COMPLEX OF ANTI-IL-4R ANTIBODY OR ANTIGEN-BINDING FRAGMENT THEREOF AND MEDICAL USE THEREOF

20240075158 ยท 2024-03-07

    Inventors

    Cpc classification

    International classification

    Abstract

    Provided are a complex of an anti-IL-4R antibody or an antigen-binding fragment thereof, and a medical use thereof. Specifically, provided are a complex of an antibody that specifically binds to IL-4R or an antigen-binding fragment thereof covalently linked to a toxin, a pharmaceutical composition comprising the complex, and a use thereof in the preparation of a drug for treating IL-4R-mediated diseases or disorders, especially a use in the preparation of an anti-cancer drug.

    Claims

    1. A complex of an anti-IL-4R antibody or an antigen-binding fragment thereof, comprising: the anti-IL-4R antibody or the antigen-binding fragment thereof, and one or more toxin molecules; wherein the anti-IL-4R antibody or the antigen-binding fragment thereof is covalently or non-covalently linked to the toxin molecules; the anti-IL-4R antibody or the antigen-binding fragment thereof comprises any one selected from the group consisting of (I) to (IV): (I) a heavy chain variable region comprising a HCDR1, a HCDR2 and a HCDR3 whose amino acid sequences are set forth in SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively; and a light chain variable region comprising a LCDR1, a LCDR2 and a LCDR3 whose amino acid sequences are set forth in SEQ ID NO: 38, SEQ ID NO: 7 and SEQ ID NO: 40, respectively; (II) a heavy chain variable region comprising a HCDR1, a HCDR2 and a HCDR3 whose amino acid sequences are set forth in SEQ ID NO: 11, SEQ ID NO: 12 and SEQ ID NO: 13, respectively; and a light chain variable region comprising a LCDR1, a LCDR2 and a LCDR3 whose amino acid sequences are set forth in SEQ ID NO: 14, SEQ ID NO: 15 and SEQ ID NO: 16, respectively; (III) a heavy chain variable region comprising a HCDR1, a HCDR2 and a HCDR3 whose amino acid sequences are set forth in SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively; and a light chain variable region comprising a LCDR1, a LCDR2 and a LCDR3 whose amino acid sequences are set forth in SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8, respectively; (IV) a heavy chain variable region comprising a HCDR1, a HCDR2 and a HCDR3 whose amino acid sequences are set forth in SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively; and a light chain variable region comprising a LCDR1, a LCDR2 and a LCDR3 whose amino acid sequences are set forth in SEQ ID NO: 42, SEQ ID NO: 39 and SEQ ID NO: 8, respectively.

    2. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, wherein the anti-IL-4R antibody is selected from any one of: a murine antibody, a chimeric antibody, a fully human antibody and a humanized antibody.

    3. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 14, wherein: the anti-IL-4R antibody or the antigen-binding fragment thereof comprises a FR derived from a human germline light chain IGKV3-11*01 or a FR having at least 95% sequence identity thereto; and/or the anti-IL-4R antibody or the antigen-binding fragment thereof comprises a FR derived from a human germline heavy chain IGHV3-48*01 or a FR having at least 95% sequence identity thereto.

    4. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, wherein: the anti-IL-4R antibody or the antigen-binding fragment thereof comprises a FR derived from a human germline light chain IGKV2D-29*01 or a FR having at least 95% sequence identity thereto; and/or the anti-IL-4R antibody or the antigen-binding fragment thereof comprises a FR derived from a human germline heavy chain IGHV1-2*02 or a FR having at least 95% sequence identity thereto.

    5. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, wherein: the anti-IL-4R antibody or the antigen-binding fragment thereof comprises a heavy chain constant region, which is a heavy chain constant region of human IgG1, IgG2, IgG3 or IgG4, or a variant thereof; and/or the antigen-binding fragment is a Fab, Fv, scFv, F(ab)2, dsfv or ScdsFv.

    6. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 5, wherein: the scFv comprises a heavy chain variable region, a linking peptide and a light chain variable region in sequence from N-terminus to C-terminus, or the scFv comprises a light chain variable region, a linking peptide and a heavy chain variable region in sequence from N-terminus to C-terminus; the linking peptide is selected from any one of the following or a combination thereof: (GxS).sub.n, (SxG).sub.n, (GGGGS).sub.n and (G).sub.n, wherein x is any integer from 1-6, and n is any integer from 1-30; or the linking peptide is selected from any one of the following or a combination thereof: GKSSGSGSESKS, EGKSSGSGSESKEF, GSTSGSGKSSEGKG, GSTSGSGKSSEGSGSTKG, GSTSGSGKPGSGEGSTKG, SRSSG and SGSSC.

    7. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, comprising any one selected from the group consisting of (I) to (VII): (I) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 43 or an amino acid sequence having at least 90% identity to SEQ ID NO: 43; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 37 or an amino acid sequence having at least 90% identity to SEQ ID NO: 37; (II) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9 or an amino acid sequence having at least 90% identity to SEQ ID NO: 9; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 10 or an amino acid sequence having at least 90% identity to SEQ ID NO: 10; (III) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1 or an amino acid sequence having at least 90% identity to SEQ ID NO: 1; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2 or an amino acid sequence having at least 90%, 95%, 98% or 99% identity to SEQ ID NO: 2; (IV) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 43 or an amino acid sequence having at least 90% identity to SEQ ID NO: 43; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 41 or an amino acid sequence having at least 90% identity to SEQ ID NO: 41; (V) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 47 or an amino acid sequence having at least 90% identity to SEQ ID NO: 47; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 48 or an amino acid sequence having at least 90% identity to SEQ ID NO: 48; (VI) the heavy chain variable region comprises the amino acid sequence set forth in any one of SEQ ID NOs: 25-27 or an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 25-27; the light chain variable region comprises the amino acid sequence set forth in any one of SEQ ID NOs: 28-30 or an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 28-30; (VII) the heavy chain variable region comprises the amino acid sequence set forth in any one of SEQ ID NOs: 31-33 or an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 31-33; the light chain variable region comprises the amino acid sequence set forth in any one of SEQ ID NOs: 34-36 or an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 34-36.

    8. (canceled)

    9. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, wherein the anti-IL-4R antibody or the antigen-binding fragment thereof comprises any one selected from the group consisting of (I) to (IV): (I) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 44 or an amino acid sequence having at least 90% identity to SEQ ID NO: 44; and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 45 or an amino acid sequence having at least 90% identity to SEQ ID NO: 45; (II) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 19 or an amino acid sequence having at least 90% identity to SEQ ID NO: 19; and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 20 or an amino acid sequence having at least 90% identity to SEQ ID NO: 20; (III) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 17 or an amino acid sequence having at least 90% identity to SEQ ID NO: 17; and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 18 or an amino acid sequence having at least 90% identity to SEQ ID NO: 18; (IV) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 44 or an amino acid sequence having at least 90% identity to SEQ ID NO: 44; and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 46 or an amino acid sequence having at least 90% identity to SEQ ID NO: 46.

    10. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, wherein: the anti-IL-4R antibody or the antigen-binding fragment thereof is linked to the toxin molecules by linkers; the linkers are proteinaceous or non-proteinaceous linkers.

    11. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 10, wherein: the linkers are selected from any one of the following or a combination thereof: ASGGPE, VM, AM, AM(G.sub.2-4S).sub.pAM, ASGCGPE, ASGCCGPE, ASGCGSCPE, ASCGTTGCPE, KASGKKYGCKKGPE and KGGGCAGGPE; wherein p is any integer from 1-10.

    12. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 11, wherein the toxin molecules are selected from any one of the following or a combination thereof: a pore-forming toxin, aerolysin from Aeromonas hydrophila, proaerolysin, bouganin, ricin, pseudomonas exotoxin, cholera toxin and diphtheria toxin.

    13. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 12, wherein the toxin is selected from any one of the following or a combination thereof: PE-LR, PE-L010R456A, PE-T20, PE-T20-KDEL, PE4E, PE40, PE38, PE24, PE25, PE38QQR, PE35, PE38KDEL, PE38DKEL, PE38RDEL and PE38KNEL.

    14. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, comprising the sequence set forth in SEQ ID NO: 52 or SEQ ID NO: 53.

    15. (canceled)

    16. A polynucleotide encoding the complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1.

    17. A vector comprising the polynucleotide according to claim 16, being a eukaryotic expression vector, a prokaryotic expression vector or a viral vector.

    18. A host cell comprising the vector according to claim 17, wherein the host cell is a bacterial, yeast or mammalian cell.

    19. A pharmaceutical composition comprising: the complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, and optionally, a pharmaceutically acceptable excipient, diluent or carrier.

    20. A method for treating and/or preventing a cancer or tumor in a subject in need thereof, the method comprising: administering to the subject in need thereof a therapeutically effective amount of the complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1.

    21. The method according to claim 20, wherein the cancer or tumor is selected from any one of the following or a combination thereof: glioma, glioblastoma, neuroblastoma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, hemangioma, meningioma and.

    22. A method for preparing a complex of an anti-IL-4R antibody or an antigen-binding fragment thereof, comprising the following steps: expressing the complex of the anti-IL-4R antibody or the antigen-binding fragment thereof in the host cell according to claim 18, and isolating the complex of the anti-IL-4R antibody or the antigen-binding fragment thereof from the host cell.

    23. The complex of the anti-IL-4R antibody or the antigen-binding fragment thereof according to claim 1, wherein the complex is a fusion protein.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0217] FIG. 1A and FIG. 1B. Schematic diagrams of the structures of exemplary complexes: 25G7-scdsFv-PE38KDEL (FIG. 1A), which is an antibody conjugate drug of the scdsFv of the antibody 25G7 and the toxin PE38KDEL, and 25G7-scFv-PE38KDEL (FIG. 1B).

    [0218] FIG. 2A and FIG. 2B. SDS-PAGE patterns of purified complexes 25G7-scdsFv-PE38KDEL and 25G7-scFv-PE38KDEL, where M is a molecular weight marker.

    [0219] FIG. 3. Flow cytometry assays for IL-4R expression levels in glioblastoma (GBM) cell lines. LN229, U251 and U87 cerebral glioma cell strains stably transfected with human IL-4R are constructed using a lentivirus system, and the overexpression levels of IL-4R are determined by flow cytometry, with corresponding cells which are not transfected with human IL-4R constructs as controls.

    [0220] FIG. 4A to FIG. 4C. Flow cytometry assays of complexes for binding on the surface of glioblastoma cells. 25G7-scdsFv-PE38KDEL and MDNA55 are assayed by flow cytometry for binding ability on the cell surface of LN229-IL4R, U251-IL4R and U87-IL4R cell strains stably transfected with IL-4R.

    [0221] FIG. 5A to FIG. 5C. The endocytosis efficiency of complexes in glioblastoma cells; 25G7-scdsFv-PE38KDEL (25G7-IT) and MDNA55 are assayed by flow cytometry for 0-to-24-hour endocytosis efficiency in LN229-IL4R, U251-IL4R and U87-IL4R cells are determined.

    [0222] FIG. 6A to FIG. 6F. The in vitro cytotoxicity of complexes to glioblastoma cells; 25G7-scdsFv-PE38KDEL (25G7-IT) and MDNA55 are assayed by the CTG method for in vitro cytotoxicity to LN229-IL4R, U251-IL4R, U87-IL4R and control cells.

    [0223] FIG. 7A to FIG. 7D. The CTG method is used to compare the in vitro cytotoxicity results of 25G7-scFv-PE38KDEL, 25G7-scdsFv-PE38KDEL and MDNA55 in LN229-IL4R, U251-IL4R and control glioma cells.

    [0224] FIG. 8A to FIG. 8C. Comparison of the in vivo efficacy of complexes in a nude mouse tumor model subcutaneously inoculated with U87-MG; 25G7-scdsFv-PE38KDEL (25G7-IT) and MDNA55 are both administered at a dose of 0.5 mg/kg (mpk), intratumorally (i.t.).

    [0225] FIG. 9A to FIG. 9C. Comparison of the in vivo efficacy of complexes in a nude mouse tumor model subcutaneously inoculated with LN229-IL4R (IL-4R-overexpressing LN229 cells); 25G7-scdsFv-PE38KDEL (25G7-IT) and MDNA55 are both administered at a dose of 0.25 mpk (i.t.), or 25G7-scdsFv-PE38KDEL at 0.25 mpk (i.v.).

    [0226] FIG. 10A to FIG. 10C. Comparison of the in vivo efficacy of complexes in a nude mouse tumor model subcutaneously inoculated with LN229-IL4R; 25G7-scdsFv-PE38KDEL (25G7-IT) is administered at doses of 0.1 mpk (the second dose and the following doses are reduced to 0.05 mpk) and 0.3 mpk (the second dose and the following doses are reduced to 0.15 mpk), and MDNA55 is administered at a dose of 0.1 mpk (the second dose and the following doses are reduced to 0.05 mpk), intratumorally (i.t.).

    DETAILED DESCRIPTION

    Terms

    [0227] To facilitate the understanding of the present disclosure, some technical and scientific terms are specifically defined below. Unless otherwise specifically defined herein, all other technical and scientific terms used herein have the meanings generally understood by those of ordinary skill in the art to which the present disclosure belongs.

    [0228] The present disclosure incorporates the disclosure of the patent document WO2020/038454A1 in its entirety into the present application.

    [0229] The three-letter and single-letter codes for amino acids used in the present disclosure are described in J. Biol. Chem, 243, p 3558 (1968).

    [0230] Human IL-4R (hIL-4R) refers to a human cytokine receptor that specifically binds to interleukin-4 (IL-4) or IL-4Ra. hIL-4R is intended to encompass various forms of molecules of IL-4R in various stages in vivo, such as, but not limited to, molecules produced by the IL-4R gene during amplification, replication, transcription, splicing, processing, translation and modification, e.g., precursor IL-4R, mature IL-4R, naturally-occurring IL-4R splice variants, modified IL-4R, or fragments thereof.

    [0231] The term antibody refers to an immunoglobulin, which is of a tetrapeptide chain structure formed by connecting two identical heavy chains and two identical light chains by interchain disulfide bonds. The heavy chain constant regions of an immunoglobulin differ in their amino acid composition and arrangement, and thus in their antigenicity. Accordingly, immunoglobulins can be divided into five classes, or isotypes of immunoglobulins, namely IgM, IgD, IgG, IgA and IgE, with their corresponding heavy chains being chain, chain, chain, chain and chain, respectively. Ig of the same class can be divided into different subclasses according to differences in the amino acid composition of the hinge regions and the number and positions of disulfide bonds of the heavy chains; for example, IgG can be divided into IgG1, IgG2, IgG3 and IgG4. Light chains are divided into or chains according to differences in the constant regions. Each of the five classes of Ig may have a chain or chain.

    [0232] The antibody light chain may further comprise a light chain constant region comprising human or murine and chains or variants thereof.

    [0233] The antibody heavy chains may further comprise a heavy chain constant region comprising human or murine IgG1, IgG2, IgG3 and IgG4 or variants thereof.

    [0234] In the antibody heavy and light chains, the sequences of about 110 amino acids near the N-terminus vary considerably and thus are referred to as variable regions (V regions); the remaining amino acid sequences near the C-terminus are relatively stable and thus are referred to as constant regions (C regions). The variable regions comprise 3 hypervariable regions (HVRs) and 4 framework regions (FRs) with relatively conservative sequences. The 3 hypervariable regions determine the specificity of the antibody and thus are also known as complementarity determining regions (CDRs). Each light chain variable region (LCVR) or heavy chain variable region (HCVR) consists of 3 CDRs and 4 FRs arranged from the amino-terminus to the carboxyl-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The 3 CDR regions of the light chain refer to light chain complementarity determining region 1 (LCDR1), light chain complementarity determining region 2 (LCDR2), and light chain complementarity determining region 3 (LCDR3); the 3 CDR regions of the heavy chain refer to heavy chain complementarity determining region 1 (HCDR1), heavy chain complementarity determining region 2 (HCDR2) and heavy chain complementarity determining region 3 (HCDR3).

    [0235] The antibody includes murine antibodies, chimeric antibodies, humanized antibodies and fully human antibodies, which may be recombinantly obtained, for example, may be recombinant fully human antibodies obtained by affinity maturation. Recombinant human antibodies include fully human antibodies that are prepared, expressed, created or isolated by recombinant methods, and the techniques and methods involved are well known in the art; examples are (1) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom; (2) antibodies isolated from a host cell transformed to express the antibodies, e.g., from a transfectoma; (3) antibodies isolated from a recombinant, combinatorial human antibody library; and (4) antibodies prepared, expressed, created or isolated by methods such as splicing of human immunoglobulin gene sequences to other DNA sequences. Such recombinant fully human antibodies comprise variable and constant regions that utilize specific human germline immunoglobulin sequences encoded by germline genes, and also include subsequent rearrangements and mutations which occur, for example, during antibody maturation.

    [0236] The term host cell refers to a cell into which an expression vector has been introduced. Host cells may include bacterial, microbial, plant or animal cells. Bacteria susceptible to transformation include members of the species enterobacteria, such as strains of Escherichia coli or Salmonella; Bacillaceae such as Bacillus subtilis; Pneumococcus; Streptococcus and Haemophilus influenzae. Suitable microorganisms include Saccharomyces cerevisiae and Pichia pastoris. Suitable animal host cell lines include CHO (Chinese hamster ovary cell line) and NS0 cells.

    [0237] Murine antibody as used herein refers to a monoclonal antibody to human IL-4R prepared according to the knowledge and skill in the art. During the preparation, a test subject is injected with the IL-4R antigen (or a polypeptide comprising epitopes), and then hybridoma of antibodies expressing the desired sequence or functional properties is isolated. In some embodiments, the murine human IL-4R-binding antibody or the antigen-binding fragment thereof may further comprise a light chain constant region of a murine or chain or a variant thereof, or further comprise a heavy chain constant region of a murine IgG1, IgG2, IgG3 or IgG4 or a variant thereof.

    [0238] Fully human antibody includes antibodies having variable and constant regions derived from human germline immunoglobulin sequences. The fully human antibody herein may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutations in vivo). However, the term fully human antibody does not include antibodies in which CDR sequences derived from the germline of another mammalian species (such as mice) have been grafted into a human framework sequence (i.e., humanized antibodies).

    [0239] Humanized antibody, also known as a CDR-grafted antibody, refers to an antibody produced by grafting non-human CDR sequences into the framework of variable regions of a human antibody. Such an antibody can overcome the strong immune response induced by the chimeric antibody because of carrying a large amount of heterologous protein components. To avoid the decrease in activity caused by the decrease in immunogenicity, the variable regions of a human antibody can be subjected to minimum reverse mutation to maintain activity.

    [0240] The term chimeric antibody refers to an antibody obtained by fusing a variable region of a murine antibody and a constant region of a human antibody, which can reduce an immune response induced by the murine antibody. The chimeric antibody is established by firstly establishing hybridoma secreting murine specific monoclonal antibody, then cloning a variable region gene from the mouse hybridoma cells, cloning a constant region gene of human antibody as required, linking the mouse variable region gene and the human constant region gene into a chimeric gene, inserting the chimeric gene into a human vector, and finally expressing chimeric antibody molecules in a eukaryotic industrial system or prokaryotic industrial system. The constant region of the human antibody may be selected from the group consisting of the heavy chain constant regions of human IgG1, IgG2, IgG3 and IgG4 or variants thereof, for example comprising human IgG2 or IgG4 heavy chain constant regions, or IgG1 mutated at amino acids without ADCC (antibody-dependent cell-mediated cytotoxicity) toxicity.

    [0241] Antigen-binding fragment refers to Fab fragments; Fab fragments; F(ab)2 fragments; Fv fragments and scFv fragments that bind to human IL-4R; and polypeptides or proteins comprising the fragments; which have antigen-binding activity. The antigen-binding fragment comprises one or more of the CDR regions of the antibody described herein. The Fv fragment comprises the heavy chain variable region and the light chain variable region of the antibody but does not comprise the constant region, and has the smallest antibody fragment of the entire antigen-binding sites. Generally, the Fv antibody also comprises a polypeptide linker between the VH and VL domains, and is capable of forming the structure required for antigen binding. Two antibody variable regions can also be linked into a single polypeptide chain using different linkers, known as single chain antibody or single chain Fv (scFv).

    [0242] The term single chain antibody, single chain Fv or scFv refers to a molecule comprising a heavy chain variable domain (or region; VH) and a light chain variable domain (or region; VL) linked by a linker (or a linking peptide). Such scFv molecules may have a general structure: NH2-VL-linker-VH-COOH or NH2-VH-linker-VL-COOH. Suitable linkers in the prior art consist of repeated GGGGS amino acid sequences or variants thereof, for example, 1-4 repeated variants (Holliger et al. (1993), Proc. Natl. Acad. Sci. USA 90:6444-6448). Other linkers that can be used in the present disclosure are described in Alfthan et al. (1995), Protein Eng. 8:725-731; Choi et al. (2001), Eur. J. Immunol. 31:94-106; Hu et al. (1996), Cancer Res. 56:3055-3061; Kipriyanov et al. (1999), J. Mol. Biol. 293:41-56; and Roovers et al. (2001), Cancer Immunol.

    [0243] The term antibody framework refers to a portion of a variable domain VL or VH, which serves as a framework for the antigen-binding loops (CDRs) of the variable domain. It is essentially a variable domain without CDRs.

    [0244] Bind to IL-4R refers to the ability to interact with human IL-4R (or epitopes or fragments thereof). The term antigen-binding site herein refers to a three-dimensional spatial site recognized by an antibody or an antigen-binding fragment described herein.

    [0245] Epitope refers to a site on an antigen to which an immunoglobulin or an antibody specifically binds. Epitopes can be formed with adjacent amino acids or formed by tertiary folding of non-adjacent amino acids. An epitope formed from contiguous amino acids is generally retained after exposure to a denaturing solvent, while an epitope formed by tertiary folding is generally lost after a denaturing solvent treatment. An epitope generally comprises, for example, at least 3-15 amino acids in a unique spatial conformation. Methods for determining what epitope is bound by a given antibody are well known in the art and include an immunoblotting assay, an immunoprecipitation assay, and the like. Methods for determining the spatial conformation of an epitope include techniques in the art and techniques described herein, such as X-ray crystallography and two-dimensional nuclear magnetic resonance.

    [0246] Specific binding, selective binding, selectively bind to and specifically bind to refer to the binding of an antibody to an epitope on a predetermined antigen. Typically, an antibody binds to a predetermined antigen with an equilibrium dissociation constant (KD) of about less than 10.sup.7 M or even less and with an affinity that is at least twice as high as its affinity for binding to a non-specific antigen other than the predetermined antigen or a closely related antigen (e.g., BSA, etc.), when determined by surface plasmon resonance (SPR) techniques in an instrument using recombinant human IL-4R as the analyte and an antibody as the ligand. The term antigen-recognizing antibody is used interchangeably herein with the term specifically binding antibody.

    [0247] Cross-react refers to the ability of an antibody described herein to bind to IL-4R from a different species. For example, an antibody described herein that binds to human IL-4R may also bind to IL-4R of another species. Cross-reactivity is measured by detecting specific reactivity with purified antigen in binding assays (e.g., SPR and ELISA) or binding or functional interactions with cells physiologically expressing IL-4R. Methods for determining cross-reactivity include standard binding assays as described herein, for example, surface plasmon resonance (SPR) analysis or flow cytometry.

    [0248] Neutralizing or blocking antibody refers to an antibody whose binding to hIL-4R results in inhibition of biological activity of hIL-4 and/or hIL-13. Such inhibition of biological activity of hIL-4 and/or IL-13 can be assessed by measuring one or more indexes of biological activity of hIL-4 and/or hIL-13 well known in the art, such as h1L-4 and/or hIL-13-induced cell activation and binding of hIL-4 to hIL-4R. See, for example, CN103739711A. Inhibition of growth (e.g., involving cells) is intended to include any measurable reduction in cell growth.

    [0249] Inducing immune response and enhancing immune response can be used interchangeably and refer to the stimulation (i.e., passive or adaptive) of an immune response to a particular antigen. The term induce specific for inducing CDC or ADCC refers to stimulating specific direct cell killing mechanism.

    [0250] Antibody-dependent cell-mediated cytotoxicity (ADCC) means that the Fc receptor-expressing cells directly kill antibody-coated target cells by recognition of the Fc segment of the antibody. The ADCC effector function of the antibody may be reduced or eliminated by modification of the Fc segment of the IgG. The modification refers to a mutation in the heavy chain constant region of the antibody, such as a mutation selected from the group consisting of N297A, L234A and L235A of IgG1; IgG2/4 chimera, F235E of IgG4, and L234A/E235A mutation.

    [0251] The fusion protein is a protein product co-expressed by two genes and obtained by DNA recombination. For example, the anti-IL-4R antibody-PE38KDEL fusion protein is a fusion protein obtained by co-expressing the anti-IL-4R antibody and the toxin molecule PE38KDEL by DNA recombination. Methods for producing and purifying antibodies and antigen-binding fragments are well known in the prior art and can be found in, for example, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (chapters 5-8 and 15). For example, mice can be immunized with human IL-4R or a fragment thereof, and the resulting antibodies can be renatured and purified, and amino acid sequencing can be performed by a conventional method. Likewise, antigen-binding fragments can be prepared by conventional methods. The antibody or the antigen-binding fragment described herein is genetically engineered to contain one or more additional human FRs in the non-human-derived CDRs. Human FR germline sequences can be obtained from the website of ImMunoGeneTics (IMGT) or from the Immunoglobulin Journal, 200115BN012441351.

    [0252] The engineered antibody or antigen-binding fragment can be prepared and purified using conventional methods. As an example, cDNA sequences encoding the heavy and light chains can be cloned and recombined into a GS expression vector. Recombinant immunoglobulin expression vectors can be stably transfected into CHO cells. The sequence of the humanized antibody described herein was inserted into a corresponding expression vector by using a molecular cloning technique, and the corresponding humanized antibody could be obtained by using an HEK293 cell expression system for expression and production. As an example, mammalian expression systems may result in glycosylation of antibodies, particularly at the highly conserved N-terminus of the Fc region. Stable clones are obtained by expression of antibodies specifically binding to the human-derived antigen. Positive clones are expanded in a serum-free medium of a bioreactor to produce antibodies. The culture medium with the secreted antibody can be purified and collected by conventional techniques. The antibody can be filtered and concentrated by conventional methods. Soluble mixtures and polymers can also be removed by conventional methods, such as molecular sieves and ion exchange. The resulting product needs to be immediately frozen, e.g., at 70 C., or lyophilized.

    [0253] The antibody may be a monoclonal antibody (mAb), which refers to an antibody derived from a single clonal cell strain, which is not limited to eukaryotic, prokaryotic, or phage clonal cell strains. The monoclonal antibody or the antigen-binding fragment can be obtained by, for example, hybridoma technology, recombinant technology, phage display technology, synthetic technology (e.g., CDR-grafting), or other technologies known in the art.

    [0254] The antibody may be a monospecific, bispecific or multispecific antibody. Multispecific antibodies may show specificity to different epitopes of a target peptide, or may also comprise antigen-binding domains that show specificity to one or more target peptides. The human anti-IL-4R antibody may be linked to, or co-expressed with, another functional molecule (such as another peptide or protein). For example, the antibody or the fragment thereof can be functionally linked (for example, by chemical coupling, genetic fusion or non-covalent binding, or in other ways) to one or more additional molecules (for example, another antibody or antigen-binding fragment) to produce a bispecific or multispecific antibody having at least one binding specificity.

    [0255] Administering, giving and treating, when applied to animals, humans, experimental subjects, cells, tissues, organs or biological fluid, refer to contacting an exogenous drug, a therapeutic agent, a diagnostic agent or composition with the animals, humans, subjects, cells, tissues, organs or biological fluid. Administering, giving and treating can refer to, for example, therapeutic, pharmacokinetic, diagnostic, research and experimental methods. The treatment of cells comprises making the reagent in contact with the cells and making the reagent in contact with fluid, where the fluid is in contact with the cells. Administering, giving and treating also mean in vitro and ex vivo treatments, e.g. of a cell, by a reagent, diagnosis, a compound, or by another cell.

    [0256] Treating, when applied to humans, veterinary or research subjects, refers to therapeutic treatment, preventive or prophylactic measures, and research and diagnostic applications.

    [0257] Treatment means to administer a therapeutic agent, such as any one of the complexes or compositions herein, internally or externally to a patient having (suspected of having or susceptible to) one or more disease symptoms for which the agent has therapeutic activity. Generally, the therapeutic agent is administered in an amount effective to alleviate one or more symptoms of the disease in the subject or population being treated, whether by inducing regression of such symptoms or inhibiting the development of such symptoms into any clinically measurable degree. The amount of therapeutic agent effective to alleviate any particular symptom of the disease (also referred to as the therapeutically effective amount) may vary depending on factors such as the disease state, age and weight of the subject, and the ability of the drug to produce a desired therapeutic effect in the subject. Whether a symptom of a disease has been alleviated can be evaluated by any clinical testing methods commonly used by doctors or other health care professionals to evaluate the severity or progression of the symptom. Although the embodiments of the present disclosure (e.g., treatment methods or articles of manufacture) may be ineffective in alleviating the symptoms of the disease of interest in a single subject, they shall alleviate the symptoms of the disease of interest in a statistically significant number of subjects as determined by any statistical test method known in the art, such as the Student's t-test, chi-square test, U-test by Mann and Whitney, Kruskal-Wallis test (H-test), Jonckheere-Terpstra test and Wilcoxon test.

    [0258] The term naturally-occurring as applied to an object refers to the fact that the object can be found in nature. For example, a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man is naturally-occurring.

    [0259] Effective amount comprises an amount sufficient to ameliorate or prevent a symptom or sign of a medical condition. An effective amount also refers to an amount sufficient to allow or facilitate diagnosis. The effective amount for a particular subject or veterinary subject may vary depending on the factors such as the disorder to be treated, the general health of the subject, the method and route and dosage of administration, and the severity of side effects. An effective amount may be the maximum dose or administration regimen to avoid significant side effects or toxic effects.

    [0260] Exogenous refers to substances that are produced outside an organism, cell or human body, depending on the context.

    [0261] Endogenous refers to substances that are produced within an organism, cell or human body, depending on the context.

    [0262] Homology or identity refers to sequence similarity between two polynucleotide sequences or between two polypeptides. When positions in two compared sequences are occupied by identical bases or amino acid monomer subunits, e.g., if the position of each of two DNA molecules is occupied by adenine, the molecules are homologous at that position. The homology percentage between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared100%. For example, if 6 out of 10 positions are matched or homologous when two sequences are optimally aligned, the two sequences are 60% homologous. Generally, when two sequences are aligned, comparison is performed to obtain the maximum homology percentage. The at least 85% sequence identity described herein means that when the variant and the parent sequence are aligned, the two sequences are at least 85% homologous; in some embodiments, they are at least 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous; in some specific embodiments, they are 90%, 95% or 99% or more homologous; in other specific embodiments, they are at least 95% homologous. The amino acid sequence having at least 85% sequence identity is obtained by one or more amino acid deletion, insertion or substitution mutations made in the parent sequence.

    [0263] As used herein, the terms cell, cell line, cell strain and cell culture are used interchangeably, and all such terms include their progeny. Therefore, the terms transformant and transformed cell include primary test cells and cultures derived therefrom, regardless of the number of times passaging is performed. It should also be understood that progeny and the parent cell may not be precisely identical in DNA content due to deliberate or inadvertent mutations. The term includes mutant progeny that have the same function or biological activity as the parent cell obtained by screening from the originally transformed cells are included.

    [0264] Optional or optionally means that the event or circumstance subsequently described may, but does not necessarily, occur, and that the description includes instances where the event or circumstance occurs or does not occur. For example, optionally comprising 1-3 antibody heavy chain variable regions means that the antibody heavy chain variable region may, but does not necessarily, exist.

    [0265] The term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. In one embodiment, the vector is a plasmid that refers to a circular double-stranded DNA loop into which additional DNA segments may be ligated. In another embodiment, the vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome. The vectors disclosed herein are capable of autonomous replication in a host cell into which they have been introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors) or being integrated into the genome of a host cell upon introduction into the host cell and thereby replicated along with the host genome (e.g., non-episomal mammalian vectors).

    [0266] The term pharmaceutical composition refers to a mixture of one or more of the complexes or the physiologically/pharmaceutically acceptable salts or prodrugs thereof described herein, and other components, wherein the other components are, for example, physiologically/pharmaceutically acceptable vehicles and excipients. The pharmaceutical composition is intended to promote the administration to an organism, so as to facilitate the absorption of the active ingredient, thereby exerting biological activity.

    [0267] The term excipient is an addition, besides the active ingredient, to a pharmaceutical formulation. It may also be referred to as an auxiliary material. For example, binders, fillers, disintegrants, lubricants in tablets; the matrix part in semisolid ointment and cream preparations; preservatives, antioxidants, corrigents, fragrances, cosolvents, emulsifiers, solubilizers, osmotic pressure regulators, colorants and the like in liquid formulations can all be referred to as excipients.

    [0268] The term diluent, also referred to as filler, is used primarily to increase the weight and volume of the tablet. The addition of the diluent not only ensures a certain volume, but also reduces the dose deviation of the main ingredients, and improves the drug's compression moldability and the like. When the drug in the tablet form contains oily components, an absorbent is necessarily added to absorb the oily components so as to maintain a dry state and thus to facilitate the preparation of the tablet. Examples include starch, lactose, inorganic salts of calcium, microcrystalline cellulose and the like.

    [0269] Immunohistochemical scoring is a histological scoring method for processing immunohistochemical results, wherein the number of positive cells in each section and the staining intensity thereof are converted into corresponding numerical values so as to achieve the aim of semi-quantifying tissue staining. A score of 0 indicates no staining observed or indicates that membrane staining is observed in less than 10% of tumor cells; a score of +1 indicates that slightly/barely detectable membrane staining is detected in more than 10% of tumor cells; a score of +2 indicates that moderate complete membrane staining is observed in more than 10% of tumor cells; a score of +3 indicates that intense complete membrane staining is observed in more than 10% of tumor cells. In the present disclosure, those samples with an IL-4R expression score of 0 or +1 can be considered to not overexpress IL-4R, while those with a score of +2 or +3 can be considered to overexpress IL-4R.

    [0270] The present application is further described below with examples; however, these examples are not intended to limit the scope of protection.

    [0271] Experimental procedures without specific conditions indicated in the examples or test examples are generally conducted according to conventional conditions, or according to conditions recommended by the manufacturers of the starting materials or commercial products. See Sambrook et al., Molecular Cloning, Cold Spring Harbor Laboratory; and Current Protocols in Molecular Biology, Ausubel et al., Greene Publishing Association, Wiley Interscience, NY. Reagents without specific origins indicated are commercially available conventional reagents.

    Example 1. Preparation of Exemplary Immunotoxins

    [0272] The single-chain variable fragment (scFv) of the humanized IL-4R monoclonal antibody hu25G7 (whose heavy chain variable region sequence is set forth in SEQ ID NO: 43 as hu25G7-VH and whose light chain variable region sequence is set forth in SEQ ID NO: 37 as hu25G7-A LCVR) was fused and expressed with mutated and truncated pseudomonas exotoxin (PE38KDEL) (SEQ ID NO: 49) via a linker ASGGPE (SEQ ID NO: 50), wherein the amino acids at positions VH-44 and VL-100 of the hu25G7 antibody were mutated into cysteine (as set forth in SEQ ID NOs: 47-48), and VH and VL were linked by a linking peptide (GGGGS) 3 (SEQ ID NO: 51); the IL-4R-targeted immunotoxin 25G7-(scdsFv)-PE38KDEL (hereinafter referred to as 25G7-IT) was thus obtained, the complete sequence being set forth in SEQ ID NO: 52.

    [0273] FIG. 1A and FIG. 1B are schematic diagrams of the structures of two immunotoxins. 25G7-IT was expressed in E. coli BL21, and protein purification and renaturation were performed from inclusion bodies; then, endotoxin was removed to obtain purified 25G7-IT with a molecular weight of about 63 KDa (SDS-PAGE results are shown in FIG. 2A and FIG. 2B).

    [0274] The heavy chain sequence of the humanized anti-human IL-4R antibody 25G7 is set forth in SEQ ID NO: 17, and the light chain sequence is set forth in SEQ ID NO: 18. Antibody expression and purification can be performed according to the conventional methods for antibody expression and purification in the art, e.g., the methods described in the patent application WO2020038454A1. The foregoing patent application is incorporated herein by reference in its entirety.

    TABLE-US-00006 Sequenceofhu25G7-VH-44 SEQIDNO:47 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKCLEWVA FISSGSSIIYYADIVKGRSTISRDNAKNTLYLQMNSLRAEDTAVYYCTR GNKRGFFDYWGQGTLVTVSS; Sequenceofhu25G7-VL-100 SEQIDNO:48 EIVLTQSPATLSLSPGERATLSCRASSSVPYMYWYQQKPGQAPRLLIYL TSNLASGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQWRAYPPMLT FGCGTKVEIK; SequenceofPE38KDEL: SEQIDNO:49 EGGSLAALTAHQACHLPLETFTRHRQPRGWEQLEQCGYPVQRLVALYLA ARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESER FVRQGTGNDEAGAANGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGT QNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLD AIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFY RTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPLA ERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPKD EL; SequenceoflinkerL1: SEQIDNO:50 ASGGPE; SequenceoflinkingpeptideL2: SEQIDNO:51 GGGGSGGGGSGGGGS; Sequenceof25G7-(scdsFv)-PE38KDEL(25G7-IT): SEQIDNO:52 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKCLEWVA FISSGSSIIYYADIVKGRSTISRDNAKNTLYLQMNSLRAEDTAVYYCTR GNKRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLS PGERATLSCRASSSVPYMYWYQQKPGQAPRLLIYLTSNLASGIPARFSG SGSGTDFTLTISSLEPEDFAVYYCQQWRAYPPMLTFGCGTKVEIKASGG PEEGGSLAALTAHQACHLPLETFTRHRQPRGWEQLEQCGYPVQRLVALY LAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAES ERFVRQGTGNDEAGAANGPADSGDALLERNYPTGAEFLGDGGDVSFSTR GTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQD LDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPG FYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWP LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPP KDEL. Inaddition,wehavedevelopedanimmunotoxin fusionprotein25G7-(scFv)-PE38KDEL,aformat withoutintroductionofadditionalinterchain disulfidebonds,theaminoacidsequenceofwhich issetforthinSEQIDNO:53. Sequenceof25G7-(scFv)-PE38KDEL: SEQIDNO:53 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVA FISSGSSIIYYADIVKGRSTISRDNAKNTLYLQMNSLRAEDTAVYYCTR GNKRGFFDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLS PGERATLSCRASSSVPYMYWYQQKPGQAPRLLIYLTSNLASGIPARFSG SGSGTDFTLTISSLEPEDFAVYYCQQWRAYPPMLTFGGGTKVEIKASGG PEEGGSLAALTAHQACHLPLETFTRHRQPRGWEQLEQCGYPVQRLVALY LAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAES ERFVRQGTGNDEAGAANGPADSGDALLERNYPTGAEFLGDGGDVSFSTR GTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQD LDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPG FYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWP LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPP KDEL. [0275] SEQ ID NO: 48;

    Example 2. Determination of Affinity Kinetics of Interactions

    [0276] The affinity kinetics of the interactions of 25G7-IT and the reference sample MDNA55 (expressed in an E. coli system and purified) with hrIL-4R-Fc (ILR-H5253, Acro) was determined on Biacore 8K (GE) using the surface plasmon resonance (SPR) technique.

    [0277] This experiment used the capture method: an anti-human IgG antibody (29234600, GE) was covalently coupled onto a CM5 chip (29149603, GE), rhIL-4R-Fc was then captured as a ligand on the chip, 25G7-IT and the reference sample MDNA55 were then each injected as analytes, and affinity analysis and calculation were performed.

    [0278] The experimental results show that 25G7-IT and the reference sample MDNA55 have strong affinities for rhIL-4R-Fc, with KD of 1.01E-10 and 4.39E-10 M, respectively (Table 2). The affinity of 25G7-IT for rhIL-4R-Fc is significantly greater than that of the reference sample MDNA55 for rhIL-4R-Fc.

    TABLE-US-00007 TABLE 2 The kinetic affinities of complexes determined by Biacore Ligand Test sample ka (1/Ms) kd (1/s) KD (M) rh IL-4R-Fc 25G7-scdsFv- 2.77E+06 2.79E04 1.01E10 PE38KDEL MDNA55 6.62E+06 2.90E03 4.39E10

    Example 3. Determination of Binding Capacity to GBM Target Cells

    [0279] The endogenous IL-4R expression in the GBM cell lines U87, U251 and LN229 is low. Therefore, the lentivirus system was used to overexpress human IL-4R in these three GBM cell lines. After G418 screening, the effect of IL-4R overexpression was identified by flow cytometry (FIG. 3). The results show that IL-4R was stably overexpressed in these three cell lines.

    [0280] Complete medium was prepared by adding 10% FBS and 1% penicillin/streptomycin to DMEM, and the U87-, U251- and LN229-IL4R stably transfected cell strains were cultured in a 37 C. incubator containing 5% CO.sub.2. Cells in T75 flasks were digested with 1.5 mL of TrpLE (Gibco, #12605-010) at 37 C. for 3-5 min and then neutralized with DMEM containing FBS. After centrifugation, cell suspensions with a concentration of 210.sup.6 cells/mL were prepared and added to a 96-well round-bottom plate at 50 L/well. 25G7-IT, MDNA55 and a hIgG1 isotype control were each diluted with DMEM to 8 concentration points (three-fold gradient: 20; 6.67; 2.22; 0.74; 0.25; 0.08; 0.03; 0 g/mL), and were added to the 96-well plate at 50 L/well and well mixed with the cells, and the complexes and the cells were co-incubated on ice for 40 min. After the incubation was complete, the cells were washed three times with 200 L of flow cytometry buffer. An anti-PE38 antibody (Sigma-aldrich, Cat: P2318-1ML) was 1:300 diluted with flow cytometry buffer and added to the 96-well plate at 50 L/well to resuspend the cells, and the antibody and the cells were co-incubated on ice for 40 min. The cells were then washed three times with 200 L of flow cytometry buffer. Anti-rabbit IgG Fab2 Alexa Fluor 647 (Cell Signaling Technology, #02/2020) was 1:500 diluted with flow cytometry buffer and added to the 96-well plate at 50 L/well to resuspend the cells, and the antibody and the cells were co-incubated on ice for 30 min. After centrifugation and three washes with 200 L of flow cytometry buffer, the cells were resuspended, and the single-cell Alexa Fluor647 signal in each well was detected by BD FACSCelesta flow cytometer.

    [0281] The mean fluorescence intensity (MFI) was analyzed, and the experimental results are shown in Table 3 and FIG. 4A to FIG. 4C: both 25G7-IT and the reference sample MDNA55 can bind to IL-4R-positive GBM cell lines, and the binding affinity of 25G7-IT for the U87-, U251- and LN229-IL4R stably transfected cell strains is greater than that of MDNA55.

    TABLE-US-00008 TABLE 3 The binding capacity results of complexes to GBM target cells LN229-IL4R Mean MFI Concentration 25G7-scdsFv- (g/mL) PE38KDEL MDNA55 Human IgG1 20 28521.5 24309 231 6.666667 27154 21148 244.5 2.222222 26803.5 19382 361 0.740741 26046 16242 286.5 0.246914 19769 12443 300 0.082305 10449.5 8311 318.5 0.027435 4750.5 4474.5 352.5 0 498 U87-IL4R Mean MFI Concentration 25G7-scdsFv- (g/mL) PE38KDEL MDNA55 Human IgG1 20 30861 32745.5 317.5 6.666667 29485.5 29702 306.5 2.222222 28386 25262 334.5 0.740741 27025 21574 339 0.246914 23766.5 17098 321.5 0.082305 13190.5 12020.5 393.5 0.027435 6168 9121 588.5 0 426 U251-IL4R Mean MFI Concentration 25G7-scdsFv- (g/mL) PE38KDEL MDNA55 Human IgG1 20 25827 22597 275 6.666667 24461 17477 288 2.222222 22952 13736 282 0.740741 20635 10682 284 0.246914 13672 8131 287 0.082305 6511 5860 274 0.027435 2947 3179 263 0 237

    Example 4. Determination of Endocytosis Efficiencies in GBM Target Cells

    [0282] To determine the endocytosis efficiencies of 25G7-IT and the reference sample MDNA55 in GBM target cells, the endocytosis efficiencies of 25G7-IT and MDNA55 in the three strains of cerebral glioma cells stably transfected with IL-4R described above were compared.

    [0283] According to the experimental results in Example 3, the final concentration of 2 g/mL was selected as a concentration for endocytosis efficiency determination as the endocytosis efficiency in the three cell samples was substantially saturated at that concentration. 25G7-IT, MDNA55 and a hIgG1 isotype control were diluted with DMEM to 2 g/mL, added to a 96-well plate at 50 L/well and well mixed with cells, and the complexes and the cells were co-incubated on ice for 40 min After three washes with DMEM complete medium, the cells were resuspended in 100 L of DMEM complete medium. 100 L of the cells labeled with 0 h in the 96-well plate was transferred to another 96-well round-bottom plate, and 100 L of 4% paraformaldehyde fixative solution was added; the cells were fixed at 4 C. After the remaining cells were cultured in a 37 C. incubator for 1 h, 2 h, 4 h and 24 h, the corresponding cells were taken out, transferred to another 96-well plate and fixed at 4 C. in the same manner.

    [0284] Cells of 0-h to 4-h endocytosis were subjected to flow cytometry antibody staining on the same day; cells after 24-h endocytosis was subjected to flow cytometry antibody staining and flow cytometry analysis when incubated until the end of the experiment. When the cells of 4-h endocytosis were fixed for half an hour, all of the fixed cells were centrifuged and washed twice with flow cytometry buffer. An anti-PE38 antibody (Sigma-aldrich, Cat: P2318-1ML) was 1:300 diluted with flow cytometry buffer and added to the 96-well plate at 50 L/well to resuspend the cells, and the antibody and the cells were then co-incubated on ice for 40 min. The subsequent experimental steps were the same as those in Example 3, and the analysis results are shown in Table 4 and FIG. 5A to FIG. 5C.

    [0285] The experimental results show that 25G7-IT and both the reference sample MDNA55 can be effectively endocytosed in IL-4R-overexpressing GBM cells; the endocytosis efficiency in the three types of cells at 4 h reached 60% to 80%, and the endocytosis efficiency of 25G7-IT in the LN229- and U251-IL4R stably transfected cell strains is greater than that of MDNA55.

    TABLE-US-00009 TABLE 4 The endocytosis efficiency results in GBM target cells Mean endocytosis efficiency (%) LN229-IL4R 225G7-scdsFv-PE38KDEL MDNA55 0 h 0 0 1 h 40.005 32.765 2 h 54.405 34.3 4 h 85.25 78.4 24 h 98.83 98.57 U87-IL4R 25G7-scdsFv-PE38KDEL MDNA55 0 h 0 0 1 h 41.81 40.52 2 h 51.155 44.06 4 h 75.145 75.41 24 h 98.25 98.18 U251-IL4R 25G7-scdsFv-PE38KDEL MDNA55 0 h 0 0 1 h 27.72 25.335 2 h 41.515 21.96 4 h 73.98 60.015 24 h 98.295 97.43

    Example 5. Determination of In Vitro Killing Efficiencies in GBM Target Cells

    [0286] To determine the in vitro killing efficiencies of 25G7-IT and the reference sample MDNA55 in GBM target cells, the CTG (CELL TITER-GLO) method was used to compare the in vitro efficacy of the two in the three strains of brain tumor cells stably transfected with human IL-4R.

    [0287] 10% FBS and 1% penicillin/streptomycin were added to DMEM to prepare complete medium. In a 37 C. incubator containing 5% CO.sub.2, the U87-IL4R, U251-IL4R and LN229-IL4R stably transfected cell strains and the U87, U251 and LN229 control cells were cultured.

    [0288] Plating was performed in a 96-well plate at 4000 cells and 130 L per well. After the plate was left overnight, when cell adhesion was complete, 20 L of gradient concentrations of drug containing 25 G7-IT or MDNA55 (final concentrations: 100 nM, 20 nM, 4 nM, 0.8 nM, 0.16 nM, 0.032 nM, 0.0064 nM, 0.00128 nM, 0.000256 nM and 0 nM) was added, and the cells were cultured in an incubator for 3 days. After three days, the 96-well plate was taken out of the incubator and equilibrated to room temperature, and 50 L of CTG reagent (CellTiter-Glo Luminescent, Promega, #G7573) was added to the cell suspensions. The plate was shaken on a shaker for 2 min to well mix the suspensions and was then left to stand at room temperature for 10 min Cell viability was measured using the built-in Luminescence mode of EnVision2105 Multimode Plate Reader (PerkinElmer). The absorbance results were converted into percentages and then analyzed using Prism 8.

    [0289] The experimental results (FIG. 6A to FIG. 6F) show that both 25G7-IT and the reference sample MDNA55 can efficiently kill the target cells among the IL-4R-overexpressing GBM cells, and particularly, the efficacy against LN229-IL4R is high: the in vitro killing effect reached 80% at the concentration of 0.1 nM. In general, the in vitro killing efficiency of 25G7-IT in the three stains of cerebral glioma cells stably transfected with IL-4R-LN229, U251 and U87is higher than that of MDNA55.

    [0290] In addition, the killing efficiency of the drug 25G7-scFv-PE38KDEL, a format without the interchain disulfide bond, in the LN229 and U251 IL-4R stably transfected cerebral glioma cell strains was compared with those of 25G7-scdsFv-PE38KDEL (25G7-IT) and MDNA55. FIG. 7A to FIG. 7D show that 25G7-scFv-PE38KDEL has a similar in vitro killing efficiency in cerebral glioma cells to 25G7-IT and MDNA55.

    Example 6. In Vivo Efficacy of IL-4R-Targeted Drugs in GBM Tumor Model

    [0291] To determine the in vivo efficacy of 25G7-IT and the reference sample MDNA55 in the GBM tumor model, a U87-MG subcutaneous inoculation model with 1+(immunohistochemical score) IL-4R expression was first constructed.

    [0292] 210.sup.6 U87-MG cells resuspended in PBS and matrigel (1:1) were subcutaneously inoculated into the right side of the back of laboratory mice (0.1 mL/mouse), and tumor growth was observed regularly. When the mean size of the subcutaneous inoculated tumors reached approximately 100-150 mm 3, the mice were divided into groups of 8. Multiple-site intratumoral administration of the drugs 25G7-scdsFv-PE38KDEL (25G7-IT) and MDNA55 was performed at a dose of 0.5 mg/kg (mpk) once a week, and a total of four doses were administered. After administration began, the body weight of the mice and the tumor size were measured twice a week. The calculation formula for tumor volume was: tumor volume (mm 3)=1/2(ab 2) (where a represents long-axis diameter and b represents short-axis diameter).

    [0293] The experimental results are shown in FIG. 8A to FIG. 8C and Table 5. In the U87-MG tumor model lowly expressing IL-4R (with an immunohistochemical score of 1+), administration was performed at 0.5 mpk once a week, and after 4 doses, 25G7-IT showed 80% TGI (tumor growth inhibition), the reference sample MDNA55 showed 51% TGI. The results indicate that in the glioma model lowly expressing IL-4R, 25G7-IT had a significantly better inhibitory effect on tumor growth than MDNA55.

    TABLE-US-00010 TABLE 5 The in vivo efficacy of IL-4R-targeted drugs in the mouse glioma model Tumor growth inhibition Inoculated Dose Number (statistical cell IL-4R (mpk, Route of of mice difference (s.c.) expression Drug QW) administration # from control) U87-MG 1+ hIgG1 isotype control 8 25G7-scdsFv- 0.5 i.t. 8 80% *** PE38KDEL MDNA55 0.5 i.t. 8 51.5% ** Note: s.c.: subcutaneous; mpk: mg/kg (mg per kg body weight); i.t.: intratumoral injection; i.v.: intravenous injection; QW: once a week. ** indicates p < 0.01, and *** indicates p < 0.001.

    Example 7. In Vivo Efficacy of IL-4R-Targeted Drugs in GBM Tumor Model (IL-4R 3+)

    [0294] To further determine the in vivo efficacy of 25G7-IT and the reference sample MDNA55 in the GBM tumor model, the IL-4R-overexpressing LN229 cell line (denoted by LN229-IL4R, with an immunohistochemical score of 3+) was utilized to construct a subcutaneous inoculation model.

    [0295] 110.sup.7 LN229-IL4R cells resuspended in PBS (1:1) were subcutaneously inoculated into the right side of the back of laboratory mice (0.1 mL/mouse), and tumor growth was observed regularly. When the mean size of the subcutaneous inoculated tumors reached approximately 100-150 mm.sup.3, the mice were divided into groups of 6-7. MDNA55 was administered at a dose of 0.25 mpk (i.t.), and 25G7-scdsFv-PE38KDEL (25G7-IT) was administered at a dose of 0.25 mpk (i.t. or i.v.). The administration was performed once a week, and a total of four doses were administered. Tumor growth monitoring and calculation were performed as in Example 6.

    [0296] The experimental results are shown in FIG. 9A to FIG. 9C and Table 6. In the LN229-IL4R tumor model highly expressing IL-4R (with an immunohistochemical score of 3+), 25G7-IT and MDNA55 showed 99% (complete response) TGI (tumor growth inhibition) when administered at 0.25 mpk (i.t.), whereas 25G7-IT showed 68% TGI when administered at the same dose (0.25 mpk, i.v.): intratumoral administration has a better effect than intravenous administration.

    [0297] In addition, in the LN229-IL4R tumor model highly expressing IL-4R (with an immunohistochemical score of 3+), the doses of immunotoxin were further reduced: 25G7-scdsFv-PE38KDEL (25G7-IT) was administered at doses of 0.1 (the second dose and the following doses were reduced to 0.05) and 0.3 (the second dose and the following doses were reduced to 0.15) mpk, and MDNA55 was administered at a dose of 0.1 (the second dose and the following doses are reduced to 0.05) mpk, intratumorally.

    [0298] The experimental results are shown in FIG. 10A to FIG. 10C and Table 6. In the LN229-IL4R tumor model (with an immunohistochemical score of 3+), administration was performed at 0.1 (first dose) or 0.05 (the second dose to the fourth dose) mpk once a week, and after 4 doses, 25G7-IT showed 77% TGI (tumor growth inhibition), whereas the reference sample MDNA55 showed 59% TGI; and when the 25G7-IT drug was administered at a dose of 0.3 (the first dose) or 0.15 (the second dose to the fourth dose), the tumors in tumor-bearing mice achieved complete response (TGI=99%). The results show that in the glioma model highly expressing IL-4R, the low concentration of 25G7-IT had a better inhibitory effect on tumor growth than MDNA55 at the same dose, whereas the high dose of the 25G7-IT drug could make tumor-bearing mice achieve complete response: a significant dose-effect relationship was shown.

    TABLE-US-00011 TABLE 6 The in vivo efficacy of IL-4R-targeted drugs in the mouse glioma model Tumor growth inhibition Inoculated Dose Number (statistical cell IL-4R (mpk, Route of of mice difference (s.c.) expression Drug QW) administration # from control) LN229- 3+ hIgG1 isotype control 6 IL4R 25G7-scdsFv- 0.25 i.t. 7 99% *** PE38KDEL 25G7-scdsFv- 0.25 i.v. 6 68% *** PE38KDEL MDNA55 0.25 i.t. 7 99% *** LN229- 3+ hIgG1 isotype control 6 IL4R 25G7-scdsFv- 0.1 i.t. 7 78% *** PE38KDEL .fwdarw. 0.05 25G7-scdsFv- 0.3 i.t. 7 99% *** PE38KDEL .fwdarw. 0.15 MDNA55 0.1 i.t. 7 61%** .fwdarw. 0.05 Note: s.c.: subcutaneous; mpk: mg/kg (mg per kg); i.t.: intratumoral injection; i.v.: intravenous injection; QW: once a week. **indicates p < 0.01, and *** indicates p < 0.001.

    [0299] The use and welfare of the laboratory animals in the present disclosure were carried out in compliance with the provisions of Association for Assessment and Accreditation of Laboratory Animal Care, International (AAALAC). The health and death of the animals were monitored daily, and routine examinations included observation of the effects of the test substance and drug on the daily performance of the animals, such as behavioral activities, weight changes and appearance.