BISPECIFIC CS1-BCMA CAR-T CELL AND APPLICATION THEREOF

20240082401 ยท 2024-03-14

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides a bispecific CS1-BCMA CAR-T cell and an application thereof. Specifically, the present invention provides a bispecific CAR, which comprises CS1 scFv and BCMA scFv, and a 4-1BB co-stimulatory domain and a CD3 activation domain. The bispecific CAR-T cell in the present invention has a significant killing effect on CS1 positive target cells and BCMA positive target cells, and can secrete IFN- against target cells and significantly inhibit the growth of RPMI8226 xenograft tumor in an in vivo experiment. The present invention further provides a preparation method and an application of the bispecific CAR-T cell.

    Claims

    1. A bispecific chimeric antigen receptor (CAR), wherein the structure of the chimeric antigen receptor is shown in the following Formula I:
    L-scFv1-I-scFv2-H-TM-C-CD3(I) wherein, each - is independently a linking peptide or a peptide bond; L is an optional signal peptide sequence; I is a flexible linker; H is an optional hinge region; TM is a transmembrane domain; C is a costimulatory signal molecule; CD3 is a cytoplasmic signaling sequence derived from CD3; one of scFv1 and scFv2 is an antigen binding domain targeting CS1, and the other is an antigen binding domain targeting BCMA.

    2. The CAR of claim 1, wherein the scFv1 is the antigen binding domain targeting CS1, and the scFv2 is the antigen binding domain targeting BCMA.

    3. The CAR of claim 2, wherein the amino acid sequence of the heavy chain variable region of the antigen binding domain targeting CS1 (scFv1) is shown in SEQ ID NO: 1, and the amino acid sequence of the light chain variable region of that is shown in SEQ ID NO: 2; and/or the amino acid sequence of the heavy chain variable region of the antigen binding domain targeting BCMA (scFv2) is shown in SEQ ID NO: 4, and the amino acid sequence of the light chain variable region of that is shown in SEQ ID NO: 5.

    4. The CAR of claim 1, wherein the amino acid sequence of the CAR is as shown in SEQ ID NO: 3.

    5. A nucleic acid molecule encoding the CAR of claim 1.

    6. A vector comprising the nucleic acid molecule of claim 5.

    7. An engineered immune cell expressing the CAR of claim 1.

    8. A formulation comprising the CAR of claim 1, the nucleic acid molecule encoding the CAR, the vector comprising the nucleic acid molecule, or the immune cell expressing the CAR, and a pharmaceutically acceptable carrier, diluent or excipient.

    9. Use of the CAR of claim 1, the nucleic acid molecule encoding the CAR, the vector or comprising the nucleic acid molecule, or the immune cell expressing the CAR in preparation of a drug or formulation for preventing and/or treating cancer or tumor.

    10. A method for the preparation of an engineered immune cell expressing the CAR of claim 1, which comprises the following steps: (a) providing an immune cell to be modified; and (b) transferring the nucleic acid molecule encoding the CAR or the vector comprising the nucleic acid molecule into the immune cell to obtain the engineered immune cell.

    11. A method of treating a disease, which comprises administering an appropriate amount of, the immune cell of claim 7 to a subject in need of treatment.

    12. The method of claim 11, wherein the disease is a cancer or a tumor.

    13. The method of claim 12, the tumor is a CS1 and/or BCMA positive tumor.

    Description

    DESCRIPTION OF THE DRAWINGS

    [0081] FIG. 1 shows the structure of CAR. Wherein, The left side of the figure is the first generation CAR (no costimulatory domain), the middle is the second generation CAR (one costimulatory domain, CD28 or 4-BB), and the right is the third generation CAR (two or more costimulatory domains).

    [0082] FIG. 2 shows the sequences of CS1 and BCMA antigens.

    [0083] FIG. 3 shows the structure of the bispecific CS1-BCMA CAR construct. Wherein, the second generation CAR structure and the 4-1BB costimulatory domain were used.

    [0084] FIG. 4 shows a diagram of the sequence of a preferred CAR construct in the present invention.

    [0085] FIG. 5 shows the percentage of CAR-positive cells. Wherein, the mouse FAB antibody and biotin-PE labeled BCMA recombinant protein were used to detect CAR+ cells by FACS, and >95% of CAR+ cells were detected by FAB antibody, and >80% of BCMA+ ScFv cells were detected by BCMA protein.

    [0086] FIG. 6 shows the expression and killing of CS1-BCMA-CAR-T cells. FIG. 6A shows CHO-BCMA,CHO-CS1 and Hela-CS1 cells stably express BCMA and CS1 antigens. Wherein, FACS detection was performed with isotype and BCMA antibody on CHO-BCMA cells, and FACS detection was performed with CS1 antibody on CHO-CS1 cells and Hela-CS1 cells. The isotype Ab was labeled blue. CS1 and BCMA Abs were labeled red. FIG. 6B shows that CS1-BCMA-CAR-T cells specifically kill CHO-CS1 cells. Cytotoxicity test showed that CS1-BCMA-CAR-T cells killed CHO-CS1 cells. Wherein, BCMA-CAR-T cells and Mock CAR-T cells were used as negative controls.

    [0087] FIG. 7 shows that CS1-BCMA-CAR-T cells kill Hela-CS1 cells. Wherein, Mock CAR-T cells and BCMA-CAR-T cells were used as negative controls.

    [0088] FIG. 8 shows that CS1-BCMA-CAR-T cells kill CHO-BCMA cells. Cytotoxicity test showed that CS1-BCMA-CAR-T cells killed CHO-BCMA target cells. Wherein, BCMA-CAR-T cells were used as positive control and Mock CAR-T cells were used as negative control.

    [0089] FIG. 9 shows that CS1-BCMA-CAR-T cells have a significantly stronger killing effect on Hela-BCMA cells than on Hela cells. Cytotoxicity test showed that CS1-BCMA-CAR-T cells killed Hela-BCMA target cells. BCMA-CAR-T cells were used as positive control and Mock CAR-T cells were used as negative control.

    [0090] FIG. 10 shows that CS1-BCMA-CAR-T cells secrete high levels of IFN- against CHO-CS1 and CHO-BCMA target cells, and do not secrete IFN- against CHO cells. * p<0.05, according to Student's t test, CS1-BCMA-CAR-T cells are compared with Mock CAR-T cells.

    [0091] FIG. 11 shows that CS1-BCMA-CAR-T cells secrete IFN- against Hela-CS1 cells and Hela-BCMA cells. * p<0.05, according to Student's t test, CS1-BCMA-CAR-T cells are compared with Mock CAR-T cells.

    [0092] FIG. 12 shows the results of CAR+ cells derived from three different donors detected by FACS with mouse FAB and biotinylated recombinant BCMA protein. Wherein, FIG. 12A shows the FACS detection results of donor #57; FIG. 12B shows the FACS detection results of donor #890; FIG. 12C shows the FACS detection results of donor #999.

    [0093] FIG. 13 shows the RTCA analysis results of CS1-BCMA-CAR-T cells from three donors. Wherein, FIG. 13A shows the RTCA analysis results of donor #57;

    [0094] FIG. 13B shows the RTCA analysis results of donor #890; FIG. 13C shows the RTCA analysis results of donor #999.

    [0095] FIG. 14 shows the IFN- secretion of CS1-BCMA CAR-T cells derived from three donors. Wherein, FIG. 14A shows the IFN- secretion of donor #57(A); FIG. 14B shows the IFN- secretion of donor #890; FIG. 14C shows the IFN- secretion of donor #999.

    [0096] FIG. 15 shows that CS1-BCMA-CAR-T cells (PMC743) significantly inhibit the growth of RPMI8226 tumor cells. PMC743 treated mice were compared with control PBS treated mice, p<0.05.

    DETAILED DESCRIPTION

    [0097] After extensive and intensive research, the inventors surprisingly discovered a bispecific CAR targeting CS1 and BCMA for the first time. The bispecific CAR comprises a CS1 scFv and a BCMA scFv, as well as a 4-1BB costimulatory domain and a CD3 activating domain. Experiments show that the bispecific CAR-T cells of the present invention have a significant killing effect on CS1 positive target cells and BCMA positive target cells, can secrete IFN- against target cells, and significantly inhibit the growth of RPMI8226 xenograft tumors in vivo. On this basis, the present 35 invention has been completed.

    Term

    [0098] In order to make this disclosure easier to understand, certain terms are first defined. As used in this application, unless expressly provided otherwise herein, each of the following terms shall have the meanings given below. Additional definitions are set forth throughout the application.

    [0099] The term about may refer to a value or composition within the acceptable error range of a particular value or composition as determined by those skilled in the art, which will depend in part on how the value or composition is measured or determined.

    [0100] The term administration refers to the physical introduction of a product of the present invention into a subject using any of a variety of methods and delivery systems known to those skilled in the art, including intravenous, intramuscular, subcutaneous, intraperitoneal, spinal or other parenteral routes of administration, such as by injection or infusion.

    [0101] The term antibody (Ab) should include, but not be limited to, an immunoglobulin, which specifically binds an antigen and comprises at least two heavy (H) and two light (L) chains interconnected by disulfide bonds, or an antigen-binding moiety thereof. Each H chain contains a heavy chain variable region (abbreviated as VH herein) and a heavy chain constant region. The heavy chain constant region contains three constant domains CH1, CH2 and CH3. Each light chain contains a light chain variable region (abbreviated as VL herein) and a light chain constant region. The light chain constant region contains a constant domain CL. The VH and VL regions can be further subdivided into hypervariable regions called complementarity determining regions (CDRs), which are scattered with more conservative regions called framework regions (FRs). Each VH and VL comprises three CDRs and four FRs, which are arranged in the following order from the amino terminus to the carboxyl terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The variable regions of the heavy and light chains contain binding domains that interact with the antigen.

    [0102] It should be understood that the amino acid name herein adopts the internationally accepted single-English letter identification, and the corresponding amino acid names abbreviated in three English letters are: Ala (A), Arg(R), Asn(N), Asp(D), Cys(C), Gln(Q), Glu(E), Gly(G), His(H), II e(I), Leu(L), Lys(K), Met(M), Phe(F), Pro(P), Ser(S), Thr (T), Trp(W), Tyr(Y), Val(V).

    CS1 and BCMA Antigens

    [0103] 35 CS1 (SLAM family member 7, CD319) and BCMA (tumor necrosis factor receptor superfamily member 17) proteins are commonly overexpressed in multiple myeloma.

    [0104] Based on their high percentage of expression in multiple myeloma, both targets are used for CAR-T cell therapy.

    [0105] FIG. 2 shows the amino acid sequence of CS1 antigen (SEQ ID NO: 12) and the amino acid sequence of BCMA antigen (SEQ ID NO: 13), in which the extracellular domain of BCMA (1-54 aa) and the extracellular domain of CS1 (23-226 aa) are underlined.

    Chimeric Antigen Receptor (CAR)

    [0106] As used herein, the terms CS1-BCMA-CAR, bispecific CAR, and CS1-BCMA bispecific CAR have the same meaning, referring to the CAR targeting CS1 and BCMA provided in the first aspect of the present invention. Specifically, the CS1-BCMA bispecific CAR of the present invention consists of two scFv, a 4-1BB costimulatory domain and a CD3 activating domain (FIG. 3). For BCMA scFv contained in bispecific CAR, the BCMA scFv derived from clone 4C8 (R. Berahovich, et al., CAR-T Cells Based on Novel BCMA Monoclonal Antibody Block Multiple Myeloma Cell Growth. Cancers (Basel) 10 (2018).) is used, and the amino acid sequence of which is shown in SEQ ID NO: 2. For CS1 scFv contained in bispecific CAR, the CS1 antibody 7A8D5 from Promab is used, and the amino acid sequence of which is shown in SEQ ID NO: 1. Experiments show that the CS1 scFv also works well against CS1 positive target cells in the form of monospecific CAR.

    [0107] The design of CARs has gone through the following process: the first generation of CAR has only one intracellular signal component, CD3 or FcRI molecule. Since there is only one activating domain in the cell, it can only cause short-term T cell proliferation and less cytokine secretion, but cannot provide long-term T cell proliferation signal and continuous in vivo anti-tumor effect, so it has not achieved good clinical efficacy. In the second generation CAR, a costimulatory molecule, such as CD28, 4-1BB, OX40 and ICOS, is introduced on the basis of the original structure. Compared with the first generation CARs, the function is greatly improved, further enhancing the persistence of CAR-T cells and the killing ability against tumor cells. On the basis of the second generation CARs, some new immune costimulatory molecules such as CD27 and CD134 are connected in tandem to develope the third and fourth generation CARs.

    [0108] The chimeric antigen receptor (CAR) of the present invention is a second-generation CAR, including an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain includes a target-specific binding element (also called antigen binding domain). The intracellular domain includes a costimulatory signal transduction region and a zeta chain part. The costimulatory signal transduction region refers to a part of intracellular domain including costimulatory molecules. The costimulatory molecules are the cell surface molecules needed for the effective response of lymphocytes to antigens, not antigen receptors or their ligands.

    [0109] A linker may be incorporated between the extracellular and transmembrane domains of the CAR, or between the cytoplasmic and transmembrane domains of the CAR. As used herein, the term linker generally refers to any oligopeptide or polypeptide that plays the role of connecting the transmembrane domain to the extracellular domain or cytoplasmic domain of the polypeptide chain. The linker may comprise 0 to 300 amino acids, preferably 2 to 100 amino acids and most preferably 3 to 50 amino acids.

    [0110] In a preferred embodiment of the present invention, the extracellular domain of CAR provided by the present invention comprises an antigen binding domain (CS1-BCMA scFv) targeting CS1 and BCMA. The CAR of the present invention, when expressed in T cells, is capable of antigen recognition based on antigen binding specificity. When it binds to its associated antigen, it affects tumor cells, causing tumor cells to not grow, be killed or be affected in other ways, and leading to the reduction or elimination of tumor burden of patients. The antigen binding domain is preferably fused with one or more intracellular domains from the costimulatory molecules and the zeta chain.

    [0111] As used herein, antigen-binding domain and single-chain antibody fragment both refer to a Fab fragment, a Fab' fragment, a F(ab').sub.2 fragment, or a single Fv fragment with antigen-binding activity. Fv antibody contains antibody heavy chain variable region and light chain variable region, but no constant region, and has the smallest antibody fragment of all antigen binding sites. In general, Fv antibody further contains a polypeptide linker between the VH and VL domains and is capable of forming the structure required for antigen binding. The antigen binding domain is usually a scFv (single-chain variable fragment). The size of scFv is generally of an intact antibody. The single-chain antibody is preferably an amino acid chain sequence encoded by a nucleotide chain.

    [0112] For the hinge region and the transmembrane region (transmembrane domain), the CAR can be designed to include a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, a transmembrane domain naturally associated with one of the domains in the CAR is used. In some examples, the transmembrane domain may be selected, or modified by amino acid substitution, to avoid binding such domains to transmembrane domains of the same or different surface membrane proteins, thereby minimizing interaction with other members of the receptor complex.

    [0113] Specifically, in a preferred embodiment of the present invention, in order to improve the viability of CAR-T cells in the tumor microenvironment, a second-generation CAR vector targeting CS1 and BCMA is constructed using 4-1BB as the costimulatory domain, which sequentially includes the single-chain antibody sequence of humanized CS1 antibody, the single-chain antibody sequence of humanized BCMA antibody, the intracellular region sequence, the intracellular region sequence of human 4-1BB, and human CD3 sequence.

    [0114] In a preferred embodiment of the present invention, the chimeric antigen receptor of the present invention is shown in FIG. 4.

    [0115] Further, the CS1-BCMA-CAR sequence is placed downstrem of the MNDU3 promoter of the second generation lentiviral construct with kanamycin resistance gene to construct a lentiviral vector expressing CS1-BCMA-CAR. 293 T cells are used to produce lentivirus and transduce T cells to prepare CS1-BCMA-CAR-T cells. For specific methods, please refer to the General Methods section.

    Vector

    [0116] The nucleic acid sequence encoding the desired molecule may be obtained using recombination methods known in the art, such as, for example, by screening a library from cells expressing the gene, by deriving the gene from a vector known to include the gene, or by direct isolation from cells and tissues containing the gene using standard techniques. Optionally, the gene of interest may be synthesized.

    [0117] The present invention also provides a vector in which the expression cassette of the present invention is inserted. Vectors derived from retroviruses such as lentiviruses are suitable tools for long-term gene transfer because they allow long-term, stable integration of transgenes and their proliferation in daughter cells. Lentiviral vectors have advantages over vectors derived from carcinogenic retroviruses such as murine leukemia viruses because they can transduce non-proliferative cells, such as hepatocytes. They also have the advantage of low immunogenicity.

    [0118] In brief summary, the expression cassette or nucleic acid sequence of the present invention is usually operably linked to the promoter and incorporated into the expression vector. The vector is suitable for replication and integration in eukaryotic cells. A typical cloning vector contains a transcription and translation terminator, an initial sequence, and a promoter that can be used to regulate expression of the desired nucleic acid sequences.

    [0119] The expression construct of the present invention can also be used for nucleic acid immunization and gene therapy by using the standard gene delivery scheme. Methods of gene delivery are known in the art. See, for example, U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, which are incorporated herein by reference in their entirety. In another embodiment, the present invention provides a gene therapy vector.

    [0120] The nucleic acid can be cloned into many types of vectors. For example, the nucleic acid may be cloned into such vectors, including, but not limited to, plasmids, phage derivatives, animal viruses, and cosmids. Specific vectors of interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

    [0121] Further, the expression vector may be provided to the cell in the form of a viral vector. Viral vector technology is well known in the art and is described in, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) and other manuals of virology and molecular biology. Viruses that may be used as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. Typically, a suitable vector comprises a replication origin, a promoter sequence, a convenient restriction enzyme site, and one or more selectable markers operative in at least one organism (e.g., WO01/96584; WO01/29058; and U.S. Pat. No. 6,326,193).

    [0122] A number of virus-based systems have been developed for the transfer of genes into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. Selective genes can be inserted into vectors and packaged into retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to the subject cells in vivo or ex vivo. Many retroviral systems are known in the art. In some embodiments, an adenoviral vector is used. Many adenoviral vectors are known in the art. In one embodiment, a lentiviral vector is used.

    [0123] Additional promoter elements, such as enhancers, can regulate the frequency of transcription initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although it has recently been shown that many promoters also contain functional elements downstream of the start site. The spacing between promoter elements is often flexible so that when the element is inverted or moved relative to another one, the promoter function is maintained. In the thymidine kinase (tk) promoter, the separation between the promoter elements can be increased by 50 bp, before the activity begins to decline. Depending on the promoter, it is shown that a single element can act cooperatively or independently to initiate transcription.

    [0124] An example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. The promoter sequence is a strongly constitutive promoter sequence capable of driving high-level expression of any polynucleotide sequence operably linked to it. Another example of a suitable promoter is the elongation growth factor-1 (EF-1). However, other constitutive promoter sequences can also be used, including but not limited to early promoter of simian virus 40 (SV40), mouse breast tumor virus (MMTV), human immunodeficiency virus (HIV) long-terminal repeat (LTR) promoter, MoMuLV promoter, avian leukemia virus promoter, immediate early promoter of Epstein-Barr virus, Ruth's sarcoma virus promoter, and human gene promoter, such as, but not limited to, an actin promoter, a myosin promoter, a heme promoter, and a creatine kinase promoter. Further, the present invention should not be limited to the use of constitutive promoters. Inducible promoters are also considered as part of the present invention. The use of inducible promoters provides a molecular switch that can turn on expression of a polynucleotide sequence operably linked to an inducible promoter when such expression is desired, or turn off expression when the expression is undesirable. Examples of inducible promoters include, but are not limited to, a metallothionein promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.

    [0125] In order to evaluate the expression of the CAR polypeptide or part thereof, the expression vector introduced into the cell may also contain either or both of the selectable marker genes or reporter genes in order to identify and select the expression cells from the cell population seeking to be transfected or infected by the viral vector. In other aspects, selectable markers can be carried on a single piece of DNA and used in co-transfection procedures. Both selectable markers and reporter genes can be flanked with appropriate regulatory sequences to be able to be expressed in host cells. Useful selectable markers include, for example, antibiotic resistance genes, such as neo, etc.

    [0126] Reporter genes are used to identify potentially transfected cells and to evaluate the functionality of regulatory sequences. Typically, the reporter gene is the following gene: it is not present in or expressed by the recipient organism or tissue, and it encodes a polypeptide of which the expression is clearly represented by some easily detectable properties such as enzyme activity. After DNA has been introduced into the receptor cells, the expression of the reporter gene is determined at the right time. Suitable reporter genes may include genes encoding luciferase, -galactosidase, chloramphenicol acetyltransferase, secretory alkaline phosphatase, or green fluorescent protein (e.g., Ui-Tei et al., 2000FEBS Letters 479:79-82). Suitable expression systems are well known and can be prepared using known techniques or commercially available. In general, a construct with a minimum of 5 flanking regions that show the highest level of reporter expression are identified as a promoter. Such promoter region can be linked to a reporter gene and used to evaluate the ability of a reagent to regulate promoter-driven transcription.

    [0127] Methods of introducing genes into cells and expressing genes into cells are known in the art. In the content of the expression vector, the vector can be easily introduced into the host cell , for example, mammalian, bacterial, yeast or insect cells, by any method in the art. For example, the expression vector can be transferred into the host cell by physical, chemical or biological means.

    [0128] Physical methods for introducing polynucleotides into host cells include calcium phosphate precipitation, lipid transfection, particle bombardment, microinjection, electroporation, etc. Methods of producing cells including vectors and/or exogenous nucleic acids are well known in the art. See, for example, Sambrook, et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A preferred method for introducing polynucleotides into host cells is calcium phosphate transfection.

    [0129] Biological methods of introducing polynucleotides of interest into host cells include the use of DNA and RNA vectors. Viral vectors, especially retroviral vectors, have become the most widely used method for inserting genes into mammalian cells such as human cells. Other viral vectors may be derived from lentivirus, poxvirus, herpes simplex virus I, adenovirus and adeno-associated virus, etc. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.

    [0130] Chemical means of introducing polynucleotides into host cells include colloidal dispersion systems, such as macromolecular complexes, nanocapsules, microspheres, beads; and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system used as an in vitro and in vivo delivery vehicle is a liposome (e.g., an artificial membrane capsule).

    [0131] In the case of using a non-viral delivery system, the exemplary delivery tool is liposome. The use of lipid preparations is considered to introduce nucleic acids into host cells (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with lipids. The nucleic acid associated with lipids may be encapsulated into the aqueous interior of the liposome, scattered in the lipid bilayer of the liposome, attached to the liposome by a connecting molecule associated with both the liposome and the oligonucleotide, trapped in the liposome, compounded with the liposome, dispersed in a solution containing the lipid, mixed with the lipid, combined with the lipid, contained in the lipid as a suspension, contained in the micelle or compounded with the micelle, or otherwise associated with lipids. Lipids, lipid/DNA or lipid/expression vectors associated with the composition are not limited to any specific structure in solution. For example, they may exist in bilayer structures as micelles or have collapsed structures. They may also be simply dispersed in solution, possibly forming aggregates of uneven size or shape. Lipids are fatty substances, which may be naturally occurring or synthesized lipids. For example, lipids include fat droplets that occur naturally in the cytoplasm and in compounds containing long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols and aldehydes.

    [0132] In a preferred embodiment of the present invention, the vector is a lentiviral vector.

    Formulation

    [0133] The present invention provides a formulation comprising the CAR-T cell of the present invention, and a pharmaceutically acceptable carrier, diluent or excipient. In one embodiment, the formulation is a liquid formulation. Preferably, the formulation is an injection. Preferably, the concentration of the CAR-T cells in the formulation is 110.sup.3110.sup.8 cells/ml, more preferably 110.sup.4110.sup.7 cells/ml.

    [0134] In one embodiment, the formulation may include buffers such as neutral buffered saline, sulfate buffered saline, etc.; carbohydrates such as glucose, mannose, sucrose or glucan, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. The formulations of the present invention are preferably formulated for intravenous administration.

    Therapeutic Use

    [0135] The present invention includes therapeutic use of cells (e.g., T cells) transduced with a lentiviral vector (LV) encoding the expression cassette of the present invention. Transducted T cells can target tumor cell markers CS1 and BCMA, synergistically activate T cells and cause T cell immune response, thus significantly improving the killing efficiency against tumor cells.

    [0136] Accordingly, the present invention also provides a method of stimulating a T cell-mediated immune response to a target cell population or tissue of a mammal, which comprises the step of administering to a mammal the CAR-T cells of the present invention.

    [0137] In one embodiment, the present invention includes a type of cell therapy in which autologous T cells from a patient (or heterologous ones from a donor) are isolated, activated and genetically modified to produce CAR-T cells, and subsequently injected into the same patient. In this way, the probability of graft-versus-host disease is extremely low, and the antigen is recognized by T cells in a manner without MHC restriction. In addition, one CAR-T can treat all cancers that express the antigen. Unlike antibody therapy, CAR-T cells can replicate in vivo, resulting in long-term persistence that can lead to sustained tumor control.

    [0138] In one embodiment, the CAR-T cells of the present invention can undergo stable in vivo T cell expansion and can last an extended amount of time. In addition, the CAR-mediated immune response can be part of an adoptive immunotherapy step in which CAR-modified T cells induce an immune response specific to the antigen-binding domain in the CAR. For example, anti-CS1 and BCMA CAR-T cells elicit a specific immune response against CS1 and/or BCMA-positive cells.

    [0139] Although the data disclosed herein specifically disclose lentiviral vectors that include the MNDU3 promoter, CS1-BCMA scFv, 4-1BB intracellular region, and CD3 signaling domain, the present invention should be interpreted to include any number of changes to each of the construct components.

    [0140] Treatable cancers include tumors that have not been vascularized or have basically not been vascularized, and tumors that have been vascularized. The cancers may include non-solid tumors (such as hematological tumors, e.g., leukemia and lymphoma) or may include solid tumors. The types of cancer treated with the CAR of the present invention include, but are not limited to, carcinomas, blastocytomas, and sarcomas, and certain leukemic or lymphoid malignancies, benign and malignant tumors, and malignant tumors, such as sarcomas, carcinomas, and melanoma. It also includes adult tumors/cancers and pediatric tumors/cancers.

    [0141] Hematological cancers are cancers of the blood or bone marrow. Examples of hematological (or haematogenic) cancers include leukemia, including acute leukemia (such as acute lymphocytic leukemia, acute myeloid leukemia, acute myelogenous leukemia and myeloblastic, premyelocytic, granulo-monocytic, monocytic and erythroleukemia), chronic leukemia (such as chronic myeloid (granulocytic) leukemia, chronic myelogenous leukemia and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (painless and high-grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and spinal cord dysplasia.

    [0142] A solid tumor is an abnormal mass of tissue that usually does not contain a cyst or fluid area. A solid tumor may be benign or malignant. Different types of solid tumors are named after the cell types that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors such as sarcomas and carcinomas include fibrosarcoma, mucinous sarcoma, liposarcoma mesothelioma, lymphoid malignant tumor, pancreatic carcinoma and ovarian carcinoma.

    [0143] In a preferred embodiment, the treatable cancer is a CS1 and/or BCMA positive tumor, such as multiple osteosarcoma, etc.

    [0144] The CAR-modified T cells of the present invention can also be used as a vaccine type for ex vivo immunization and/or in vivo therapy of mammals. Preferably, the mammal is a human.

    [0145] For ex vivo immunization, at least one of the following occurs in vitro before the cells are administered into mammals: i) expanding the cells, ii) introducing the nucleic acid encoding a CAR into the cells, and/or iii) cryopreservation of the cells.

    [0146] The ex vivo procedure is well known in the art and is discussed more fully below. In brief, cells are isolated from mammals (preferably humans) and genetically modified (i.e., transduced or transfected in vitro) with a vector expressing the CAR disclosed herein. CAR-modified cells can be administered to mammalian recipients to provide therapeutic benefits. The mammalian recipient may be a human, and CAR-modified cells may be autologous relative to the recipient. Optionally, the cells may be allogeneic, syngeneic or xenogeneic relative to the recipient.

    [0147] In addition to the use of cell-based vaccines in terms of ex vivo immunization, the present invention also provides compositions and methods for in vivo immunization to induce an immune response against an antigen in a patient.

    [0148] The present invention provides a method of treating a tumor comprising administering to a subject in need thereof a therapeutically effective amount of the CAR-modified T cells of the present invention.

    [0149] The CAR-modified T cells of the present invention may be administered alone or as a pharmaceutical composition in combination with a diluent and/or with other components such as IL-2, IL-17 or other cytokines or cell populations. Briefly, the pharmaceutical composition of the present invention may comprise a population of target cells as described herein in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may include buffers such as neutral buffered saline, sulfate buffered saline, etc.; carbohydrates such as glucose, mannose, sucrose or dextran, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. The composition of the present invention is preferably formulated for intravenous administration.

    [0150] The pharmaceutical composition of the present invention may be administered in a manner suitable for the disease to be treated (or prevented). The number and frequency of administration will be determined by such factors as the patient's condition, and the type and severity of the patient's disease, although the appropriate dose may be determined by clinical trials.

    [0151] When immunologically effective amount, anti-tumor effective amount, tumor-suppressive effective amount or therapeutic amount is indicated, the precise amount of the composition of the present invention to be administered may be determined by a physician taking into account individual differences in age, weight, tumor size, degree of infection or metastasis, and condition of the patient (subject). It may be generally noted that the pharmaceutical composition comprising T cells described herein may be administered at a dose of 10.sup.4 to 10.sup.9 cells/kg body weight, preferably at a dose of 10.sup.5 to 10.sup.6 cells/kg body weight (including all integer values in those ranges). T cell compositions may also be administered multiple times at these doses. Cells can be administered by using injection techniques well known in immunotherapy (see e.g., Rosenberg et al., NewEng. J. of Med. 319:1676, 1988). The optimal dosage and treatment regimen for a specific patient can be easily determined by a skilled person in the medical field by monitoring the patient's signs of disease and adjusting the treatment accordingly.

    [0152] The administration of the subject composition can be carried out in any convenient manner, including by spraying, injection, swallowing, infusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intraspinally, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In one embodiment, the T cell composition of the present invention is administered to a patient by intradermal or subcutaneous injection. In another embodiment, the T cell composition of the present invention is preferably administered by i.v. injection. The composition of T cells can be injected directly into tumors, lymph nodes or infected sites.

    [0153] In certain embodiments of the present invention, cells activated and expanded using the methods described herein or other methods known in the art to expand T cells to therapeutic levels are administered to the patient in combination with (e.g., before, simultaneously, or after) any number of relevant treatment forms, including but not limited to treatment with the following agents: the agents such as antiviral therapy, cidofovir and interleukin-2, cytarabine (also known as ARA-C) or natalizumab therapy in MS patients or efalizumab therapy in psoriasis patients or other therapy in PML patients. In further embodiments, the T cells of the present invention may be used in combination with chemotherapy, radiation, immunosuppressive agents such as cyclosporin, azathioprine, methotrexate, mycophenolate and FK506, antibodies or other immunotherapeutic agents. In further embodiments, the cell composition of the present invention is administered to a patient in combination with (e.g., before, simultaneously, or after) bone marrow transplantation, the use of a chemotherapeutic agent such as fludarabine, external beam radiotherapy (XRT), cyclophosphamide. For example, in one embodiment, a subject may undergo a standard treatment of high-dose chemotherapy followed by peripheral blood stem cell transplantation. In some embodiments, after transplantation, the subject receives an infusion of the expanded immune cells of the present invention. In an additional embodiment, the expanded cells are administered before or after surgery.

    [0154] The dose of the above treatment administered to the patient will vary with the precise attributes of the treated disorder and the recipient of the treatment. The proportion of doses administered to humans may be implemented according to practices accepted in the field. Typically, 110.sup.6 to 110.sup.10 modified T cells (e.g., CAR-T cells) of the present invention may be administered to the patient by, for example, intravenous reinfusion per treatment or per course of treatment.

    The Main Advantages of the Present Invention Include

    [0155] (a) The bispecific CAR-T cells of the present invention have a significant killing effect on CS1 positive target cells and BCMA positive target cells. [0156] (B) The bispecific CAR-T cells of the present invention secrete IFN- against CS1 positive target cells and BCMA positive target cells. [0157] (c) The bispecific CAR-T cells of the present invention can significantly inhibit the growth of RPMI8226 xenograft tumors in vivo.

    [0158] The present invention is further explained below in conjunction with specific example. It should be understood that these examples are only for illustrating the present invention and not intend to limit the scope of the present invention. The experimental methods of which the conditions are not specifically indicated in the following examples are usually in accordance with conventional conditions such as those described in Sambrook et al., Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989), or according to the conditions recommended by the manufacturer. Unless otherwise stated, percentages and parts are calculated by weight.

    General Materials and Methods

    [0159] 1. Isolation of Peripheral Blood Mononuclear Cells (PBMCs) from Whole Blood

    [0160] Whole blood collected from single or multiple donors (depending on the amount of blood required) (Stanford Hospital Blood Center, Stanford, California) was added to a 10 mL heparin vacuum container (purchased from Becton Dickinson). In a 50 ml conical centrifuge tube (PBS, pH 7.4, Ca2.sup.+/Mg2.sup.+ free), about 10 ml of anticoagulant whole blood was mixed with sterile phosphate buffer saline (PBS) for a total volume of 20 ml. The cell layer containing peripheral blood mononuclear cells (PBMCs) on the diluted plasma/Ficoll interface was carefully sucked to avoid inhaling any Ficoll, washed twice with PBS, and centrifuged at 200 xg for 10 minutes at room temperature. The cells were counted with a blood cell counter. PBMCs were washed once with CAR-T medium (AIM V-AlbuMAX (BSA) (Life Technologies) which contained 5% AB serum and 1.25 ug/mL amphotericin B (Gemini Bioproducts, Woodland, CA), 100 U/mL penicillin, and 100 ug/mL streptomycin). Cells were directly used in subsequent experiments or cryopreserved at 80 C.

    2. T Cell Activation

    [0161] The isolated cells (washed with 1xPBS (pH 7.4), Ca.sup.2+/Mg.sup.2+ free) were washed once with CAR-T medium (AIM V-AlbuMAX (BSA) (Life Technologies) without addition of human interleukin-2 (huIL-2) (Invitrogen). CAR-T medium contained 5% AB serum and 1.25 ug/mL amphotericin B (Gemini Bioproducts, Woodland, CA), 100 U/mL penicillin, and 100 ug/mL streptomycin). The cell concentration was 510.sup.5 cells/ml. The cells were re-suspended in CAR-T medium containing 300 U/mL huIL2, and the final concentration was 510.sup.5 cells/mL. PBMCs were activated at a CD3-CD28 magnetic bead to cell ratio of 1:1.

    3. T Cell Transduction and Expansion

    [0162] After PBMC activation, the cells were incubated at 37 C., 5% CO.sub.2 for 24 hours. Each well contained 110.sup.6 cells, and 510.sup.6 lentiviruses and 2 L/mL of Transplus medium (Alstem, Richmond, California) were added (final dilution was 1:500). Cells were incubated for another 24 hours before the viruses were added repeatedly. Cells were cultured for 12-14 days in the persistence of fresh medium containing 300 U/mL IL-2 (the total incubation time depends on the final number of CAR-T cells required). The cell concentration was analyzed every 2-3 days, and the culture medium was added to dilute the cell suspension to 110.sup.6 cells/mL.

    3. FACS Detection of CAR Positive Cells

    [0163] Cells were washed and suspended in FACS buffer (phosphate buffer saline (PBS) containing 0.1% sodium azide and 0.4% BSA). Cells were divided into aliquots (110.sup.6 cells). Fc receptors were blocked on ice with standard goat IgG (Life Technologies) for 10 minutes. Biotin-labeled polyclonal goat anti-mouse F(ab)2 antibody (Life Technologies) was used to detect CS1. BCMA-biotin-labeled recombinant protein was used to detect BCMA+ CAR cells. Biotin-labeled normal polyclonal goat IgG antibody (Life Technologies) was used as an isotype control. (1:200 dilution, reaction volume was 100 l). Cells were incubated at 4 C. for 25 minutes and washed once with FACS buffer, then suspended in FACS buffer. Each tube was added with 100 l 1:1000 diluted standard mouse IgG (Invitrogen) for blockade and incubated on ice for 10 minutes. The cells were then washed with FACS buffer and resuspended in 100 l FACS buffer. Cells were then stained with phycoerythrin (PE)-labeled streptavidin (BD Pharmingen, San Diego, CA) and allophycocyanin (APC)-labeled CD3 (eBiocience, San Diego, CA).

    4. Cytotoxicity Assay (Real-Time Cytotoxicity Assay)

    [0164] The cytotoxicity assay was performed according to the manufacturer's operating guidelines using ACEA.

    5. ELISA

    [0165] IFN- cytokines were detected using ELISA kits, and the experiment was carried out according to the manufacturer's operating guidelines.

    Example 1 CS1-BCMA-CAR-T Cells Express CS1 ScFv and BCMA scFv

    [0166] The bispecific CS1-BCMA scFv fragment, 41BB costimulatory domain and CD3 zeta activating domain were inserted into CAR, and the CAR lentiviruses were transducecd into T cells. The results show that CS1-BCMA-CAR cells are effectively expanded in vitro.

    [0167] CAR containing no scFv and TF tags was constructed using the same method, named Mock CAR, and used as a negative control in cytotoxicity and cytokine assays.

    [0168] CS1-BCMA-CAR positive cells were detected by FACS using mouse FAB antibody and biotin-labeled BCMA recombinant protein.

    [0169] The results are shown in FIG. 5. The MNDU3 promoter was used for CAR-expressing lentivirus construction, and a high percentage of CAR-positive cells were in the cell transduction products.

    [0170] The CAR-positive cells obtained in this example were named PMC743 and used in subsequent experiments.

    Example 2 CS1-BCMA-CAR-T Cells Kill CHO-CS1 Cells and Hela-CS1 Cells

    [0171] CS1-BCMA CAR-T cells (PMC743) were co-incubated with CHO-CS1 cells, Hela-CS1 cells (CS1 positive, CS1 antigen stably transfected cells), and CHO cells (CS1 negative), respectively. BCMA-41BB-CD3-CAR-T cells (PMC744) and Mock CAR-T cells were used as controls. The ratios of effect cells to target cells (E:T) preserved by cryopreservation were 20:1 and 40:1. The incubation time was 24 hours.

    [0172] CHO-BCMA and CHO-CS1 staining with BCMA and CS1 antibodies is shown in FIG. 6A.

    [0173] After 24 hours of co-incubation, XCelligence system was used to perform real-time cytotoxicity assay on CS1-BCMA-CAR-T cells and target cell lines.

    [0174] The results show that CS1-BCMA-41BB-CD3 CAR-T cells (PMC743) can kill CHO-CS1 cells, while BCMA-41BB-CD3-CAR-T cells (PMC744) and Mock CAR-T cells (FIG. 6B) cannot kill CHO-CS1 cells.

    [0175] The same assay was performed with Hela-CS1. The results show that PMC743 can kill Hela-CS1 cells, while monospecific BCMA CAR-T cells can not kill Hela-CS1 cells (FIG. 7).

    Example 3 CS1-BCMA-CAR-T Cells Specifically Kill CHO-BCMA Cells and Hela-BCMA Cells

    [0176] The same assay was performed with CHO and Hela cell lines stably expressing BCMA using a method similar to Example 2.

    [0177] The results show that, similar to BCMA-CAR-T cells, CS1-BCMA-CAR-T cells specifically kill BCMA positive target cells (FIG. 8).

    [0178] Hela-BCMA target cells (stably transducted with BCMA antigen) were used to perform detection. The results show that CS1-BCMA-CAR-T cells have high killing activity to them (FIG. 9).

    Example 4 CS1-BCMA-CAR-T Cells Secret High Levels of IFN- Against CS1-Positive Cells

    [0179] CS1-BCMA-CAR-T cells were co-incubated with target cells, and the supernatant was collected. ELISA analysis was performed using Fisher's kit according to operating procedures.

    [0180] The results show that after co-incubation of CS1-BCMA CAR-T cells with CHO-CS1 and CHO-BCMA (FIG. 10) and Hela-CS1 and Hela-BCMA cells (FIG. 11), high levels of IFN- secretion were detected. The above results show that CS1-BCMA-CAR-T cells can specifically target CS1 and BCMA positive target cells with high specificity.

    Example 5 Preparation of CS1-BCMA-CAR-T Cells Using PBMCs from a Donor

    [0181] Transduction of PMC743 CAR was performed using PBMCs from three donors, numbered #57, #890, and #999, respectively. Monospecific BCMA-CAR-T cells and CS1-CAR-T cells were used as controls.

    [0182] CAR-T cells from 3 donors were expanded to obtain CAR positive cells with high expression levels (FIG. 12).

    [0183] Mouse F(ab)2 antibody was used for detection, and the proportion of PMC743 CAR cells of donor #57 was >70%. Biotinylated BCMA recombinant protein was used for detection, and the proportion was 28%. The results of single BCMA CAR-T cells were similar, in which the proportion of mFAB antibody detected was 57%, and the proportion of BCMA protein detected was 30%. There were 68% CAR+ cells in CS1 CAR-T cells, while control T cells were negative (FIG. 12A).

    [0184] PMC743 CAR was transferred to donor #890. The results show that the proportion of CAR+ cells detected by mFAB was 81%, and the proportion detected by BCMA protein was 42% (FIG. 12B). Similar data were also obtained for the transduction of BCMA CAR and CS1 CAR based on donor #890, containing about 80% CAR+ cells.

    [0185] A high percentage of CAR+ cells was also observed for PMC743 CAR transduction based on donor #999 (FIG. 12C).

    [0186] The above results show that the PMC743 CAR of the present invention can be effectively transduced, so that CAR+ cells are expressed in a higher proportion.

    Example 6 CS1-BCMA-CAR-T Cell Specifically Kill CS1 Positive Cells

    [0187] The CS1-BCMA CAR-T cells of PBMC from 3 donors prepared in Example 5 were used for killing detection. Monospecific CS1-CAR-T cells and BCMA-CAR-T cells were prepared by a similar method and used as controls. Using CHO-BCMA and CHO-CS1 as target cells, the cytotoxicity assay was performed using a method similar to Example 2.

    [0188] The results show that CS1-BCMA CAR-T cells can kill BCMA positive and CS1 positive cells at the same time (FIG. 13). The killing effect of CS1-BCMA cells is similar to that of BCMA-CAR-T cells on CHO-BCMA cells, and is similar or slightly lower than the killing effect of CS1-CAR-T cells from the same donor on CHO-CS1 cells. Since CS1-CAR-T cells do not kill CHO-BCMA cells and BCMA-CAR-T cells do not kill CHO-CS1 cells, the killing of each kind of CAR-T cells is specific.

    [0189] The level of IFN- secretion was detected using a method similar to Example 4.

    [0190] The results show that CS-1-BCMA-CAR-T cells secret high levels of IFN- against CS1-positive and BCMA-positive cells (FIG. 14). In CHO-BCMA cells, IFN- secretion of CS-1-BCMA-CAR-T cells is significantly higher than that of Mock CAR-T cells and higher than that of monospecific BCMA-CAR-T cells.

    [0191] The IL-6 secretion was further analyzed. In terms of CRS safe CAR-T cells, all 3 donors had the lowest IL-6 level.

    Example 7 In Vivo, CS1-BCMA-CAR-T Cells Significantly Block the Growth of RPMI8226 Xenograft Tumors

    [0192] Multiple myeloma RPMI8226 xenograft tumor model was used to analyze the in vivo killing of CS1-BCMA-CAR-T cells.

    [0193] 210.sup.6 RPMI8226-luciferase-positive cells (ATCC, CCL155) were injected intravenously into NSG mice and 110.sup.7 CS1-BCMA-CAR-T cells were injected intravenously the next day.

    [0194] The results show that CS1-BCMA-CAR-T cells significantly delayed tumor growth compared with the control group, p<0.05 (FIG. 15).

    [0195] All references mentioned in the present application are incorporated by reference herein, as though individually incorporated by reference. In addition, it should be understood that after reading the above teaching content of the present invention, various changes or modifications may be made by those skilled in the art, and these equivalents also fall within the scope as defined by the appended claims of the present application.

    [0196] The sequences and related informations involved in this application are as follows:

    TABLE-US-00001 SEQ ID Sequence NO. name Specificsequence 1 Anti-CS1 VQLQQSGPEVVRPGVSVKISCKGSGYTFTDYAIHW antibody VKQSHAKSLEWIGVINTYNGNTNYNQKFKGKATM heavychain TVDKSSSTAYMELARLTSEDSAIYYCTRTGYYYGPS variable HYFDYWGQGTTLTVSS region 2 Anti-CS1 DIVLTQSPASLTVSLGQRATMSCRASKSVSTSGYSY antibody VHWYQQKPGQPPKLLIYLASNLESGVPARFSASGSG lightchain TDFTLNIHPVEEEDAATYYCQHSRELPWTFGGGTKL variable EIKR region 3 Chimeric VQLQQSGPEVVRPGVSVKISCKGSGYTFTDYAIHW antigen VKQSHAKSLEWIGVINTYNGNTNYNQKFKGKATM receptor TVDKSSSTAYMELARLTSEDSAIYYCTRTGYYYGPS HYFDYWGQGTTLTVSSGGGGSGGGGSGGGGSDIVL TQSPASLTVSLGQRATMSCRASKSVSTSGYSYVHW YQQKPGQPPKLLIYLASNLESGVPARFSASGSGTDF TLNIHPVEEEDAATYYCQHSRELPWTFGGGTKLEIK RGGGGSGGGGSGGGGSDIVMTQSPATLSVTPGDRV SLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSIS GIPSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHS FPPTFGGGTKLEIKGGGGGGGGSGGGGSQVQLQQ SGPELVKPGASVKMSCKASGYTFTSYVMHWVKQK PGQGLEWIGYIIPYNDATKYNEKFKGKATLTSDKSS STAYMELSSLTSEDSAVYYCARYNYDGYFDVWGA GTTVTVSSLEKTTTPAPRPPTPAPTIASQPLSLRPEAC RPAAGGAVHTRGLDFASDKPFWVLVVVGGVLACY SLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQ EEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQ NQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRR KNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPR 4 Anti-BCMA QVQLQQSGPELVKPGASVKMSCKASGYTFTSYVM antibody HWVKQKPGQGLEWIGYIIPYNDATKYNEKFKGKAT heavychain LTSDKSSSTAYMELSSLTSEDSAVYYCARYNYDGY variable FDVWGAGTTVTVSS region 5 Anti-BCMA DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWY antibody QQKSHESPRLLIKYASQSISGIPSRFSGSGSGSDFTLSI lightchain NSVEPEDVGVYYCQNGHSFPPTFGGGTKLEIK variable region 6 Linking GGGGS peptide 7 Signal MALPVTALLLPLALLLHAARP peptide 8 Hingeregion KTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVH TRGLDFASD 9 Transmembr FWVLVVVGGVLACYSLLVTVAFIIFWV aneregion 10 Costimulatory KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEE signal EGGCEL molecule 11 CD32 RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVL DKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPR 12 CS1antigen MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGA VTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVT QNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYS SSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGT CVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSI LPISWRWGESDMTFICVARNPVSRNFSSPILARKLCE GAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKR ERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPH TNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDT PRLFAYENVI 13 BCMA MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLT antigen CQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFV LMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSR TGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFP LPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSIS AR