failed to reprogram mouse embryonic fibroblasts to iPSCs in the absence of leukemia inhibitory factor (LIF) and feeder cells (Takahashi and Yamanaka, 2006). Since previous culture condition for limb progenitors (Cooper et al. 2011) was effective only for the short term, the inventors sought to optimize the conditions for long-term maintenance of limb progenitors. Ultimately, the inventors found that a cocktail of CHIR90021 (a GSK30 antagonist) Fgf8, RA, SB431542 (a Bmp/TGF? inhibitor) and Y-27632 (a Rock inhibitor) will maintain limb progenitors in a HA or Matrigel 3-D matrix for an extended period of culture. Although RA is necessary to keep cells in the progenitor state through activation of limb progenitor genes such as Meis1/2 and by blocking chondrogenic differentiation (Cooper et al., 2011), RA can also induce apoptosis as seen in interdigital mesenchyme. The RA-induced apoptosis is partially mediated by Bmp7 (Dup6 et al., 1999), thus TGF?/BMP antagonist SB431542 may not only inhibit differentiation of limb progenitors but also block cell death during culture. In addition, it is noteworthy that the endogenous RA concentration is higher in the anterior part of the embryo than that in the posterior region and thereby promotes induction of Tbx5, but not Tbx4, during forelimb initiation (Nishimoto et al., 2015). It is therefore likely that RA also contributes to upregulation of Tbx5 in rLPCs during reprogramming, and is thus responsible for the forelimb-like characteristics of these cells.
Potential of rLPCs for Clinical Application
[0030] As rLPCs have the potential to differentate into chondrocytes and connective tissues, rLPCs could, in principle, be harnessed for regenerative therapies in the future. Previously, endogenous limb progenitors and iPSC-derived limb progenitor-like cells have been shown to enhance regenerative processes when transplanted into amputated frog limbs and mouse digit tips, respectively (Lin et al., 2013; Chen et al., 2017). 3D spheroids of limb progenitor-like cells also can be induced from mouse embryonic stem cells (Mori et al., 2019). None of these studies, however, have demonstrated that induced or reprogrammed limb progenitors have the capacity, on their own, to give rise to a limb-like structure, patterned along various axes and containing appropriate differentiated tisssues. In principle, this can be tested by constructing a recombinant limb, in which dissociated limb mesenchyme (or, in principle, rLPCs) are pelleted, and packed into an empty shell of limb ectoderm, and grafted onto a host embryo (Zwilling, 1964, Ros et, al., 1994). Such recombinant limbs made with limb progenitors make well formed limb-like structures. However, as the recombaint limb assay is only feasible with avian embryos, a recombinant system using reprogrammed avian cells will be required.
[0031] This study may also open the way to in vivo direct rLPC reprogramming (Zhou et al., 2008). By overexpressing the reprogramming factors in dermal fibroblasts at an amputation site of a human limb, cells might be reprogrammed towards a limb progenitor state, thereby potentiating the in situ development of a limb-like structure. Of note, two of the reprogramming factors, Lin28 and Prdm16 are re-expressed in blastema of regenerating appendages in other systems (Rao et. al., 2009; Yoshida et. al., 2020). While such therapeutic applications will require a great deal of further work, the study described here provides a more immediate platform for interrogating the molecular control of the limb progenitor state.
The Roles of the Reprogramming Factors in Specification of Limb Mesenchyme
[0032] At some level, the factors that emerged from this reprogramming screen were surprising. Neither genes previously described as controlling the position of the limb buds along the anteroposterior axis (eg. Hox genes), nor transcription factors known to be essential for the formation of a limb bud (eg. Tbx4/5, Nmyc) (Agarwal et al., 2003; McQueen and Towers, 2020) were required for rLPC reprogramming. The identifed reprogramming factors are, however, able to induce the expression f all these transcription factors during the reprogramming process. Whether they do so during normal limb bud remains an openquestion. Whle they could indeed act upsteam during limb specification, alternatively they could function downstream in the endogenous context to maintain Hox, Tbx and Nmyc activity through a positive feedback loop.
[0033] Of the reprogramming factors identified, Lin28a is perhaps the most explicable. In a highly conserved pathway, Lin28 acts to block the expression of the microRNA let-7 (reviewed in Balzeau et al., 2017). Intriguingly, a number of key genes transcribed in early limb progenitors, including Sall4, Nmyc, Tbx5 and Lin41, are suppressed by members of the let-7 miRNA family in other contexts, including the regulation of embryonic stem cells, iPSC reprogramming, and during cardiogenesis (Wang et al., 2013). Thus, there is a possibility that Lin28a indirectly upregulates expression of limb progenitor-specific genes globally, by blocking let-7 miRNA activity during rLPC reprogramming. Consistent with Lin28a playing such a role during normal limb development, let-7 is present at a very low level during limb bud formation, and is up-regulated at later stages as the limb bud starts to differentiate (Lancman et al., 2005), concomitant with a decrease in expression of Lin28a. Intriguingly, let-7 also acts to suppress stemness factors in the context of iPSC reprogramming, including Oct4, Nanog, Sox2 (Melton et al., 2010), Myc, and Lin41 (Worringer et al., 2013). This raises the possibility that there is a let7 barrier that may hamper rLPC reprogramming (and potenially normal specification of limb mesenchyme) as seen in iPSC reprogramming (Worringer et al., 2013).
[0034] In striking contrast, however, neither Zbtb16 nor Prdm16 is required for the formation of the endogenous limb buds, nor for the normal differentiation of limb tissues; although both of these transcription factors are strongly expressed throughout the early limb mesenchyme. Mice deficient for Zbtb16 (also known as PLZF), a zinc finger transcription factor, display some patterning defects in the proximal limb, and show disregulated interactions with the Gli3 pathway and altered Hox gene expression (Barna et al., 2005), but clearly do not have defects in producing limb progenitors. Similarly, mice carrying null mutations in Prdm16, a chromatin-modifying transcription factor containing multiple zinc fingers, present with craniofacial defects, but have no limb phenotype. Thus, these two transcription factors, both strongly expressed in limb progenitors and capable (in concert with Lin28a) of activating the entire limb progenitor genetic program, appear to be dispensable for their specification in vivo. A plausible explanation for this would be the existence of functional redundancy. Indeed, at least in the case off Prdm16, there is a highly related paralogue, called Evil, which is similarly expressed throughout the early limb bud yet is dispensable for normal limb development (Cela et al., 2013). Reinforcing the idea that there might be functional redundancy between Pdrm16 and Evil in this context, the two factors have similar functions in normal and malignant hematopoiesis. While testing the requirement for these factors in the specification of limb progenitors will require genetic studies beyond the scope of the current work, their identification validates this reprogramming strategy as an approach to find heretofore unappreciated potential regulators of limb cell fate.
Nucleic Acids
[0035] An engineered nucleic acid is a polynucleotide (e.g., at least two nucleotides covalently linked together, and in some instances, containing phosphodiester bonds, referred to as a phosphodiester backbone) that does not occur in nature. Engineered nucleic acids include recombinant nucleic acids and synthetic nucleic acids. A recombinant nucleic acid is a molecule that is constructed by joining nucleic acids (e.g., isolated nucleic acids, synthetic nucleic acids or a combination thereof) from two different organisms (e.g., human and mouse). A synthetic nucleic acid is a molecule that is amplified or chemically, or by other means, synthesized. A synthetic nucleic acid includes those that are chemically modified, or otherwise modified, but can base pair with (bind to) naturally occurring nucleic acid molecules. Recombinant and synthetic nucleic acids also include those molecules that result from the replication of either of the foregoing.
[0036] An engineered nucleic acid may comprise DNA (e.g., genomic DNA, cDNA or a combination of genomic DNA and cDNA), RNA or a hybrid molecule, for example, where the nucleic acid contains any combination of deoxyribonucleotides and ribonucleotides (e.g., artificial or natural), and any combination of two or more bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine, hypoxanthine, isocytosine and isoguanine.
[0037] In some embodiments, a nucleic acid is a complementary DNA (cDNA). cDNA is synthesized from a single-stranded RNA (e.g., messenger RNA (mRNA) or microRNA (miRNA)) template in a reaction catalyzed by reverse transcriptase.
[0038] Engineered nucleic acids of the present disclosure may be produced using standard molecular biology methods (see, e.g., Green and Sambrook, Molecular Cloning, A Laboratory Manual, 2012, Cold Spring Harbor Press). In some embodiments, nucleic acids are produced using GIBSON ASSEMBLY? Cloning (see, e.g., Gibson, D. G. et al. Nature Methods, 343-345, 2009; and Gibson, D. G. et al. Nature Methods, 901-903, 2010, each of which is incorporated by reference herein). GIBSON ASSEMBLY? typically uses three enzymatic activities in a single-tube reaction: 5 exonuclease, the 3 extension activity of a DNA polymerase and DNA ligase activity. The 5 exonuclease activity chews back the 5 end sequences and exposes the complementary sequence for annealing. The polymerase activity then fills in the gaps on the annealed domains. A DNA ligase then seals the nick and covalently links the DNA fragments together. The overlapping sequence of adjoining fragments is much longer than those used in Golden Gate Assembly, and therefore results in a higher percentage of correct assemblies. The MegaGate molecular cloning method may also be used. MegaGate is a toxin-less Gateway technology that eliminates the ccdb toxin used in Gateway recombinase cloning and instead utilizes meganuclease-mediated digestion to eliminate background vectors during cloning (see, e.g., Kramme C. et al. STAR Protoc. 2021 Oct. 22; 2(4):100907, incorporated herein by reference). Other methods of producing engineered polynucleotides may be used in accordance with the present disclosure.
[0039] In some embodiments, an engineered nucleic acid comprises a promoter operably linked to an open reading frame. A promoter is a nucleotide sequence to which RNA polymerase binds to initial transcription (e.g., ATG). Promoters are typically located directly upstream from (at the 5 end of) a transcription initiation site. In some embodiments, a promoter is a heterologous promoter. A heterologous promoter is not naturally associated with the open reading frame to which is it operably linked.
[0040] In some embodiments, a promoter is an inducible promoter. An inducible promoter may be regulated in vivo by a chemical agent, temperature, or light, for example. Inducible promoters enable, for example, temporal and/or spatial control of gene expression. Inducible promoters for use in accordance with the present disclosure include any inducible promoter described herein or known to one of ordinary skill in the art. Examples of inducible promoters include, without limitation, chemically/biochemically-regulated and physically-regulated promoters such as alcohol-regulated promoters, tetracycline-regulated promoters (e.g., anhydrotetracycline (aTc)-responsive promoters and other tetracycline responsive promoter systems, which include a tetracycline repressor protein (tetR), a tetracycline operator sequence (tetO) and a tetracycline transactivator fusion protein (tTA)), steroid-regulated promoters (e.g., promoters based on the rat glucocorticoid receptor, human estrogen receptor, moth ecdysone receptors, and promoters from the steroid/retinoid/thyroid 25 receptor superfamily), metal-regulated promoters (e.g., promoters derived from metallothionein (proteins that bind and sequester metal ions) genes from yeast, mouse and human), pathogenesis-regulated promoters (e.g., induced by salicylic acid, ethylene or benzothiadiazole (BTH)), temperature/heat-inducible promoters (e.g., heat shock promoters), and light-regulated promoters (e.g., light responsive promoters from plant cells). In some embodiments, the inducible promoter is a tetracycline-inducible promoter. In some embodiments, the inducible promoter is a doxycycline-inducible promoter. In other embodiments, a promoter is a constitutive promoter (active in vivo, unregulated).
[0041] An open reading frame is a continuous stretch of codons that begins with a start codon (e.g., ATG), ends with a stop codon (e.g., TAA, TAG, or TGA), and encodes a polypeptide, for example, a protein. An open reading frame is operably linked to a promoter if that promoter regulates transcription of the open reading frame.
[0042] Vectors used for delivery of an engineered nucleic acids include viral vectors and non-viral vectors. Non-limiting examples of viral vectors include retrovirus, adenovirus, adeno-associated virus (AAV), and herpes simplex virus. Non-limiting examples of non-viral vectors include minicircles, plasmids, bacterial artificial chromosomes (BACs), and yeast artificial chromosomes. Transposon-based systems, such as the piggyBac? system (e.g., Chen et al. Nature Communications. 2020; 11(1): 3446), may be used as a vector system to deliver an engineered nucleic acid. Other non-limiting examples include nanoparticle-based systems, such as lipid nanoparticles.
[0043] Transfection refers to the uptake of exogenous (e.g., engineered) nucleic acids (e.g., DNA or RNA) by a cell. A cell has been transfected when an exogenous nucleic acid has been introduced inside the cell membrane. A number of transfection techniques are generally known in the art. See, e.g., Graham et al. (1973) Virology, 52:456, Sambrook et al. (2001) Molecular Cloning, a laboratory manual, 3rd edition, Cold Spring Harbor Laboratories, New York, Davis et al. (1995) Basic Methods in Molecular Biology, 2nd edition, McGraw-Hill, and Chu et al. (1981) Gene 13: 197. Such techniques can be used to introduce one or more engineered nucleic acid into cells. The term refers to both stable and transient uptake of the nucleic acid (e.g., DNA or RNA).
ADDITIONAL EMBODIMENTS
[0044] Additional embodiments are encompassed by the following numbered paragraphs:
[0045] 1. A method comprising: [0046] delivering a set of factors to fibroblasts, wherein the factors are selected from PRDM16, ZBTB16, LIN28, and LIN41; and [0047] optionally culturing the fibroblasts to produce limb progenitors.
[0048] 2. The method of paragraph 1, wherein the set of factors comprise or consist of two or more factors are selected from PRDM16, ZBTB16, LIN28, and LIN41, optionally LIN28 and PRDM16 or LIN28 and ZBTB16.
[0049] 3. The method of paragraph 2, wherein the set of factors comprise or consist of three or more factors are selected from PRDM16, ZBTB16, LIN28, and LIN41.
[0050] 4. The method of paragraph 3, wherein the set of factors comprise or consist of PRDM16, ZBTB16, and LIN28.
[0051] 5. The method of paragraph 3, wherein the set of factors comprise or consist of PRDM16, ZBTB16, LIN28, and LIN41.
[0052] 6. A composition comprising: [0053] a set of factors selected from PRDM16, ZBTB16, LIN28, and LIN41; and [0054] optionally fibroblasts.
[0055] 7. The composition of paragraph 6, wherein the set of factors comprise or consist of two or more factors are selected from PRDM16, ZBTB16, LIN28, and LIN41, optionally LIN28 and PRDM16 or LIN28 and ZBTB16.
[0056] 8. The composition of paragraph 7, wherein the set of factors comprise or consist of three or more factors are selected from PRDM16, ZBTB16, LIN28, and LIN41.
[0057] 9. The composition of paragraph 8, wherein the set of factors comprise or consist of PRDM16, ZBTB16, and LIN28.
[0058] 10. The composition of paragraph 8, wherein the set of factors comprise or consist of PRDM16, ZBTB16, LIN28, and LIN41.
[0059] 11. The method or composition of any one of the preceding paragraphs, wherein the fibroblasts are non-limb Prx-negative fibroblasts.
[0060] 12. The method or composition of any one of the preceding paragraphs, wherein the factors are encoded on one or more engineered nucleic acid, optionally in an expression vector.
EXAMPLES
[0061] The studies described below established long-term culture conditions to maintain limb progenitors, identified factors that are sufficient to reprogram non-limb fibroblasts into rLPCs, and validated their similarity to limb progenitors via multiple criteria.
Example 1. Optimization of Culture Conditions for Early Mouse Limb Bud Progenitors
[0062] Prior to embarking on a reprogramming strategy, we needed to establish culture conditions capable of sustaining authentic limb progenitors, to assure that putative reprogrammed limb progenitor-like cells would be able to expand into colonies while maintaining a limb progenitor-like identity. 3D-culture systems mimicking physiological conditions have been used to support expansion of primary progenitor populations such as neural and nephron progenitors (Madl et al., 2017; Li et al., 2016), as well as for cellular reprogramming of iPSCs (Caiazzo, 2016). To mimic the early limb bud extracellular environment, we exploited hydrogel scaffolds made from high molecular weight hyaluronic acid (HA) and adipic acid dihydrazide crosslinkers. HA is a large glycosaminoglycan that is known to be a major component of the extracellular matrix (ECM) of the developing limb buds (Li et al., 2007).
[0063] In a previous study, we showed that treating cultured chick limb bud cells with a combination of Wnt3a, Fgf8 and retinoic acid (RA) maintained them in a progenitor state for 48 hours (Cooper et al., 2011). Here, we utilized CHIR99021, a GSK3 inhibitor in place of Wnt3a. We compared the effect of these factors on mouse limb progenitors, cultured within a 3D-HA-gel scaffold with those maintained in two-dimensional culture on polystyrene plastic. To provide a readout for maintenance of a limb progenitor identity, we harvested limb bud progenitors from E9.5 Prx1-GFP reporter mice (Prx1-CreER-ires-GFP)(Kawanami et al., 2009), in which GFP activity is specifically seen in the limb buds (
[0064] Finally, we asked whether other culture matrices besides HA could maintain limb progenitors in the presence of CHIR99021, Fgf8, RA, SB431542 and Y-27632. Several scaffolds we tested failed to do so, however we discovered that limb bud cells plated onto Matrigel grew to a similar extent, and maintained expression of limb-specific markers, equivalent to those seeded into the HA scaffold (data not shown). Accordingly, the HA and Matrigel systems were used interchangeably in subsequent experiments as noted below (being careful to always compare to controls cultured in the same matrix).
Example 2. Identification of Candidate Genes for Specification of Limb Progenitor Identity
[0065] To generate a list of candidate transcription factors potentially involved in early limb fate specification, we used RNA-seq to identify genes expressed exclusively in the early chick limb fields. We harvested the forelimb and hindlimb buds of HH17-19 embryos, as well as presumptive neck and flank mesenchyme from HH19-20 embryos (
[0066] Finally, we added Lin28a to the list. Lin28a is a highly conserved RNA-binding protein, the major function of which is to bind nascent let-7 micro RNA in order to block its biogenesis (Viswanathan et al., 2008). Lin28a plays roles in regulating development and pluripotency (Tsialikas and Romer-Seibert, 2015), and is known as one of the iPSC reprogramming factors (Yu et al., 2007). Of note, expression of Lin28a mRNA has been specifically seen in early limb buds, in both mouse and chicken embryos, and its expression is downregulated as limb development progresses (Buganim et al., 2014). Moreover, we observe a relatively higher expression level of Lin28a in mouse limb buds than in the flank lateral plate mesoderm (
Example 3. Overexpression of Candidate Genes Specifically Expressed in Early Limb Buds Activates Expression of Limb Progenitor Genes in Non-Limb Fibroblasts
[0067] We isolated GFP-negative fibroblasts from the non-limb regions of E13.5 Prx1-GFP transgenic embryos. These non-limb fibroblasts were infected with pooled retroviruses transducing our 18 candidate factors, and were cultured under the conditions optimized for legitimate limb progenitors (
Example 4. Combinatorial Overexpression of Prdm16, Zbtb16 and Lin28a Induces Limb Progenitor Marker Expression in Non-Limb Fibroblasts
[0068] Next, to identify which of the factors in our initial pool were responsible for the induction of limb progenitor marker genes, we examined the effect of withdrawing individual factors from the mix on the activation of the Prx1 promoter, as reflected by GFP expression (18-1 factor assay; and data not shown). Efficiency of the induction was measured as a GFP score, which was calculated by dividing the GFP positive area by total area staining with DAPI (
[0069] The reprogramming factors we identified are expressed in both endogenous forelimb and hindlimb buds. To ask whether the reprogrammed cells acquired forelimb or hindlimb-like identity, we examined the expression levels of Tbx5 and Tbx4, genes responsible for specification of the forelimb and hindlimb, respectively (Rodriguez-Esteban et al., 1999). We found that Tbx5, but not Tbx4, is induced in the reprogrammed cells, suggesting that the non-limb fibroblasts obtained forelimb-like traits through the overexpression of the reprogramming factors (
[0070] As noted above, we found that the clusters of reprogrammed cells were morphologically reminiscent of endogenous limb progenitors. To more rigorously assess this impression, we used forward scatter profiling to measure cell size, via flow cytometry. As expected from direct observation, the values of the reprogrammed cells were smaller than those of non-limb fibroblasts, and in the similar range to authentic limb progenitors (data not shown). We also quantified and compared the size of nuclei (DAPI.sup.+) in unreprogrammed fibroblasts with that in the reprogrammed cells, and found the area of DAPI.sup.+ was decreased after reprogramming (data not shown), again similar to the measured DAPI area of limb progenitors. Together, the reprogrammed cells share transcriptional and morphological similarities with legitimate early limb progenitors, and henceforth are termed as reprogrammed limb progenitor-like cells, or rLPCs.
Example 5. Overexpression of Egr1 Suppresses Limb Progenitor Proliferation and Induces Precocious Differentiation of Chicken Limb Progenitors
[0071] The results described above suggest that Pdrm16, Zbtb16 and Lin28a can in concert, convert non-limb fibroblasts into rLPCs. Lin28a in particular was the most indispensable in our 7-1 and 7-2 assays. Accordingly, we further investigated the role of Lin28a in rLPC reprogramming, in order to gain a more mechanistic understanding of the processes. Potential insight into this question came from consideration of its function as an iPSC reprogramming factor. In that context, Lin28a acts to block production of the Let-7 microRNA. This is significant because the let-7 target, Lin41 suppresses translation of Egr1, which in turn antagonizes upregulation of pluripotency genes. Thus, in the presence of Lin28a, Lin41 activity promotes iPSC reprogramming (Ecsedi and Grosshans, 2013). Of note, let-7a is present in the chick limb buds and its expression level is increased as limb outgrowth proceeds (Lancman et al., 2005), corresponding to downregulation of Lin28a expression (Yokoyama et al., 2008). Lin41 mRNA is also expressed in the early chicken and mouse limb mesenchyme (Lancman et al., 2005; and data not shown). Conversely, Egr1 is not expressed in E9.5 or 10.5 mouse limb progenitors, nor is it seen in the forelimb-forming region of HH15 chicken embryos (
[0072] To test if Egr1 indeed plays a role in the regulation of limb progenitors during limb development, human EGR1 coding sequences were electroporated into the somatopleural layer at the prospective forelimb level of HH13 chicken embryos, prior to the expression of endogenous Egr1 mRNA (
Example 6. Addition of Lin41 Accelerates Proliferation of rLPCs
[0073] Given that Egr1 appears to oppose the rLPC reprogramming (as previously observed for iPSC reprogramming) we decided to add Lin41 to the core set of reprogramming factors with the goal of further repressing expression of Egr1. Non-limb fibroblasts, carrying the GFP reporter under the control of the Prx1 promotor were infected with lentivirus transducing Lin28a, Prdm16, and Zbtb16, with or without the addition of Lin41 (
Example 7. Reprogrammed rLPCs and Primary Limb Progenitors Share Similar Transcriptional Profiles
[0074] Although the rLPCs that result from driving Prdm16, Zbtb16, Lin28a and Lin41 activity in non-limb fibroblasts show elevated expression of every early limb bud progenitor marker we tested, it was important to establish whether their global transcriptional profile approximated that of legitimate limb progenitors. To that end, we carried out a transcriptome-wide analysis by droplet-based single cell RNA sequencing (scRNAseq). Fibroblasts reprogrammed for 2, 4, 8 or 14 days (enriched for Prx1-GFP transgene expression by FACS, data not shown) were compared to E9.5 and E10.5 limb progenitors cultured in vitro under identical 3D matrigel conditions for 8 days. In addition, we assayed limb progenitors taken directly from E9.5, E10.0, E10.5 and E11.5/E12.5 stage embryos, as well as non-limb fibroblasts (cultured under either 2D or 3D conditions) as reference. In total, 74,268 single cell transcriptomes (data not shown) were subject to dimensional reduction, low dimensional embedding (Brecht et al., 2018), graph-based clustering (Traag et al., 2019) and partition-based graph abstraction (PAGA) (Wolf et al., 2019).
[0075] The cells broadly cluster into seven distinct states, congruent with the different sources of the profiled cells (
[0076] Most non-limb fibroblasts subjected to reprogramming for 2, 4 or 8 days are found in the same clusters as control non-limb fibroblasts. Strikingly however, the 3D cultured reprogrammed cells at day 14 completely overlapped with the cultured limb progenitors and were indistinguishable in terms of their transcriptome, showing essentially no differential gene expression and coverage (
[0077] The UMAP pattern we observed can be further understood by reference to genes that characterize each cluster. Markers for non-limb fibroblasts (e.g., Acta2, Tagln) were quickly extinguished for all non-limb fibroblasts grown in 3D Matrigel culture, but only reprogrammed rLPCs upregulated markers similar to the early limb progenitors (e.g., Lhx2, Sall4, Tfap2c, Msx1/2, Mycn). Notably, the reprogrammed cells did not upregulate markers of differentiating late-stage limb progenitors, such as Sox9 (
[0078] While the 3D cultured limb progenitors fall into a single continuous cluster in this analysis, some distinctions can be observed within the clusters of limb progenitors directly taken from the embryo, reflecting differences in the patterning of the cells across the limb bud. Thus, there are subclusters representing Shh-expressing cells of the ZPA (zone of polarizing activity), and other genes indicative of cell variation across the anterior-posterior, and proximo-distal axes (data not shown). In this context, the rLPCs, reprogrammed at day 14, mostly show expression of early proximal genes such as proximal Hox genes. In addition, the limb progenitors express either Tbx5 or Tbx4, depending on their forelimb or hindlimb origin, while rLPCs express the forelimb marker Tbx5, albeit at a reduced level relative to limb progenitors. Taken together, the transcriptome analysis suggests that the reprogrammed cells attain an early forelimb progenitor state, in an active state of proliferation, without evidence of late patterning or differentiation (
Example 8. Trajectory Analysis Reveals the Sequence of Events During the Reprogramming of Non-Limb Fibroblasts into Limb Progenitor-Like Cells
[0079] Having established that driving the expression of Lin28a, Prdm16, Zbtb16 and Lin41 indeed drives non-limb fibroblasts to a limb progenitor-like state, we wanted to better understand the process by which this occurs. Accordingly, to explore the transcriptional dynamics of the reprogramming, we sub-clustered the cells at higher resolution (
[0080] At 14 days after infection and 3D culture, the infected, 3D cultured cells are clustered into four rLPC sub-states (r1, r2, r3, and E9) as well as three transit sub-states (T1, T2, T3), which are used as fates to construct trajectories (
[0081] The reconstructed rLPC trajectories suggest that by Day 4, the r1 cluster with high proliferative activity arise that dominate the contribution to the subsequent successful reprogrammed state (
Example 9. Reprogrammed rLPCs Differentiate into Limb Cell Types and Respond Properly to Limb Patterning Cues In Vitro
[0082] While rLPCs closely resembled limb progenitors at a transcriptional level, it was important to also establish whether they were capable of behaving as such at a functional level. To that end, we first asked if they acquired the capability to differentiate into cell types normally found in the developing limb bud. In this instance reprogramming was done without Lin41, as we wanted the rLPCs to be able to freely differentiate once culture conditions were changed. After reprogramming, GFP positive rLPCs were sorted by FACS and cultured in 96 well plastic plates under micromass culture conditions (a well-established in vitro system, used to study the differentiation of limb progenitors) in the presence of the growth factors we optimized for keeping limb progenitors undifferentiated. When the cultures became confluent, the growth factors were withdrawn to promote differentiation of the cells, and they were grown for 8 additional days. The chondrogenic capacity of the cells was then analyzed by Sox9 protein and Alcian blue staining, and qPCR for Sox9 (an early chondroprogenitor marker) and Aggrecan1 (Agc1) (a mature chondrocyte marker). We also assessed the capacity to differentiate into connective tissue by looking at expression levels of Scleraxis (Scx), a marker for tendon and ligament precursors (Schweitzer et al., 2001), and Odd-skipped related 2 (Osr2) a gene known to be required for specification of joint cells (Gao et al., 2011). Multiple clusters of differentiated reprogrammed cells stained positively with Sox9 and Alcian blue whereas unreprogrammed non-limb fibroblasts did not (
[0083] We next asked whether the reprogrammed cells would respond to patterning signals in a manner similar to endogenous limb progenitors. The optimized media we established for maintaining limb progenitors in culture already contained RA and Fgf8, two signals important for the establishment of proximodistal patterning in the limb buds (Cooper et al., 2011). We therefore examined targets of each of these factors that are upregulated during the normal patterning of the developing limb bud. Meis2, a downstream effector of RA signaling in the proximal limb bud and Dusp6, a readout of Fgf signaling in the distal limb bud, were both activated in the reprogrammed cells (
Example 10. Reprogrammed rLPCs Differentiate into Limb Cell Types In Vivo
[0084] While these results indicate that rLPCs can respond similarly to limb progenitors under artificial conditions in vitro and generate limb-specific cell types in that setting, it was important to determine whether they could also integrate into a developing limb bud and differentiate appropriately in vivo. To test this, we exploited a tetracycline-inducible lentivirus system (Stadtfeld et. al., 2008) (
[0085] rLPCs were generated by introducing Lin28a, Prdm16, Zbtb16 and Lin41 to non-limb fibroblasts via the lentivirus vectors, cultured in the presence of doxycycline, as well as the factors optimized for maintaining limb progenitors (
Example 11. Reprogramming Human Fibroblasts into Cells Resembling Limb Progenitors
[0086] The identification of a set of genes capable of reprogramming embryonic mouse non-limb fibroblasts into rLPCs holds the promise of providing new insight into the specification of the limb bud. In addition, however, this work suggests a potential route towards providing cells that can be used in a therapeutic setting, provided the process can be replicated starting with adult human cells. While a full characterization of human rLPCs would be beyond the scope of this study, we wanted to at least get an indication of whether the reprogramming factors we identified in the murine system would have a similar effect in human fibroblasts. To that end, adult human dermal fibroblasts were infected with lentiviruses transducing our three core reprogramming factors, Lin28a, Pdrm16 and Zbtb16, and were then placed in 3D culture under limb progenitor maintenance conditions. After 18 days, cell aggregates emerged, resembling plated mouse limb bud cells as well as those seen when reprogramming mouse non-limb fibroblasts (data not shown). We examined the expression of several limb progenitor markers (SALL4, LHX2 and NMYC) as well as EGR1 in these cells. All three limb progenitor markers were up-regulated in comparison with control human dermal fibroblasts, while EGR1 expression was diminished (data not shown). Of note, the expression patterns of NMYC and EGR1 were mutually exclusive (data not shown).
[0087] To get a more complete understanding of the transcriptional changes resulting from the reprogramming of the human dermal fibroblasts, we undertook a single-cell transcriptomic analysis of the human cultures infected with the Lin28a, Pdrm16, Zbtb16 lentiviruses, with or without co-infection of Lin41. Cells cultured in the 3D limb progenitor maintenance conditions for 18 days were compared to control human dermal fibroblasts grown in the same conditions (data not shown). These data further support the down-regulation of dermal fibroblast markers and up-regulations of limb progenitor markers (data not shown). A limitation of using human cells is the lack of legitimate embryonic human limb progenitors for comparison. Therefore, the human reprogrammed and control samples were aligned with the mouse single cell transcriptome embedding. This analysis indicates that the reprogrammed human dermal fibroblasts aligned with the early mouse limb progenitor state (data not shown).
[0088] Finally, to get preliminary indication of whether the reprogrammed human rLPCs have some of the same differentiation potential as limb bud cells, we conducted xenograft experiments in which the dissociated putative reprogrammed cells were transplanted into chicken limb buds. Unlike mouse non-limb fibroblasts, the grafted human dermal fibroblasts were able to engraft in the chicken limbs, however, they were completely excluded from cartilage elements and showed no Sox9 expression (data not shown). By contrast, a fraction of the grafted reprogrammed cells integrated into Sox9.sup.+ cartilage (data not shown), implying that the cells could differentiate into chondrocytes. The percentage of transplanted cells incorporated into the cartilage seemed to be much lower than with the mouse rLPCs. However, that was to be expected as, unlike the transgenic mouse cells, human dermal fibroblasts lacked the Prx1-GFP reporter, and hence the cultures could not be enriched for reprogrammed cells by FACS prior to transplantation. Taken together, these results suggest that human dermal fibroblasts are indeed transformed by the same reprogramming factors as in the mouse, towards a state that at least has characteristics in common with limb progenitors.
Materials and Methods for Examples 1-11
Mouse and Chicken Embryos
[0089] Mouse colonies were maintained in the vivarium at the New Research Building of Harvard Medical School. Prx1-CreER-IRES-GFP (hereafter Prx1-GFP) mice were provided by Shunichi Murakami (Case Western Reserve University)(Kawanami et al., 2009). Ai9 (Gt[ROSA]26Sor.sup.tm9[CAG-tdTomato]Hze) and CAG-GFP (C57BL/6-Tg [CAG-EGFP].sup.10sb/J) mouse strains were purchased from the Jackson Laboratory. Ai9 mice were crossed with Prx1-GFP mice to obtain Prx1-CreER-IRES-GFP:Rosa-CAG-LSL-tdTomato reporter embryos (Prx1-tdTomato). White leghorn eggs were obtained from Charles River. Chicken embryos were staged according to the Hamburger and Hamilton stages (HH) (Hamburger and Hamilton, 1951). All animal experiments were performed under the guidelines of the Harvard Medical School Institutional Animal Care and Use Committee.
Embryonic Fibroblast Isolation
[0090] Embryonic fibroblasts were derived from E13.5 Prx1-GFP or Prx1-tdTomato embryos (the head, neck, limbs, lateral plate mesoderm derived tissues, and internal organs were discarded). The dissected embryos were minced with a razor blade and incubated in 0.25% Trypsin (Sigma) for 15 min. The suspension was plated in Gelatin (Millipore)-coated 15-cm tissue culture dishes in DMEM/10% FBS/1% Pen-Strep media (DMEM/FBS). The cells were grown at 37? C. in 5% CO.sub.2 until confluent, and GFP- or GFP/tdTomato-negative fibroblasts were collected by a FAC sorter Astrios (Beckman Coulter). After the sorted cells were grown until confluent, the cells were split once before being frozen (Passage 3).
Matrigel Coating
[0091] 200 ul of Matrigel (Corning) is diluted with 200 ul of chilled OPTI-MEM (gibco) (1:1 dilution), and the diluted Matrigel was placed in a well of a 24-well plate (Corning). The plate was incubated to be gelatinized in a cell culture chamber at 37? C. for 30 min.
Harvest and Culture of Limb Progenitors
[0092] Forelimb (FL) buds from E9.5 Prx1-GFP mouse embryos or HH18 GFP-chicken embryos were dissected out and incubated in 0.25% Trypsin for 5-10 min at room temperature to loosen ectodermal tissues. After the surface ectoderm was removed by fine forceps, limb progenitors (LPs) were dissociated gently by pipetting and pelleted by centrifugation. The cells were re-dissociated by culture media, and LPs obtained from two limb buds were placed in one well of 24-well plate dishes, a hyaluronan (HA)-based hydrogel (CELENYS) or a well of Matrigel-coated 24-well plate dishes. To make the LP culture media (CFRSY media), DMEM/FBS was supplemented with 3 ?M Chir99021 (Tocris), 150 ng/ml Fgf8 (R&D Systems), 25 nM Retinoic acid (Tocris), 5 ?M SB431542 (Sigma-Aldrich), 10 ?M Y-27632 (Cayman Chemical), 55 ?M 2-Mercaptoethanol (gibco), and MEM Non-Essential Amino Acids Solution (100?, NEAA, gibco). The media was changed every other day until Day6, and then changed every day until Day10.
Quantitative PCR (qPCR)
[0093] RNA was extracted using Tryzol (Invitrogen) or RNeasy Mini kit (Qiagen). For qPCR of Lin28a, RNAs were extracted from FL, HL and flank mesenchyme located between FL and HL buds at E9.5 CD1 mouse embryos by using RNeasy Mini kit. To recover RNA from the cells cultured in the HA-hydrogels, the cells in the gels were lysed in 1 ml Trizol (for 1 to 5 hydrogels) by vortexing for 5 min. 200 ?l of Chloroform (Sigma-Aldrich) was added and vortexed for 10 sec, and then incubated for 3 min at room temperature. After centrifugation (10,000 g, 20 min, 4? C.), aqueous phase was collected, and 500 ?l isopropanol was added. After centrifugation and two washes with 80% ethanol, RNA pellets were dissolved in RNase-free water and kept at ?80? C. until use. The collected RNA was reverse-transcribed by SuperScript III First-Strand Synthesis System (Thermo Fisher). PCR reaction was performed by using Brilliant III Ultra-Fast SYBR Green QPCR kit (Agilent) and CFX Touch Real-Time PCR Detection System (Bio-Rad). Relative expression levels were calculated by the ??Cq method. Sequences (5-3) of primers for qPCR are described in Table S4.
Plasmid Construction
[0094] The coding regions of candidate genes were PCR-amplified from mouse embryo derived cDNA or purchased clones (Thermo Scientific). The PCR-amplified sequences were cloned into pDONR221 using the Gateway BP reaction mix (Invitrogen). The resulting entry clones were then recombined with pMXs-gw (Gift from Shinya Yamanaka; Addgene #18656) using the Gateway LR reaction mix (Invitrogen). For FUW-TetO-Prdm16 and FUW-TetO-Lin41, cDNAs of Prdm16 and Lin41 were amplified by PCR from pMXs-Prdm16 and pMXs-Lin41 inserted to FUW-TetO-MCS (Addgene #84008) using Gibson Assembly Mix (New England Biolabs), respectively. To obtain pT2A-CAGGS-H2B-mCherry-IRES-ZsGreen1 and pT2A-CAGGS-EGR1-IRES-ZsGreen1, cDNAs of H2B-mCherry and EGR1 were integrated into pT2A-CAGGS-IRES-ZsGreen1 (Atsuta and Takahashi, 2016). For pBS-cSall4, pBS-cLin28a, pBS-cLin41 and pBS-cEgrl, the sequences amplified by PCR from HH18 or HH24 FL cDNA libraries that were generated by SuperScript III First-Strand Synthesis System (Thermo Fischer) were cloned into pBS-D (a gift from Dr. Daisuke Saito [Kyushu University]).
Viral Production
[0095] Plat-E cells (Morita et al., 2000) were grown to 60-70% confluency in 10-cm dishes. pMXs-based retroviral vectors were transfected using Polyethylenimine (PEI, PolyScience). 30 ?l of PEI (1 mg/ml) was diluted in 70 ?l OPTI-MEM and incubated for 5 min at room temperature. 10 ?g plasmid DNA was added to 100 ?l OPTI-MEM, and then PEI and plasmid DNA solutions were combined and vortexed vigorously. The mixture was incubated for 30 min, and was added to the Plat-E cells. The cells were incubated for 24 hrs, and the media was replaced with 5 ml of fresh DMEM/FBS. The cells were incubated for another 24 hrs. 48 hrs after the initial transfection, the supernatant was collected and filtered. For production of lentiviruses, 293T cells were cultured up to 50-60% confluency in 10-cm dishes. 40 ?l of PEI was diluted in 60 ?l OPTI-MEM and incubated for 5 min at room temperature. 7.5 ?g plasmid DNA carrying the reprogramming factor, 4.5 ?g psPAX2 and 1.5 ?g VSV-G plasmids were added to PEI solution, and the transfectant was incubated for 30 min. Then, the mixture was added to 293T cells, and 48 hrs after the transfection, the supernatant was harvested and filtrated through 0.45-?m SFCA syringe filters (Corning).
Reprogramming Assays:
Reprogramming for Mouse Embryonic Fibroblasts Using HA-Hydrogels
[0096] At 60-70% confluency, mouse embryonic fibroblasts (Prx1-GFP negative) were cultured in the supernatant of retroviruses carrying the candidate factors for 24 hrs in the presence of Polybrene (8 ?g/ml; Sigma-Aldrich) at 37? C. (Day 0), and the media was replaced with DMEM/FBS containing 2-Mercaptoethanol and NEAA (Day 0). 48 hrs after viral infection, the media was supplemented with 3 ?M Chir99021, 150 ng/ml Fgf8, 25 nM Retinoic acid, 10 ?M Y-27632, 55 ?M 2-Mercaptoethanol, and Non-Essential Amino Acids (CFRY media; Day2). 48 hrs after CFRY administration, the viral infected cells were detached by Trypsin/EDTA, and the cells from each well of 24-well plates were suspended in 20 ?l of CFRSY media (CFRY plus 5 ?M SB431542). Subsequently, the cell suspension was loaded on the top of the HA-gels, and the gels were incubated for 30 min at 37? C. After incubation, the HA-gels were placed in 200 ?l of CFRSY media, and the media was changed with the fresh CFRSY media every two days from Day4 to 10, every day from Day11 to 14. See also the schematics in
Reprogramming for Mouse Embryonic Fibroblasts Using Matrigel
[0097] At 60-70% confluency, GFP/tdTomato-negative fibroblasts from Prx1-tdTomato mice were cultured in the supernatant of lentiviruses carrying Prdm16, Zbtb16, Lin28a, and Lin41 (PZLL) for 24 hrs in the presence of Polybrene (8 ?g/ml) at 37? C. (Day ?1). The media was replaced with DMEM/FBS containing 2 ?g/ml of Doxycycline (Dox; Sigma-Aldrich), 2-Mercaptoethanol and NEAA (Day 0). Next day the media was replaced with CFRY media containing Dox (CFRYD media; Day 1). 48 hrs after Dox administration, the cells were dissociated with TryPLE Express, and plated on Matrigel. The media was supplemented with CFRSYD media (Day 3), and was changed with the fresh CFRSYD media every two days from Day4 to 10, every day from Day11 to 14. 4-hydroxy tamoxifen (Calbiochem) was added to the media at Day 12 and Day13, to induce Prx1-tdTomato. See also the schematics in
Reprogramming for Human Adult Fibroblasts Using Matrigel
[0098] Similar to mouse cell reprogramming, human fibroblasts (iXCells Biotechnologies) were transduced with lentiviruses to misexpress PZLL at 60-70% confluency. After 2 day-culture of DMEM/FBS/Dox and another 2 day-culture with CFRY/Dox, the cells were transferred onto Matrigel bed and cultured for additional 14 days with CFRSY/Dox media. The total culture term was 18 days.
Immunostaining
[0099] For immunohistochemical staining, the following antibodies were used as described previously (Atsuta et al., 2019): anti-GFP (1:1000; Sigma), anti-Lhx2 (1:500; Millipore-Sigma), anti-Sall4 (1:500; Abcam), anti-Sox9 (1:500; Millipore-Sigma), anti-EGR1 (1:250; Thermo Fisher), anti-Collagen type I (1:100; Rockland), anti-Nmyc (1:500; Santa Cruz Biotechnology), anti-Tfap2c (1:500; Santa Cruz Biotechnology), anti-Msx1/2 (1:100; DSHB), anti-pH3 (1:500; Millipore-Sigma), anti-Collagen type II (1:100; DSHB), anti-MHC (1:50; DSHB), and anti-Human nuclei (1:250; Millipore-Sigma). For staining of Col2A1, an antigen retrieval using Target Retrieval Solution (DAKO) was performed in advance of blocking. To stain the 3D-cultured cells embedded in the HA-gel or Matrigel, the cells in the gels were placed in 1% PFA/PBS overnight at 4? C. The next day, the gels with the cells were incubated in 0.5% Triton X-100 (Sigma-Aldrich)/PBS for 15 min at room temperature, and then in 1% Blocking Reagent (Roche)/TNT buffer for 1 hr at room temperature, followed by primary and secondary antibody incubations. The stained cells were placed on a glass-bottom dish (MatTek), and images were taken by the confocal microscope LSM710 (Carl Zeiss).
Micromass Culture and Alcian Blue Staining
[0100] Micromass culture and alcian blue staining were performed as previously described (Atsuta et al., 2019). Fibroblasts and LPs from E9.5 Prx1-GFP mouse forelimb (FL) buds, and Prx1-GFP positive reprogrammed cells were used to generate micromass cultures. ?5?10.sup.4 cells per 20 ?l of DMEM/FBS were dropped into each well of 96-well. After being attached, the cells were cultured in the presence of CFRSY for 2 days, and then in DMEM/FBS for 8 days.
Probes and In Situ Hybridization
[0101] Whole mount in situ hybridization for HH15 and HH17 chicken embryos was performed as described in (Tonegawa et al., 1997). cDNA sequences for chicken Sall4, Lin28a, Lin41 and Egr1 are described in Supplemental Table 4. RNA probes were transcribed using DIG-RNA labeling Mix (Roche) and T3 RNA polymerase (Roche), and the probes were detected with NBT/BCIP solution (Roche).
In Ovo Electroporation
[0102] The in ovo electroporation was performed as previously described (Atsuta et al., 2019). Briefly, eggs were incubated for approximately 54 hrs at 38? C. DNA solution was prepared at 4 ?g/?l, and injected into the coelomic cavity of HH14 embryos. Three electric pulses of 50 V, 2 ms, were given, followed by 7 pulses of 5 V, 10 ms, with 10-ms interval between pulses (Super Electroporator NEPA21-type II, NEPA GENE).
Tamoxifen and 4-Hydroxy Tamoxifen (4-OHT) Treatment
[0103] Tamoxifen was dissolved in corn oil (Sigma-Aldrich), and 1 mg of tamoxifen was given to E8.5 Prx1-tdTomato pregnant dams by intraperitoneal injections; 2 ?M of 4-OHT (Calbiochem) was used for reprogramming experiments to activate CreER proteins.
Cell Transplantation to Chicken Embryos
[0104] For cell injection, LPs from E9.5 CAG-GFP mouse FL, fibroblasts infected with lentiviruses carrying mCherry, and Prx1-tdTomato positive reprogrammed cells were used. The LPs form 10 FL buds were dissociated in 100 ?l of DMEM/FBS. The mCherry-expressing fibroblasts and the tdTomato-reprogrammed cells were retrieved from one well of 24-well plates using TryPLE Express, and after pelleted, the cells were dissociated with 50 ?l of DMEM/FBS. The cell suspension was injected in FL buds of HH20 chicken embryos, and the embryos were harvested at HH32.
RNA-Seq Library Preparation
[0105] Fertilized chicken eggs were incubated at 38? C. FL and HL buds were dissected from HH18 embryos. Flank and neck mesenchyme were dissected from HH19 embryos (to allow for enough accumulation of mesenchymal cells). Neck tissue was located in the mesenchyme directly above the FL bud. Loose ectodermal tissues were removed and remaining mesenchyme was placed in TRIzol (Invitrogen) for RNA extraction. RNA-Seq on chick RNA was carried out as previously described (Christodoulou et al., 2014). Libraries were constructed without RNA or cDNA fragmentation and did not include normalization. Uniform amplification was achieved with amplification cycling before the reaction reached saturation, as determined by qPCR. Following Hi-Seq (Illumina) sequencing, reads were aligned using Tophat (version 1.4.0) (Trapnell et al., 2009).
Dissociation and FAC-Sorting of 3D Cultured Cells Before scRNA-Seq
[0106] For sorting reprogrammed Prx1-GFP or Prx1-tdTomato cells, a FACS sorter Astrios (Beckman Coulter) or On-chip Sort HSG (On-chip Biotechnologies) was used. After washing with PBS, the cells cultured in the HA-gels or on Matrigel were incubated in TryPLE Express (gibco) for 30 min at 37? C. The cell suspension was pipetted with cut P1000 pipette tips every 10 min, to completely dissociate the cell clusters. The suspension was filtrated by 100 m Cell strainers (Falcon) and 40 ?m Cell strainers (VWR), and cells were pelleted by centrifugation (400?g for 5 min). The pellets were dissociated by DRAQ5/DAPI in 0.1% BSA/PBS and incubated for 5 min before the sorting. DRAQ5-positive, DAPI-negative cells were sorted for cells on reprogramming at day 2, 4, 8. For HA-gel reprogrammed cells at day 14, additional gating on GFP channel derived GFP-positive and GFP-negative samples. For Matrigel-derived day 14 reprogrammed cells for PZL- as well as PZLL-factors, only GFP-positive cells were collected. DRAQ5-positive, DAPI-negative, Matrigel-derived day 8 cultured E9.5 and E10.5 limb progenitors were collected. The E9.5 cultured limb progenitors were subject to 4-OHT, such that large fraction were tdtomato-positive, but the cells were collected regardless of tdTomato-positivity. DRAQ5-positive, DAPI-negative, tdTomato-positive cells were sorted for the limb mesenchyme cells for E10.5, E11.5 as well as E12.5 cells. For E9.5 limb progenitors, samples were collected without tdTomato gating to maximize yield.
Single-Cell RNA-Seq Library Preparation:
[0107] InDrops scRNA-Seq
[0108] LPs were obtained from E9.5 and E10.5 mouse FL buds. HA-gel derived reprogrammed cells (PZL-factor) and empty controls, as well as CFSRY cultured NonLFs were collected and processed individually. cDNA library preparation was performed by Single Cell Core (HMS).
10?Genomics scRNA-seq
[0109] FAC-sorted LPs were obtained from E9.5 and E10.5 Prx1-tdTomato mouse FL buds. All libraries included about 10-15% of MEF cells to mitigate batch effect. cDNA library preparation was performed by using 10? Genomics Chromium Single Cell 3 (v.3 Chemistry; 10? Genomics) gene-expression kit, according to manufacturer's instructions. Gel beads in emulsion (GEM) formation was performed with a Chromium Controller (10? Genomics; Biopolymer Facility at HMS). cDNA library was prepared in house.
Single-Cell RNA-Seq Sequencing
[0110] InDrops libraries were sequenced with Illumina Nextseq 500 platform, using paired-end reads with the read length configuration recommended by InDrops (61 bp for transcript, 14 bp for barcode and UMI, 8 bp i7 index for part of barcode, 8 bp i5 index for sample index). 10? Genomics libraries were sequenced with Illumina Nextseq 500 platform as well as Novaseq 6000 platform. For Nextseq 500, recommended configuration by 10? Genomics (28 bp for cell barcode 1 and UMI, 8 bp i7 index for sample index, 98 bp for transcript) we used. For Novaseq, 150 bp paired-end sequencing with sample i7 index were used (compatible with the 10? Genomics cellranger count matrix mapping software).
RNA-Seq analyses
[0111] Analysis on transcriptome gene expression was conducted in R. The pvclust package (Suzuki and Shimodaira, 2006) was used to perform principal component analysis. The AnimalTFDB (Zhang et al., 2012) online resource was used to select transcription factors from the chick and mouse genomes.
Single-Cell RNA-Seq Analyses
Transcriptome Annotation
[0112] For mouse samples, Ensembl release 98 mm10 transcriptome was used as base transcriptome annotation, with pseudogenes filtered from the GTF file using cellranger mkgtf command. For retroviral infected hyaluronan samples, transgenes for human Lin28a, EGFP (for Prx1GFP transgene) was added to generate custom transcriptome annotation for quantification for reprogrammed cells. For lentiviral infected Matrigel samples, transgenes for EGFP (for Prx1GFP transgene), rtTA, and human Lin41 as well as PLZF, and 3UTR sequences of WPRE were added to generate custom transcriptome annotation for quantification for reprogrammed cells. The limb progenitors were subject to the same transcriptome annotation (yielding zero counts for the transgenes). All four human samples were multiplexed with mouse and chick samples (Supplementary Table 1). The chick data was not presented in this manuscript. Thus, for species demultiplexing, Ensembl release 99 hg38 transcriptome, Ensembl release 98 Gallus gallus-6.0 transcriptome and the filtered Ensembl release 98 mm10 transcriptome was merged using the cellranger mkgtf command to generate human-mouse-chick transcriptome for initial mapping for demultiplexing. For human-specific mapping, the filtered hg38 transcriptome with transgenes for EGFP, rtTA, and mouse Prdm16 and mouse Lin28a were added. For the limb progenitor samples processed with 10? genomics, tdtomato, EGFP transgenes were added for mapping.
InDrop Preprocessing Sequencing results were demultiplexed by dropTag from dropEst package (Petukhov et al. 2018). The demultiplexed reads were aligned with STAR aligner (Dobin et al. 2013). The aligned reads were split into forward and reverse alignment, since InDrops is directional. The resulting forward and reverse alignment files were quantified using dropEst package including directional UMI correction option (Petukhov et al. 2018) with transcriptome annotation split into forward and reverse direction to avoid mapping of antisense reads.
10? Data Processing
[0113] Sequencing results were demultiplexed by cellranger and aligned using cellranger count (internally by STAR aligner (Dobin et al. 2013)). For the four libraries that needed species demultiplexing, cellular barcodes that had less than 5% of UMI counts from other species were selected for subsequent mapping with the corresponding species transcriptome (see above).
Quality Control and Clustering
[0114] Cellular barcodes with high mitochondrial content (>15%), high hemoglobin gene count (>10%) and low gene counts (<1,200) were filtered out. All libraries were subject to doublet detection via Scrublet (Wolock et al. 2019). The overall findings were not sensitive to the identified doublets. Batch effect was assessed by simply merging the individual UMI count matrices for clustering, which revealed dominant batch effect by technology (InDrop vs 10?) and time (the last 10? batch was separated by several months due to the pandemic). Thus, Seurat v3 integration procedure (SCTransform based) was applied (Stuart, Butler et al. 2019) with 30 dimensions for the individual batches. Further, cell cycle effect, a fraction of mitochondrial genes was regressed out. Principal component analysis (PCA) was performed on the integrated, scaled features for dimensional reduction and Uniform Manifold Approximation and Projection (UMAP) (McInnes et al. 2018) was used primarily for the cellular embedding coordinates. Leiden algorithm was applied on the neighbor graph with 10 iterations (Seurat default) to derive cluster boundaries (Traag et al. 2019). For all steps of clustering, the number of principal components were determined by observing the elbow of variance explained by the principal components, however, robustness of the relationship was confirmed by changing the number of principal components and deriving essentially similar relationship. Thus, 20 principal components were used for downstream processing. Resolution parameter of 0.2 was used for gross subdivision of all cells into 7 clusters (
Differentially Expressed Gene Analysis, Gene Set Overlap Analysis
[0115] Differentially expressed gene analysis (
Waddington Optimal Transport (WOT) Analysis
[0116] The Waddington Optimal Transport analysis estimates the growth rate based on the cell cycle as well as apoptosis gene scores, calculated by z-score normalization (Schiebinger et al. 2019). Combat batch correction (Johnson et. al 2007) provided by scanpy framework was applied to the log-normalized UMI expression level before deriving the z-scores. The resulting cell cycle score as well as apoptosis score was used to infer the initial cell growth estimates, and growth fraction estimation as well as transport maps for control virus-infected time series, PZL (Prdm16+Ztbt16+Lin28a; 3-factor lentiviral expression)-infected time series, PZLL (Prdm16+Ztbt16+Lin28a+Lin41; 4-factor lentiviral expression)-infected time series were calculated separately with the following parameters: epsilon=0.05, lambda1=1, lambda2=50, growth_iteration=3. The choice of parameters were not sensitive for the overall findings. Since the day 8 PZL scRNA-seq had very low coverage, transcriptomes from day 8 PZLL-infected cells that do not show expression of transgene human Lin41 were included for the inference of this intermediate stage inference. Based on the transport maps, the ancestor and descendant relationship was calculated resulting in transition matrices between time points. The resulting transition tables were used to construct the alluvial diagrams used in
Human/Mouse scRNA-Seq Data Processing
[0117] The four human UMI count matrices were merged first and only orthologous genes (1:1 matching) from the human transcriptome based on biomaRt (Durinck et al., 2009) were translated into mouse genes. The resulting matrix were integrated with the mouse libraries treating the human libraries as a separate batch (SCTransform-based Seurat integration). All subsequent clustering steps were identical to the mouse-only analysis.
REFERENCES
[0118] Agarwal, P., Wylie, J. N., Galceran, J., Arkhitko, O., Li, C., Deng, C., Grosschedl, R., and Bruneau, B. G. (2003). Tbx5 is essential for forelimb bud initiation following patterning of the limb field in the mouse embryo. Development 130, 623-633. [0119] Ahlmann-Eltze, C. and Huber, W. (2020). glmGamPoi: Fitting gamma-poisson generalized linear models on single cell count data. Bioinfomatics, btaa1009. [0120] Amezquita, R. A., Lun, A. T. L., Becht, E., Carey, V. J., Carpp, L. N., Marini, F, Rue-Albrecht, K., Risso, D., Soneson, C., Waldron, L., et al. (2020). Orchestrating single-cell analysis with Bioconductor. Nat. Methods 17, 137-145. [0121] Atsuta, Y., and Takahashi, Y. (2016). Early formation of the M?llerian duct is regulated by sequential actions of BMP/Pax2 and FGF/Lim1 signaling. Development 143, 3549-3559. [0122] Atsuta, Y., Tomizawa, R. R., Levin, M., and Tabin, C. J. (2019). L-type voltage-gated Ca.sup.2+ channel CaV1.2 regulates chondrogenesis during limb development. Proc. Natl. Acad. Sci. USA 116, 21592-21601. [0123] Balzeau J, Menezes M R, Cao S, Hagan J P. (2017). The Lin28/let-7 Pathway in Cancer. Front Genet. 28; 8:31. [0124] Barna, M., Hawe, N., Niswander, L., and Pandolfi, P. P. (2000). Plzf regulates limb and axial skeletal patterning. Nat. Genet. 25, 166-172. [0125] Barna M, Pandolfi P P, Niswander L. (2005). Gli3 and Plzf cooperate in proximal limb patterning at early stages of limb development. Nature 436(7048):277-81. [0126] Becht, E., McInnes, L., Healy, J., Dutertre, C. A., Kwok, H., Ng, L. G., Ginhoux, F., and Newell, E. (2018). Dimensionality reduction for visualizing single-cell data using UMAP. Nat. Biotechnol. 37, 38-44. [0127] Bjork B C, Turbe-Doan A, Prysak M, Herron B J, Beier D R. (2010). Prdm16 is required for normal palatogenesis in mice. Hum Mol Genet. 19(5):774-89. [0128] Bohm, J., Buck, A., Borozdin, W., Mannan, A. U., Matysiak-Scholze, U., Adham, I., Schulz-Schaeffer, W., Floss, T., Wurst, W., Kohlhase, J., et al. (2008). Sall1, sall2, and sall4 are required for neural tube closure in mice. Am. J. Pathol. 173, 1455-1463. [0129] Brunson, J. C. (2020). ggalluvial: layered grammar for Alluvial plots. J. Open Source Software 5, 2017. [0130] Buganim, Y., Markoulaki, S., van Wietmarschen, N., Hoke, H., Wu, T., Ganz, K., Akhtar-Zaidi, B., He, Y., Abraham, B. J., Porubsky, D., et al. (2014). The developmental potential of iPSCs is greatly influenced by reprogramming factor selection. Cell Stem Cell 15, 295-309. [0131] Butler, A., Hoffman, P., Smibert, P., Papalexi, E., and Satija, R. (2018). Integrating single-cell transcriptomic data across different conditions, technologies, and species. Nat. Biotechnol. 36, 411-420. [0132] Caiazzo, M. O., Y.; Ranga, A.; Piersigilli, A.; Tabata, Y.; Lutolf, M. P. (2016). Defined three-dimensional microenvironments boost induction of pluripotency. Nat. Mater. 15, 344-352. [0133] Capellini, T. D., Giacomo, G. D., Salsi, V. Brendolan, A., Ferretti, E., Srivastava, D. Zppavigna, V. and Selleri, L. (2006). Pbx1/Pbx2 requirement for distal limb patterning is mediated by the hierarchical control of Hox gene spatial distribution and Shh expression. Development 133, 2263-2273. [0134] Cel? P, BalkovA S M, Bryjovd A, HorikovA D, Misek I, Richman J M, Buchtovi M. (2013). Expression, function and regulation of Evi-1 during embryonic avian development. Gene Expr Patterns. 13(8):343-53. [0135] Chapman, S. C., Lawson, A., Macarthur, W. C., Wiese, R. J., Loechel, R. H., Burgos-Trinidad, M., Wakefield, J. K., Ramabhadran, R., Mauch, T. J., and Schoenwolf, G. C. (2005). Ubiquitous GFP expression in transgenic chickens using a lentiviral vector. Development 132, 935-940. [0136] Chen, H., Lun, Y., Ovchinnikov, D., Kokubo, H., Oberg, K., Pepicelli, C., Gan, L., Lee, B., and Johnson, R. (1998). Limb and kidney defects in Lmx1b mutant mice suggest an involvement of LMX1B in human nail patella syndrome. Nat. Genet. 19, 51-55. [0137] Chen, Y., and Gridley, T. (2013). Compensatory regulation of the Snail and Snai2 genes during chondrogenesis. J. Bone Miner. Res. 28, 1412-1421. [0138] Chen, Y., Xu, H. and Lin, G. (2017). Generation of iPSC-derived limb progenitor-like cells fro stimulating phalange regeneration in the adult mouse. Cell Disco. 3, Article number: 17046. [0139] Christodoulou, D. C., Wakimoto, H., Onoue, K., Eminaga, S., Gorham, J. M., DePalma, S. R., Herman, D. S., Teekakirikul, P., Conner, D. A., McKean, D. M., et al. (2014). 5RNA-Seq identifies Fhll as a genetic modifier in cardiomyopathy. J Clin. Invest. 124, 1364-1370. [0140] Cooper, K. L., Hu, J. K., ten Berge, D., Fernandez-Teran, M., Ros, M. A., and Tabin, C. J. (2011). Initiation of proximal-distal patterning in the vertebrate limb by signals and growth. Science 332, 1083-1086. [0141] Dobin, A., Davis, C. A., Schlesinger, F., Drenkow, J., Zaleski, C., Jha, S., Batut, P., Chaisson, M., and Gingeras, T. R. (2013). STAR: ultrafast universal RNA-seq aligner. Bioinformatics 29, 15-21. [0142] Dup?, V., Ghyselinck, N. B., Thomazy, V., Nagy, L., Davies, P. J., Chambon, P., and Mark, M. (1999). Essential roles of retinoic acid signaling in interdigital apoptosis and control of BMP-7 expression in mouse autopods. Dev. Biol. 208, 30-43. [0143] Durinck, S., Spellman, P. T., Birney, E., and Huber, W. (2009). Mapping identifiers for the integration of genomic datasets with the R/Bioconductor package biomaRt. Nat. Protoc. 4, 1184-1191. [0144] Ecsedi, M., and Grosshans, H. (2013). LIN-41/TRIM71: emancipation of a miRNA target. Genes Dev. 27, 581-589. [0145] Gao, Y., Lan, Y., Liu, H., and Jiang, R. (2011). The zinc finger transcription factors Osr1 and Osr2 control synovial joint formation. Dev. Biol. 352, 83-91. [0146] Gros, J., and Tabin, C. J. (2014). Vertebrate limb bud formation is initiated by localized epithelial-to-mesenchymal transition. Science 343, 1253-1256. [0147] Haghverdi, L., Lun, A. T. L., and Marioni, J. C. (2018). Batch effects in single-cell RNA-sequencing data are corrected by matching mutual nearest neighbors. Nat. Biotechnol. 36, 421-427. [0148] Hamburger, V., and Hamilton, H. L. (1951). A series of normal stages in the development of the chick embryo. J. Morphol. 88, 49-92. [0149] Healy, C., Uwanogho, D., and Sharpe, P. T. (1999). Regulation and role of Sox9 in cartilage formation. Dev. Dyn. 215, 69-78. [0150] Izpisua Belmonte, J. C., Brown, J. M., Crawley, A., Duboule, D., and Tickle, C. (1992). Hox-4 gene expression in mouse/chicken heterospecific grafts of signalling regions to limb buds reveals similarities in patterning mechanisms. Development 115, 553-560. [0151] Johnson, W. E., Li, C. and Rabinovic, A. (2007). Adjusting batch effects in microarray expression data using empirical Bayes methods. Biostatistics 8, 118-127. [0152] Kawamura, T., Suzuki, J., Wang, Y. V., Menendez, S., Morera, L. B., Raya, A., Wahl, G. M., and Izpisua Belmonte, J. C. (2009). Linking the p53 tumour suppressor pathway to somatic cell reprogramming. Nature 460, 1140-1144. [0153] Kawanami, A., Matsushita, T., Chan, Y. Y., and Murakami, S. (2009). Mice expressing GFP and CreER in osteochondro progenitor cells in the periosteum. Biochem. Biophys. Res. Commun. 386, 477-482. [0154] Korsunsky, I., Nathan, A., Millard, N., and Raychaudhuri, S. (2019). Presto scales Wilcoxon and auROC analyses to millions of observations. bioRxiv. [0155] Lancman, J. J., Caruccio, N. C., Harfe, B. D., Pasquinelli, A. E., Schageman, J. J., Pertsemlidis, A., and Fallon, J. F. (2005). Analysis of the regulation of lin-41 during chick and mouse limb development. Dev. Dyn. 234, 948-960. [0156] Li, Y., Toole, B. P., Dealy, C. N., and Kosher, R. A. (2007). Hyaluronan in limb morphogenesis. Dev. Biol. 305, 411-420. [0157] Liberzon, A., Subramanian, A., Pinchback, R., Thorvaldsd?ttir, H., Tamayo, P., and Mesirov, J. P. (2011). Molecular signatures database (MSigDB) 3.0. Bioinformatics 27, 1739-1740. [0158] Lin, G., Chen, Y., and Slack, J. M. W. (2013). Imparting regenerative capacity to limbs by progenitor cell transplantation. Dev. Cell 24, 41-51. [0159] Lin, X., Huang, J., Chen, T., Wang, Y., Xin, S., Li, J., Pei, G., and Kang, J. (2008). Yamanaka factors critically regulate the developmental signaling network in mouse embryonic stem cells. Cell Res. 18, 1177-1189. [0160] Madl, C. M., LeSavage, B. L., Dewi, R. E., Dinh, C. B., Stowers, R. S., Khariton, M., Lampe, K. J., Nguyen, D., Chaudhuri, O., Enejder, A., et al. (2017). Maintenance of neural progenitor cell stemness in 3D hydrogels requires matrix remodelling. Nat. Mater. 16, 1233-1242. [0161] Melton, C., Judson, R. L. and Blelloch, R. (2010). Opposing microRNA families regulate self-renewal in mouse embryonic stem cells. Nature 463, 621-626. [0162] Mori, S., Sakakura, E., Tsunekawa, Y., Hagiwara, M., Suzuki, T., and Eiraku, M. (2019). Self-organized formation of developing appendages from murine pluripotent stem cells. Nat. Commun. 10, Article number: 3802. [0163] Morita, S., Kojima, T., and Kitamura, T. (2000). Plat-E: an efficient and stable system for transient packaging of retroviruses. Gene Ther. 7, 1063-1066. [0164] Nishimoto, S., Minguillon, C., Wood, S., and Logan, M. P. (2015). R A acts in a coherent feed-forward mechanism with Tbx5 to control limb bud induction and initiation. Cell Rep. 12, 879-891. [0165] Perkins A S, Mercer J A, Jenkins N A, Copeland N G. (1991). Patterns of Evi-1 expression in embryonic and adult tissues suggest that Evi-1 plays an important regulatory role in mouse development. Development 111(2):479-87. [0166] Petukhov, V., Guo, J., Baryawno, N., Severe, N., Scadden, D. T., Samsonova, M. G., and Kharchenko, P. V. (2018). dropEst: pipeline for accurate estimation of molecular counts in droplet-based single-cell RNA-seq experiments. Genome Biol. 19, Article number: 78. [0167] Rao, N., Jhamb, D., Milner, D. J., Li, B., Song, F., Wang, M., Voss, S. R., Palakal, M., King, M. W., Saranjami, B., Nye, H. L., Cameron, J. A., and Stocum, D. L. (2009). Proteomic analysis of blastema formation in regenerating axolotl limbs. BMC Biol. 7, 83. [0168] Rodriguez-Esteban, C., Schwabe, J. W., Pena, J. D., Rincon-Limas, D. E., Magall?n, J., Botas, J., and Izpisda Belmonte, J. C. (1998). Lhx2, a vertebrate homologue of apterous, regulates vertebrate limb outgrowth. Development 125, 3925-3934. [0169] Rodriguez-Esteban, C., Schwabe, J. W. R., La Pena, D. L., Rincon-Limas, D. E., Magall?n, J., Botas, J. and Izpisua Belmonte, J. C. (1998). Lhx2, a vertebrate homologue of apterous, regulates vertebrate limb outgrowth. Development 125, 3925-3934. [0170] Ros, M. A., Lyons, G. E., Mackem, S., and Fallon, J. F. (1994). Recombinant limbs as a model to study homeobox gene regulation during limb development. Dev. Biol. 166, 59-72. [0171] Schiebinger, G., Shu, J., Tabaka, M., Cleary, B., Subramanian, V., Solomon, A., Gould, J., Liu, S., Lin, S., Berube, P., et al. (2019). Optimal-transport analysis of single-cell gene expression identifies developmental trajectories in reprogramming. Cell 176, 928-943. [0172] Schweitzer, R., Chyung, J. H., Murtaugh, L. C., Brent, A. E., Rosen, V., Olson, E. N., Lassar, A., and Tabin, C. J. (2001). Analysis of the tendon cell fate using Scleraxis, a specific marker for tendons and ligaments. Development 128, 3855-3866. [0173] Stadtfeld, M., Maherali, N., Breault, D. T., and Hochedlinger, K. (2008). Defining molecular cornerstones during fibroblast to iPS cell reprogramming in mouse. Cell Stem Cell 2, 230-240. [0174] Stuart, T., Butler, A., Hoffman, P., Hafemeister, C., Papalexi, E., Mauck III, W. E., Hao, Y., Stoecklus, M., Smibert, P., and Satija, R. (2019). Comprehensive integration of single-cell data. Cell 177, 1888-1902. [0175] Subramanian, A., Tamayo, P., Mootha, V. K., Mukherjee, S., Ebert, B. L., Gillette, M. A., Paulovich, A., Pomeroy, S. L., Golub, T. R., Lander, E. S., and Mesirov, J. P. (2005). Gene set enrichment analysis: a knowledge-based approach for interpreting genome-wide expression profiles. Proc Natl Acad Sci USA 102, 15545-15550. [0176] Suzuki, R., and Shimodaira, H. (2006). Pvclust: an R package for assessing the uncertainty in hierarchical clustering. Bioinformatics 22, 1540-1542. [0177] Takahashi, K., and Yamanaka, S. (2006). Induction of pluripotent stem cells from mouse embryonic and adult fibroblast cultures by defined factors. Cell 126, 663-676. [0178] Takahashi, K., and Yamanaka, S. (2015). A developmental framework for induced pluripotency. Development 142, 3274-3285. [0179] Takeuchi, J. K., Koshiba-Takeuchi, K., Suzuki, T., Kamimura, M., Ogura, K., and Ogura, T. (2003). Tbx5 and Tbx4 trigger limb initiation through activation of the Wnt/Fgf signaling cascade. Development 130, 2729-2739. [0180] Tarchini, B., Duboule, D., and Kmita, M. (2006). Regulatory constraints in the evolution of the tetrapod limb anterior-posterior polarity. Nature 443, 985-988. [0181] Tonegawa, A., Funayama, N., Ueno, N., and Takahashi, Y. (1997). Mesodermal subdivision along the mediolateral axis in chicken controlled by different concentrations of BMP-4. Development 124, 1975-1984. [0182] Traag, V. A., Waltman, L., and van Eck, N. J. (2019). From Louvain to Leiden: guaranteeing well-connected communities. Sci. Rep. 9, Article number: 5233. [0183] Trapnell, C., Pachter, L., and Salzberg, S. L. (2009). TopHat: discovering splice junctions with RNA-Seq. Bioinformatics 25, 1105-1111. [0184] Tschopp, P., Sherratt, E., Sanger, T. J., Groner, A. C., Aspiras, A. C., Hu, J. K., Pourquie, O., Gros, J., and Tabin, C. J. (2014). A relative shift in cloacal location repositions external genitalia in amniote evolution. Nature 516, 391-394. [0185] Tsialikas, J., and Romer-Seibert, J. (2015). LIN28: roles and regulation in development and beyond. Development 142, 2397-2404. [0186] Vierbuchen, T., Ostermeier, A., Pang, Z. P., Kokubu, Y., Siidhof, T. C., and Wernig, M. (2010). Direct conversion of fibroblasts to functional neurons by defined factors. Nature 463, 1035-1041. [0187] Viswanathan, S. R., Daley, G. Q., and Gregory, R. I. (2008). Selective blockade of microRNA processing by Lin28. Science 320, 97-100. [0188] Wang, T., Shi, S., and Sha, H. (2013). MicroRNAs in regulation of pluripotency and somatic cell reprogramming. RNA Biol. 10, 1255-1261. [0189] Watanabe, K., Ueno, M., Kamiya, D., Nishiyama, A., Matsumura, M., Wataya, T., Takahashi, J. B., Nishikawa, S., Nishikawa, S., Muguruma, K., et al. (2007). A ROCK inhibitor permits survival of dissociated human embryonic stem cells. Nat. Biotechnol. 25, 681-686. [0190] Wolf, F. A., Angerer, P., and Theis, F. J. (2018). SCANPY: large-scale single-cell gene expression data analysis. Genome Biol. 19, Article number: 15. [0191] Wolf, F. A., Hamey, F. K., Plass, M., Solana, J., Dahlin, J. S., G?ttgens, B., Rajewsky, N., Simon, L., and Theis, F. J. (2019). PAGA: graph abstraction reconciles clustering with trajectory inference through a topology preserving map of single cells. Genome Biol. 20, Article number: 59. [0192] Wolock, S. L., Lopez, R., and Klein, A. M. (2019). Scrublet: computational identification of cell doublets in single-cell transcriptomic data. Cell Syst. 8, 281-291. [0193] Worringer, K. A., Rand, T. A., Hayashi, Y., Sami, S., Takahashi, K., Tanabe, K., Narita, M., Srivastava, D., and Yamanaka, S. (2013). The let-7/LIN-41 pathway regulates reprogramming to human induced pluripotent stem cells by controlling expression of prodifferentiation genes. Cell Stem Cell 14, 40-52. [0194] Yokoyama, S., Hashimoto, M., Shimizu, H., Ueno-Kudoh, H., Uchibe, K., Kimura, I. and Asahara, H. (2008). Dynamic gene expression of Lin-28 during embryonic development in mouse and chicken. Gene Expr. Patterns 8, 155-160. [0195] Yoshida, K., Kawakami, K., Abe, G. and Tamura, K. (2020). Zebrafish can regenerate endoskeleton in larval pectoral fin but the regenerative ability declines. Dev. Biol. 463, 110-123. [0196] Yu, J., Vodyanik, M. A., Smuga-Otto, K., Antosiewicz-Bourget, J., Frane, J. L., Tian, S., Nie, J., Jonsdottir, G. A., Ruotti, V., Stewart, R., et al. (2007). Induced pluripotent stem cell lines derived from human somatic cells. Science 318, 1917-1920. [0197] Zhang, H. M., Chen, H., Liu, W., Liu, H., Gong, J., Wang, H., and Guo, A. Y. (2012). AnimalTFDB: a comprehensive animal transcription factor database. Nucleic Acids Res. 40, D144-D149. [0198] Zhou, Q., Brown, J., Kanarek, A., Rajagopal, J. and Melton, D. A. (2008). In vivo reprogramming of adult pancreatic exocrine cells to beta-cells. Nature 455, 627-632.
[0199] All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
[0200] The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.
[0201] It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
[0202] In the claims, as well as in the specification above, all transitional phrases such as comprising, including, carrying, having, containing, involving, holding, composed of, and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases consisting of and consisting essentially of shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03.
[0203] The terms about and substantially preceding a numerical value mean?10% of the recited numerical value.
[0204] Where a range of values is provided, each value between and including the upper and lower ends of the range are specifically contemplated and described herein.