CHIMERIC ANTIGEN RECEPTOR T CELLS TARGETING THE TUMOR MICROENVIRONMENT
20240075070 ยท 2024-03-07
Assignee
Inventors
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K16/22
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
A61K38/177
HUMAN NECESSITIES
C07K2317/22
CHEMISTRY; METALLURGY
C07K2317/62
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
A61K38/177
HUMAN NECESSITIES
C07K16/2809
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
International classification
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The invention provides methods and compositions for use in treating cancer, which advantageously may be achieved by targeting of the tumor microenvironment.
Claims
1-49. (canceled)
50. A bispecific antibody reagent comprising: (i) an anti-EGFR antibody reagent comprising an amino acid sequence of SEQ ID NO: 42; and (ii) an anti-CD3 antibody reagent comprising an amino acid sequence of SEQ ID NO: 43.
51. The bispecific antibody reagent of claim 50, further comprising a linker.
52. The bispecific antibody reagent of claim 50, wherein the linker comprises a glycine-based linker.
53. The bispecific antibody reagent of claim 50, further comprising a leader sequence.
54. The bispecific antibody reagent of claim 53, wherein the leader sequence is a CD8 leader sequence.
55. The bispecific antibody reagent of claim 53, wherein the leader sequence is an IgK leader sequence.
56. The bispecific antibody reagent of claim 53, wherein IgK leader sequence comprising an amino acid sequence of SEQ ID NO: 32.
57. The bispecific antibody reagent of claim 50 comprising from N-terminal to C-terminal the leader sequence, an anti-EGFR antibody reagent, the linker, and the anti-CD3 antibody reagent.
58. A bispecific antibody reagent comprising amino acids 494-1003 of SEQ ID NO: 35.
59. The bispecific antibody reagent of claim 50, wherein the bispecific antibody reagent comprises a bispecific T cell engager.
60. A polynucleotide comprising a nucleic acid sequence encoding the bispecific antibody reagent of claim 50.
61. A vector comprising a nucleic acid sequence encoding the polynucleotide of claim 60.
62. A cell comprising the polynucleotide of claim 60.
63. The cell of claim 62, wherein the cell is a mammalian cell.
64. The cell of claim 62, wherein the mammalian cell is an immune cell.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
DETAILED DESCRIPTION
[0098] The invention provides improved approaches to chimeric antigen receptor T cell (CAR T cell)-based therapy. In general, the improvements relate to different aspects of targeting in antitumor therapy, for example, targeting of the tumor microenvironment.
[0099] As is explained further below, we have demonstrated that regulatory T cells (also referred to herein as Tregs), which play a role in the suppression of a subject's immune response against tumors (e.g., in the tumor microenvironment), can be targeted with CAR T cells. The invention thus provides CAR T cells, in which the CAR is directed against a Treg antigen or marker (e.g., GARP, LAP, CTLA4, or CD25; also see below). In other examples, the invention provides CAR T cells that secrete antibodies (e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bispecific antibodies (e.g., bispecific T cell engagers)) against one or more Treg antigens or markers (e.g., GARP, LAP, CTLA4 and CD25; also see below). In addition to targeting Tregs, the invention provides CAR T cells and related methods for delivering other therapeutic agents (e.g., antibodies and related molecules) to tumors. In one example, a CAR T cell having a CAR specific for EGFRvIII is used to target brain tumors (e.g., glioblastomas). Such CAR T cells may also be used to deliver therapeutic molecules, such as antibody reagents (e.g., single chain antibodies, single domain antibodies (e.g., camelid antibodies), or bi-specific antibodies (e.g., bispecific T cell engagers)) to these tumors. These methods are particularly advantageous, as they, in effect, facilitate antibody administration to the brain, despite the blood brain barrier through which antibodies do not normally pass. These approaches, as well as related methods and compositions, are described further, as follows.
Chimeric Antigen Receptors
[0100] The technology described herein provides improved CARs for use in immunotherapy. The following discusses CARs and the various improvements.
[0101] The terms chimeric antigen receptor or CAR or CARs as used herein refer to engineered T cell receptors, which graft a ligand or antigen specificity onto T cells (for example, na?ve T cells, central memory T cells, effector memory T cells or combinations thereof). CARs are also known as artificial T-cell receptors, chimeric T-cell receptors or chimeric immunoreceptors.
[0102] A CAR places a chimeric extracellular target-binding domain that specifically binds a target, e.g., a polypeptide, expressed on the surface of a cell to be targeted for a T cell response onto a construct including a transmembrane domain and intracellular domain(s) of a T cell receptor molecule. In one embodiment, the chimeric extracellular target-binding domain comprises the antigen-binding domain(s) of an antibody that specifically binds an antigen expressed on a cell to be targeted for a T cell response. The properties of the intracellular signaling domain(s) of the CAR can vary as known in the art and as disclosed herein, but the chimeric target/antigen-binding domains(s) render the receptor sensitive to signaling activation when the chimeric target/antigen binding domain binds the target/antigen on the surface of a targeted cell.
[0103] With respect to intracellular signaling domains, so-called first-generation CARs include those that solely provide CD3zeta (CD3?) signals upon antigen binding. So-called second-generation CARs include those that provide both co-stimulation (e.g., CD28 or CD 137) and activation (CD3?) domains, and so-called third-generation CARs include those that provide multiple costimulatory (e.g., CD28 and CD 137) domains and activation domains (e.g., CD3?). In various embodiments, the CAR is selected to have high affinity or avidity for the target/antigenfor example, antibody-derived target or antigen binding domains will generally have higher affinity and/or avidity for the target antigen than would a naturally-occurring T cell receptor. This property, combined with the high specificity one can select for an antibody provides highly specific T cell targeting by CAR T cells.
[0104] As used herein, a CAR T cell or CAR-T refers to a T cell that expresses a CAR. When expressed in a T cell, CARs have the ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives T-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
[0105] As used herein, the term extracellular target binding domain refers to a polypeptide found on the outside of the cell that is sufficient to facilitate binding to a target. The extracellular target binding domain will specifically bind to its binding partner, i.e., the target. As non-limiting examples, the extracellular target-binding domain can include an antigen-binding domain of an antibody or antibody reagent, or a ligand, which recognizes and binds with a cognate binding partner protein. In this context, a ligand is a molecule that binds specifically to a portion of a protein and/or receptor. The cognate binding partner of a ligand useful in the methods and compositions described herein can generally be found on the surface of a cell. Ligand:cognate partner binding can result in the alteration of the ligand-bearing receptor, or activate a physiological response, for example, the activation of a signaling pathway. In one embodiment, the ligand can be non-native to the genome. Optionally, the ligand has a conserved function across at least two species.
Antibody Reagents
[0106] In various embodiments, the CARs described herein comprise an antibody reagent or an antigen-binding domain thereof as an extracellular target-binding domain.
[0107] As used herein, the term antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen. An antibody reagent can comprise an antibody or a polypeptide comprising an antigen-binding domain of an antibody. In some embodiments of any of the aspects, an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as V.sub.H), and a light (L) chain variable region (abbreviated herein as V.sub.L). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab)2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g., de Wildt et al., Eur. J. Immunol. 26(3):629-639, 1996; which is incorporated by reference herein in its entirety)) as well as complete antibodies. An antibody can have the structural features of IgA, IgG, IgE, IgD, or IgM (as well as subtypes and combinations thereof). Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies. Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like. Fully human antibody binding domains can be selected, for example, from phage display libraries using methods known to those of ordinary skill in the art. Furthermore, antibody reagents include single domain antibodies, such as camelid antibodies.
[0108] The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). The extent of the framework region and CDRs has been precisely defined (see, Kabat, E. A. et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia et al., J. Mol. Biol. 196:901-917, 1987; each of which is incorporated by reference herein in its entirety). Each V.sub.H and V.sub.L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
[0109] In one embodiment, the antibody or antibody reagent is not a human antibody or antibody reagent (i.e., the antibody or antibody reagent is mouse), but has been humanized. A humanized antibody or antibody reagent refers to a non-human antibody or antibody reagent that has been modified at the protein sequence level to increase its similarity to antibody or antibody reagent variants produced naturally in humans. One approach to humanizing antibodies employs the grafting of murine or other non-human CDRs onto human antibody frameworks.
[0110] In one embodiment, the extracellular target binding domain of a CAR comprises or consists essentially of a single-chain Fv (scFv) fragment created by fusing the V.sub.H and V.sub.L domains of an antibody, generally a monoclonal antibody, via a flexible linker peptide. In various embodiments, the scFv is fused to a transmembrane domain and to a T cell receptor intracellular signaling domain, e.g., an engineered intracellular signaling domain as described herein. In another embodiment, the extracellular target binding domain of a CAR comprises a camelid antibody.
[0111] Antibody binding domains and ways to select and clone them are well-known to those of ordinary skill in the art. In one embodiment, the antibody reagent is an anti-GARP antibody reagent and comprises the sequence of SEQ ID NO: 3 or 25, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 3 or 25. In another embodiment, the antibody reagent is an anti-LAP antibody reagent and comprises the sequence of SEQ ID NO: 9 or 15, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 9 or 15. In another embodiment, the antibody reagent is an anti-EGFR or anti-EGFRvIII antibody reagent and comprises the sequence of SEQ ID NO: 21, 27, 33, 36, 42, 45, 55, 57, or 65, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 21, 27, 33, 36, 42, 45, 55, 57, or 65. In another embodiment, the antibody reagent is an anti-CD19 antibody reagent and comprises the sequence of SEQ ID NO: 51 or 63, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 51 or 63. In another embodiment, the antibody reagent is an anti-CD3 antibody reagent and comprises the sequence of SEQ ID NO: 34, 43, 52, 56, or 64, or comprises a sequence with at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or greater sequence identity to the sequence of SEQ ID NO: 34, 43, 52, 56, or 64. In various examples, the antibody can be selected from C225, 3C10, Cetuximab, and 2173.
[0112] In one embodiment, the CARs useful in the technology described herein comprise at least two antigen-specific targeting regions, an extracellular domain, a transmembrane domain, and an intracellular signaling domain. In such embodiments, the two or more antigen-specific targeting regions target at least two different antigens and may be arranged in tandem and separated by linker sequences. In another embodiment, the CAR is a bispecific CAR. A bispecific CAR is specific to two different antigens.
Target/Antigen
[0113] Any cell-surface moiety can be targeted by a CAR. Often, the target will be a cell-surface polypeptide that may be differentially or preferentially expressed on a cell that one wishes to target for a T cell response. To target Tregs, antibody reagents can be targeted against, e.g., Glycoprotein A Repetitions Predominant (GARP), latency-associated peptide (LAP), CD25, CTLA-4, ICOS, TNFR2, GITR, OX40, 4-1BB, and LAG-3. To target tumors or cancer cells, antibody domains can be targeted against, e.g., EGFR or EGFRvIII, as described herein. Targeting tumor antigens or tumor-associated antigens that are specific to the tumors can provide a means to target tumor cells while avoiding or at least limiting collateral damage to non-tumor cells or tissues. Non-limiting examples of additional tumor antigens, tumor-associated antigens, or other antigen of interest include CD19, CD37, BCMA (tumor necrosis factor receptor superfamily member 17 (TNFRSF17); NCBI Gene ID: 608; NCBI Ref Seq NP_001183.2) and mRNA (e.g., NCBI Ref Seq NM_001192.2), CEA, immature laminin receptor, TAG-72, HPV E6 and E7, BING-4, calcium-activated chloride channel 2, cyclin B1, 9D7, Ep-CAM, EphA3, her2/neu, telomerase, mesotheliun, SAP-1, survivin, BAGE family, CAGE family, GAGE family, MAGE family, SAGE family, XAGE family, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, gp100/pmel17, tyrosinase, TRP-1/-2, MC1R, BRCA1/2, CDK4, MART-2, p53, Ras, MUC1, TGF-?RII, IL-15, IL13Ra2, and CSF1R.
Transmembrane Domain
[0114] Each CAR as described herein includes a transmembrane domain that joins the extracellular target-binding domain to the intracellular signaling domain.
[0115] As used herein, transmembrane domain (TM domain) refers to the generally hydrophobic region of the CAR which crosses the plasma membrane of a cell. The TM domain can be the transmembrane region or fragment thereof of a transmembrane protein (for example a Type I transmembrane protein or other transmembrane protein), an artificial hydrophobic sequence, or a combination thereof. While specific examples are provided herein and used in the Examples, other transmembrane domains will be apparent to those of skill in the art and can be used in connection with alternate embodiments of the technology. A selected transmembrane region or fragment thereof would preferably not interfere with the intended function of the CAR. As used in relation to a transmembrane domain of a protein or polypeptide, fragment thereof refers to a portion of a transmembrane domain that is sufficient to anchor or attach a protein to a cell surface.
[0116] In one embodiment, the transmembrane domain of a CAR or fragment thereof is derived from or comprises the transmembrane domain of CD8 (e.g., any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, or 66, or variants thereof). In an alternate embodiment, the transmembrane domain or fragment thereof of the CAR described herein comprises a transmembrane domain selected from the transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CDI Ia, CD18), ICOS (CD278), 4-1BB (CD137), 4-1BBL, GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRFI), CD160, CD19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CDI Id, ITGAE, CD103, ITGAL, CDI Ia, LFA-1, ITGAM, CDI Ib, ITGAX, CDI Ic, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1(CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), SLAMF6 (NTB-A, Lyl08), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, and/or NKG2C.
[0117] CD8 is an antigen preferentially found on the cell surface of cytotoxic T lymphocytes. CD8 mediates cell-cell interactions within the immune system, and acts as a T cell co-receptor. CD8 consists of an alpha (CD8?) and beta (CD8?) chain. CD8a sequences are known for a number of species, e.g., human CD8a, (NCBI Gene ID: 925) polypeptide (e.g., NCBI Ref Seq NP_001139345.1) and mRNA (e.g., NCBI Ref Seq NM_000002.12). CD8 can refer to human CD8, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, CD8 can refer to the CD8 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CD8 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD8 sequence.
[0118] 4-1BBL is a type 2 transmembrane glycoprotein belonging to the TNF superfamily. 4-1BBL is expressed on activated T lymphocytes. 4-1BBL sequences are known for a number of species, e.g., human 4-1BBL, also known as TNFSF9 (NCBI Gene ID: 8744) polypeptide (e.g., NCBI Ref Seq NP_003802.1) and mRNA (e.g., NCBI Ref Seq NM_003811.3). 4-1BBL can refer to human 4-1BBL, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, 4-1BBL can refer to the 4-1BBL of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human 4-1BBL are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference 4-1BBL sequence.
Co-Stimulatory Domain
[0119] Each CAR described herein optionally comprises the intracellular domain of one or more co-stimulatory molecule or co-stimulatory domain. As used herein, the term co-stimulatory domain refers to an intracellular signaling domain of a co-stimulatory molecule. Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen. In one example, a 4-1BB intracellular domain (ICD) can be used (see, e.g., below and SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, 67, or variants thereof). Additional illustrative examples of such co-stimulatory molecules include CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (OX40), CD137 (4-1BB), CD150 (SLAMF1), CD152 (CTLA4), CD223 (LAG3), CD270 (HVEM), CD273 (PD-L2), CD274 (PD-L1), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70. In one embodiment, the intracellular domain is the intracellular domain of 4-1BB. 4-1BB (CD137; TNFRS9) is an activation-induced costimulatory molecule, and is an important regulator of immune responses.
Intracellular Signaling Domain
[0120] CARs as described herein comprise an intracellular signaling domain. An intracellular signaling domain, refers to the part of a CAR polypeptide that participates in transducing the message of effective CAR binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited following antigen binding to the extracellular CAR domain. In various examples, the intracellular signaling domain is from CD3? (see, e.g., below and SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, 68, or variants thereof). Additional non-limiting examples of ITAM-containing intracellular signaling domains that are of particular use in the technology include those derived from TCR?, FcR?, FcR?, CD3?, CD3?, CD3?, CD3?, CD3?, CD22, CD79a, CD79b, and CD66d.
[0121] CD3 is a T cell co-receptor that facilitates T lymphocyte activation when simultaneously engaged with the appropriate co-stimulation (e.g., binding of a co-stimulatory molecule). A CD3 complex consists of 4 distinct chains; mammal CD3 consists of a CD3? chain, a CD3? chain, and two CD3? chains. These chains associate with a molecule known as the T cell receptor (TCR) and the CD3? to generate an activation signal in T lymphocytes. A complete TCR complex comprises a TCR, CD3?, and the complete CD3 complex.
[0122] In some embodiments of any aspect, a CAR polypeptide described herein comprises an intracellular signaling domain that comprises an Immunoreceptor Tyrosine-based Activation Motif or ITAM from CD3 zeta (CD3?). In some embodiments of any aspect, the ITAM comprises three motifs of ITAM of CD3? (ITAM3). In some embodiments of any aspect, the three motifs of ITAM of CD3? are not mutated and, therefore, include native or wild-type sequences. In some embodiments, the CD3? sequence comprises the sequence of a CD3? as set forth in the sequences provided herein.
[0123] Individual CAR and other construct components as described herein can be used with one another and swapped in and out of various constructs described herein, as can be determined by those of skill in the art. Each of these components can comprise or consist of any of the corresponding sequences set forth herein, or variants thereof.
[0124] A more detailed description of CARs and CAR T cells can be found in Maus et al., Blood 123:2624-2635, 2014; Reardon et al., Neuro-Oncology 16:1441-1458, 2014; Hoyos et al., Haematologica 97:1622, 2012; Byrd et al., J. Clin. Oncol. 32:3039-3047, 2014; Maher et al., Cancer Res 69:4559-4562, 2009; and Tamada et al., Clin. Cancer Res. 18:6436-6445, 2012; each of which is incorporated by reference herein in its entirety.
[0125] In one embodiment, the CAR further comprises a linker domain. As used herein linker domain refers to an oligo- or polypeptide region from about 2 to 100 amino acids in length, which links together any of the domains/regions of the CAR as described herein. In some embodiment, linkers can include or be composed of flexible residues such as glycine and serine so that the adjacent protein domains are free to move relative to one another. Longer linkers may be used when it is desirable to ensure that two adjacent domains do not sterically interfere with one another. Linkers may be cleavable or non-cleavable. Examples of cleavable linkers include 2A linkers (for example T2A), 2A-like linkers or functional equivalents thereof and combinations thereof. In various examples, linkers having sequences as set forth herein, or variants thereof, are used. It is to be understood that the indication of a particular linker in a construct in a particular location does not mean that only that linker can be used there. Rather, different linker sequences (e.g., P2A and T2A) can be swapped with one another (e.g., in the context of the constructs of the present invention), as can be determined by those of skill in the art. In one embodiment, the linker region is T2A derived from Thosea asigna virus. Non-limiting examples of linkers that can be used in this technology include T2A, P2A, E2A, BmCPV2A, and BmIFV2A. Linkers such as these can be used in the context of polyproteins, such as those described below. For example, they can be used to separate a CAR component of a polyprotein from a therapeutic agent (e.g., an antibody, such as a scFv, single domain antibody (e.g., a camelid antibody), or a bispecific antibody (e.g., a BiTE)) component of a polyprotein (see below).
[0126] In some embodiments, a CAR as described herein optionally further comprises a reporter molecule, e.g., to permit for non-invasive imaging (e.g., positron-emission tomography PET scan). In a bispecific CAR that includes a reporter molecule, the first extracellular binding domain and the second extracellular binding domain can include different or the same reporter molecule. In a bispecific CAR T cell, the first CAR and the second CAR can express different or the same reporter molecule. In another embodiment, a CAR as described herein further comprises a reporter molecule (for example hygromycin phosphotransferase (hph)) that can be imaged alone or in combination with a substrate or chemical (for example 9-[4-[.sup.18F]fluoro-3-(hydroxymethyl)butyl]guanine ([.sup.18F]FHBG)). In another embodiment, a CAR as described herein further comprises nanoparticles at can be readily imaged using non-invasive techniques (e.g., gold nanoparticles (GNP) functionalized with .sup.64Cu.sub.2+). Labeling of CAR T cells for non-invasive imaging is reviewed, for example in Bhatnagar et al., Integr. Biol. (Camb). 5(1):231-238, 2013, and Keu et al., Sci. Transl. Med. 18; 9(373), 2017, which are incorporated herein by reference in their entireties.
[0127] GFP and mCherry are demonstrated herein as fluorescent tags useful for imaging a CAR expressed on a T cell (e.g., a CAR T cell). It is expected that essentially any fluorescent protein known in the art can be used as a fluorescent tag for this purpose. For clinical applications, the CAR need not include a fluorescent tag or fluorescent protein. In each instance of particular constructs provided herein, therefore, any markers present in the constructs can be removed. The invention includes the constructs with or without the markers. Accordingly, when a specific construct is referenced herein, it can be considered with or without any markers or tags (including, e.g., histidine tags) as being included within the invention.
[0128] In one embodiment, the CAR polypeptide sequence corresponds to, comprises, or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity of a sequence selected from SEQ ID NOs: 1, 7, or 13, or the combination of SEQ ID NOs: 21-24, 27-30, 36-39, 45-48, 57-60, or 65-68. As can be determined by those of skill in the art, various functionally similar or equivalent components of these CARs can be swapped or substituted with one another, as well as other similar or functionally equivalent components known in the art or listed herein.
Antibodies and Related Molecules Delivered by CAR T Cells
[0129] As noted above, the CAR T cells of the invention can optionally be used to deliver antibody reagents (or other therapeutic molecules, e.g., cytokines) to tumors, such as to the tumor microenvironment. In various embodiments, the antibody reagents are encoded by the same nucleic acid molecule as the CAR, thus facilitating transduction of cells (e.g., T cells) to express both a CAR and an antibody reagent. In such examples, the antibody reagent can be expressed, e.g., such that it is separated from the CAR (and optionally other proteins, e.g., markers) by cleavable linker sequences (e.g., a 2A linker, such as, e.g., P2A or T2A; see above). The antibody reagent can be expressed under the control of the same promoter as the CAR (e.g., by an EF1a promoter), and can be constitutively expressed. In other examples, the antibody reagent is expressed under the control of an inducible promoter, e.g., a promoter that is expressed upon T cell activation (e.g., an NFAT promoter). Such an inducible promoter can be used, e.g., to ensure that the antibody is expressed only upon T cell activation, and thus only, e.g., when the CAR T cell is within the tumor microenvironment, to which locale it may be advantageous to have antibody production limited. As is understood in the art, the CAR coding sequences can be 5 or 3 to the antibody reagent coding sequences in various vector designs within the invention.
[0130] In various examples, the antibodies expressed within a CAR T cell (e.g., from the same nucleic acid molecule as the CAR) are single chain antibodies or single domain antibodies as described herein (scFV or camelids). In the case of single chain antibodies, the chains may be in the order L-H or H-L, and optionally may be separated from one another by a linker (e.g., a glycine-based linker).
[0131] In various examples, the antibodies are bi-specific antibodies including, e.g., bispecific T cell engagers (BiTEs). Such molecules can target T cells (e.g., by binding CD3) as well as a tumor antigen (e.g., EGFR, EGFRvIII, or CD19; also see above), and can be used to augment the T cell response in, e.g., the tumor microenvironment. The two components of a BiTE can optionally be separated from one another by a linker (e.g., a glycine-based linker).
[0132] Antibody reagents can be targeted against, e.g., tumor antigens or Treg antigens, such as those described herein, or other antigens (e.g., EGFR, EGFRvIII, CD19, CTLA4, CD25, GARP, LAP, IL-15, IL13Ra2, CSF1 R etc.)
[0133] In addition to optionally delivering antibody reagents, as described herein, the CAR T cells of the invention can be used to delivery other therapeutic molecules including, e.g., cytokines and toxins.
[0134] Other components of CARs and related constructs (or variants thereof), as described herein, such as IgK (e.g., SEQ ID NO: 32, 41, 50, 54, 62, or variants thereof), CD8 leader (e.g., SEQ ID NO: 2, 14, 20, or variants thereof), and related sequences, can be selected for use in making constructs of the invention, as will be apparent to those of skill in the art.
Cells and Therapy
[0135] One aspect of the technology described herein relates to a mammalian cell comprising any of the CAR polypeptides described herein (optionally together with another therapeutic molecule, e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a BiTE) or a cytokine); or a nucleic acid encoding any of the CAR polypeptides described herein (optionally together with another therapeutic molecule, e.g., an antibody reagent (e.g., a scFv, a camelid antibody, or a cytokine). In one embodiment, the mammalian cell comprises an antibody, antibody reagent, antigen-binding portion thereof, any of the CARs described herein, or a cytokine, or a nucleic acid encoding such an antibody, antibody reagent, antigen-binding portion thereof, any of the CARs described herein, or a cytokine. The mammalian cell or tissue can be of human, primate, hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog or cat origin, but any other mammalian cell may be used. In a preferred embodiment of any aspect, the mammalian cell is human.
[0136] In one embodiment, the cell is a T cell. In alternate embodiments of any aspect, the cell is an immune cell. As used herein, immune cell refers to a cell that plays a role in the immune response. Immune cells are of hematopoietic origin, and include lymphocytes, such as B cells and T cells; natural killer cells; myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes. In some embodiments, the cell is a T cell; a NK cell; a NKT cell; lymphocytes, such as B cells and T cells; and myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
[0137] In one embodiment, the cell is obtained from an individual having or diagnosed as having cancer, a plasma cell disorder, or autoimmune disease.
[0138] Cancer as used herein can refer to a hyperproliferation of cells whose unique trait, loss of normal cellular control, results in unregulated growth, lack of differentiation, local tissue invasion, and metastasis, and can be glioblastoma, glioma, leukemia, lymphoma, multiple myeloma, or a solid tumor. Non-limiting examples of leukemia include acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphocytic leukemia (ALL), and chronic lymphocytic leukemia (CLL). In one embodiment, the cancer is ALL or CLL. Non-limiting examples of lymphoma include diffuse large B-cell lymphoma (DLBCL), follicular lymphoma, chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), mantle cell lymphoma (MCL), marginal zone lymphomas, Burkitt lymphoma, hairy cell leukemia (HCL), and T cell lymphoma (e.g., peripheral T cell lymphoma (PTCL), including cutaneous T cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL)). In one embodiment, the cancer is DLBCL or follicular lymphoma. Non-limiting examples of solid tumors include adrenocortical tumor, alveolar soft part sarcoma, carcinoma, chondrosarcoma, colorectal carcinoma, desmoid tumors, desmoplastic small round cell tumor, endocrine tumors, endodermal sinus tumor, epithelioid hemangioendothelioma, Ewing sarcoma, germ cell tumors (solid tumor), giant cell tumor of bone and soft tissue, hepatoblastoma, hepatocellular carcinoma, melanoma, nephroma, neuroblastoma, non-rhabdomyosarcoma soft tissue sarcoma (NRSTS), osteosarcoma, paraspinal sarcoma, renal cell carcinoma, retinoblastoma, rhabdomyosarcoma, synovial sarcoma, and Wilms tumor. Solid tumors can be found in bones, muscles, or organs, and can be sarcomas or carcinomas. It is contemplated that any aspect of the technology described herein can be used to treat all types of cancers, including cancers not listed in the instant application. As used herein, the term tumor refers to an abnormal growth of cells or tissues, e.g., of malignant type or benign type.
[0139] As used herein, an autoimmune disease or disorder is characterized by the inability of one's immune system to distinguish between a foreign cell and a healthy cell. This results in one's immune system targeting one's healthy cells for programmed cell death. Non-limiting examples of an autoimmune disease or disorder include inflammatory arthritis, type 1 diabetes mellitus, multiples sclerosis, psoriasis, inflammatory bowel diseases, SLE, and vasculitis, allergic inflammation, such as allergic asthma, atopic dermatitis, and contact hypersensitivity. Other examples of auto-immune-related disease or disorder, but should not be construed to be limited to, include rheumatoid arthritis, multiple sclerosis (MS), systemic lupus erythematosus, Graves' disease (overactive thyroid), Hashimoto's thyroiditis (underactive thyroid), celiac disease, Crohn's disease and ulcerative colitis, Guillain-Barre syndrome, primary biliary sclerosis/cirrhosis, sclerosing cholangitis, autoimmune hepatitis, Raynaud's phenomenon, scleroderma, Sjogren's syndrome, Goodpasture's syndrome, Wegener's granulomatosis, polymyalgia rheumatica, temporal arteritis/giant cell arteritis, chronic fatigue syndrome CFS), psoriasis, autoimmune Addison's Disease, ankylosing spondylitis, acute disseminated encephalomyelitis, antiphospholipid antibody syndrome, aplastic anemia, idiopathic thrombocytopenic purpura, myasthenia gravis, opsoclonus myoclonus syndrome, optic neuritis, Ord's thyroiditis, pemphigus, pernicious anaemia, polyarthritis in dogs, Reiter's syndrome, Takayasu's arteritis, warm autoimmune hemolytic anemia, Wegener's granulomatosis and fibromyalgia (FM).
[0140] In one embodiment, the mammalian cell is obtained for a patient having an immune system disorder that results in abnormally low activity of the immune system, or immune deficiency disorders, which hinders one's ability to fight a foreign agent (e.g., a virus or bacterial cell).
[0141] A plasma cell is a white blood cell produces from B lymphocytes which function to generate and release antibodies needed to fight infections. As used herein, a plasma cell disorder or disease is characterized by abnormal multiplication of a plasma cell. Abnormal plasma cells are capable of crowding out healthy plasma cells, which results in a decreased capacity to fight a foreign object, such as a virus or bacterial cell. Non-limiting examples of plasma cell disorders include amyloidosis, Waldenstrom's macroglobulinemia, osteosclerotic myeloma (POEMS syndrome), monoclonal gammopathy of unknown significance (MGUS), and plasma cell myeloma.
[0142] T cells can be obtained from a subject using standard techniques known in the field. For example, T cells can be isolated from peripheral blood taken from a donor or patient. T cells can be isolated from a mammal. Preferably, T cells are isolated from a human.
[0143] A cell, for example a T cell, can be engineered to comprise any of the CAR polypeptides described herein (including CAR polypeptides that are cleavably linked to antibody reagents or cytokines, as described herein); or a nucleic acid encoding any of the CAR polypeptides (and optionally also a genetically encoded antibody reagent or cytokine) described herein. In one embodiment, the any of the CAR polypeptides (optionally together with an antibody reagent as described herein or a cytokine) described herein are expressed from a lentiviral vector. The lentiviral vector is used to express the CAR polypeptide (and optionally also the antibody reagent or cytokine) in a cell using infection standard techniques.
[0144] Retroviruses, such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding a gene or chimeric gene of interest. A selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells, e.g., in vitro or ex vivo. Retroviral systems are well known in the art and are described in, for example, U.S. Pat. No. 5,219,740; Kurth and Bannert (2010) Retroviruses: Molecular Biology, Genomics and Pathogenesis Calster Academic Press (ISBN:978-1-90455-55-4); and Hu et al., Pharmacological Reviews 52:493-512, 2000; which are each incorporated by reference herein in their entirety. Lentiviral system for efficient DNA delivery can be purchased from OriGene; Rockville, MD. In alternative embodiments, the CAR polypeptide (and optionally the antibody reagent or cytokine) of any of the CARS described herein are expressed in the mammalian cell via transfection or electroporation of an expression vector comprising nucleic acid encoding the CAR. Transfection or electroporation methods are known in the art.
[0145] Efficient expression of the CAR polypeptide (and optionally the antibody reagent or cytokine) of any of the polypeptides described herein can be assessed using standard assays that detect the mRNA, DNA, or gene product of the nucleic acid encoding the CAR (and optional antibody reagent or cytokine). For example, RT-PCR, FACS, northern blotting, western blotting, ELISA, or immunohistochemistry.
[0146] In one embodiment, the CAR polypeptide (and optional antibody reagent or cytokine) described herein is constitutively expressed. In one embodiment, the CAR polypeptide is constitutively expressed and the optional antibody reagent or cytokine is inducible expressed. In one embodiment, the CAR polypeptide (and optional antibody reagent or cytokine) described herein is encoded by recombinant nucleic acid sequence.
[0147] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: engineering a T cell to comprise any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein on the T cell surface; and administering the engineered T cell to the subject. In the case of cancer, the method can be for treating diagnosed cancer, preventing recurrence of cancer, or for use in an adjuvant or neoadjuvant setting.
[0148] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: administering the cell of any of the mammalian cells comprising the any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein.
[0149] Cluster differentiation (CD) molecules are cell surface markers present on leukocytes. As a leukocyte differentiates and matures its CD profile changes. In the case that a leukocytes turns into a cancer cell (i.e., a lymphoma), its CD profile is important in diagnosing the disease. The treatment and prognosis of certain types of cancers is reliant on determining the CD profile of the cancer cell. CDX.sub.+, wherein X is a CD marker, indicates the CD marker is present in the cancer cell, while CDX- indicates the marker is not present. One skilled in the art will be capable of assessing the CD molecules present on a cancer cell using standard techniques, for example, using immunofluorescence to detect commercially available antibodies bound to the CD molecules.
[0150] In some embodiments of any of the aspect, the engineered CAR-T cell is stimulated and/or activated prior to administration to the subject.
Administration
[0151] In some embodiments, the methods described herein relate to treating a subject having or diagnosed as having cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder with a mammalian cell comprising any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein, or a nucleic acid encoding any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein. As used herein, a CAR T cells as described herein refers to a mammalian cell comprising any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein, or a nucleic acid encoding any of the CAR polypeptides (and optional antibody reagents or cytokines) described herein. As used herein, a condition refers to a cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder. Subjects having a condition can be identified by a physician using current methods of diagnosing the condition. Symptoms and/or complications of the condition, which characterize these conditions and aid in diagnosis are well known in the art and include but are not limited to, fatigue, persistent infections, and persistent bleeding. Tests that may aid in a diagnosis of, e.g., the condition, but are not limited to, blood screening and bone marrow testing, and are known in the art for a given condition. A family history for a condition, or exposure to risk factors for a condition can also aid in determining if a subject is likely to have the condition or in making a diagnosis of the condition.
[0152] The compositions described herein can be administered to a subject having or diagnosed as having a condition. In some embodiments, the methods described herein comprise administering an effective amount of activated CAR T cells described herein to a subject in order to alleviate a symptom of the condition. As used herein, alleviating a symptom of the condition is ameliorating any condition or symptom associated with the condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. In one embodiment, the compositions described herein are administered systemically or locally. In a preferred embodiment, the compositions described herein are administered intravenously. In another embodiment, the compositions described herein are administered at the site of a tumor.
[0153] The term effective amount as used herein refers to the amount of activated CAR T cells needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of the cell preparation or composition to provide the desired effect. The term therapeutically effective amount therefore refers to an amount of activated CAR T cells that is sufficient to provide a particular anti-condition effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a condition), or reverse a symptom of the condition. Thus, it is not generally practicable to specify an exact effective amount. However, for any given case, an appropriate effective amount can be determined by one of ordinary skill in the art using only routine experimentation.
[0154] Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals. The dosage can vary depending upon the dosage form employed and the route of administration utilized. The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50. Compositions and methods that exhibit large therapeutic indices are preferred. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of activated CAR T cells, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for bone marrow testing, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
[0155] In one aspect of the technology, the technology described herein relates to a pharmaceutical composition comprising activated CAR T cells as described herein, and optionally a pharmaceutically acceptable carrier. The active ingredients of the pharmaceutical composition at a minimum comprise activated CAR T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of activated CAR T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of activated CAR T cells as described herein. Pharmaceutically acceptable carriers for cell-based therapeutic formulation include saline and aqueous buffer solutions, Ringer's solution, and serum component, such as serum albumin, HDL and LDL. The terms such as excipient, carrier, pharmaceutically acceptable carrier or the like are used interchangeably herein.
[0156] In some embodiments, the pharmaceutical composition comprising activated CAR T cells as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, the components apart from the CAR T cells themselves are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. Any of these can be added to the activated CAR T cells preparation prior to administration.
[0157] Suitable vehicles that can be used to provide parenteral dosage forms of activated CAR T cells as disclosed within are well known to those skilled in the art. Examples include, without limitation: saline solution; glucose solution; aqueous vehicles including but not limited to, sodium chloride injection, Ringer's injection, dextrose injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
Dosage
[0158] Unit dosage form as the term is used herein refers to a dosage for suitable one administration. By way of example, a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag. In one embodiment, a unit dosage form is administered in a single administration. In another, embodiment more than one unit dosage form can be administered simultaneously.
[0159] In some embodiments, the activated CAR T cells described herein are administered as a monotherapy, i.e., another treatment for the condition is not concurrently administered to the subject.
[0160] A pharmaceutical composition comprising the T cells described herein can generally be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, in some instances 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. If necessary, T cell compositions can also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. Med. 319:1676, 1988).
[0161] In certain aspects, it may be desired to administer activated CAR T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom as described herein, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain aspects, T cells can be activated from blood draws of from 10 cc to 400 cc. In certain aspects, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
[0162] Modes of administration can include, for example intravenous (i.v.) injection or infusion. The compositions described herein can be administered to a patient transarterially, intratumorally, intranodally, or intramedullary. In some embodiments, the compositions of T cells may be injected directly into a tumor, lymph node, or site of infection. In one embodiment, the compositions described herein are administered into a body cavity or body fluid (e.g., ascites, pleural fluid, peritoneal fluid, or cerebrospinal fluid).
[0163] In a particular exemplary aspect, subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells. These T cell isolates can be expanded by contact with an artificial APC, e.g., an aAPC expressing anti-CD28 and anti-CD3 CDRs, and treated such that one or more CAR constructs of the technology may be introduced, thereby creating a CAR T cell. Subjects in need thereof can subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. Following or concurrent with the transplant, subjects can receive an infusion of the expanded CAR T cells. In one embodiment, expanded cells are administered before or following surgery.
[0164] In some embodiments, lymphodepletion is performed on a subject prior to administering one or more CAR T cell as described herein. In such embodiments, the lymphodepletion can comprise administering one or more of melphalan, cytoxan, cyclophosphamide, and fludarabine.
[0165] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices.
[0166] In some embodiments, a single treatment regimen is required. In others, administration of one or more subsequent doses or treatment regimens can be performed. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer. In some embodiments, no additional treatments are administered following the initial treatment.
[0167] The dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen. The dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.
Combination Therapy
[0168] The activated CAR T cells described herein can optionally be used in combination with each other and with other known agents and therapies, as can determined to be appropriate by those of skill in the art. In one example, two or more CAR T cells targeting different Treg markers (e.g., GARP, LAP, etc.) can be administered in combination. In another example, two or more CAR T cells targeting different cancer antigens are administered in combination. In a further example, one or more CAR T cell targeting a Treg marker (e.g., GARP, LAP, etc.) and one or more CART cell targeting one or more tumor antigens are administered in combination.
[0169] Administered in combination, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as simultaneous or concurrent delivery. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered. The activated CAR T cells described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the CAR-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed. The CAR T therapy and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease. The CAR T therapy can be administered before another treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
[0170] When administered in combination, the activated CAR T cells and the additional agent (e.g., second or third agent), or all, can be administered in an amount or dose that is higher, lower or the same as the amount or dosage of each agent used individually, e.g., as a monotherapy. In certain embodiments, the administered amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually. In other embodiments, the amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, that results in a desired effect (e.g., treatment of cancer) is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower) than the amount or dosage of each agent individually required to achieve the same therapeutic effect. In further embodiments, the activated CAR T cells described herein can be used in a treatment regimen in combination with surgery, chemotherapy, radiation, an mTOR pathway inhibitor, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, or a peptide vaccine, such as that described in Izumoto et al., J. Neurosurg. 108:963- 971, 2008.
[0171] In one embodiment, the activated CAR T cells described herein can be used in combination with a checkpoint inhibitor. Exemplary checkpoint inhibitors include anti-PD-1 inhibitors (Nivolumab, MK-3475, Pembrolizumab, Pidilizumab, AMP-224, AMP-514), anti-CTLA4 inhibitors (Ipilimumab and Tremelimumab), anti-PDL1 inhibitors (Atezolizumab, Avelomab, MSB00107180, MEDI4736, and MPDL3280A), and anti-TIM3 inhibitors.
[0172] In one embodiment, the activated CAR T cells described herein can be used in combination with a chemotherapeutic agent. Exemplary chemotherapeutic agents include an anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludarabine)), an mTOR inhibitor, a TNFR glucocorticoid induced TNFR related protein (GITR) agonist, a proteasome inhibitor (e.g., aclacinomycin A, gliotoxin or bortezomib), an immunomodulator such as thalidomide or a thalidomide derivative (e.g., lenalidomide). General chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex?), bicalutamide (Casodex?), bleomycin sulfate (Blenoxane?), busulfan (Myleran?), busulfan injection (Busulfex?), capecitabine (Xeloda?), N4-pentoxycarbonyl-5- deoxy-5-fluorocytidine, carboplatin (Paraplatin?), carmustine (BiCNU?), chlorambucil (Leukeran?), cisplatin (Platinol?), cladribine (Leustatin?), cyclophosphamide (Cytoxan? or Neosar?), cytarabine, cytosine arabinoside (Cytosar-U?), cytarabine liposome injection (DepoCyte), dacarbazine (DTIC-Dome?), dactinomycin (Actinomycin D, Cosmegan), daunorubicin hydrochloride (Cerubidine?), daunorubicin citrate liposome injection (DaunoXome?), dexamethasone, docetaxel (Taxotere?), doxorubicin hydrochloride (Adriamycin?, Rubex?), etoposide (Vepesid?), fludarabine phosphate (Fludara?), 5- fluorouracil (Adrucil?, Efudex?), flutamide (Eulexin?), tezacitibine, Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea?), Idarubicin (Idamycin?), ifosfamide (IFEX?), irinotecan (Camptosar?), L-asparaginase (ELSPAR?), leucovorin calcium, melphalan (Alkeran?), 6-mercaptopurine (Purinethol?), methotrexate (Folex?), mitoxantrone (Novantrone?), mylotarg, paclitaxel (Taxol?), phoenix (Yttrium90/MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (Gliadel?), tamoxifen citrate (Nolvadex?), teniposide (Vumon?), 6-thioguanine, thiotepa, tirapazamine (Tirazone?), topotecan hydrochloride for injection (Hycamptin?), vinblastine (Velban?), vincristine (Oncovin?), and vinorelbine (Navelbine?). Exemplary alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard?, Chlorethaminacile, Demethyldopan?, Desmethyldopan?, Haemanthamine?, Nordopan?, Uracil nitrogen mustard?, Uracillost?, Uracilmostaza?, Uramustin?, Uramustine?), chlormethine (Mustargen?), cyclophosphamide (Cytoxan?, Neosar?, Clafen?, Endoxan?, Procytox?, Revimmune?), ifosfamide (Mitoxana?), melphalan (Alkeran?), Chlorambucil (Leukeran?), pipobroman (Amadei?, Vercyte?), triethylenemelamine (Hemel?, Hexalen?, Hexastat?), triethylenethiophosphoramine, Temozolomide (Temodar?), thiotepa (Thioplex?), busulfan (Busilvex?, Myleran?), carmustine (BiCNU?), lomustine (CeeNU?), streptozocin (Zanosar?), and Dacarbazine (DTIC-Dome?). Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin?); Temozolomide (Temodar? and Temodal?); Dactinomycin (also known as actinomycin-D, Cosmegen?); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran?); Altretamine (also known as hexamethylmelamine (HMM), Hexalen?); Carmustine (BiCNU?); Bendamustine (Treanda?); Busulfan (Busulfex? and Myleran?); Carboplatin (Paraplatin?); Lomustine (also known as CCNU, CeeNU?); Cisplatin (also known as CDDP, Platinol? and Platinol?-AQ); Chlorambucil (Leukeran?); Cyclophosphamide (Cytoxan? and Neosar?); Dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC-Dome?); Altretamine (also known as hexamethylmelamine (HMM), Hexalen?); Ifosfamide (Ifex?; Prednumustine; Procarbazine (Matulane?); Mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, Mustargen?); Streptozocin (Zanosar?); Thiotepa (also known as thiophosphoamide, TESPA and TSPA, Thioplex?); Cyclophosphamide (Endoxan?, Cytoxan?, Neosar?, Procytox?, Revimmune?); and Bendamustine HC1 (Treanda?). Exemplary mTOR inhibitors include, e.g., temsirolimus; ridaforolimus (formally known as deferolimus, (IR,2R,45)-4-[(2R)-2 [(1R,95,125,15R,16E,18R,19R,21R,235,24E,26E,28Z,305,325,35R)-I, 18-dihydroxy-19,30-dimethoxy-15, 17,21,23,29,35- hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.049] hexatriaconta-16,24,26,28-tetraen-12-yl]propyl]-2-methoxycyclohexyl dimethylphosphinate, also known as AP23573 and MK8669, and described in PCT Publication No. WO 03/064383); everolimus (Afinitor? or RADOOI); rapamycin (AY22989, Sirolimus?); simapimod (CAS 164301-51-3); emsirolimus, (5-{2,4-Bis [(35,)-3-nnethylmorpholin-4-yl]pyrido[2,3-(i]pyrimidin-7-yl}-2- methoxyphenyl)methanol (AZD8055); 2-Amino-8-[iraw5,-4-(2-hydroxyethoxy)cyclohexyl]-6- (6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3-JJpyrimidin-7(8H)-one (PF04691502, CAS 1013101-36-4); and N2-[1,4-dioxo-4-[[4-(4-oxo-8-phenyl-4H-1-benzopyran-2- yl)morpholinium-4-yl]nethoxy]butyl]-arginylglycyl-L-a-aspartylL-serine-, inner salt (SF1126, CAS 936487-67-1), and XL765. Exemplary immunomodulators include, e.g., afutuzumab (available from Roche?); pegfilgrastim (Neulasta?); lenalidomide (CC-5013, Revlimid?); thalidomide (Thalomid?), actimid (CC4047); and IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon ?, CAS 951209-71-5, available from IRX Therapeutics). Exemplary anthracyclines include, e.g., doxorubicin (Adriamycin? and Rubex?); bleomycin (lenoxane?); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine?); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome?); mitoxantrone (DHAD, Novantrone?); epirubicin (Ellence?); idarubicin (Idamycin?, Idamycin PFS?); mitomycin C (Mutamycin?); geldanamycin; herbimycin; ravidomycin; and desacetylravidomycin. Exemplary vinca alkaloids include, e.g., vinorelbine tartrate (Navelbine?), Vincristine (Oncovin?), and Vindesine (Eldisine?)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ? and Velban?); and vinorelbine (Navelbine?). Exemplary proteosome inhibitors include bortezomib (Velcade?); carfilzomib (PX-171-007, (5)-4-Methyl-N-((5)-I-(((5)-4-methyl-I-((R)-2-methyloxiran-2-yl)-I-oxopentan-2- yl)amino)-I-oxo-3-phenylpropan-2-yl)-2-((5,)-2-(2-morpholinoacetamido)-4- phenylbutanamido)-pentanamide); marizomib (NPT0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and O-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]-L-seryl-O- methyl-N-[IIS)-2-[(2R)-2-methyl-2-oxiranyl]-2-oxo-I-(phenylmethyl)ethyl]- L-serinamide (ONX-0912).
[0173] One of skill in the art can readily identify a chemotherapeutic agent of use (e.g., see Physicians' Cancer Chemotherapy Drug Manual 2014, Edward Chu, Vincent T. DeVita Jr., Jones & Bartlett Learning; Principles of Cancer Therapy, Chapter 85 in Harrison's Principles of Internal Medicine, 18.sup.th edition; Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology, Chapters 28-29 in Abeloff's Clinical Oncology, 2013 Elsevier; and Fischer D. S. (ed.): The Cancer Chemotherapy Handbook, 4.sup.th ed. St. Louis, Mosby-Year Book, 2003).
[0174] In an embodiment, activated CAR T cells described herein are administered to a subject in combination with a molecule that decreases the level and/or activity of a molecule targeting GITR and/or modulating GITR functions, a molecule that decreases the Treg cell population, an mTOR inhibitor, a GITR agonist, a kinase inhibitor, a non-receptor tyrosine kinase inhibitor, a CDK4 inhibitor, and/or a BTK inhibitor.
Efficacy
[0175] The efficacy of activated CAR T cells in, e.g., the treatment of a condition described herein, or to induce a response as described herein (e.g., a reduction in cancer cells) can be determined by the skilled clinician. However, a treatment is considered effective treatment, as the term is used herein, if one or more of the signs or symptoms of a condition described herein is altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced, e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate. Treatment according to the methods described herein can reduce levels of a marker or symptom of a condition, e.g. by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% or more.
[0176] Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the disease is halted). Methods of measuring these indicators are known to those of skill in the art and/or are described herein.
[0177] Treatment includes any treatment of a disease in an individual or an animal (some non-limiting examples include a human or an animal) and includes: (1) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g., pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms. An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, for that disease. Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response. It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy of a given approach can be assessed in animal models of a condition described herein. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.
[0178] All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior technology or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.
[0179] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.
[0180] Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.
[0181] The technology described herein is further illustrated by the following examples, which in no way should be construed as being further limiting.
EXAMPLES
Example 1. EGFRvIII-Targeted CAR T Cells
[0182] CAR T cells having an EGFRvIII antigen-binding moiety (e.g., CART-EGFRvIII cells) represent a promising cellular therapy for specific targeting of cytolytic cells to the tumor microenvironment, in part because EGFRvIII is specifically expressed on tumor tissue while generally absent from healthy tissue. In this example, CART-EGFRvIII cells were tested in vitro and in vivo in two animal models.
[0183] T cells from leukapheresis products obtained from deidentified healthy donors were stimulated with Dynabeads (Human T-Activator CD3/CD28) at a bead to cell ratio of 3:1 and cultured in complete RPMI 1640 medium. Ten days following stimulation and lentivirus transduction, cells were frozen and stored for use in functional assays.
[0184] Initial tests were performed in vitro to characterize the ability of CAR-EGFRvIII cells to preferentially kill tumor cells relative to untransduced control cells in a twenty-hour luciferase-based assay, shown in
[0185] For in vivo experiments, U87vIII tumor cells were collected in logarithmic growth phase, washed, and administered to mice subcutaneously in a xenograft model of human glioblastoma (
[0186] The potent antitumor effect observed in vitro was mirrored in the in vivo subcutaneous xenograft model of human glioblastoma (
[0187] The presence of regulatory T cells (Tregs) was observed in human patient tumor tissues after treatment with CART-EGFRvIII cells (
Example 2. Design and Characterization of CAR T Cells Targeted to Treg-Associated Antigens
[0188]
[0189] Next, CAR constructs encoding CARs targeting LAP and GARP were designed. Schematic illustrations of these constructs are shown in
[0190] Transduction efficiencies of Treg-targeted CAR constructs
TABLE-US-00001 CAR construct ND47 ND48 ND50 pMGH 97 CAR-GARP 68.0% 81.0% 72.8% (SEQ ID NO: 1) pMGH 99 CAR-LAP-H-L 57.1% 79.5% 80.4% (SEQ ID NO: 7) pMGH 100 CAR-LAP-L- 72.2% 88.2% 90.1% H (SEQ ID NO: 13) pMGH 105 CAR-EGFR- N/A N/A 51.2% GARP (SEQ ID NO: 19)
[0191] To test anti-LAP CART cells, CAR T cells were co-cultured with isolated Tregs expanded from the same donor and transduced to express GFP as a Treg marker. Tregs were activated overnight with anti-CD3 and anti-CD28 (
[0192] To further characterize the effect of antigen expression on function of LAP- and GARP-targeted CAR T cells, immortalized cell lines were screened for LAP and GARP antigen-expression, and the cytotoxic effect by each CAR T cell was assessed. First, HUT78 cells, a cutaneous human CD4 T cell lymphocyte-derived cell line that expresses IL-2, was stained for GARP and LAP (
[0193] Next, secretion of anti-GARP camelid antibodies by CART-EGFR-GARP cells was characterized by western blot (
Example 3. Design and Characterization of BiTE-Secreting CAR T Cells
[0194] Another mechanism provided herein to enhance efficacy of CAR T cell activity within tumor microenvironments (e.g., to overcome immune regulation by Tregs) is through a CAR T cell that secretes a immune-modulating antibodies, such as a BiTE. Without wishing to be bound by theory, the present inventors have discovered that expression of an immune-modulating antibody (e.g., a BiTE) from a construct that also encodes a CAR can further amplify antitumor effects.
[0195] One exemplary nucleic acid construct, CAR-EGFR-BiTE-(EGFR-CD3), shown schematically in
[0196] BiTE secretion by CART-EGFR-BiTE-(EGFR-CD3) cells was confirmed by isolating supernatant from cultures containing SupT1 cells transduced with CAR-EGFR-BiTE-(EGFR-CD3), calculating the concentration of BiTE in the supernatant based on OD450, and performing western blot analysis. The concentration of BiTE in the supernatant was 0.604 ng/mL. Results of a western blot experiment are shown in
[0197] Next, binding of BiTE molecules was assessed by flow cytometry. HEK293T cells were transduced with CAR-EGFR-BiTE-(EGFR-CD3), and supernatants containing secreted BiTEs were collected and incubated with K562 cells (
[0198] A similar experiment was conducted using SupT1 cells as transduction hosts for CAR-EGFR-BiTE-(EGFR-CD3).
[0199] Next, the ability of BiTEs secreted from transduced CAR T cells was characterized in vitro. Supernatants containing BiTEs secreted from HEK293T cells transduced with CAR-EGFR-BiTE-(EGFR-CD3) were incubated with a coculture of untransduced ND4 cells and U87vIII target cells at varying ratios. As shown in
[0200] To enable inducible expression of BiTE upon T cell activation, a construct containing an NFAT promoter was designed and synthesized. As shown in
Example 4. Sequence Information
[0201] Anti-GARP CAR-pMGH 97: CD8 Leader-anti-GARP-CD8 hinge+TM-4-1BB-CD3z (SEQ ID NO: 1) comprising CD8 leader sequence (amino acids 1-21 of SEQ ID NO: 1; SEQ ID NO: 2); anti-GARP camelid (amino acids 22-128 of SEQ ID NO: 1; SEQ ID NO: 3); CD8 hinge/TM domain (amino acids 129-197 of SEQ ID NO: 1; SEQ ID NO: 4); 4-1BB ICD (amino acids 198-239 of SEQ ID NO: 1; SEQ ID NO: 5); and CD3? (amino acids 240-351 of SEQ ID NO: 1; SEQ ID NO: 6).
TABLE-US-00002 (SEQIDNO:1) MALPVTALLLPLALLLHAARPDIQMTQSPSSLSASLGDRVTITCQASQSI SSYLAWYQQKPGQAPNILIYGASRLKTGVPSRFSGSGSGTSFTLTISGLE AEDAGTYYCQQYASVPVTFGQGTKVELKTTTPAPRPPTPAPTIASQPLSL RPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRG RKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAP AYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNE LQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPP R CD8leadersequence (aminoacids1-21ofSEQIDNO:1; SEQIDNO:2) MALPVTALLLPLALLLHAARP anti-GARPcamelid (aminoacids22-128ofSEQIDNO:1; SEQIDNO:3) DIQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYG ASRLKTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQ GTKVELK CD8hinge/TMdomain (aminoacids129-197ofSEQIDNO:1; SEQIDNO:4) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids198-239ofSEQIDNO:1; SEQIDNO:5) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3? (aminoacids240-351ofSEQIDNO:1; SEQIDNO:6) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR KRNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0202] Anti-LAP CAR (H-L)-pMGH 99: CD8 Leader?Anti-LAP?CD8 hinge+TM?4-1BB?CD3z (SEQ ID NO: 7) comprising CD8 leader sequence (amino acids 1-21 of SEQ ID NO: 7; SEQ ID NO: 8), anti-LAP scFv (H-L) (amino acids 22-307 of SEQ ID NO: 7; SEQ ID NO: 9), CD8 hinge/TM domain (amino acids 308-376 of SEQ ID NO: 7; SEQ ID NO: 10), 4-1BB ICD (amino acids 377-418 of SEQ ID NO: 7; SEQ ID NO: 11), and CD3? (amino acids 419-530 of SEQ ID NO: 7; SEQ ID NO: 12).
TABLE-US-00003 (SEQIDNO:7) MALPVTALLLPLALLLHAARPMKLWLNWIFLVTLLNDIQCEVKLVESGGG LVQPGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLGFIRNKPNGYTT EYSASVKGRFTISRDNSQSILYLQMNVLRAEDSATYYCARYTGGGYFDYW GQGTTLTVSSGGGGSGGGGSGGGGSGGGGSMMSSAQFLGLLLLCFQGTRC DIQMTQTTSSLSASLGDRLTISCRASQDISNYLNWYQQKPDGTVKLLIYY TSRLHSGVPSRFSGSGSGTDYSLTISNLEQADIATYFCQQGDTLPWTFGG GTKLEIKTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQE EDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEY DVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRR GKGHDGLYQGLSTATKDTYDALHMQALPPR CD8leadersequence (aminoacids1-21ofSEQIDNO:7; SEQIDNO:8) MALPVTALLLPLALLLHAARP Anti-LAPscFv(H-L) (aminoacids22-307ofSEQIDNO:7; SEQIDNO:9) MKLWLNWIFLVTLLNDIQCEVKLVESGGGLVQPGGSLSLSCAASGFTFTD YYMSWVRQPPGKALEWLGFIRNKPNGYTTEYSASVKGRFTISRDNSQSIL YLQMNVLRAEDSATYYCARYTGGGYFDYWGQGTTLTVSSGGGGSGGGGSG GGGSGGGGSMMSSAQFLGLLLLCFQGTRCDIQMTQTTSSLSASLGDRLTI SCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDY SLTISNLEQADIATYFCQQGDTLPWTFGGGTKLEIK CD8hinge/TMdomain (aminoacids308-376ofSEQIDNO:7; SEQIDNO:10) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids377-418ofSEQIDNO:7; SEQIDNO:11) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3?. (aminoacids419-530ofSEQIDNO:7; SEQIDNO:12) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0203] Anti-LAP CAR (L-H)-pMGH 100: CD8 Leader-anti-LAP-CD8 hinge+TM-4-1BB-CD3z (SEQ ID NO: 13) comprising CD8 leader (amino acids 1-21 of SEQ ID NO: 13; SEQ ID NO: 14), anti-LAP scFv (L-H) (amino acids 22-307 of SEQ ID NO: 13; SEQ ID NO: 15), CD8 hinge/TM (amino acids 308-376 of SEQ ID NO: 13; SEQ ID NO: 16), 4-1BB ICD (amino acids 377-418 of SEQ ID NO: 13; SEQ ID NO: 17), and CD3z (amino acids 419-530 of SEQ ID NO: 13; SEQ ID NO: 18).
TABLE-US-00004 (SEQIDNO:13) MALPVTALLLPLALLLHAARPMMSSAQFLGLLLLCFQGTRCDIQMTQTTS SLSASLGDRLTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVP SRFSGSGSGTDYSLTISNLEQADIATYFCQQGDTLPWTFGGGTKLEIKGG GGSGGGGSGGGGSGGGGSMKLWLNWIFLVTLLNDIQCEVKLVESGGGLVQ PGGSLSLSCAASGFTFTDYYMSWVRQPPGKALEWLGFIRNKPNGYTTEYS ASVKGRFTISRDNSQSILYLQMNVLRAEDSATYYCARYTGGGYFDYWGQG TTLTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQE EDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEY DVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRR GKGHDGLYQGLSTATKDTYDALHMQALPPR CD8leader (aminoacids1-21ofSEQIDNO:13; SEQIDNO:14) MALPVTALLLPLALLLHAARP Anti-LAPscFv(L-H) (aminoacids22-307ofSEQIDNO:13; SEQIDNO:15) MMSSAQFLGLLLLCFQGTRCDIQMTQTTSSLSASLGDRLTISCRASQDIS NYLNWYQQKPDGTVKLLIYYTSRLHSGVPSRFSGSGSGTDYSLTISNLEQ ADIATYFCQQGDTLPWTFGGGTKLEIKGGGGSGGGGSGGGGSGGGGSMKL WLNWIFLVTLLNDIQCEVKLVESGGGLVQPGGSLSLSCAASGFTFTDYYM SWVRQPPGKALEWLGFIRNKPNGYTTEYSASVKGRFTISRDNSQSILYLQ MNVLRAEDSATYYCARYTGGGYFDYWGQGTTLTVSS CD8hinge/TM (aminoacids308-376ofSEQIDNO:13; SEQIDNO:16) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids377-418ofSEQIDNO:13; SEQIDNO:17) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids419-530ofSEQIDNO:13; SEQIDNO:18) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0204] Anti-EGFR CAR secreting anti-GARP Camelid-pMGH 105: CD8 Leader-anti-EGFR-CD8 hinge+TM-4-1BB-CD3z-anti-GARP camelid (SEQ ID NO: 19) comprising CD8 leader (amino acids 1-21 of SEQ ID NO: 19; SEQ ID NO: 20), anti-EGFR scFv (amino acids 22-267 of SEQ ID NO: 19; SEQ ID NO: 21), CD8 hinge/TM (amino acids 268-336 of SEQ ID NO: 19; SEQ ID NO: 22), 4-1BB (amino acids 337-378 of SEQ ID NO: 19; SEQ ID NO: 23), CD3z (amino acids 379-490 of SEQ ID NO: 19; SEQ ID NO: 24), 2A cleavage sequence (amino acids 494-515 of SEQ ID NO: 19; SEQ ID NO: 31), IgK leader (amino acids 519-539 of SEQ ID NO: 19; SEQ ID NO: 32), and anti-GARP camelid (amino acids 540-646 of SEQ ID NO: 19; SEQ ID NO: 25).
TABLE-US-00005 (SEQIDNO:19) MALPVTALLLPLALLLHAARPQVQLKQSGPGLVQPSQSLSITCTVSGFSL TNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVF FKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAGGGGSGGGGS GGGGSGGGGSDILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRT NGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQ NNNWPTTFGAGTKLELKTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGG AVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQP FMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYN ELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYS EIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRPGSGSGATNF SLLKQAGDVEENPGPRTAMETDTLLLWVLLLWVPGSTGDDIQMTQSPSSL SASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYGASRLKTGVPSR FSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQGTKVELKHHHH HHSG CD8leader (aminoacids1-21ofSEQIDNO:19; SEQIDNO:20) MALPVTALLLPLALLLHAARP Anti-EGFRscFv (aminoacids22-267ofSEQIDNO:19; SEQIDNO:21) QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGV IWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALT YYDYEFAYWGQGTLVTVSAGGGGSGGGGSGGGGSGGGGSDILLTQSPVIL SVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSR FSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELK CD8hinge/TM (aminoacids268-336ofSEQIDNO:19; SEQIDNO:22) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BB (aminoacids337-378ofSEQIDNO:19; SEQIDNO:23) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids379-490ofSEQIDNO:19; SEQIDNO:24) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR 2Acleavagesequence (aminoacids494-515ofSEQIDNO:19; SEQIDNO:31) GSGATNFSLLKQAGDVEENPGP IgKleader (aminoacids519-539ofSEQIDNO:19; SEQIDNO:32) METDTLLLWVLLLWVPGSTGD Anti-GARPcamelid. (aminoacids540-646ofSEQIDNO:19; SEQIDNO:25) DIQMTQSPSSLSASLGDRVTITCQASQSISSYLAWYQQKPGQAPNILIYG ASRLKTGVPSRFSGSGSGTSFTLTISGLEAEDAGTYYCQQYASVPVTFGQ GTKVELK
[0205] pMGH113-3C10 scFv-CD8 Hinge/TM-4-1BB ICD-CD3z-P2A-IgK leader-Cetuximab scFv-CD3 scFv-His-tag (SEQ ID NO: 26) comprising 3C10 scFv (amino acids 1-243 of SEQ ID NO: 26; SEQ ID NO: 27), CD8 hinge/TM (amino acids 244-312 of SEQ ID NO: 26; SEQ ID NO: 28), 4-1BB ICD (amino acids 313-354 of SEQ ID NO: 26; SEQ ID NO: 29), CD3z (amino acids 355-466 of SEQ ID NO: 26; SEQ ID NO: 30), P2A (amino acids 467-488 of SEQ ID NO: 26; SEQ ID NO: 31), IgK leader (amino acids 491-511 of SEQ ID NO: 26; SEQ ID NO: 32), Cetuximab scFv (amino acids 512-752 of SEQ ID NO: 26; SEQ ID NO: 33), CD3 scFv (amino acids 758-1000 of SEQ ID NO: 26; SEQ ID NO: 34).
TABLE-US-00006 (SEQIDNO:26) EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGR IDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRG GVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSA SISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTG SGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIKTTTPAPR PPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCG VLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEG GCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMG GKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTA TKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPPRMETDTLLLWV LLLWVPGSTGDDILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQR TNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQ QNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQS LSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRL SINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTV SAGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQ GLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAV YYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQ SPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASG VPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK HHHHHH 3C10scFv (aminoacids1-243ofSEQIDNO:26; SEQIDNO:27) EIQLQQSGAELVKPGASVKLSCTGSGFNIEDYYIHWVKQRTEQGLEWIGR IDPENDETKYGPIFQGRATITADTSSNTVYLQLSSLTSEDTAVYYCAFRG GVYWGPGTTLTVSSGGGGSGGGGSGGGGSHMDVVMTQSPLTLSVAIGQSA SISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLISLVSKLDSGVPDRFTG SGSGTDFTLRISRVEAEDLGIYYCWQGTHFPGTFGGGTKLEIK CD8hinge/TM (aminoacids244-312ofSEQIDNO:26; SEQIDNO:28) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids313-354ofSEQIDNO:26; SEQIDNO:29) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids355-466ofSEQIDNO:26; SEQIDNO:30) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR P2A (aminoacids467-488ofSEQIDNO:26; SEQIDNO:31) GSGATNFSLLKQAGDVEENPGP IgKleader (aminoacids491-511ofSEQIDNO:26; SEQIDNO:32) METDTLLLWVLLLWVPGSTGD CetuximabscFv (aminoacids512-752ofSEQIDNO:26; SEQIDNO:33) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKY ASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGA GTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQSLSITCTVSGFS LTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQV FFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSA CD3scFv (aminoacids758-1000ofSEQIDNO:26; SEQIDNO:34) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
[0206] pMGH133-2173 scFv-CD8 Hinge/TM-4-1BB ICD-CD3z-P2A-IgK leader-Cetuximab scFv-CD3 scFv-His-tag (SEQ ID NO: 35) comprising 2173 scFv (amino acids 1-246 of SEQ ID NO: 35; SEQ ID NO: 36), CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 35; SEQ ID NO: 37), 4-1BB ICD (amino acids 316-357 of SEQ ID NO: 36; SEQ ID NO: 38), CD3z (amino acids 358-469 of SEQ ID NO: 35; SEQ ID NO: 39), P2A (amino acids 470-491 of SEQ ID NO: 35; SEQ ID NO: 40), IgK leader (amino acids 494-514 of SEQ ID NO: 35; SEQ ID NO: 41), Cetuximab scFv (amino acids 515-755 of SEQ ID NO: 35; SEQ ID NO: 42), and CD3 scFv (amino acids 761-1003 of SEQ ID NO: 35; SEQ ID NO: 43).
TABLE-US-00007 (SEQIDNO:35) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPPRMETDTLL LWVLLLWVPGSTGDDILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWY QQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADY YCQQNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQP SQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFT SRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTL VTVSAGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQR PGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSED SAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQ LTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKV ASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKL ELKHHHHHH 2173scFv (aminoacids1-246ofSEQIDNO:35; SEQIDNO:36) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK CD8hinge/TM (aminoacids247-315ofSEQIDNO:35; SEQIDNO:37) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids316-357ofSEQIDNO:35; SEQIDNO:38) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids358-469ofSEQIDNO:35; SEQIDNO:39) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR P2A (aminoacids470-491ofSEQIDNO:35; SEQIDNO:40) GSGATNFSLLKQAGDVEENPGP IgKleader (aminoacids494-514ofSEQIDNO:35; SEQIDNO:41) METDTLLLWVLLLWVPGSTGD CetuximabscFv (aminoacids515-755ofSEQIDNO:35; SEQIDNO:42) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKY ASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGA GTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQSLSITCTVSGFS LTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQV FFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSA CD3scFv (aminoacids761-1003ofSEQIDNO:35; SEQIDNO:43) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
[0207] pMGH134-2173 scFv-CD8 Hinge/TM-4-1BB ICD-CD3z-P2A-IgK leader-CD19 scFv-CD3 scFv-His-tag (SEQ ID NO: 44) comprising 2173 scFv (amino acids 1-246 of SEQ ID NO: 44; SEQ ID NO: 45), CD8 hinge/TM (amino acids 247-315 of SEQ ID NO: 44; SEQ ID NO: 46), 4-1BB ICD (amino acids 316-357 of SEQ ID NO: 44; SEQ ID NO: 47), CD3z (amino acids 358-469 of SEQ ID NO: 44; SEQ ID NO: 48), P2A (amino acids 470-491 of SEQ ID NO: 44; SEQ ID NO: 49), IgK leader (amino acids 494-514 of SEQ ID NO: 44; SEQ ID NO: 50), CD19 scFv (amino acids 515-764 of SEQ ID NO: 44; SEQ ID NO: 51), CD3 scFv (amino acids 770-1012 of SEQ ID NO: 44; SEQ ID NO: 52).
TABLE-US-00008 (SEQIDNO:44) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPPRMETDTLL LWVLLLWVPGSTGDDIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSY LNWYQQIPGQPPKLLIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVD AATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGGSGGGGSQVQLQQSGAE LVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNY NGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYA MDYWGQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTR YTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYM QLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSG GSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPK RWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNP LTFGAGTKLELKHHHHHH 2173scFv (aminoacids1-246ofSEQIDNO:44; SEQIDNO:45) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK CD8hinge/TM (aminoacids247-315ofSEQIDNO:44; SEQIDNO:46) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids316-357ofSEQIDNO:44; SEQIDNO:47) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids358-469ofSEQIDNO:44; SEQIDNO:48) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR P2A (aminoacids470-491ofSEQIDNO:44; SEQIDNO:49) GSGATNFSLLKQAGDVEENPGP IgKleader (aminoacids494-514ofSEQIDNO:44; SEQIDNO:50) METDTLLLWVLLLWVPGSTGD CD19scFv (aminoacids515-764ofSEQIDNO:44; SEQIDNO:51) DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKL LIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPW TFGGGTKLEIKGGGGGGGGSGGGGSQVQLQQSGAELVRPGSSVKISCKAS GYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNYNGKFKGKATLTADES SSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTTVTVSS CD3scFv (aminoacids770-1012ofSEQIDNO:44; SEQIDNO:52) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
[0208] pMGH135-(NFAT response element)-IgK leader-Cetuximab scFv-CD3 scFv-His-tag-(EF1a Promoter)-2173 scFv-CD8 hinge/TM-4-1BB ICD-CD3z (SEQ ID NO: 53) comprising IgK leader (amino acids 1-21 of SEQ ID NO: 53; SEQ ID NO: 54), Cetuximab scFv (amino acids 22-262 of SEQ ID NO: 53; SEQ ID NO: 55), CD3 scFv (amino acids 268-510 of SEQ ID NO: 53; SEQ ID NO: 56), 2173 scFv (amino acids 517-762 of SEQ ID NO: 53; SEQ ID NO: 57), CD8 hinge/TM (amino 763-831 of SEQ ID NO: 53; SEQ ID NO: 58), 4-1BB ICD (amino acids 832-873 of SEQ ID NO: 53; SEQ ID NO: 59), CD3z (amino acids 874-985 of SEQ ID NO: 53; SEQ ID NO: 60).
TABLE-US-00009 (NFATresponseelement) METDTLLLWVLLLWVPGSTGDDILLTQSPVILSVSPGERVSFSCRASQSI GTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVE SEDIADYYCQQNNNWPTTFGAGTKLELKGGGGSGGGGSGGGGSQVQLKQS GPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNT DYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFA YWGQGTLVTVSAGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYT MHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQL SSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGS GGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRW IYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLT FGAGTKLELKHHHHHH (EF1aPromoter) (SEQIDNO:53) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPR (Note:thetwopolypeptidesnotedaboveare denotedwithasinglesequenceidentifierfor convenience,butitshouldbeunderstoodthatthe CARandBiTEcomponentscanbemadeseparately, duetothetwoseparatepromoters;seeabove.) IgKleader (aminoacids1-21ofSEQIDNO:53; SEQIDNO:54) METDTLLLWVLLLWVPGSTGD CetuximabscFv (aminoacids22-262ofSEQIDNO:53; SEQIDNO:55) DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKY ASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFGA GTKLELKGGGGSGGGGSGGGGSQVQLKQSGPGLVQPSQSLSITCTVSGFS LTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQV FFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSA CD3scFv (aminoacids268-510ofSEQIDNO:53; SEQIDNO:56) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDDHYCLYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK 2173scFv (aminoacids517-762ofSEQIDNO:53; SEQIDNO:57) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK CD8hinge/TM (aminoacids763-831ofSEQIDNO:53; SEQIDNO:58) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids832-873ofSEQIDNO:53; SEQIDNO:59) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids874-985ofSEQIDNO:53; SEQIDNO:60) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0209] pMGH136-(NFAT response element)-IgK leader-CD19 scFv-CD3 scFv-His-tag-(EF1a Promoter)-2173 scFv-CD8 Hinge/TM-4-1BB ICD-CD3z (SEQ ID NO:61) comprising (NFAT response element), IgK leader (amino acids 1-21 of SEQ ID NO: 61; SEQ ID NO: 62), CD19 scFv (amino acids 22-271 of SEQ ID NO: 61; SEQ ID NO: 63), CD3 scFv (amino acids 277-519 of SEQ ID NO: 61; SEQ ID NO: 64), 2173 scFv (amino acids 526-771 of SEQ ID NO: 61; SEQ ID NO: 65), CD8 hinge/TM (amino acids 772-840 of SEQ ID NO: 61; SEQ ID NO: 66), 4-1BB ICD (amino acids 841-882 of SEQ ID NO: 61; SEQ ID NO: 67), CD3z (amino acids 883-994 of SEQ ID NO: 61; SEQ ID NO: 68).
TABLE-US-00010 METDTLLLWVLLLWVPGSTGDDIQLTQSPASLAVSLGQRATISCKASQSV DYDGDSYLNWYQQIPGQPPKLLIYDASNLVSGIPPRFSGSGSGTDFTLNI HPVEKVDAATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGGSGGGGSQVQ LQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWP GDGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTT VGRYYYAMDYWGQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKT SGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDK SSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSSVEGGS GGSGGSGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSSVSYMNWYQQ KSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYC QQWSSNPLTFGAGTKLELKHHHHHH (EF1aPromoter) (SEQIDNO:61) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIKTTTP APRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAG TCGVLLLSLVITLYCKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDP EMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPR (Note:thetwopolypeptidesnotedaboveare denotedwithasinglesequenceidentifierfor convenience,butitshouldbeunderstoodthatthe CARandBiTEcomponentscanbemadeseparately, duetothetwoseparatepromoters;seeabove.) IgKleader (aminoacids1-21ofSEQIDNO:61; SEQIDNO:62) METDTLLLWVLLLWVPGSTGD CD19scFv (aminoacids22-271ofSEQIDNO:61; SEQIDNO:63) DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKL LIYDASNLVSGIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPW TFGGGTKLEIKGGGGGGGGSGGGGSQVQLQQSGAELVRPGSSVKISCKAS GYAFSSYWMNWVKQRPGQGLEWIGQIWPGDGDTNYNGKFKGKATLTADES SSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYWGQGTTVTVSS CD3scFv (aminoacids277-519ofSEQIDNO:61; SEQIDNO:64) DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGY INPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYY DDHYCLDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSA SPGEKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSG SGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK 2173scFv (aminoacids526-771ofSEQIDNO:61; SEQIDNO:65) EIQLVQSGAEVKKPGESLRISCKGSGFNIEDYYIHWVRQMPGKGLEWMGR IDPENDETKYGPIFQGHVTISADTSINTVYLQWSSLKASDTAMYYCAFRG GVYWGQGTTVTVSSGGGGSGGGGSGGGGSGGGGSDVVMTQSPDSLAVSLG ERATINCKSSQSLLDSDGKTYLNWLQQKPGQPPKRLISLVSKLDSGVPDR FSGSGSGTDFTLTISSLQAEDVAVYYCWQGTHFPGTFGGGTKVEIK CD8hinge/TM (aminoacids772-840ofSEQIDNO:61; SEQIDNO:66) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC 4-1BBICD (aminoacids841-882ofSEQIDNO:61; SEQIDNO:67) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3z (aminoacids883-994ofSEQIDNO:61; SEQIDNO:68) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0210] Other aspects of the invention are within the scope of the following numbered paragraphs. [0211] 1. A chimeric antigen receptor (CAR) T cell comprising a heterologous nucleic acid molecule, wherein the heterologous nucleic acid molecule comprises: [0212] (a) a first polynucleotide encoding a CAR comprising an antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and [0213] (b) a second polynucleotide encoding a therapeutic agent. [0214] 2. The CAR T cell of paragraph 1, wherein the therapeutic agent comprises an antibody reagent. [0215] 3. The CAR T cell of paragraph 2, wherein the antibody reagent comprises a single chain antibody or a single domain antibody. [0216] 4. The CAR T cell of paragraph 2 or 3, wherein the antibody reagent comprises a bispecific antibody reagent. [0217] 5. The CAR T cell of paragraph 4, wherein the bispecific antibody reagent comprises a bispecific T cell engager (BiTE). [0218] 6. The CAR T cell of paragraph 3, wherein the single domain antibody comprises a camelid antibody. [0219] 7. The CAR T cell of paragraph 1, wherein the therapeutic agent comprises a cytokine. [0220] 8. The CAR T cell of any one of paragraphs 1 to 7, wherein the CAR and the therapeutic agent are produced in the form of a polyprotein, which is cleaved to generate separate CAR and therapeutic agent molecules. [0221] 9. The CAR T cell of paragraph 8, wherein the polyprotein comprises a cleavable moiety between the CAR and the therapeutic agent. [0222] 10. The CAR T cell of paragraph 9, wherein the cleavable moiety comprises a 2A peptide. [0223] 11. The CAR T cell of paragraph 10, wherein the 2A peptide comprises P2A or T2A. [0224] 12. The CAR T cell of any one of paragraphs 1 to 11, wherein the CAR and the therapeutic agent are each constitutively expressed. [0225] 13. The CAR T cell of any one of paragraphs 1 to 12, wherein expression of the CAR and the therapeutic agent is driven by an elongation factor-1 alpha (EF1?) promoter. [0226] 14. The CAR T cell of any one of paragraphs 1 to 11, wherein the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling. [0227] 15. The CAR T cell of paragraph 14, wherein the inducible promoter comprises the NFAT promoter. [0228] 16. The CAR T cell of any one of paragraphs 1 to 11, wherein the CAR is expressed under the control of a constitutive promoter and the therapeutic agent is expressed under the control of an inducible promoter, which is optionally inducible by T cell receptor or CAR signaling. [0229] 17. The CAR T cell of any one of paragraph 1 to 16, wherein the CAR further comprises one or more co-stimulatory domains. [0230] 18. The CAR T cell of any one of paragraphs 1 to 17, wherein the antigen-binding domain of the CAR comprises an antibody, a single chain antibody, a single domain antibody, or a ligand. [0231] 19. The CAR T cell of any one of paragraphs 1 to 18, wherein the transmembrane domain of the CAR comprises a CD8 hinge/transmembrane domain, which optionally comprises the sequence of any one of SEQ ID NOs: 4, 10, 16, 22, 28, 37, 46, 58, and 66, or a variant thereof. [0232] 20. The CAR T cell of any one of paragraphs 1 to 19, wherein the intracellular signaling domain comprises a CD3? (intracellular signaling domain, which optionally comprises the sequence of any one of SEQ ID NOs: 6, 12, 18, 24, 30, 39, 48, 60, and 68, or a variant thereof. [0233] 21. The CAR T cell of any one of paragraphs 1 to 20, comprising a 4-1BB co-stimulatory domain, which optionally comprises the sequence of any one of SEQ ID NOs: 5, 11, 17, 23, 29, 38, 47, 59, and 67, or a variant thereof. [0234] 22. The CAR T cell of any one of paragraphs 1-21, wherein the CAR antigen-binding domain or the therapeutic agent, when the therapeutic agent comprises an antibody reagent, bind to a tumor-associated antigen. [0235] 23. The CAR T cell of paragraph 22, wherein the tumor-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is a solid tumor-associated antigen. [0236] 24. The CAR T cell of paragraph 22 or 23, wherein the tumor-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds comprises epidermal growth factor receptor variant III (EGFRvIII), EGFR, CD19, prostate-specific membrane antigen (PSMA), or IL-13 receptor alpha 2 (IL-13R?2), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 21, 27, 33, 36, 42, 45, 51, 55, 57, 63, 65, and variants thereof. [0237] 25. The CAR T cell of any one of paragraphs 1 to 21, wherein the CAR antigen-binding domain or the therapeutic agent, when the therapeutic agent comprises an antibody reagent, binds to a Treg-associated antigen. [0238] 26. The CAR T cell of paragraph 25, wherein the Treg-associated antigen to which the CAR antigen-binding domain or the therapeutic agent binds is selected from the group consisting of glycoprotein A repetitions predominant (GARP), latency-associated peptide (LAP), CD25, and cytotoxic T lymphocyte-associated antigen-4 (CTLA-4), and optionally the CAR antigen-binding domain or the therapeutic agent comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, and variants thereof. [0239] 27. A CAR T cell comprising a polynucleotide encoding a CAR, wherein the CAR comprises an antigen-binding domain, a transmembrane domain, and an intracellular signaling domain; and the antigen-binding domain binds to a Treg-associated antigen. [0240] 28. The CAR T cell of paragraph 27, wherein the Treg-associated antigen is selected from the group consisting of GARP, LAP, CD25, and CTLA-4. [0241] 29. The CAR T cell of paragraph 27 or 28, wherein the CAR further comprises one or more co-stimulatory domains. [0242] 30. The CAR T cell of any one of paragraphs 27 to 29, wherein the antigen-binding domain of the CAR comprises a scFv or a single domain antibody, which optionally comprises a sequence selected from the group consisting of SEQ ID NO: 3, 9, 15, 25, and variants thereof. [0243] 31. A CAR T cell comprising a heterologous nucleic acid molecule encoding an amino acid sequence having at least 90% sequence identity to the amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, and SEQ ID NO: 13. [0244] 32. The CAR T cell of paragraph 31, comprising a heterologous nucleic acid molecule encoding an amino acid sequence of any one of SEQ ID NO: 26, SEQ ID NO: 35, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 61, SEQ ID NO: 19, SEQ ID NO: 1, SEQ ID NO: 7, and SEQ ID NO: 13. [0245] 33. A nucleic acid molecule encoding (i) a CAR polypeptide, or (ii) a polyprotein comprising a CAR polypeptide and a therapeutic agent, of any one of paragraphs 1 to 32. [0246] 34. A CAR polypeptide, or polyprotein comprising a CAR polypeptide and a therapeutic agent, of any one of paragraphs 1 to 32. [0247] 35. A pharmaceutical composition comprising one or more CAR T cells, nucleic acid molecules, CAR polypeptides, or a polyproteins of any one of paragraphs 1 to 34. [0248] 36. A method of treating a patient having cancer, the method comprising administering to the patient a pharmaceutical composition comprising one or more CAR T cell of any one of paragraphs 1-32 or a pharmaceutical composition of paragraph 35. [0249] 37. The method of paragraph 36, wherein by targeting the tumor microenvironment, systemic toxicity is reduced. [0250] 38. The method of paragraph 36 or 37, wherein the cancer is characterized by the presence of one or more solid tumors. [0251] 39. The method of any one of paragraphs 36 to 38, wherein the cancer is characterized by tumor-infiltrating Tregs. [0252] 40. The method of any one of paragraphs 36 to 39, wherein the cancer is a glioblastoma. [0253] 41. A method of treating a patient having cancer, the method comprising administering to the patient a CAR T cell product, genetically modified to secrete a tumor-toxic antibody or cytokine, wherein by directing the cancer toxicity locally to the tumor microenvironment, systemic toxicity is reduced. [0254] 42. The method of paragraph 41, wherein the CAR T cell is genetically modified to deliver an antibody against CTLA4, CD25, GARP, LAP, IL15, CSF1R, or EGFR, or a bispecific antibody against to the tumor microenvironment. [0255] 43. The method of paragraph 42, wherein the bispecific antibody is directed against EGFR and CD3. [0256] 44. A method of delivering a therapeutic agent to a tissue or organ in a patient to treat a disease or pathology, the method comprising administering to said patient a CAR T cell, genetically modified to secrete a therapeutic antibody, toxin, or agent, wherein the therapeutic antibody, toxin, or agent would, by itself, be unable to enter or penetrate the tissue or organ. [0257] 45. The method of paragraph 44, wherein the tissue or organ is in the nervous system. [0258] 46. The method of paragraph 45, wherein the nervous system is the central nervous system. [0259] 47. The method of paragraph 46, wherein the central nervous system is the brain. [0260] 48. The method of any one of paragraphs 44 to 47, wherein the disease or pathology is glioblastoma. [0261] 49. The method of paragraph 44, wherein the therapeutic antibody is anti-EGFR (anti-epidermal growth factor receptor) or anti-EGFRvIII.
[0262] The following claims are meant to be representative only and not to limit the scope of the disclosed invention. In at least one aspect, we claim: