BURKHOLDERIA VACCINES AND THERAPEUTICS
20240075122 · 2024-03-07
Inventors
- Tung HOANG (Honolulu, HI, US)
- Ian A. MCMILLAN (Honolulu, HI, US)
- Yun HEACOCK-KANG (Honolulu, HI, US)
- Zhenxin SUN (Honolulu, HI, US)
- Jan ZARZYCKI-SIEK (Honolulu, HI, US)
- Michael H. NORRIS (Honolulu, HI, US)
Cpc classification
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/569
CHEMISTRY; METALLURGY
International classification
Abstract
Virulence factors from Burkholderia species are provided by this invention as are antibodies specifically binding the same and methods of using the virulence factors and antibodies in methods of immunizing and treating or attenuating a Burkholderia infection.
Claims
1. A composition comprising (a) a recombinant Surface Attachment Protein 1 (Sap1) polypeptide having the amino acid sequence of SEQ ID NO:1, (b) a recombinant Surface Attachment Protein 2 (Sap2) polypeptide having the amino acid sequence of SEQ ID NO:10, or (c) a combination of (a) and (b), wherein the recombinant Sap1 polypeptide and/or recombinant Sap2 polypeptide is tagged and/or in admixture with an adjuvant.
2. The composition of claim 1, wherein the Sap2 polypeptide further comprises a signal peptide.
3. A method of immunizing against a Burkholderia infection comprising administering to a subject in need thereof a composition of claim 1 thereby immunizing the subject against a Burkholderia infection.
4. A kit for diagnosing a Burkholderia infection comprising a recombinant Surface Attachment Protein immobilized on a substrate, the recombinant Surface Attachment Protein comprising: (a) a recombinant Surface Attachment Protein 1 (Sap1) polypeptide having the amino acid sequence of SEQ ID NO:1, (b) a recombinant Surface Attachment Protein 2 (Sap2) polypeptide having the amino acid sequence of SEQ ID NO:10, or (c) a combination of (a) and (b).
5. A composition comprising a preservative; and (a) an isolated Surface Attachment Protein 1 (Sap1) antibody having a variable domain comprising (i) a CDR1 of SEQ ID NO:14, (ii) a CDR2 of SEQ ID NO:18, and (iii) a CDR3 of SEQ ID NO:22; (b) an isolated Surface Attachment Protein 2 (Sap2) antibody comprising a variable domain comprising (i) a CDR1 of SEQ ID NO:26, (ii) a CDR2 of SEQ ID NO:29, and (iii) a CDR3 of SEQ ID NO:32; or (c) a combination of (a) and (b).
6. The composition of claim 5, wherein the variable domain of the Sap1 antibody comprises (i) the CDR1 of SEQ ID NO:15, SEQ ID NO:16, or SEQ ID NO:17; (ii) the CDR2 of SEQ ID NO:19, SEQ ID NO:20, or SEQ ID NO:21; and (iii) the CDR3 of SEQ ID NO:23, SEQ ID NO:24, or SEQ ID NO:25.
7. The composition of claim 5, wherein the variable domain of the Sap2 antibody comprises (i) the CORI of SEQ ID NO:27 or SEQ ID NO:28; (ii) the CDR2 of SEQ ID NO:30 or SEQ ID NO:31; and (iii) the CDR3 of SEQ ID NO:33 or SEQ ID NO:34.
8. A method of treating or attenuating a Burkholderia infection or Burkholderia-associated condition in a subject comprising administering to a subject in need of treatment an effective amount of a Surface Attachment Protein 1 (Sap1) antibody, a Surface Attachment Protein 2 (Sap2) antibody, or a combination thereof thereby treating or attenuating the Burkholderia infection or Burkholderia-associated condition in the subject.
9. The method of claim 8, wherein the antibody is a monoclonal antibody or nanobody.
10. The method of claim 8, wherein the Burkholderia-associated condition is melioidosis or pneumonia.
11. A live-attenuated Burkholderia pseudomallei comprising deletion of nucleic acids encoding the BPSL0636 polypeptide of SEQ ID NO:35.
12. The live-attenuated Burkholderia pseudomallei of claim 11, further comprising deletion of nucleic acids encoding the BPSS0015 polypeptide of SEQ ID NO:137.
13. A method of immunizing against a Burkholderia pseudomallei infection comprising administering to a subject in need thereof a live-attenuated Burkholderia pseudomallei of claim 11 thereby immunizing the subject against a Burkholderia pseudomallei infection.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
DETAILED DESCRIPTION OF THE INVENTION
[0022] A TRANSITomic approach was used to profile transcriptomes of single Burkholderia pseudomallei cells as they transit through host cell infection at defined stages: vacuole entry; cytoplasmic escape and replication; and membrane protrusion, promoting cell-to-cell spread. The B. pseudomallei TRANSITome revealed dynamic gene-expression flux during transit in host cells and identified genes that are required for pathogenesis. Several hypothetical proteins were exhibited virulence mechanisms, including attachment, cytoskeletal modulation, and autophagy evasion. Based upon these analyses, the present invention provides compositions for use in treating or attenuating Burkholderia infection.
[0023] Accordingly, the present invention provides a composition including an effective amount of an isolated, recombinant Sap1 polypeptide (also referred to herein as BPSIJ0097) or peptide thereof; an isolated, recombinant Sap2 polypeptide (also referred to herein as BPSS1860) or peptide thereof; or a combination thereof, wherein the recombinant Sap1 polypeptide and/or recombinant Sap2 polypeptide is tagged and/or in admixture with an adjuvant. In one aspect, the composition includes an isolated, recombinant Sap1 polypeptide or peptide thereof. In another aspect, the composition includes an isolated, recombinant Sap2 polypeptide or peptide thereof. In yet another aspect of the invention the composition includes both Sap1 and Sap2 polypeptide or peptides thereof.
[0024] In accordance with some aspects of the invention, suitable isolated Sap1 polypeptides or proteins include those derived from any clinically relevant species or strain of Burkholderia. The amino acid sequence of Sap1 proteins from various strains of Burkholderia that are suitable for the composition of the present invention are shown in
[0025] The N-terminal amino acid residues of the full-length Sap1 represent the native secretion/signal sequence. Thus, the mature secreted form of Sap1 is represented by the 92 C-terminal amino acid residues in each of SEQ ID NOs:2-9. Correspondingly, the amino acid residues in each of SEQ ID NOs:2-9 are referred to as the immature form of Sap1. According to some aspects, the Sap1 polypeptide of this invention is the mature form. According to other aspects, the Sap1 polypeptide of this invention is the immature form.
[0026] In another aspect of the present invention, the composition includes an isolated immunogenic peptide of Sap1. Suitable Sap1 peptides are about 20 to about 80 amino acids in length. More preferably Sap1 peptides are between about 30-50 amino acids in length, more preferably between about 30-60 amino acids in length.
[0027] In accordance with other aspects of the invention, suitable isolated Sap2 polypeptides or proteins include those derived from any clinically relevant species or strain of Burkholderia. The amino acid sequence of Sap2 proteins from various strains of Burkholderia that are suitable for the composition of the present invention are shown in
[0028] The N-terminal amino acid residues of the full-length Sap2 represent the native secretion/signal sequence. Thus, the mature secreted form of Sap2 is represented by the 375 C-terminal amino acid residues in each of SEQ ID NOs:11-13. Correspondingly, the amino acid residues in each of SEQ ID NOs:11-13 are referred to as the immature form of Sap2. According to some aspects, the Sap2 polypeptide of this invention is the mature form. According to other aspects, the Sap2 polypeptide of this invention is the immature form.
[0029] In another aspect of the present invention, the composition includes an isolated immunogenic peptide of Sap2. Suitable Sap2 peptides are about 20 to about 350 amino acids in length. More preferably Sap2 peptides are between about 30-300 amino acids in length, more preferably between about 30-200 amino acids in length.
[0030] Unless indicated to the contrary, both the immature and the mature forms of native Sap1 and Sap2, and the sequences having less than 100% similarity with native Sap1 and Sap2 (i.e., native sequences and analogs alike, collectively referred to herein as Sap1 and Sap2) may be used in the compositions and methods of the present invention.
[0031] Sap1 and Sap2 proteins and peptides of the invention may differ from the native polypeptides designated as SEQ ID NOs:2-9 and 11-13, respectively, in terms of one or more additional amino acid insertions, substitutions or deletions, e.g., one or more amino acid residues within SEQ ID NOs:2-9 and 11-13 may be substituted by another amino acid of a similar polarity, which acts as a functional equivalent, resulting in a silent alteration. That is to say, the change relative to the native sequence would not appreciably diminish the basic properties of native Sap1 or Sap2. Any such analog of Sap1 or Sap2 may be screened in accordance with the protocols disclosed herein (e.g., the cell attachment assay) to determine if it maintains native Sap1 or Sap2 activity. Substitutions within these Surface Attachment Proteins may be selected from other members of the class to which the amino acid belongs. For example, nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine. Polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine. Positively charged (basic) amino acids include arginine, lysine and histidine. Negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
[0032] Ideally, a highly purified Sap1/Sap2 preparation is used in the compositions and methods of this invention. Examples include Sap1 and Sap2 proteins or peptides purified from the species or strain of Burkholderia exemplified in
[0033] For some uses of the proteins disclosed herein, it may be advantageous to use them in the form of fusion proteins. In some aspects, the Sap1 and/or Sap2 protein is fused at its N-terminus or its C-terminus to a protein, protein domain, or peptide, e.g., a tag, in particular an affinity or purification tag. Suitable tags include the peptides: WSHPQFEK (SEQ ID NO:131) available under the tradename STREP-TAG II, EQKLISEEDL (SEQ ID NO:132) conventionally known as a myc-tag, DYKDDDDK (SEQ ID NO:133) available under the tradename FLAG-tag, HHHHHH (SEQ ID NO:134) conventionally known as a His-tag, YPYDVPDYA (SEQ ID NO:135) conventionally known as an HA-tag, CCPGCC (SEQ ID NO:136) conventionally known as a TC-tag, or AAA conventionally known as a 3Ala-tag; or proteins such as glutathione-S-transferase (GST), maltose binding protein (MBP), or chitin binding domain (CBD), which also allow for easy detection and/or easy purification of recombinant proteins. Further, proteins with chromogenic or fluorescent properties, such as green fluorescent protein (GFP) or yellow fluorescent protein (YFP), are also suitable tags of the present disclosure.
[0034] In another aspect of the invention, the isolated Sap1 and/or Sap2 protein or peptide thereof is linked or conjugated to an immunogenic carrier molecule. In some cases, the immunogenic carrier molecule may be covalently or non-covalently bound to the Sap1 or Sap2 protein or peptide. Exemplary immunogenic carrier molecules include, but are not limited to, bovine serum albumin, chicken egg ovalbumin, keyhole limpet hemocyanin, tetanus toxoid, diphtheria toxoid, thyroglobulin, a pneumococcal capsular polysaccharide, CRM197 (genetically detoxified form of diphtheria toxin), and a meningococcal outer membrane protein.
[0035] In aspects wherein the Sap1 and/or Sap2 composition is intended for use as a subunit vaccine, the Sap1 and/or Sap2 protein or peptide thereof is in admixture with an adjuvant. An adjuvant, as defined herein, is a substance that serves to enhance the immunogenicity of protein or peptide of the invention. An immune adjuvant may enhance an immune response to an antigen that is weakly immunogenic when administered alone, e.g., inducing no or weak antibody titers or cell-mediated immune response, increase antibody titers to the antigen, and/or lowers the dose of the antigen effective to achieve an immune response in the individual. Thus, adjuvants are often given to boost the immune response and are well known to the skilled artisan.
[0036] Suitable adjuvants include, but are not limited to: [0037] (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminum sulfate, etc.; [0038] (2) calcium-based salts; [0039] (3) silica; [0040] (4) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides or bacterial cell wall components), such as, for example, [0041] (a) MF59 (WO 90/14837), containing 5% squalene, 0.5% polysorbate 80, and 0.5% sorbitan trioleate (optionally containing various amounts of muramyl tripeptide phosphatidylethanolamine) formulated into submicron particles using a microfluidizer such as Model 110Y microfluidizer (Microfluidics, Newton, MA), [0042] (b) SAF, containing 10% squalene, 0.4% polysorbate 80, 5% pluronic-blocked polymer L121, and thr-MDP either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, [0043] (c) RIBI adjuvant system (RAS), (Corixa, Hamilton, MT) containing 2% squalene, 0.2% polysorbate 80, and one or more bacterial cell wall components from the group consisting of 3-O-deacylated monophosphorylipid A (MPL) described in U.S. Pat. No. 4,912,094, trehalose dimycolate (TDM), and cell wall skeleton (CWS), preferably MPL+CWS (DETOX); and [0044] (d) a Montanide ISA; [0045] (5) saponin adjuvants, such as those sold under the tradenames QUIL-A or QS-21 STIMULON (Antigenics, Framingham, MA) (see, e.g., U.S. Pat. No. 5,057,540), may be used or particles generated therefrom such as ISCOM (immunostimulating complexes formed by the combination of cholesterol, saponin, phospholipid, and amphipathic proteins) and ISCOMATRIX (having essentially the same structure as an ISCOM but without the protein); [0046] (6) bacterial components (e.g., endotoxins, in particular superantigens, exotoxins and cell wall components) and lipopolysaccharides, synthetic lipid A analogs such as aminoalkyl glucosamine phosphate compounds (AGP), or derivatives or analogs thereof, which are available from Corixa, and described in U.S. Pat. No. 6,113,918; one such AGP is 2-[(R)-3-tetradecanoyloxytetradecanoylamino]ethyl 2-Deoxy-4-O-phosphono-3-O[(R)-3-tetradecanoyloxy-tetradecanoyl]-2-[(R)-3-tetradecanoyloxytetradecanoylamino]-b-D-glucopyranoside, which is also known as 529 (formerly known as RC529), which is formulated as an aqueous form or as a stable emulsion; [0047] (7) synthetic polynucleotides such as oligonucleotides containing CpG motif(s) (U.S. Pat. No. 6,207,646); [0048] (8) cytokines and chemokines (e.g., granulocyte macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), macrophage colony stimulating factor (M-CSF), colony stimulating factor (CSF), erythropoietin (EPO), interleukin 2 (IL-2), IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-10, IL-12, IL-15, IL-18, interferon gamma, interferon gamma inducing factor I (IGIF), transforming growth factor beta, RANTES (regulated upon activation, normal T-cell expressed and presumably secreted), macrophage inflammatory proteins (e.g., MIP-1 alpha and MIP-1 beta), tumor necrosis factor (TNF), costimulatory molecules B7-1 and B7-2, and Leishmania elongation initiating factor (LEIF)); [0049] (9) complement, such as a trimer of complement component C3d; [0050] (10) toll-like receptor agonists, e.g., TLR4 agonists such as glucopyranosyl lipid adjuvant (GLA); [0051] (11) serum proteins, e.g., transferrin; [0052] (12) viral coat proteins, e.g., rotavirus capsid VP6 protein; and [0053] (13) block copolymer adjuvants, e.g., Hunter's TITERMAX adjuvant (VAXCEL, Inc. Norcross, GA).
[0054] Muramyl peptides include, but are not limited to, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanine-2-(1-2dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (MTP-PE), etc.
[0055] In certain aspects, the adjuvant includes an aluminum salt. The aluminum salt adjuvant may be used to form an alum-precipitated vaccine or an alum-adsorbed vaccine. Aluminum-salt adjuvants are well-known in the art and are described, for example, in Harlow & Lane ((1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory) and Nicklas ((1992) Res. Immunol. 143:489-493). The aluminum salt may include, but is not limited to, hydrated alumina, alumina hydrate, alumina trihydrate (ATH), aluminum hydrate, aluminum trihydrate, aluminum (III) hydroxide, aluminum hydroxyphosphate sulfate, Aluminum Phosphate Adjuvant (APA), amorphous alumina, trihydrated alumina, or trihydroxyaluminum.
[0056] In some aspects, the Sap1 and/or Sap2 protein compositions of the present invention are prepared by formulating Sap1 and/or Sap2 with a pharmaceutically acceptable carrier and optionally a pharmaceutically acceptable excipient. As used herein, the terms pharmaceutically acceptable carrier and pharmaceutically acceptable excipient (e.g., additives such as diluents, antioxidants, preservatives and solubilizing agents) are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Examples of pharmaceutically acceptable carriers include water, e.g., buffered with phosphate, citrate and another organic acid. Representative examples of pharmaceutically acceptable excipients that may be useful in the present invention include antioxidants such as ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt forming counterions such as sodium; and/or nonionic surfactants such as polysorbate, polyethylene glycol (PEG), and poloxamers.
[0057] Sap1 and/or Sap2 protein compositions of the present invention may be prepared for storage by mixing the active ingredient(s) having the desired degree of purity with the pharmaceutically acceptable carrier and optional excipient and/or additional active agent, in the form of lyophilized formulations or aqueous solutions. The Sap1 and/or Sap2 protein compositions may be formulated as single dose vials, multi-dose vials or as pre-filled glass or plastic syringes.
[0058] Another aspect of the present invention relates to a method of immunizing against a Burkholderia infection in a subject. This method involves administering a Sap1 and/or Sap2 protein composition of the present invention, in an amount effective to immunize against Burkholderia infection in the subject. A suitable subject for treatment in accordance with this aspect of the present invention is a subject at risk of developing a Burkholderia infection. In accordance with this aspect of the invention, an effective amount of the Sap1 and/or Sap2 protein composition for administration to a subject is the amount necessary to generate a humoral (i.e., antibody-mediated) immune response. Preferably, administration of an effective amount of the composition induces a neutralizing immune response against Burkholderia in the subject, in particular a Burkholderia species that is a pathogen or opportunistic pathogen of a human or animal, e.g., B. mallei, B. pseudomallei, B. multivorans, B. cepacia or B. cenocepacia. To effectuate an effective immune response in a subject, the composition may further contain one or more additional Burkholderia antigens or an adjuvant as described supra. In an alternative aspect of the invention, the adjuvant is administered separately from the Sap1 and/or Sap2 protein composition to the subject, either before, after, or concurrent with administration of the Sap1 and/or Sap2 protein composition of the present invention. Modes of administration are known to a person skilled in the art and may be carried out parenterally, transmucosally, transdermally, intramuscularly, intravenously, intradermally, intranasally, subcutaneously, intraperitoneally, and formulated accordingly.
[0059] This invention further provides a serological assay and kit for diagnosing a Burkholderia infection and/or determining whether a subject has elicited an immune response to a Sap1 and/or Sap2 protein. Serological tests of this invention are based on monitoring or detecting the presence of anti-Sap1 and/or anti-Sap2 antibodies in a subject sample, e.g., blood, lymph, saliva, etc. In vitro methods of diagnosis/detection generally include contacting a subject sample (e.g., blood, serum, plasma, fractions of plasma, etc.) with an immobilized Sap1 and/or Sap2 protein and detecting specific binding between antibodies in the subject sample and the Sap1 and/or Sap2 proteins, either as a cocktail or as individual protein species, where the presence of specific binding is indicative of a prior, or current, infection and/or immune response to a vaccine. For example, diagnosis may use an ELISA technique or western blot, where a serum sample is diluted in PBS or other acceptable excipient, and incubated with the Sap1 and/or Sap2 proteins, where a positive result in the ELISA or a visual response in a western blot is indicative of reactivity. In a particular aspect, a conventional sandwich type assay is used. A sandwich assay is performed by first attaching the Sap1 and/or Sap2 proteins to an insoluble surface or support. The Sap1 and/or Sap2 proteins may be bound to the surface by any convenient means, depending upon the nature of the surface, either directly or through specific antibodies. The particular manner of binding is not crucial so long as it is compatible with the reagents and overall methods of the invention. They may be bound to the surfaces covalently or non-covalently, preferably non-covalently. Samples, fractions or aliquots thereof are then added to separately assayable supports (for example, separate wells of a microtiter plate) containing support-bound Sap1 and/or Sap2 proteins. Preferably, a series of standards, containing known concentrations of antibodies is assayed in parallel with the samples or aliquots thereof to serve as controls.
[0060] To facilitate the diagnosis of a Burkholderia infection and/or determine whether a subject has elicited an immune response to a Sap1 and/or Sap2 protein, the invention provides a kit. The kit of this invention includes a recombinant Surface Attachment Protein immobilized on a substrate, wherein the recombinant Surface Attachment Protein is a Sap1 polypeptide having the amino acid sequence of SEQ ID NO:1, preferably Sap1 polypeptides of SEQ ID NOs:2-9; a Sap2 polypeptide having the amino acid sequence of SEQ ID NO:10, preferably Sap2 polypeptides of SEQ ID NOs:11-13, or a combination of Sap1 and Sap2 proteins. Suitable substrates that may be used to immobilize the Sap1 and/or Sap2 polypeptides include beads, e.g., magnetic beads, membranes and microtiter plates. These are typically made of glass, plastic (e.g., polystyrene), polysaccharides, nylon or nitrocellulose. Microtiter plates are especially convenient because a large number of assays can be carried out simultaneously, using small amounts of reagents and samples. Preferably, the kit includes reagents, such as positive and negative controls; secondary antibodies for detection, where the provided secondary antibodies may be conjugated to an enzyme for detection; substrates for such enzymes; buffers and the like for performing assays. In certain aspects, the kit includes anti-SAP1 and/or anti-SAP2 antibodies (e.g., monoclonal antibodies) as positive controls.
[0061] Another aspect of the present invention relates to a composition including an effective amount of an antibody that specifically binds a Sap1 polypeptide, an antibody that specifically binds a Sap2 polypeptide, or a combination thereof, wherein the antibody is in admixture with a preservative and optionally a pharmaceutically acceptable carrier as described herein. As used herein, an antibody refers to an antibody, antigen-binding fragment of an antibody, or a genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. Binding specificity refers to selective recognition of the antibody for a particular epitope of an antigen. The term epitope includes any protein determinant capable of specific binding to an immunoglobulin or T-cell receptor or otherwise interacting with a molecule. An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids in a unique spatial conformation. Antibodies that recognize the same epitope can be verified in a simple immunoassay showing the ability of one antibody to block the binding of another antibody to a target antigen.
[0062] In one aspect, the antibody of the composition is an anti-Sap1 antibody or antigen-binding fragment thereof or an anti-Sap2 antibody or antigen-binding fragment thereof. In some aspects, the composition includes both Sap1 and Sap2 antibodies or antigen binding fragments thereof. Preferably, the composition includes one or more neutralizing Sap1 and/or Sap2 antibodies or antigen-binding fragments thereof. In yet another aspect, the anti-Sap1 and/or anti-Sap2 antibody composition is multivalent in that specifically binds more than one Burkholderia antigen. For example, the composition may include one or more antibodies that recognize one or more additional Burkholderia antigens, including LPS and/or CPS antigens.
[0063] For purposes of the present invention, the term antibody includes monoclonal antibodies, polyclonal antibodies, antibody fragments, genetically engineered forms of the antibodies, and combinations thereof. More specifically, the term antibody includes full length (i.e., naturally occurring or formed by normal immunoglobulin gene fragment recombinatorial processes) immunoglobulin molecules (e.g., an IgG antibody) and immunologically active fragments thereof (i.e., including the specific binding portion of the full-length immunoglobulin molecule), which again may be naturally occurring or synthetic in nature. Accordingly, the term antibody fragment or antigen-binding fragment includes a portion of an antibody such as F(ab).sub.2, F(ab).sub.2, Fab, Fab, Fv, scFv and engineered fragments including, e.g., domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g., monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains. Regardless of structure, an antibody fragment binds with the same antigen that is recognized by the full-length antibody, and, in the context of the present invention, specifically binds Sap1 or Sap2.
[0064] Monoclonal antibodies of the invention may be murine, human, humanized or chimeric. A humanized antibody is a recombinant protein in which the CDRs of an antibody from one species, e.g., a rodent, rabbit, dog, goat, horse, or chicken antibody (or any other suitable animal antibody), are transferred into human heavy and light variable domains. The constant domains of the antibody molecule are derived from those of a human antibody. Methods for making humanized antibodies are well known in the art. Yet other monoclonal antibodies of the present invention may be bispecific, e.g., they have specificity for both Sap1 and Sap2. Bispecific antibodies are preferably human or humanized. A suitable Sap1 antibody includes the SR1 #140 antibody disclosed herein. A suitable Sap2 antibody includes the SR2 #1 antibody disclosed herein.
[0065] The above-described antibodies can be obtained in accordance with standard techniques. For example, Sap1, Sap2, or an immunologically active fragment of Sap1 or Sap2 can be administered to a subject (e.g., a mammal such as a human or mouse). The proteins can be used by themselves as immunogens or they can be attached to a carrier protein or other objects, such as beads. After the mammal has produced antibodies, a mixture of antibody producing cells, such as splenocytes, are isolated, from which polyclonal antibodies may be obtained. Monoclonal antibodies may be produced by isolating individual antibody-producing cells from the mixture and immortalizing them by, for example, fusing them with tumor cells, such as myeloma cells. The resulting hybridomas are preserved in culture and the monoclonal antibodies are harvested from the culture medium. Methods of making and screening antibodies are well-known in the art.
[0066] In a particular aspect, the antibody of the composition is an anti-Sap1 nanobody, an anti-Sap2 nanobody, or a combination thereof. Recombinant nanobody production is based on specific nonclassic single-chain antibodies, existing naturally together with classic antibodies in Camelids (and some species of cartilaginous fishes). These specific molecules are composed of a dimer of only one short (without first constant CH1 region) heavy immunoglobulin chain and are fully functional in the absence of the light immunoglobulin chain. Only one variable domain (VHH, nanoantibody, nanobody or single-domain nanoantibody) of this antibody is necessary and sufficient for specific recognition and binding of antigen. Organization of variable domains (VHH) of nonclassic antibodies is largely similar to that of the variable domains (VH) of classic antibodies (human VH-domains of subclass IgG3 immunoglobulins have most evident homology with VH and VHH of Camelids). In both cases V-domains are composed of four conservative framework regions (FR), surrounding three hypervariable complementarity determining regions (CDRs). Methods of making and screening nanobodies are well-known in the art.
[0067] In particular aspects of this invention, the antibody composition of this invention includes an isolated Sap1 antibody having a variable domain including (i) a CDR1 with the amino acid sequence X.sub.1RTX.sub.2SX.sub.3YAX.sub.4G (SEQ ID NO:14), wherein X.sub.1 is G or R, X.sub.2 is I or F, X.sub.3 is S or R, and X.sub.4 is M or L, (ii) a CDR2 with the amino acid sequence AIX.sub.1X.sub.2X.sub.3X.sub.4X.sub.5X.sub.6TX.sub.7YADSVSG (SEQ ID NO:18), wherein X.sub.1 is N or S, X.sub.2 is L, T or W, X.sub.3 is S or G, X 4 is S or G, X.sub.5 is S or G, X.sub.6 is S, N or T, and X.sub.7 is S, G or H, and (iii) a CDR3 with the amino acid sequence X.sub.1X.sub.2X.sub.3X.sub.4X.sub.5W (SEQ ID NO:22), wherein X.sub.1 is A, S or T, X.sub.2 is D or N, X.sub.3 is F or G, X.sub.4 is S or A, and X.sub.5 is S, N or Y; and/or an isolated Sap2 antibody having a variable domain including (i) a CDR1 with the amino acid sequence GSX.sub.1FRFNAMG (SEQ ID NO:26), wherein X.sub.1 is R or I, (ii) a CDR2 with the amino acid sequence X.sub.1IX.sub.2SGX.sub.3STX.sub.4YADSVKG (SEQ ID NO:29), wherein X.sub.1 is S or D, X.sub.2 is T or A, X.sub.3 is D or G, and X.sub.4 is V or N, and (iii) a CDR3 with the amino acid sequence QGSX.sub.1RX.sub.2PTX.sub.3X.sub.4EYX.sub.5YW (SEQ ID NO:32), wherein X.sub.1 is H or Y, X.sub.2 is Y or R, X.sub.3 is V or A, X.sub.4 is F or Y, and X.sub.5 is D or E.
[0068] In particular aspects, the variable domain of the Sap1 antibody includes (i) a CDR1 with the amino acid sequence GRTISSYAMG (SEQ ID NO: 15), GRTFSRYAMG (SEQ ID NO:16), or RRTFSSYALG (SEQ ID NO:17); (ii) a CDR2 with the amino acid sequence AINLSSSSTSYADSVKG (SEQ ID NO:19), AISTSGGNTGYADSVKG (SEQ ID NO:20), or AISWGGSTTHYADSVQG (SEQ ID NO:21); and (iii) a CDR3 with the amino acid sequence ADGSNW (SEQ ID NO:23), RRSVGSMSASNFASW (SEQ ID NO:24), or TNGAYW (SEQ ID NO:25). In other aspects, the variable domain of the Sap2 antibody includes (i) a CDR1 with the amino acid sequence GSRFRFNAMG (SEQ ID NO:27) or GSRFRFNAMG (SEQ ID NO:28); (ii) a CDR2 with the amino acid sequence SITSGDSTVYADSVKG (SEQ ID NO:30) or DIASGGSTNYADSVKG (SEQ ID NO:31); and (iii) a CDR3 with the amino acid sequence QGSHRYPTVFEYDYW (SEQ ID NO:33) or QGSYRRPTAYEYEYW (SEQ ID NO:34). In accordance with some aspects, the antibody is a monoclonal antibody. In accordance with other aspects, the antibody is a nanobody. Exemplary Sap1 nanobodies have amino acid sequences as set forth in SEQ ID NO:100-102. Exemplary Sap2 nanobodies have amino acid sequences as set forth in SEQ ID NO:103-104.
[0069] Ideally, Sap1 and/or Sap2 antibodies may inhibit or reduce Sap1 activity and Sap2 activity, respectively, e.g., cell attachment activity. In some embodiments, the Sap1 and/or Sap2 antibodies neutralize (e.g., substantially eliminate) Sap1 and Sap2 activity, respectively.
[0070] Another aspect of the present invention is directed to a method of treating or attenuating a Burkholderia infection in a subject. This method includes administering to a subject in need of treatment an effective amount of a Sap1 antibody (e.g., a monoclonal antibody or nanobody), a Sap2 antibody (e.g., a monoclonal antibody or nanobody), or a combination thereof, in an amount effective to treat or attenuate the Burkholderia infection in the subject. In accordance with this aspect of the invention, Burkholderia-associated conditions include, without limitation, melioidosis and pneumonia.
[0071] Administration of the antibody(ies) can be carried out by any conventional method including those described elsewhere herein. For purposes of this and other aspects of the invention, the target subject encompasses any animal, preferably a mammal, more preferably a human. In the context of administering a composition of the invention for purposes of treating or attenuating a Burkholderia infection in a subject, the target subject encompasses any subject that has been exposed to a pathogenic Burkholderia species (including opportunistic pathogens) and/or exhibited signs or symptoms of a Burkholderia infection. Such species of Burkholderia include, e.g., B. mallei, B. pseudomallei, B. multivorans, B. cepacia or B. cenocepacia, preferably B. pseudomallei or B. cenocepacia. Particularly susceptible subjects include infants, juveniles, adults or elderly adults exposed to a pathogenic Burkholderia species (including opportunistic pathogens), as well as immunocompromised juvenile, adults, and elderly adults, and subjects with diseases such as CF and diabetes mellitus. In the context of using compositions of the present invention to treat or attenuate a Burkholderia infection, either via active or passive vaccination, the concentration of Sap1 and Sap2 proteins or peptides or anti-Sap1 and anti-Sap2 antibodies in the composition are adequate to achieve the treatment or attenuation of Burkholderia infection, particularly the treatment or attenuation of Burkholderia in susceptible populations. In the context of using anti-Sap1 and anti-Sap2 antibody compositions to treat or attenuate a Burkholderia infection, the amounts of antibodies are capable of achieving a reduction in a number of symptoms, a decrease in the severity of at least one symptom, or a delay in the further progression of at least one symptom, or even a total alleviation of the infection.
[0072] Therapeutically effective amounts of Sap1 protein, Sap2 protein, anti-Sap1 and anti-Sap2 antibodies can be determined in accordance with standard procedures, which take numerous factors into account, including, for example, the concentrations of these active agents in the composition, the mode and frequency of administration, the severity of the Burkholderia infection to be treated (or attenuated), and subject details, such as age, weight and overall health and immune condition. General guidance can be found, for example, in the publications of the International Conference on Harmonization and in Remington's Pharmaceutical Sciences (Mack Publishing Company 1990), which is hereby incorporated by reference in its entirety. A clinician may administer Sap1 protein and/or Sap2 protein or anti-Sap1 and/or anti-Sap2 antibodies, until a dosage is reached that provides the desired or required prophylactic or therapeutic effect. The progress of this therapy can be easily monitored by conventional assays.
[0073] Therapeutically effective amounts of Sap1 protein and Sap2 protein for immunization may depend on whether adjuvant is co-administered, with higher dosages being required in the absence of adjuvant. The amount of Sap1 protein and Sap2 protein for administration sometimes varies from 1 g to 500 g per patient and more usually from 5 g to 500 g per injection for human administration. Occasionally, a higher dose of 1-2 mg per injection is used. Typically, about 10, 20, 50 or 100 g is used for each human injection. The timing of injections can vary significantly from once a day, to once a year, to once a decade. Generally, an effective dosage can be monitored by obtaining a fluid sample from the subject, generally a blood serum sample, and determining the titer of antibody developed against the Sap1 and/or Sap2 protein or peptide, using methods well-known in the art and readily adaptable to the specific antigen to be measured. Ideally, a sample is taken prior to initial dosing and subsequent samples are taken and titered after each immunization. Generally, a dose or dosing schedule which provides a detectable titer at least four times greater than control or background levels at a serum dilution of 1:100 is desirable, where background is defined relative to a control serum or relative to a plate background in ELISA assays.
[0074] Therapeutically effective amount of the Sap1 antibody and/or Sap2 antibody composition typically is at least 50 mg composition per kilogram of body weight (mg/kg), including at least 100 mg/kg, at least 150 mg/kg, at least 200 mg/kg, at least 250 mg/kg, at least 500 mg/kg, at least 750 mg/kg and at least 1000 mg/kg, per dose or on a daily basis. Dosages for monoclonal antibody or nanobody compositions might tend to be lower and may be at least about 5 mg/kg, at least about 10 mg/kg, at least about 15 mg/kg, at least about 20 mg/kg, or at least about 25 mg/kg. In some methods, two or more antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated. Antibody is usually administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of antibody in the subject. Alternatively, antibody can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the antibody in the subject. In general, human antibodies show the longest half-life, followed by humanized antibodies, chimeric antibodies, and nonhuman antibodies. The dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, and preferably until the subject shows partial or complete amelioration of symptoms of disease.
[0075] The therapeutic compositions of the present invention can be administered as part of a combination therapy in conjunction with another active agent, depending upon the nature of the Burkholderia infection that is being treated. Such additional active agents include anti-infective agents, antibiotic agents, and antimicrobial agents. Representative anti-infective agents that may be useful in the present invention include vancomycin and lysostaphin. Representative antibiotic agents and antimicrobial agents that may be useful in the present invention include penicillinase-resistant penicillins, cephalosporins and carbapenems, including vancomycin, lysostaphin, penicillin G, ampicillin, oxacillin, nafcillin, cloxacillin, dicloxacillin, cephalothin, cefazolin, cephalexin, cephradine, cefamandole, cefoxitin, imipenem, meropenem, gentamycin, teicoplanin, lincomycin and clindamycin. Dosages of these antibiotics are well known in the art. The anti-inflammatory, anti-infective, antibiotic and/or antimicrobial agents may be combined prior to administration, or administered concurrently (as part of the same composition or by way of a different composition) or sequentially with the inventive therapeutic compositions of the present invention. In certain embodiments, the administering is repeated. The subject may be an infant, juvenile, adult, or elderly adult. The subject may also be an immuno-compromised juvenile, adult, or elderly adult.
[0076] Another aspect of the present invention relates to a method of identifying inhibitors of Sap1/2 activity. This method involves providing a cell population, a preparation containing Sap1 and Sap2, and a candidate Sap1/2 inhibitor. The cell population is exposed to the preparation containing Sap1 and Sap2 in the presence and absence of the candidate inhibitor, and Sap1/2-mediated cell attachment is measured in the presence and in the absence of the candidate inhibitor. The reduced level of cell attachment is indicative of an inhibitor of Sap1 and/or Sap2 activity. Inhibitors identified in such a screen are particularly useful in the prevention, treatment or attenuation of Burkholderia infection
[0077] The candidate compounds utilized in the assays described herein may be essentially any compound or composition suspected of being capable of affecting biological functions or interactions. The compound or composition may be part of a library of compounds or compositions. Alternatively, the compound or compositions may be designed specifically to interact or interfere with the biological activity of Sap1, Sap2, or Sap1 and Sap2 of the present invention.
[0078] In a further aspect, this invention provides a live-attenuated B. pseudomallei, the genome of which has a deletion of all or a portion of the nucleic acids encoding the BPSL0636 polypeptide of SEQ ID NO:35 so that a functional protein is not produced. In certain aspects, the genome of the live-attenuated B. pseudomallei has a deletion of all or a portion of the nucleic acids encoding the BPSL0636 polypeptide of SEQ ID NO:35 and a deletion of all or a portion of the nucleic acids encoding the BPSS0015 polypeptide of SEQ ID NO:137, i.e., a double knockout mutant. Deletion or knock out of the nucleic acids encoding the BPSL0636 polypeptide and optionally BPSS0015 polypeptide can be carried out as described in the Example 1 or using any other conventional method. Given the defect in invasion and complete attenuation of the BPSL0636 deletion mutant and BPSL0636/BPSS0015 double deletion mutant, these strains are particularly useful in prophylaxis. Accordingly, the invention further provides methods for immunizing against a B. pseudomallei infection by administering to a subject in need thereof a live-attenuated B. pseudomallei BPSL0636 deletion mutant or BPSL0636/BPSS0015 double deletion mutant.
[0079] The following non-limiting examples are provided to further illustrate the present invention.
Example 1: B. pseudomallei Intracellular TRANSITome
Materials and Methods
[0080] Bacterial Strains and Eukaryotic Cell Lines, Media, and Culturing Conditions. All manipulation of Bp was conducted in a CDC-approved and -registered BSL3 facility at the University of Hawai'i at Mnoa with all experiments approved by the Institutional Biosafety Committee and were performed using BSL3 practices following recommendations set forth in the BMBL, 5.sup.th edition. Escherichia coli EPMax10B-lacI.sup.q-pir.sup.52 was routinely used as a cloning strain. The Bp wild-type strains, K96243 and 1026b, and their derivatives were cultured in Luria Broth (LB) or 1M9 minimal media supplemented with 20 mM glucose (MG). For selection of the glyphosate resistance gene (gat) in E. coli and Bp, MG medium supplemented with 0.3% (w/v) glyphosate was used. Murine macrophage cell line (RAW264.7, ATCC), human embryonic kidney cell line (HEK293T, ATCC), and human neuroblastoma cell line (SK-N-SH, ATCC) were used in this study for Bp infection. All cell lines were commercially available cell lines originally obtained from ATCC. The eukaryotic cell cultures were grown in Dulbecco's Modified Eagle Medium (DMEM, Hyclone) supplemented with 10% fetal bovine serum (FBS, Hyclone) at 37 C. with 5% CO.sub.2, and the Antibiotic-Antimycotic reagent (Invitrogen) was added at 1 concentration for cell culture maintenance but omitted during Bp infection studies.
[0081] Molecular Reagents and Methods. All molecular reagents and methods of transcriptomic analysis were used as previously described (Kang et al. (2011) Genome Res. 21:925-935; Kang et al. (2015) Nat. Protoc. 10:974-984).
[0082] Macrophage Infection with Fluorescence-Tagged B. pseudomallei. The Bp wild-type strain K96243 was labeled with red- and yellow-fluorescence proteins for easy visualization during macrophage infection. Briefly, the pUC57-PS12-yfp (Norris et al. (2010) Appl. Environ. Microbiol. 76:7635-7640) was digested with NcoI, blunt-ended, and the yfp gene was ligated with the mini-Tn7-gat-rip (Norris et al. (2010) Appl. Environ. Microbial. 76:7635-7640) backbone digested with BamHI and blunt-ended. The yfp gene was in the same orientation as the rfp gene in the resulting plasmid and both genes were driven by a constitutive promoter in Bp, PC.sub.S12 (Barrett et al. (2008) Appl. Environ. Microbiol. 74:4498-4508). The mini-Tn7-gat-rfp-yfp plasmid was then conjugated into K96243 along with the helper plasmid pTNS3-asd.sub.Ec (Kang et al. (2009) Appl. Environ. Microbiol. 75:4015-4027). Bp with insertion of the mini-Tn7 plasmid at the attTn7 site was confirmed by PCR according to known methods (Norris et al. (2009) Appl. Environ. Microbiol. 75:6062-6075). Stable expression of the RFP and YFP proteins was confirmed and used for macrophage infection studies.
[0083] The macrophage infection with Bp was carried as follows. First, the RAW 264.7 cells were seeded onto 0.17 mm PET membrane coated Membrane Slides (Carl Zeiss) that were pretreated with UV and then 150 g/mL poly-L-lysine. The RFP-YFP-tagged Bp strain was grown to mid-log phase (OD.sub.6000.8) and diluted to approximately 410.sup.5 CFU/mL in DMEM medium with 10% FBS. RAW264.7 cells were infected at a multiplicity of infection (MOI) of 0.2 for 30 minutes and extracellular Bp were washed away with 1 phosphate-buffered saline (PBS). Fresh DMEM medium supplemented with 10% FBS was then added to the membrane slides without antibiotics to ensure a valid comparison to the control. At 1, 2, 6 hours post-infection, correlating to the vacuole, cytoplasm, and protrusion stages, respectively, the membrane slides were washed with 1PBS and immediately fixed with 1% (w/v) paraformaldehyde (PFA) for 5 minutes followed by 70% (v/v) ethanol for 30 minutes. To obtain the control Bp cells as the baseline for microarray comparison, the same diluted Bp culture as above was incubated in the DMEM medium with 10% FBS for 1 hour, harvested by centrifugation and resuspended in 1% (w/v) PFA for 5 minutes. The fixed bacteria were then smeared on to the membrane slides, treated with 70% (v/v) ethanol for 30 minutes.
[0084] To visualize Bp at different stages during macrophage infection, the macrophage plasma and vacuolar membranes were stained with FM 4-64FX lipophilic dye and actin was stained with Oregon Green 488 Phalloidin (Thermo Fisher Scientific). The fluorescent images were obtained on a Zeiss PALM laser catapulting system with 100 oil immersion objective. Single Bp cells from the various stages (vacuole, cytoplasmic replication, and protrusion) of infection were cut by the focused laser and catapulted with unfocused low-intensity laser into the 0.2 mL PCR tube lid containing lysis buffer (Kang et al. (2011) Genome Res. 21:925-935; Kang et al. (2015) Nat. Protoc. 10:974-984). Cells within the cytoplasm and protrusion stages carried actin tails but were differentiated by the time post-infection and visual location in respective intracellular niche. For the control condition (Bp grown in DMEM), a total of nine Bp cells were catapulted into the same PCR tube before processing. Single Bp cells and pooled control Bp cells were processed using previously described methods (Kang et al. (2011) Genome Res. 21:925-935; Kang et al. (2015) Nat. Protoc. 10:974-984).
[0085] Two-Color Microarray and Data Analysis. Transcriptomic analysis was carried out with the B. mallei/pseudomallei 70mer oligo arrays (J. Craig Venter Institute). Each Bp cell was estimated to contain less than 2 pg of total RNA (Kang et al. (2011) Genome Res. 21:925-935; Kang et al. (2015) Nat. Protoc. 10:974-984). Single Bp cells isolated directly from host were lysed, and the cDNA synthesis and amplification from single bacterium total RNA were performed (Kang et al. (2011) Genome Res. 21:925-935; Kang et al. (2015) Nat. Protoc. 10:974-984). The amplified cDNA were labeled with Cy3 or Cy5 dye and hybridized to the B. mallei/pseudomallei 70mer oligo arrays following established protocols (Kang et al. (2011) Genome Res. 21:925-935; Kang et al. (2015) Nat. Protoc. 10:974-984; Heacock-Kang et al. (2017) Mol. Microbiol. 106:976-985). Microarray slides were scanned in a GenePix 4000 microarray scanner with GenePix Pro software 5.1. Individual TIFF images from each channel were processed with Spotfinder software 3.2.1 to generate the raw data. The raw data were then normalized using MIDAS software 2.21 with low intensity filtering, LOWESS normalization, standard deviation regularization, and in-slide replicate analysis. Finally, the normalized data in technical replicates were combined, using MEV software 4.5.1, to generate gene fold-change data (P0.05) when comparing one single bacterium during macrophage infection to the in vitro control. The biological replicates for each infection stage were also merged using MEV software to identify the genes that were consistently up- or down-regulated through one-way ANOVA with multiple comparisons (P0.05). All heat maps were presented in a green-black-red color gradient; green color indicates up-regulation and red color indicates down-regulation, when the gene expression in each infection stage was compared to the control condition. Grey boxes represented the lack of expression data in a technical replicate for that gene. Reference genome of K96243 type strain was used and a total of 5797 genes were analyzed (Winsor et al. (2008) Bioinformatics 24:2803-2804).
[0086] Gene Assignment and Pathway Designation. Gene description, function prediction, and functional category assignment was assisted for some genes using Burkholderia Genome database (Winsor et al. (2008) Bioinformatics 24:2803-2804) and Kyoto Encyclopedia of Genes and Genomes (KEGG; Kanehisa & Goto (2000) Nucleic Acids Res. 28:27-30).
[0087] Real-Time RT-PCR. Validation of microarray data with Real-time RT-PCR was performed using TAQMAN probe. Three housekeeping genes, BPSL0602, BPSL2502, and BPSS2061, that have consistent expression levels across all conditions tested were chosen based on microarray data, as well as published transcriptomic data (Ooi et al. (2013) PLoS Genet. 9:e1003795). BPSS1511, BPSL1528, and BPSL1064 showed differential expression in the TRANSITome data with up-regulation in the vacuole, cytoplasm, and protrusion, respectively, and similar expression results were observed using RT-PCR. Oligos for real-time RT-PCRs were designed using Integrated DNA Technologies Primer Quest software and are presented in Table 1.
TABLE-US-00001 TABLE1 SEQID OligoName Sequence(5.fwdarw.3) NO: BPSL1064-For GCAACGCGATTTCTAC 36 BPSL1064-Probe 56-FAM/AATTCCACGCATATCAAGGG/3BHQ_1 37 BPSL1064-Rev AAGGCGAACCGATAAT 38 BPSL1064-up ACTGTTCTGGGAGCAG 39 BPSL1064-down AGAGATCGGCGAGAAG 40 BPSL1528-For AAAGTGCTCAATCAACG 41 BPSL1528-Probe 56-FAM/AAACGACTATCGTTATGCGG/3BHQ_1 42 BPSL1528-Rev GAAGAACGTGCTGTAAC 43 BPSL1528-up CGGCGAATTTCGACG 44 BPSL1528-down TGATGTTCGCACGCTC 45 BPSS1511-For CTCGAGCAACTGATCC 46 BPSS1511-Probe 56-FAM/CTCTACGGCTTCGACGAATG/3BHQ_1 47 BPSS1511-Rev GTGATCGCCGAGATAG 48 BPSS1511-up TGACGATCGAAGGCAG 49 BPSS1511-down GCGACGAACGCATCC 50 BPSL0602-For GAATACGCGATCAATCTG 51 BPSL0602-Probe 56-FAM/ACTACGTGCTCGAACAGTTC/3BHQ_1 52 BPSL0602-Rev TCGGTGATCTCGAAAC 53 BPSL0602-up ACATCGACCGCTGGGT 54 BPSL0602-down GCCAGGTTCGCGATC 55 BPSL2502-For CGTGCTGCTCTATTTG 56 BPSL2502-Probe 56-FAM/CGACGAGCAGGATGATGAAC/3BHQ_1 57 BPSL2502-Rev GCGTAAACGGAATCAC 58 BPSL2502-up GATCATGGTCGGCATC 59 BPSL2502-down GTGCCGATCGACGAG 60 BPSS2061-For TCAGGTCAAGCACATT 61 BPSS2061-Probe 56-FAM/CACGACCTACTCCATCCTAA/3BHQ_1 62 BPSS2061-Rev CCGGACAGGTTGTTAT 63 BPSS2061-up GCAGCAAACCATCCTC 64 BPSS2061-down CCAAGTTCGGTCGCAG 65
[0088] Each real-time PCR reaction contains 120 nM of each forward and reverse oligos, and 12 nM of probe. Real-time PCR was performed in the iCycler iQ (Bio-Rad) with the following steps: denaturation (95 C. for 10 minutes), 55 cycles of amplification and quantification (95 C. for 20 seconds and 65 C. for 45 seconds). Supermixes for all reactions were made and aliquoted into sub-supermixes for each gene assayed. Eight RT-PCR reactions were done for each gene and condition, performed for three single Bp cells as biological replicates. Data were processed and fold-changes were calculated following known methods (Peirson et al. (2003) Nucleic Acids Res. 31:e73).
[0089] Engineering of the Bp 1026b Virulence Factor Mutants. Chromosomal mutant knock-outs were attempted for 206 spatially upregulated Bp hypothetical genes in wild-type 1026b strain, using -RED recombineering as previously described (Kang et al. (2011) Nat. Protoc. 6:1085-1104). Mutations were generated by insertion of glyphosate resistance gene gat for selection, along with pheS gene for counter-selection for subsequent complementation (Kang et al. (2011) Nat. Protoc. 6:1085-1104). All mutants were verified using PCR with 191 of the 206 genes attempted being successfully mutated.
[0090] Engineering of the Bp 1026b Virulence Factor Complements. The 11 mutants that were determined to be defective in the intracellular replication assay (Table 4) were complemented and tested via intracellular replication assay. The complementation was done by reintroducing a single copy of the gene at their native loci in the corresponding mutant, using -RED recombineering as previously described and counter-selecting for the loss of pheS gene in the resulting complemented strain (Kang et al. (2011) Nat. Protoc. 6:1085-1104). Primers used in complementation are listed in Table 2. All complements were verified using PCR.
TABLE-US-00002 TABLE2 SEQ OligoName Sequence(5.fwdarw.3) IDNO: BPSL0097-up-pheS GGATGCCCAGCAGAGCTTTG 66 CGAATGGGAGACACGACATG BPSL0097-down-gat GCTTGTACATCAGGATGTGG 67 CGTTACTGCTTGATGAAGCG BPSL0636-up-pheS GGATGCCCAGCAGAGCTTTG 68 TGCACGAGGAAATCGAGCAG BPSL0636-down-gat GCTTGTACATCAGGATGTGG 69 TCGTTCAGTGGTGGTGGCCT BPSL1126-up-pheS GGATGCCCAGCAGAGCTTTG 70 AACGAACGTCACCCACGGTC BPSL1126-down-gat GCTTGTACATCAGGATGTGG 71 CGCTTCAACGCTTCGCGAAC BPSL1390-up-pheS GGATGCCCAGCAGAGCTTTG 72 TTCCCATCACATCGATGGCG BPSL1390-down-gat GCTTGTACATCAGGATGTGG 73 TATCTCACGCGCCGTTAACG BPSL1422-up-pheS GGATGCCCAGCAGAGCTTTG 74 TCGGCTAACTCAATGGGCAG BPSL1422-down-gat GCTTGTACATCAGGATGTGG 75 TCACGACGAGCAGCTCACCT BPSL2714-up-pheS GGATGCCCAGCAGAGCTTTG 76 CAAACGCCTAACGTTCTCCG BPSL2714-down-gat GCTTGTACATCAGGATGTGG 77 GTCAGGACAGCACGAGCTTC BPSS0015-up-pheS GGATGCCCAGCAGAGCTTTG 78 CTTTGCCGTTTCCCGTTTCG BPSS0015-down-gat GCTTGTACATCAGGATGTGG 79 GCCGTGCTCAAAGACGTTGC BPSS1265-up-pheS GGATGCCCAGCAGAGCTTTG 80 GACGGTGAGCGCCGTGGATG BPSS1265-down-gat GCTTGTACATCAGGATGTGG 81 TCGCCGCGCTAGCGCGATCT BPSS1780-up-pheS GGATGCCCAGCAGAGCTTTG 82 CCGAGACCCACGCATGCAAC BPSS1780-down-gat GCTTGTACATCAGGATGTGG 83 GACATTCAACGGCCGGATGC BPSS1818-up-pheS GGATGCCCAGCAGAGCTTTG 84 CGTTTCGGCGAGTGACCATG BPSS1818-down-gat GCTTGTACATCAGGATGTGG 85 ATTCGCGCTCAGCTCAGCAG BPSS1860-up-pheS GGATGCCCAGCAGAGCTTTG 86 GCGACGTATACCCGCGAATC BPSS1860-down-gat GCTTGTACATCAGGATGTGG 87 ACGCATCAGGGCAGCGTCAG BPSL0097-up-compHA ATCCCCTGATTCCCTTTGTC 88 AACAGCAATGGATATCAGCC GTTGAAATTCGCCGCTATTG CGGTC BPSL0097-dw-compHA GATGTGCTTAAAAACTTACT 89 CAATGGAATTAGCTCGAGTT AGGTGTCACGCGTAGTCCGG GACGTCGTACGGGTAGCCGC CCTGCTTGATGAAGCGCGCGT BPSS1860-up-compHA ATCCCCTGATTCCCTTTGTC 90 AACAGCAATGGATATCAGCC GTTGATTATTCGATCGAATC CGCTTC BPSS1860-dw-compHA GATGTGCTTAAAAACTTACT 91 CAATGGAATTAGCTCGAGTT AGGTGTCACGCGTAGTCCGG GACGTCGTACGGGTAGCCGC CGGGCAGCGTCAGCGGAAACG
[0091] Growth Curves of B. pseudomallei 1026b Mutants. Growth curves were initiated by growing the 1026b wild-type and various mutant strains overnight, then diluting 200 into fresh LB. The 96-well plate was incubated at 37 C. with shaking in the BioTek ELx808IU and measuring the OD.sub.600 every 30 minutes for 30 hours. Each growth curve was done in triplicate and average was presented with the standard error of the mean (s.e.m).
[0092] Purification/Immunoblot of BPSL0097 and BPSS1860. BPSL0097 and BPSS1860 were purified using nickel affinity chromatography. BPSL0097 was purified with an N-terminal His6-tag from pViet (Hoang et al. (1999) Gene 237:361-371) in E. coli ER2566 codon plus strain under native conditions, and BPSS1860 was purified with an N-terminal His.sub.6-tag from pViet (Hoang et al. (1999) Gene 237:361-371) in E. coli ER2566 codon plus strain under denatured conditions with 8 M urea. Purified BPSL0097 and BPSS1860 were run on a SDS-PAGE gel and blotted to a PVDF membrane. Immunoblots were carried out using the Western Breeze blocker/diluent and protocol (Thermo Fisher). A pool of melioidosis patient sera (n=7) and nave sera (n=2) was de-identified and used to probe the blotted PVDF membrane (1:40 dilution). A secondary goat anti-human Ig-HRP antibody (1:10,000 dilution, Invitrogen) and NOVEX ECL Chemiluminescent Substrate Reagent Kit (Thermo Fisher) was used for detection.
[0093] Cell Infection Assays. Intracellular replication assays were carried out using a modified aminoglycoside protection assay. RAW264.7 cells were seeded at 80% confluence, infected at an MOI of 1 for 1 hour, washed with 1PBS, and then fresh DMEM+FBS containing 750 g/mL amikacin and 750 g/mL kanamycin was added. At various time points post-infection, monolayers were washed two times with 1PBS, lysed with 0.2% TRITON X-100 in PBS, and dilutions of lysates were plated onto LB to enumerate intracellular bacteria. Attachment assays were carried out with various cell lines at an MOI of 1. For attachment efficiency tests, infection was initiated similarly as the intracellular replication assay, and at 1 hour post-infection (hpi) the bacteria-containing medium was removed, the monolayers were washed 3 times with PBS, and lysed with 0.2% TRITON X-100 in PBS, diluted, plated onto LB to enumerate attached bacteria. The attachment efficiency was determined by dividing the attached number by the initial number of infecting bacteria. All Experiments were carried out in triplicate and error bars represent the s.e.m.
[0094] Plaque assays were carried out in confluent monolayers of HEK293T cells in 24-well plates. Bp 1026b strains were used to infect monolayers at an MOI of 1. After one hour, monolayers were washed with 1PBS and overlaid with DMEM+FBS supplemented with 1.2% low gelling temperature agarose sold under the tradename SEAPLAQUE (Lonza) and 750 g/mL amikacin and 750 g/mL kanamycin. At 24 hpi, monolayers were fixed with 4% PFA in 1PBS for 45 minutes. Monolayers were stained with a 1% crystal violet solution for ease of viewing. Plaques were viewed with a Zeiss AxioObserver D1 and the accompanying AxioVision 64 bit 4.9.1 software was used to measure plaque diameter. Plaque assays were carried out in triplicate and 10 to 20 plaques per replicate were measured for comparison.
[0095] Chemical modulation of autophagy was carried out as previously described with minor modifications (Cullinane et al. (2008) Autophagy 4:744-753). Briefly, RAW264.7 cells were treated with either 4 M rapamycin or 10 mM 3-methyladenine 1 hpi and bacterial cell counts determined at 24 hpi as described above.
[0096] Immunofluorescence and Transmission Electron Microscopy. The BPSL0097 and BPSS1860 mutant strains were complemented with translational HA (human influenza hemagglutinin)-tagged BPSL0097, or BPSS1860, respectively. Mutants and the complemented strains were stained with a primary antibody of mouse anti-HA conjugated to fluorescent dye sold under the tradename ALEXAFLUOR 594 (1:200 dilution, Thermo Fisher Scientific), followed with secondary goat-anti-mouse antibody conjugated to fluorescent dye sold under the tradename ALEXAFLUOR 488-10 nm colloidal gold conjugate (1:50 dilution, Thermo Fisher Scientific). Labeled bacterial cells were visualized using a Zeiss D1 observer fluorescence microscope and a 120 kV Hitachi HT7700 digital transmission electron microscope.
[0097] For visualization of the BPSS0015 mutant infected macrophage cells, 60-mm tissue culture dishes were treated with 150 g/mL poly-L-lysine and RAW264.7 murine macrophages were seeded and allowed to attach overnight. Wild-type Bp 1026b and the BPSS0015 mutant strains were used to infect the monolayers as described above. At 24 hpi, the media was removed and the monolayers were fixed for 2 hours with 2.5% glutaraldehyde in 0.1 M sodium cacodylate buffer at pH 7.4. The dishes were washed twice with 0.1 M cacodylate buffer for 20 minutes each. Samples were post-fixed in 1% osmium tetroxide in 0.1 M cacodylate buffer for 1 hour then dehydrated in a graded ethanol series. Epoxy resin was used to infiltrate samples and allowed to polymerize at 60 C. for 2 days. Samples were visualized using a 120 kV Hitachi HT7700 digital transmission electron microscope. Images were captured using an AMT XR-41 20482048 pixel bottom-mount high-resolution camera.
[0098] For visualization of microtubule-associated protein light chain 3 (LC3) colocalization to the BPSS0015 mutant or wild-type Bp, HEK293T cells were transfected with pEGFP-LC3 (Addgene) using transfection reagent sold under the tradename LIPOFECTAMINE 2000 (Invitrogen) following the manufacturers protocol. Wild-type Bp 1026b and BPSS0015 mutant strains were used to infect, as described above, the monolayers stably expressing LC3-GFP. At 24 hpi, monolayers were fixed with 1% PFA for 1 hour, permeabilized with 0.2% TRITON X-100, stained with DAPI and FM 4-64FX lipophilic dyes, and visualized using Zeiss D1 observer fluorescence microscope.
[0099] For visualization of BPSS1818 mutant-infected macrophage cells, the infected monolayer was stained by red plasma membrane stain, or DAPI and -tubulin antibody conjugated with a fluorescent dye sold under the tradename ALEXAFLUOR 594 (1:50 dilution, Cell Signaling Technology). Images were captured with an AxioObserer D1 and accompanying Axiovision 4.9.1 software. Multi-color fluorescent images were captured with the multichannel fluorescence acquisition module of the Axiovision software. Images were deconvolved using the image) plugin Iterative Deconvolve 3D.
[0100] Live-Cell Time-Lapse Imaging. Light microscopy of infected cell monolayers was carried out as described (Norris et al. (2010) Appl. Environ. Microbiol. 76:7635-7640), except for a few modifications. Glass bottom 12-well plates were obtained from MatTek Corporation and treated with 150 g/mL poly-L-lysine. Monolayers were seeded and infected with bacteria in 200 L of DMEM+FBS at an MOI of 10. After 1 hour, the medium containing bacteria was removed, the monolayers were washed two times with 1PBS, and DMEM containing 750 g/mL amikacin and 750 g/mL kanamycin was added for the remainder of the experiment. Live-cell imaging was taken on an Olympus microscope equipped with the Weather Station incubation system at 37 C. with 5% CO.sub.2. Images were captured at 1 frame/5 minutes for 24 hours. Images were compiled into videos using ImageJ.
[0101] Animal Studies. BALB/c mice between 4 and 6 weeks of age were purchased from Charles River Laboratory. Animals were anesthetized with 100 mg/kg ketamine plus 10 mg/kg xylazine and infected with Bp via the intranasal (i.n.) route (Propst et al. (2010) Infect. Immun. 78:3136-3143). Groups of mice (n=5) were challenged with a dose of 4,500 CFU (5 LD.sub.50 for wild-type Bp 1026b), monitored daily for disease symptoms, and euthanized according to pre-determined humane endpoints. The lungs, liver, and spleen of surviving mice were removed, homogenized, and serial diluted to determine bacterial burdens. Statistical differences in survival times were determined by Kaplan-Meier curves followed by the log-rank test.
[0102] Ethics. The animal studies described in this manuscript were conducted in compliance with the NIH (National Institutes of Health) Guide for the Care and Use of Laboratory Animals and approved by the Institutional Animal Care and Use Committee at the University of Hawai'i at Mnoa. Melioidosis patient sera samples used in immunoblot analysis were de-identified. Blood samples were collected following informed consent under ethics approval provided by Townsville Hospital and Health Services, Australia.
[0103] Statistics and Reproducibility. Microarray data were analyzed in MEV software 4.5.1. All other statistical analyses were completed in Prism software 6.0. All experiments were done in triplicate unless otherwise noted, and all the data points were graphed for quantitative analyses. All qualitative microscopy experiments were done in triplicate. All experiments were repeated independently at least once, and replications were successful.
Results and Discussion
[0104] Bp Gene Expression Flux in Host Cells. Bp transiting through the host experiences various environmental niches, starting from host cell entry into an intracellular vacuole, escaping from the vacuole into the host cell cytoplasm, and finally protruding toward neighboring host cells, spreading the infection (French et al. (2011) Proc. Natl. Acad. Sci. USA 108:12095-12100). Therefore, it was hypothesized that, as Bp transits through its intracellular lifecycle, gene-expression is altered to accommodate each unique environmental niche. To probe this hypothesis, laser capture microdissection (LCM; Emmert-Buck et al. (1996) Science 274:998-1001) and total transcript amplification (Kang et al. (2015) Nat. Protoc. 10:974-984) were used to isolate single Bp cells at each stage of intracellular infection and determine their transcriptional profiles, hereafter referred to as the Bp TRANSITome. Comparing single Bp cells isolated from various stages of intracellular infection to those grown in vitro (via microarray analysis, it was observed that 1,953 genes were differentially expressed in a stage-specific manner. Many genes showed niche-specific expression, indicating dynamic global control of functions at each stage of infection. Biological triplicates from each stage of infection showed high reproducibility for many genes, supporting the validity of this approach to analyze the gene expression of intracellular pathogens. Genes showing high reproducibility likely represent conserved functions while genes showing high variability between biological triplicates could be distinguished as a class of genes to study due to variable expression during intracellular infection. Microarray data was validated via qRT-PCR on three selected stage specific genes and three housekeeping genes, exhibiting high correlation to validate this method for the investigation of intracellular pathogens.
[0105] Known virulence factors showed specific expression patterns during the three defined stages of Bp intracellular infection. For example, Bp uses its T3SS.sub.Bsa to escape the vacuole to gain entry into the host cell cytoplasm (Gong et al. (2011) PLoS One 6:e17852) and this was confirmed by the up-regulation of numerous type III secretion system genes during the vacuole stage of infection (e.g., BPSS1539, BPSS1401, BPSS1620, BPSS1551, BPSS1544, BPSS1535, BPSS1616, BPSS1592, and BPSS1618). All type VI secretion systems present in the Bp genome (i.e., T6SS-1, T6SS-2, T6SS-3, T6SS-4, T6SS-5, and T6SS-6) were differentially expressed compared to Bp grown in vitro, indicating that they are important for maintenance of intracellular infection beyond the known function of host cell membrane fusion (Warawa & Woods (2005) FEMS Microbiol. Lett. 242:101-108; Toesca et al. (2014) Infect. Immun. 82:1436-1444; Schwarz et al. (2014) Infect. Immun. 82:1445-1452). While only portions of each type VI secretion system showed expression in the TRANSITome, including a lack of Hcp1 (BPSS1498) expression, it was posited that this was due to the limited temporal resolution. Other significant pathways including flagella and chemotaxis genes (BPSL0269, BPSL0275, BPSL0281, BPSL3309, BPSL3319, BPSL0860, BPSL0268, BPSL3299, BPSL3300, BPSL3302, BPSL3303, BPSL3305, BPSL3306, and BPSL3307), pilus and fimbriae genes (BPSS2187, BPSS2189, BPSS2190, BPSS0092, BPSS1895, BPSS0091, BPSS0120, BPSS1893, BPSS1899, BPSS1599, BPSS1600, BPSS1891, BPSS2028, BPSS3173, BPSS2193, BPSS1897, BPSS1593, and BPSS2198), aerobic metabolism genes (BPSL1220, BPSL1223, BPSL1214, BPSL1606, BPSL1221, BPSL1219, and BPSL1222) and anaerobic energy metabolism genes (BPSL2307, BPSL1604, BPSL2311, BPSL2310, BPSL2312, BPSL2313, and BPSS1158), phosphate transport genes (BPSL1360, BPSL1361, BPSL1362, BPSL1363, BPSL1364, and BPSS1566), and potential virulence factors (BPSS0769, BPSL1431, BPSS0746, BPSL1064, BPSL1176, BPSS2052, BPSL1903, BPSL1375, BPSL2264, BPSL0393, BPSL1411, BPSL1637, BPSL0803, BPSS1795, BPSS2341, BPSS1740, BPSS1728, and BPSS1741) showed significant differential regulation throughout the Bp TRANSITome highlighting their potential importance during infection. Notably there were many genes of unknown functions were differentially regulated throughout the Bp TRANSITome.
[0106] TRANSITome Reveals Uncharacterized Virulence Factors. The Bp TRANSITome is composed of approximately 30% of genes annotated as hypothetical or putative, having no assigned function. These genes were investigated for their contribution to Bp intracellular infection. Specifically, 206 genes were targeted for knockout and 191 in-frame deletional mutants of were successfully created for the genes showing distinct expression patterns during the Bp intracellular lifecycle. To assess their role in intracellular infection, these hypothetical/putative genes were deleted in the naturally competent prototype strain Bp 1026b using -red recombineering (Kang et al. (2011) Nat. Protoc. 6:1085-1104). Of the hypothetical genes that showed stage-specific expression, approximately 100 genes showed high expression in the vesicular stage of infection, while approximately 55 genes showed up-regulation during cytoplasmic replication, and approximately 74 genes were highly expressed during the process of spreading by protrusion towards neighboring cells. The stage-specific expression of these hypothetical proteins indicates that they contribute to different processes during intracellular infection.
[0107] The 191 mutants were screened with a qualitative cell fusion assay in RAW264.7 murine macrophages, identifying 11 mutants that showed reduced cell fusion compared to wild-type Bp. Seven of the attenuated mutants were in genes up-regulated during the vacuole stage of infection (i.e., BPSL0097, BPSL0636, BPSL1126, BPSL1390, BPSL2714, BPSS1265, and BPSS1780), two mutants in genes highly expressed in the cytoplasm (i.e., BPSL1422 and BPSS1818), and two highly expressed during the protrusion stage of infection (i.e., BPSS0015 and BPSS1860). Of these 11 genes, four, i.e., BPSL0097, BPSL0636, BPSL1126, and BPSL1422, have not been identified in the literature while seven have had some reference. BpeT and BpeS, regulators of the RND efflux pump BpeEF-OprC, responsible for co-trimoxizole resistance, also control expression of BPSL1390, BPSL2714 and BPSS1780 are co-expressed with 165 other genes under similar conditions. In addition, a homolog of BPSS1780 was detected in purified outer membrane fractions from B. mallei (Schell, et al. (2011) J. Proteome Res. 10:2417-2424). BPSS0015 is expressed in early stationary phase culture of Bp, but further characterization of the function of this protein has not been carried out (Wongtrakoongate, et al. (2011) J. Biomed. Biotechnol. 2011:530926-530926). BPSS1265 was one of forty-nine genes deleted during clinical treatment of melioidosis but no characterization of the function of this gene was undertaken (Chantratita et al. (2011) Proc. Natl. Acad. Sci. USA 108:17165-17170). BPSS1818 was down-regulated in a N-acylhomoserine lactone synthase mutant strain of Bp indicating that it is potentially tied to quorum sensing regulation (Ooi et al. (2013) PLoS Genet. 9:e1003795). BPSS1860 has been previously identified as part of the Bp core secretome suggesting an extracellular function (Vander Broek et al. (2015) Mol. Cell Proteomics 14:905-916). All references to these genes were peripheral suggesting a more in-depth study should be undertaken. Therefore, a detailed functional characterization of all 11 genes identified through the Bp TRANSITome was undertaken.
[0108] The involvement of these hypothetical proteins during the course of host cell infection was assessed via a quantitative attachment and invasion (Table 3), and intracellular replication (Table 4) assays.
TABLE-US-00003 TABLE 3 Attachment Frequency.sup.1 Invasion frequency.sup.1 Gene ID (P value).sup.2 (P value).sup.2 BPSL0097 5 3 (0.0070) 55 10 (0.1145) BPSL0636 60 18 (0.2046) 25 10 (0.0285) BPSL1126 41 8 (0.0432) 90 15 (0.7096) BPSL1390 29 5 (0.0204) 285 100 (0.1435) BPSL1422 33 6 (0.0260) 40 10 (0.0550) BPSL2714 44 6 (0.0431) 70 5 (0.2193) BPSS0015 52 22 (0.1740) 45 9 (0.0651) BPSS1265 122 3 (0.3113) 150 9 (0.0835) BPSS1780 35 10 (0.0372) 100 36 (1.000) BPSS1818 46 4 (0.0451) 165 48 (0.2810) BPSS1860 10 2 (0.0084) 110 20 (0.7415) .sup.1Values represent mean percent of wildtype Bp 1026b attachment, invasion, or intracellular replication at specified times plus or minus the standard error mean. .sup.2Unpaired t test (two-sided) comparing each mutant to wildtype Bp 1026b. Significant values are bolded.
TABLE-US-00004 TABLE 4 Mutant intracellular replication.sup.1 (P value).sup.2 Gene ID 2 hpi 4 hpi 16 hpi 24 hpi BPSL0097 17 12 50 25 97 25 16 1 (0.0196) (0.2302) (0.9264) (<0.0001) BPSL0636 94 8 175 66 101 12 71 28 (0.7891) (0.3486) (0.9171) (0.3739) BPSL1126 37 5 0 0 93 9 108 6 (0.0290) (0.0161) (0,6915) (0.3340) BPSL1390 71 34 75 43 107 1 100 5 (0.4970) (0.6433) (0.5136) (0.9027) BPSL1422 25 2 25 25 69 14 95 7 (0.0153) (0.1012) (0.1586) (0.6401) BPSL2714 94 25 25 25 75 13 18 0 (0.8615) (0.1012) (0.2182) (<0.0001) BPSS0015 44 15 625 195 138 10 15 1 (0.0783) (0.0560) (0.0628) (<0.0001) BPSS1265 144 27 200 66 115 6 21 2 (0.2434) (0.2302) (0.3048) (0.0001) BPSS1780 196 25 275 50 132 34 17 1 (0.0366) (0.0352) (0.4235) (<0.0001) BPSS1818 85 14 150 87 114 16 16 1 (0.5401) (0.6087) (0.4997) (<0.0001) BPSS1860 79 8 200 25 82 13 23 2 (0.3475) (0.0474) (0.3657) (0.0001) .sup.1Values represent mean percent of wildtype Bp 1026b attachment, invasion, or intracellular replication at specified times plus or minus the standard error mean. .sup.2Unpaired t test (two-sided) comparing each mutant to wildtype Bp 1026b. Significant values are bolded.
[0109] The BPSL0097 and BPSS1860 mutants showed drastic decreases in attachment at five and ten percent of wild-type, respectively, while other mutants showed moderate defects in this process (Table 3). The BPSL0636 mutant was the only strain to show a significant defect in invasion with a 75 percent decrease compared to wild-type (Table 3). Six mutants, BPSL0097, BPSL1126, BPSL1390, BPSL1422, BPSL2714, and BPSS0015, showed defects in intracellular replication between 2 and 6 hours post-infection, ranging from 17-75 percent wild-type replication while eight mutants, BPSL0097, BPSL0636, BPSL2714, BPSS0015, BPSS1265, BPSS1780, BPSS1818, and BPSS1860, showed 15-71 percent wild-type replication at 24 hours post-infection (Table 4). Significant defects were observed at 24 hours post-infection for the BPSL0097, BPSL2714, BPSS0015, BPSS1265, BPSS1780, BPSS1818, and BPSS1860 mutants (Table 4). All 11 hypothetical genes have hundreds of orthologs in Burkholderia strains signifying that they have conserved functions. In vitro growth and complementation analyses showed that the defects during intracellular replication were not caused by reduced in vitro fitness or polar effect of these mutations, which validates these genes as virulence factors.
[0110] To further evaluate the roles of these genes in Bp pathogenesis, multiple established infection models were employed including HEK293T plaque formation, live cell imaging of RAW264.7 cell infection, and acute melioidosis infection in BALB/c mice (French et al. (2011) Proc. Natl. Acad. Sci. USA 108:12095-12100; Propst et al. (2010) Infect. Immun. 78:3136-3143). Five of the mutants, BPSL1126, BPSL1390, BPSL1422, BPSL2714, and BPSS1780, showed disease progression comparable to wild-type Bp, indicating that even though they showed attenuation in the cell infection models, these genes were not required for pathogenesis in vivo. The BPSS1265 mutant showed delayed morbidity with 60% survival of mice over the duration of the study, indicating that this gene could be important for acute infection but attenuation does not extend to chronic forms of murine melioidosis. The BPSL0636 mutant showed significant attenuation in cell culture, marked by a significant reduction in plaque diameter during infection of HEK293T cells (
[0111] Discovery of Two Attachment Proteins. Mutants of BPSL0097 and BPSS1860 showed an attenuated phenotype when tested in HEK293T cells (
[0112] To confirm the prediction that BPSL0097 and BPSS1860 are presented on the outer surface of Bp, complemented strains expressing hemagglutinin (HA) tagged fusion proteins (BPSL0097::BPSL0097-HA or BPSS1860::BPSS1860-HA) were generated. The HA-tagged fusion strains were stained positively, via immunofluorescence (IF) with an anti-HA antibody, confirming that these proteins are located on the surface of Bp. Because BPSL0097-HA appeared to be located on the periphery of the bacterium and exhibited higher fluorescence signals on the poles, immunogold labeling (IG) and transmission electron microscopy (TEM) was conducted to gain a better resolution of each protein's distribution on the bacterial surface. BPSL0097-HA showed localization limited to the poles of Bp, largely agreeing with the IF result. On the contrary, BPSS1860-HA showed an even distribution across the bacterial surface via IF and this was validated by IG TEM. Since these two surface proteins are required for full pathogenesis in vivo, their immunogenicity was further evaluated in clinical melioidosis via immunoblot against serum from patients with melioidosis. While BPSL0097 showed no reaction to patient sera, purified BPSS1860 was recognized specifically by pooled patient sera demonstrating its use as a diagnostic target. The lack of immunogenicity to BPSL0097 was likely due to low presentation on the bacterial cell surface, lack of immunogenic protein sequence, or a representation of the number of sera samples pooled (n=7). Taken together, the data presented here highlights the discovery of these attachment proteins, BPSL0097 and BPSS1860, as virulence factors independently required for the progression of Bp infection.
[0113] BPSS1818 Modulates Host Cell Tubulin. Highly expressed in the cytoplasm, a mutant of BPSS1818 also showed changes in phenotype during in vitro and in vivo infections. Specifically, fused RAW264.7 cells infected with the BPSS1818 mutant showed extended host cell cytoskeleton and distended MNGCs compared to wild-type Bp. In addition, RAW264.7 cells infected with the BPSS1818 mutant showed elongated microtubules with pronounced fibers when magnified. In vitro growth and complementation analyses showed that these defects were not caused by reduced in vitro fitness, secondary mutation, or polar effect, indicating that mutation of BPSS1818 was responsible for the observed phenotypes. The mutant of BPSS1818 was highly attenuated in RAW264.7 cells (Tables 3 and 4) as well as in HEK293T cells (
[0114] Bp Evades Autophagy Clearance via BPSS0015. The Bp TRANSITome revealed that the BPSS0015 gene was highly expressed in the protrusion stage during host cell infection, indicating its importance for later steps of the infection lifecycle. In vitro growth and complementation analyses showed that these defects were not caused by reduced in vitro fitness, secondary mutation, or polar effect, indicating that mutation in BPSS0015 was responsible for the observed phenotypes. A mutant of this gene showed a significant decrease in intracellular replication and plaque sizes in RAW264.7 and HEK293T cells (
[0115] Model of Bp Intracellular Pathogenesis. The intracellular TRANSITome of Bp was investigated. Thousands of known and unknown genes and pathways undergo dynamic gene-expression flux as Bp transits through distinct environmental niches in the host cells. The Bp TRANSITome led to the discovery of several virulence factors that are required for complete Bp pathogenesis. Comprehensive screens of 191 mutants and functional characterizations determined potential functions for some of these virulence factors during Bp infection of host cells. Based on the data presented, functions to four of these virulence factors were assigned: BPSL0097 and BPSS1860 are surface attachment proteins, BPSS1818 is a modulator of host cell tubulin, and BPSS0015 is a factor involved in evasion of host cell autophagy. These virulence determinants have the potential to be exploited as therapeutic targets and vaccines against melioidosis.
Example 2: Subunit Vaccines, Monoclonal Antibodies and Nanobodies
[0116] As described herein, two virulence factors, BPSL0097 (also referred to herein as surface attachment protein 1 or Sap1) and BPSS1860 (also referred to herein as surface attachment protein 2 or Sap2), were identified and characterized for their role in cellular infection. These proteins are surface antigens used for host-cell attachment (
[0117] Construct Optimization for BPSL0097 Expression. BPSL0097 (SEQ ID NO:4) is a membrane-associated protein with high GC content DNA sequence. To purify BPSL0097 in high quantity and purity, a number of modifications were tried and the following modifications were found to provide for ideal expression and purification. In particular, the DNA sequence encoding BPSL0097 was optimized for E. coli protein expression systems and set forth herein in SEQ ID NO:92; the signal peptide (MKRTGLFLALTGGIVAFSVAQA; SEQ ID NO:93) was excluded; and a minimum of three additional Alanines were added to the C-terminus of BPSL0097 for the final step of purification and successful cleavage from Intein-CBD protein. The sequence of the purified protein is set forth herein in SEQ ID NO:94.
[0118] BPSL0097-3Ala Protein Purification Protocol. pTXB1-BPSL0097-3Ala plasmid (SEQ ID NO:95) was isolated from strain E3264. This plasmid (200-300 ng) was transformed into chemical competent 5R2566/pLysS_RIPL (strain 53072) E. coli and cells were plated on LB+Ap100+Sp25+Ch125 (100 g/mL ampicillin, 25 g/mL streptomycin, and 25 g/mL chloramphenicol). After an overnight incubation at 37 C., 10-20 colonies were picked and inoculated into 4 mL LB+Ap100+Sp25+Ch125 liquid media. Cultures were allowed to grow to mid-log phase, OD.sub.6001.0, and a small amount of culture was added into one L pre-warmed LB medium with a proper concentration of antibiotics, LB+Ap100+Sp25+Ch125. The culture was incubated at 37 C. with agitation (225 rpm) until the culture reached OD.sub.600 0.6-0.7. Subsequently, the temperature was reduced to 20 C. and 0.25 mM IPTG (isopropyl -D-1-thiogalactopyranoside) was added once the culture reached OD.sub.600 0.8-0.9. After an 18-hour induction, cells were pelleted at 8300 rpm for 8 minutes at 4 C. and re-suspended in 30 mL column buffer+1 mM phenylmethylsulfonyl fluoride (PMSF)+0.2% TRITON X-100+(optional) 0.5 mM EDTA. The suspension was frozen at 80 C. and the cells were subjected to multiple cycles of freeze-and-thaw to lyse the cells. Sonication was also performed to facilitate cell lysis. DNaseI (10 g/mL) and MgCl.sub.2 (10 mM) were added to the lysed cells and the mixture was centrifuged at 27,000 rpm for 2 hours at 4 C. Approximately, 10 L of E. coli culture yielded approximately 10-11 mg of BPSL0097 protein. Protein was purified by column chromatography.
[0119] Construct Optimization for BPSS1860 Expression. BPSS1860 (SEQ ID NO:12) is a membrane-associated protein with high GC content DNA sequence. To purify soluble BPSS1860, a number of modifications were tried and the following modifications were found to provide for ideal expression and purification. In particular, the DNA sequence encoding BPSS1860 included its own ribosomal binding site and signal peptide (MKFNCIAATILAAVAADATA; SEQ ID NO:96) and is set forth herein in SEQ ID NO:97; and the 6His-2Gly tag was needed at the C-terminus of BPSS1860 for the final step of purification, utilizing immobilized metal (divalent nickel) affinity chromatography. The sequence of the purified protein is set forth herein in SEQ ID NO:98.
[0120] pMLBAD-BPSS1860-C-His6 Protein Purification Protocol. pMLBAD-BPSS1860-C-His6 plasmid (SEQ ID NO:99) was isolated from strain E3040. The plasmid (200-300 ng) was transformed into chemical competent E. coli strain E3072 and cells were plated on LB+Tp100+Sp25+Ch125. Cell culture and induction conditions were the same as those described for BPSL0097. After an 18-hour induction, cells were pelleted at 8300 rpm for 8 minutes at 4 C. and re-suspended in 120 mL column buffer+1 mM PMSF+0.5% TRITON X-100+0.1 mg/mL lysozyme. The suspension was frozen at 80 C. and the cells were subjected to multiple cycles of freeze-and-thaw to lyse the cells. Sonication was also performed to facilitate cell lysis. DNaseI (10 g/mL) and MgCl.sub.2 (10 mM) were added to the lysed cells and the mixture was centrifuged at 27,000 rpm for 2 hours at 4 C. Approximately, 1 L of E. coli culture yielded approximately 0.5 mg of BPSS1860 protein. Protein was purified by column chromatography.
[0121] Primary and Booster Vaccine Formulation. Vaccine formulations were prepared as provided in Table 5.
TABLE-US-00005 TABLE 5 Component Adjuvant Control Vaccine MPLA (1 mg/mL) 120 l 120 l Alum (10 mg/mL) 231 l 231 l BPSL0097-3xAla (8 mg/mL) 37.5 l BPSS1860-His (1.55 mg/mL) 193.5 l 1x PBS 349 l 128 l Total Volume 700 l 700 l MPLA, Monophosphoryl-Lipid A
[0122] The mixtures were pipetted up and down for 5 minutes to mix and allow the Alum to absorb antigens. Subsequently, 100 l of adjuvant control or vaccine were administered via i.p. to each mouse.
[0123] Generation of Antibodies. Monoclonal antibodies (mAbs) and nanobodies (Nbs) were created to assess the viability of Sap1/Sap2-based immunotherapies. First, one mAb against Sap1 (SR1 #140) and one mAb against Sap2 (SR2 #1) were generated and binding affinity was demonstrated via immunoblot, which showed specificity of each antibody toward its respective target. To evaluate their potential viability as an immunotherapy, the ability of each mAb to block Bp attachment to HEK293T cells was evaluated. Bp attachment was reduced by either mAb to less than 50% indicating the therapeutic potential of Sap1/Sap2-based immunotherapies (
[0124] Nbs are known for their small size, ease of purification, and ability to bind masked epitopes. Therefore, three Nbs targeting Sap1 and two Nbs targeting Sap2 were generated against purified Sap1 and Sap2 (Table 6). These Nbs were shown to bind to their respective targets with a high degree of specificity.
TABLE-US-00006 TABLE6 SEQID Nanobody Sequence NO: NbSap1_1F MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQA 100 GGSLRLSCEATGRTISSYAMGWFRQAPGKEREFVAA INLSSSSTSYADSVKGRFTISRDNAKNTVYLQMNSL KPEDTAVYTCADGSNWGQGTQVTVSS NbSap1_1H MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQA 101 GGSLRLSCAASGRTFSRYAMGWFRQAPGKEREFVAA ISTSGGNTGYADSVKGRFTISRDNAKNTVYYLEMTS LKPEDTAVYYCNARRSVGSMSASNFASWGQGTQVTV SS NbSap1_E12 MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQA 102 GGSLSLSCTASRRTFSSYALGWFRQAPGKEREFVAA ISWGGSTTHYADSVQGRFAISRDNAKNTVYYLQMNN LKPEDTAVYYCTNGAYWGQGTQVTVSS NbSap2_D7 MKYLLPTAAAGLLLLAAQPAMAQVQLQESGGGLVQA 103 GGSLRLSCAASGSRFRENAMGWYRQAPGKQRELVAS ITSGDSTVYADSVKGRFTISRHNANNTAYAYLQMNN LKAEDTAVYYCRHQGSHRYPTVFEYDYWGQGTQVTV SS NbSap2_F7 MAQVQLQESGGGSVQAGGSLRLSCAASGSIFRENAM 104 GWYRQAPGKQREFVADIASGGSTNYADSVKGRFAIS RDNAKNTVYYLQMNNLKAEDTAVYYCRHQGSYRRPT AYEYEYWGQGTQVTVSS CDRs are underlined
[0125] Subunit Vaccines. In addition to Sap1/Sap2-based immunotherapies, Sap1/Sap2-based subunit vaccines were developed. The vaccine composition containing equal concentrations of Sap1 and Sap2 proteins as well as Alum plus MPLA as an adjuvant were administered to BALB/c mice in a primary vaccination followed by a homologous booster two weeks later. Following the booster, mice were bled and sera tested for Sap1- or Sap2-specific IgG via ELISA. All vaccinated mice showed significant Sap1- and Sap2-specific IgG responses when compared to control mice (
[0126] To demonstrate the effectiveness of each protein alone as a subunit vaccine, mice were immunized with a Sap1 only subunit vaccine or a Sap2 only subunit vaccine. In particular, Balb/c mice were vaccinated with a Sap1 plus Sap2 vaccine, Sap1 only vaccine, Sap2 only vaccine, or adjuvant control. Antigen-specific IgG titers were determined via ELISA and it was observed that Balb/c mice showed robust IgG responses targeting Sap1 in both vaccine formulations. By comparison, control mice showed no response against Sap1.
[0127] Unlike most commercial clinical assays, positive standards are often unavailable at the beginning of an experimental immunization study or when anti-sera are raised against unknown substances. Endpoint titer allow for a quantitative analysis of an unknown sample using negative instead of positive standards. The endpoint titer of a sample is defined as the reciprocal of the highest dilution that gives a positive reaction. To determine whether a reaction is positive or negative, an absorbance cutoff value must be defined. Readings above the cutoff are considered positive while readings at or below the cutoff are negative.
[0128] Reciprocal endpoint titers showed a significant difference between Sap1-specific IgG in the control and both vaccine formulations (Sap1 plus Sap2, and Sap1 only) (
[0129] To demonstrate that the observed antibody response was not specific to Balb/c mice, C57Bl/6 mice were vaccinated with a Sap1 plus Sap2 vaccine, Sap1 only vaccine, Sap2 only vaccine, or adjuvant control and antigen specific (Sap1 or Sap2) IgG titers were determined via ELISA. C57Bl/6 mice also exhibited a robust IgG response targeting Sap1 in both vaccine formulations, whereas control mice showed no response against Sap1. Reciprocal endpoint titers showed a significant difference between Sap1-specific IgG in the control and both vaccine formulations (Sap1 plus Sap2, and Sap1 only)(
[0130] These results demonstrate the use of Sap1/Sap2-based subunit vaccines to induce an immune response against Bp thereby providing complete protection against lethal Bp challenge in the highly susceptible BALB/c model of murine melioidosis.
Example 3: Sap1 is Required for Pathogenesis of Burkholderia cepacia Complex Strains
Materials and Methods
[0131] Bacterial Strains, Plasmids, Cell Lines, and Growth Conditions. All strains and vectors used and generated in this study are listed in Tables 7 and 8.
TABLE-US-00007 TABLE 7 Strain Lab ID Genotype/Description Source Bcc B. cepacia LO6 P0754 Prototroph; cystic TomLin et al. fibrosis isolate (2001) Can. J. Microbiol. 47: 949-954 LO6 sap1 E4484 sap1::FRT-Tp.sup.r- This work pheS/attTn7::miniTn7- gat-rfp LO6 sap1/comp E4485 sap1::FRT-Tp.sup.r- This work pheS/attTn7::miniTn7- Cm-tel-gfp-sap1_L06 B. cenocepacia E1554 Prototroph; cystic P. Sokol K56-2 fibrosis isolate K56-2 sap1 E3237 sap1::FRT-Tp.sup.r- This work pheS/attTn7::miniTn7- gat-rfp K56-2 E4486 sap1::FRT-Tp.sup.r- This work sap1/comp pheS/attTn7::miniTn7- Cm-tel-gfp-sap1_K56 E. coli DH5 E0272 F-80dlacZM15 Lab collection (lacZYA-argF) U169 endA1 recA1 hsdR17 (rK mK+) supE44 thi-1 gyrA96 relA1 EP-Max10B- E1354 Kan.sup.r, Gm.sup.r, F.sup. .sup. mcrA Lab collection pir116 asd (mrr-hsdRMS-mcrBC) trp::Gm.sup.r mob- 80dlacZ M15 Kan.sup.r lacX74 deoR recA1 endA1 araD139 (ara, leu) 7697 galU galKrpsL nupG Tn- pir116-FRT2 asd::wFRT trp::Gm.sup.r-FRT5 mob[recA::RP4-2 Tc::Mu-Kan.sup.r] EP-Max10B-lacI.sup.q E1869 F.sup. .sup. mcrA (mrr- Lab collection pir hsdRMS-mcrBC) 80dlacZ M15 lacX74 deoR recAl endAl araD139 (ara, leu) 7697 galU galKrpsL nupG lacI.sup.q- FRT8 pir-FRT4 EP-Max10B- E2072 F.sup. .sup. mcrA (mrr- Lab collection dapA::Gm.sup.r- hsdRMS-mcrBC) lacI.sup.q-pir leu + 80dlacZ M15 mob-Kan.sup.r lacX74 deoR recA1 endA1 galU galKrpsL nupG dapA::lacI.sup.q- FRT8 pir-Gm.sup.r leu + mob[recA::RP4-2 Tc::Mu-Kan.sup.r]
TABLE-US-00008 TABLE 8 Plasmids Lab ID Relevant properties Source pRK2013 E0272 Kan.sup.r, helper plasmid Figurski & encoding conjugative Helinski (1979) proteins Proc. Natl. Acad. Sci. USA 76: 1648-1652 pPS854-FRT- E0855 Ap.sup.r; Cm.sup.r; plasmid with Lab collection Cm.sup.r Cm.sup.r-FRT-cassette pwFRT-P.sub.CS12- E1584 Tel.sup.r; P.sub.CS12-Tel.sup.r cassette Barrett, et al. Tel.sup.r flanked by wild-type (2008) FRT sequences Appl. Environ. Microbiol. 74: 4498-4508 mini-Tn7- E2462 GS.sup.r, mini-Tn7-gat Norris et al. gat-gfp harboring gfp (2009) mini-Tn7- E2326 GS.sup.r, mini-Tn7-gat Appl. Environ. gat-rfp harboring rfp Microbiol. 75: 6062-6075 mini-Tn7- E4487 Cm.sup.r; Tel.sup.r; mini-Tn7 This work Cm-tel-gfp- harboring gfp and K56 sap1_K56 sap1 mini-Tn7- E4488 Cm.sup.r; Tel.sup.r; mini-Tn7 This work Cm-tel-gfp- harboring gfp and LO6 sap1_LO6 sap1 pTNS3-asd.sub.Ec E2237 Suicidal helper plasmid Kang et al. containing E. coli asd (2009) and transposase for the Appl. Environ. Tn7 site-specific Microbiol. transposition system 75: 4015-4027 pKaKa5 E3217 Tet.sup.r; broad-host-range Heacock-Kang A-red helper plasmid et al. (2018) based on Tet resistance Sci. Rep. that also confers DNA 8: 12422 uptake pFRT1-Tp.sup.r- E2964 Tp.sup.r, Ap.sup.r, FRT1 flanked Barrett, et al. pheS Tp.sup.r-pheS cassette (2008) Appl. Environ. Microbiol. 74: 4498-4508
[0132] Bcc and E. coli were cultured using LB medium (Difco) or 1M9 minimal medium supplemented with 20 mM glucose, 500 M MgSO.sub.4, and 25 M CaCl.sub.2) (MG), and following additives when appropriate: trimethoprim (Tp; 100 g/mL for E. coli, 200 g/mL for K56-2, 300 g/mL for LO6), tetracycline (Tet; 10 g/mL for E. coli, 50 g/mL for K56-2, 150 g/mL for LO6), tellurite (Tel; 10 g/mL for E. coli, 125 g/mL for Bcc), chloramphenicol (Cm; 25 g/mL for E. coli, 150 g/mL for Bcc), glyphosate (GS; 0.1% v/v for E. coli, 0.4% v/v for Bcc), chlorinated phenylalanine (cPhe, 0.1% w/v), and diaminopimelic acid (DAP; 100 g/mL). Derivatives of E. coli strain EP-Max 10B (BioRad), E1869 and E1354 were routinely used for cloning or plasmid mobilization into Bcc as previously described (Kang et al. (2011) Nat. Protoc. 6:1085-1104; Norris et al. (2009) Appl. Environ. Microbiol. 75:6062-6075).
[0133] Human lung epithelial cell line A549 and murine macrophage cell line RAW264.7 were cultured in DMEM containing 4.5 g/L glucose with 4.0 mM L-glutamine (HyClone). All cultures were supplemented with 10% (v/v) heat-inactivated standard FBS (HyClone) and antibiotic/antimycotic solution (100 U/mL penicillin, 100 g/mL streptomycin, and 250 ng/mL amphotericin B; HyClone). Cells were maintained at 37 C. and 5% CO.sub.2 in a humidified incubator. Cell lines were maintained at 50-80% confluence at which point RAW264.7 macrophages were passaged using a cell scraper and A549 cells were passaged with 0.25% trypsin-EDTA (Gibson). Cell lines were maintained in CORNING flasks and plates with CELLBIND surfaces. Cell concentrations were determined using the Scepter handheld automated cell counter (Millipore).
[0134] General Molecular Methods. Oligonucleotides were synthesized through Integrated DNA Technology and are listed in Table 9. Ail molecular methods and their components utilized were employed as previously described (Kang et al. (2011) Nat. Protoc. 6:1085-1104).
TABLE-US-00009 TABLE9 SEQID OligoID;Oligoname Sequence(5.fwdarw.3) NO: 876;TN7L ATTAGCTTACGACGCTACACCC 105 3093;V_C0817pheS-gat GATCCACAGCGCAACGGCCCGGCATG 106 dw CGCCGGGCCGTGATCGGTTCAGCTGG CACGACAG 3094;V_C0817pheS-gat AAACACATAGCTAACCCAGCCTGGTG 107 up CCCGCAAGCCTGGAGACAGGGCGATT AAGTTGGG 3095;V_C0817pheS-M13 TGCGCGATCCACAGC 108 dwEND 3096;V_C0817pheS-gat TCACCTTTAAACACATAGCTAAC 109 upEND 3097;V_C0817pheS-gat GCATTCGGTTCGGTCGG 110 dwscreen 3098;V_C0817pheS-gat TGTGCTTGCTATCGTTTACCG 111 upscreen 3099;glmS1BcK56-2 GTGTGAAACCACTTCGTCTTG 112 3100;glmS2BcK56-2 GAAGATCGTGCTCGGCGAAATG 113 3101;glmS3BcK56-2 TTCCTGCGTTCGGTGCCAGTCG 114 3102;glmS4BcK56-2 CCGAGCTGCTGAAGAACACC 115 3166;BamHIV_C0817 TATATGGATCCGCGGGAATGGACG 116 miniTn7 3167;PstIV_C0817 ATATCTGCAGTGGAATCGTTTCGGAT 117 miniTn7 G 3169;LO6PstIV_C0817 ATATCTGCAGCGATAAATTCATATCG 118 miniTn7 TTTCGGC 3170;LO6BamHI TATATGGATCCGCGCGTTACTGCTTG 119 V_C0817miniTn7 AT 3214;HindIIIV_C0817 ATATAAGCTTGGAATCGTTTCGGATG 120 mT7gRFP 3215;SpeIV_C0817 TATATACTAGTCGCGGGAATGGACG 121 mT7gRFP 3216;LO6HindIII ATATAAGCTTCGATAAATTCATATCG 122 V_C0817mT7gRFP TTTCGGC 3217;LO6SpeIV_C0817 TATATACTAGTCGCGCGTTACTGCTT 123 mT7gRFP GAT 3297;KpnIV_C0817dn TATATGGTACCGCGGGAATGGACG 124 3298;KpnIV_C0817up ATATGGTACCTGGAATCGTTTCGGAT 125 G 3299;LO6KpnIV_C0817 TATATGGTACCGCGCGTTACTGCTTG 126 dn 3300;LO6KpnIV_C0817 ATATGGTACCGATAAATTCATATCGT 127 up TTCGGC 3499;LO6glmS1 GGTACCGACGTCGACAAGC 128 3500;LO6glmS2 CGACAAGCCGAGGAATCTGG 129 3501;LO6glmS3 GCTGCTCGCGTATCACACC 130
[0135] Construction of Mutant and Complementation Strains. Bcc strains K56-2 and LO6 were mutated using -RED recombineering (Heacock-Kang et al. (2018) Sci. Rep. 8:12422; Kang et al. (2011) Nat. Protoc. 6:1085-1104). Briefly, pKaKa5 was tri-parentally conjugated into each Bcc strain assisted by pRK2013 and selected on MG with appropriate concentrations of tetracycline. For mutant construction, pFRT-Tp-pheS was used as PCR template with oligos 3093-3096 and 1 g of the product was co-incubated with Bcc strains containing pKaKa5 at room temperature for 30 minutes. The co-incubation mixture was recovered in 4 mL of LB for 4 hours shaking at 225 rpm, after which the culture was harvested and plated on LB+Tp200 (K56-2) or LB+Tp300 (LO6). Resulting colonies were purified on their respective media and screened for proper deletion via PCR. Verified mutants were tagged using the mini-Tn7-gat-rfp plasmid as described (Norris et al. (2010) Appl. Environ. Microbial. 76:7635-7640). Successful integrations were verified with PCR of the four glmS sites and fluorescent microscopy.
[0136] Complementation also used the mini-Tn7 based integration method (Norris et al. (2010) Appl. Environ. Microbial. 76:7635-7640; Kang et al. (2009) Appl. Environ. Microbial. 75:4015-4027). Briefly, Bcc genomic DNA was used as template for PCR with respective primers (3297-3300) to amplify the sap1 gene, as well as introducing KpnI digestion sites on either side to be cloned into mini-Tn7-gat-gfp linearized by KpnI. The resulting plasmids, mini-Tn7-gat-gfp-sap1_K56 and mini-Tn7-gat-gfp-sap1_LO6, were then digested with PstI and XhoI to replace the gat gene with a tellurite resistance cassette to differentiate strains in competition assays. Additionally, a Cm.sup.r cassette was cloned in by BspHI and BglII digestion of pPS854-ERT-Cm.sup.r. Restriction digest verified plasmid size and orientation. Genomic integration of the complementation vectors mini-Tn7-Cm-tel-gfp-sap1_K56 and mini-Tn7-Cm-tel-gfp-sap1_LO6 was done as previously described (Norris et al. (2010) Appl. Environ. Microbiol. 76:7635-7640) and verified by PCR and florescent microscopy.
[0137] Growth Characterization of Mutants and Complementation Strains. Wild-type, mutant, and complement strains were grown to stationary phase, sub-cultured 1:200 into 250 mL of LB in a 500 mL flask and grown at 37 C. and 225 rpm. Aliquots of 250 L were pulled at designated times, added to 750 L ddH.sub.2O in cuvettes, and absorbance was read via spectrophotometer at 600 nm.
[0138] Attachment Assays. The attachment assay was carried out by dilution of bacterial strains in PBS and plated on LB. Colonies were counted to determine the number of colony forming units (CFU) used to initiate the infection and calculate attachment efficiencies. The dilutions were used to infect the cell cultures in 24-well CELLBIND plates at an MOT of 10:1. After 30 minutes, the bacteria-containing medium was removed and the monolayers were washed 3 times with pre-warmed PBS. Monolayers were lysed with 0.2% TRITON X-100 in PBS, diluted, plated onto LB and incubated at 37 C. for 48 hours. Colonies were enumerated and attachment efficiency was determined by dividing the attached number by the initial number of bacteria. The experiment was carried out in triplicate, normalized to each wild-type control, and the numbers represent the average of all three replicates with the error bars representing the standard errors of the mean (s.e.m.). An unpaired t-test was used to determine the significance of attachment efficiencies between the wild-type, mutants, and complements.
[0139] Biofilm Crystal Violet Assay. Quantification of biofilm production was performed as previously described with modifications (Merritt et al. (2005) John Wiley & Sons, Inc.; O'Toole (2011) J. Visual. Exp. 2437). Briefly, bacterial strains were grown to late-log, sub-cultured at 1:200, and 125 L dispensed into Costar SEROCLUSTER 96-well microtiter plates (CORNING) with each strain being replicated ten times. Sterile media served as a negative control. The outside perimeter of the 96-well plates was filled with ddH.sub.2O to minimize evaporation from wells. After 18 hours, wells were rinsed with ddH.sub.2O and patted dry. At this point, half of the wells were filled with 150 L of 1% (w/v) crystal violet for 15 minutes, rinsed, and allowed to air dry. The other wells were filled with 150 L of 0.1% (w/v) SDS resuspension mixture and mixed via repeated pipetting and scraping of the sides. The resulting resuspensions were then serially diluted and plated on LB to enumerate CFUs. The crystal violet-stained wells were solubilized with 200 L of a modified biofilm dissolving solution of 80% ethanol+10% SDS (w/v), and 150 L transferred to a flat-bottomed 96-well microtiter plate and read for absorbance at 550 nm (Tram et al. (2013) Adv. Microbiol. 3(2):200-204). An unpaired t-test was used to determine the significance of differences in biomass and CFUs between the wild-type, mutants, and complements.
[0140] D. melanogaster in vivo Competition Study. D. melanogaster studies were performed as described previously with modifications (Castonguay-Vanier et al. (2011) PLoS ONE 5:e11467). Briefly, wild-type Oregon R flies were maintained on standard cornmeal sucrose medium. Mutant and complement strains were washed in a 5% sucrose+PBS solution and adjusted to a final 1:1 ratio totaling 2.510.sup.10 CFU/mL. From this, 150 L was added to Whatman filters atop 5 mL of 5% sucrose agar and allowed to dry at room temperature for 30 minutes. Twelve, 1- to 3-day old male flies were starved for 3 hours and added to each vial, with three vials for a total of 36 flies used per Bcc strain combination. As a control, the mixtures were also plated on 5% sucrose agar without flies to monitor the ratio over time. At two and four days post-inoculation, three flies from each vial were taken for CFU enumeration, with each vial's flies being treated separately. Serial dilutions of the fly homogenate were plated onto LB (CFU.sub.total) or LB with chloramphenicol and tellurite (CFU.sub.complement). CFU.sub.mutant was determined from the difference of CFU.sub.total and CFU.sub.complement the ratio of which to yields the in vivo competitive index (CI) (CFU.sub.mutant/CFU.sub.complement).
[0141] Imaging of the Gastrointestinal Tract and Crop. Additional flies from the above CI experiments were sacrificed; the crops and gastrointestinal tract (GI) were carefully removed under a dissection microscope and cured in PROLONG Gold Antifade reagent (Invitrogen) as previously described (Heacock-Kang et al. (2017) Mol. Microbiol. 106:976-985). A cover slip was placed over the organs and pressed flat to remove air bubbles and sealed with clear nail polish applied along the edges. After letting cure for 30 minutes, the slides were imaged using a Zeiss Observer D1 with AxioCam MRc5 and accompanying Axiovision 4.9.1 software.
[0142] C. elegans Survival Studies. Each bacterial strain was inoculated on three plates with nematode growth media (NGM) and allowed to grow as lawns for 36 hours; fifteen L4 age-synchronized C. elegans were added to each plate for a total of 45 worms for each Bcc strain (Tan et al. (1999) Proc. Natl. Acad. Sci. USA 96:2408-2413). E. coli OP50 was used as a food source as well as a negative control. Observations were recorded daily. The experiment was conducted twice with comparable results.
[0143] BALB/c Mice Infection Studies. Frozen aliquots of the strains were plated to determine accurate CFUs. Bacteria used for inoculations were washed in PBS, diluted to the desired concentration, and plated at the start of the study to accurately determine the number of CFUs used. Six-week-old female BALB/c mice were purchased from Jackson Laboratories. Before challenge, the mice were anesthetized by intraperitoneal injection of 100 mg/kg ketamine and 10 mg/kg xylazine. For the CI studies, 40 L of the 1:1 mutant/complement (710.sup.7 CFU/mouse) strain mixture was inoculated intratracheally using the BioLITE Intubation System (Braintree Scientific), with PBS as negative control. Five mice were used per group. The same 1:1 mixture was also plated for comparative CFU changes as a further control. After 3 or 5 days, mice were euthanized after which their lungs were harvested and homogenized in 5 mL PBS. Serial dilutions of the homogenate were plated onto LB (CFU.sub.total) or LB with chloramphenicol and tellurite (CFU.sub.complement). CFU.sub.mutant Was determined from the difference of CFU.sub.total and CFU.sub.complement the ratio of which to yields the in vivo CI (CFU.sub.mutant/CFU.sub.complement).
[0144] For survival studies, mice were inoculated via the intratracheal route with 310.sup.8 CFU/mouse with five mice used per strain. One mouse in LO6 sap1 group died during intubation and was censored from the experiment. Survival was monitored for 10 days, and moribund mice were euthanized according to predetermined criteria for end point. At the end of 10-day post-infection, surviving mice were euthanized, and the lungs, livers, and spleens were homogenized in 5 mL PBS for serial dilution and CFU enumeration.
Results and Discussion
[0145] Sap1 is Conserved in Burkholderia Species Including Bcc K56-2 and Bcc LO6. Sap1 (BPSL0097) is a Bp attachment factor that is expressed on the poles of the bacterial surface and required for complete pathogenesis. See Example 1. Within the Burkholderia species there are 627 orthologs of Sap1 (Burkholderia Ortholog Group BG002978) indicating a conserved function within the genus. Within the ortholog group, approximately 42% of the strains are within the Bcc, including B. cenocepacia K56-2 and B. cepacia LO6 isolated from CF patients. There is a high similarity between the Bp K96243, Bcc K56-2, and Bcc LO6 genetic loci of sap1. The surrounding genes are organized similarly with an acetyltransferase upstream (BSPL0096, RS04965, and RS04845) and a hypothetical protein downstream (BPSL0098, RS04975, and RS04855) of each sap1 homolog. There is conservation at the nucleotide level in this genetic region with 68% identity between Bp K96243 and both Bcc strains while there is 82.3% identity between Bcc strains. In addition, the Sap1 protein sequence is conserved between Bp K96243, Bcc K56-2, and Bcc LO6 strains. The Sap1 homologs in Bcc K56-2 (SEQ ID NO:8) and Bcc LO6 (SEQ ID NO:9) have 81.6% and 84.2% amino acid identity with Sap1 from Bp K96243 (SEQ ID NO:4), respectively, and 93% amino acid identity with each other.
[0146] While PSORTb3.0 analysis showed that Sap1 homologs have an unknown cellular localization (Winsor et al. (2008) Bioinformatics 24:2803-2804), the results presented in Example 1 indicate that Sap1 protein is exported and expressed on the bacterial surface. Sap1 export is likely through a standard Sec-dependent pathway indicated by the N-terminal signal peptide and predicted cleavage site between amino acids 22-23 (probability of 0.8729) in Bp K96243 Sap1 determined through SignalP 5.0 analysis (Almagro Armenteros et al. (2019) Nat. Biotechnol. 37:420-423). Bcc K56-2 and Bcc LO6 have similar predicted cleavage sites between amino acids 23-24 (probabilities of 0.9083 and 0.9444) indicating similar export. Approximately 46% of the amino acid changes between the Sap1 homologs is in the N-terminal signal peptide. Accordingly, when the signal peptide sequence is excluded, Bcc K56-2 and Bcc LO6 Sap1 homologs share 87% and 89.1% amino acid identity with Bp K96243 Sap1 and 95.7% amino acid identity with each other. Taken together, these observations indicate a conserved function of Sap1 across Burkholderia species.
[0147] Sap1 is Required for Biofilm Formation and Attachment to Host Cells. To investigate the role of Bcc Sap1 in attachment to non-living and living surfaces, deletional mutants of the sap1 gene were generated in Bcc strains K56-2 and LO6 using -RFD recombineering and corresponding complements were prepared using the mini-Tn7-based integration system. The sap1 mutants and complements showed no defects during in vitro growth when compared to the wild-type strains, K56-2 or LO6.
[0148] Since attachment is an important initial step in biofilm formation, a biofilm assay was used to determine whether the sap1 mutants were defective in biofilm formation. The K56-2 sap1 mutant was modestly reduced in its ability to form biofilm and the complement recovered this defect (
[0149] To further characterize the role of Bcc Sap1 on biological surfaces, the sap1 mutants were tested for their ability to attach to A549 human lung epithelial cells and RAW264.7 murine macrophage cells. The K56-2 sap1 mutant was able to attach to A549 and RAW264.7 cells at 13% and 22% of wild-type K56-2 level. Complementation of the K56-2 sap1 mutant rescued this defect indicating that Sap1 is involved in the attachment process. The LO6 sap1 mutant was also significantly defective in attachment to both cell lines. The LO6 sap1 mutant showed an attachment ability at 30% of wild-type LO6 to A549 cells and at 2% of wild-type LO6 to RAW264.7 cells. The complementation of the LO6 sap1 mutant restored its attachment ability to wild-type levels. The Sap1 protein is confirmed here to be essential for attachment of K56-2 and LO6 strains to different host cell types, indicating its significant role in this initial step of Bcc pathogenesis.
[0150] The sap1 Mutants are Less Competitive in D. melanogaster. Given the importance of the Sap1 protein in biofilm formation and host cell attachment, it was determined whether Sap1 is involved in in vivo fitness, colonization, and pathogenesis within invertebrate and vertebrate hosts. The D. melanogaster feeding model, a well-established invertebrate model useful in assessment of in vivo bacterial fitness, was used to determine if Sap1 is important for colonization of the fly crop (Sibley et al. (2008) PLoS Pathog. 4:e1000184; Castonguay-Vanier et al. (2011) PLoS ONE 5:e11467; Mulcahy et al. (2011) PLoS Pathog. 7:e1002299). Equal CFUs of each sap1 mutant and its corresponding complement strain were mixed for infection to determine the CI in D. melanogaster. The CI is the ratio of the mutant to its complement and is a metric representing the fitness of the sap1 mutant within a specific environment. A CI of less than one indicates that the mutant is less competitive than its complement strain. When grown together in LB medium, the K56-2 sap1 mutant and its complement strain had an average CI of 0.99 and 0.96 at two and four days post-infection (dpi), respectively, indicating no fitness difference in vitro. The K56-2 sap1 mutant and its complement strain had an average CI of 0.33 and 0.28 at two and four dpi in D. melanogaster, indicating a significant defect of the sap1 mutant in in vivo fitness compared to the complemented strain. This quantitative evidence was corroborated by qualitative fluorescent microscopy of fly crops showing that the gfp-tagged complement strain colonized at higher levels than the rfp-tagged sap1 mutant. A similar trend was observed with the LO6 strain. The LO6 sap1 mutant showed no defects in its ability to compete with its complement strain in vitro, with CIs of 1.01 and 1.05 at two and four dpi. At two dpi, the LO6 sap1 mutant and complement have a CI of 0.34, indicating that the complement out competed the mutant significantly. At four dpi, the CI was reduced to 0.17 further highlighting the defect of the LO6 sap1 mutant during in vivo colonization. This was confirmed qualitatively through visualization of the D. melanogaster crop showing a high proportion of the gfp-tagged complement strain compared to the rfp-tagged sap1 mutant. These results show that Sap1 is important for in vivo fitness of these two Bcc strains in the fly feeding model and facilitates colonization of the fly crop.
[0151] Sap1 is Required for Pathogenesis in vivo in C. elegans. It was subsequently determined whether defects in colonization mediated by sap1 are correlated with changes in Bcc virulence. To assess the importance of Sap1 in vivo, the K56-2 and LO6 sap1 mutants were tested in a C. elegans survival assay. C. elegans (n=45) were allowed to feed on lawns of the wild-type strains, sap1 mutants, or the complement strains and survival was monitored for 218 hours. The C. elegans feeding on the K56-2 wild-type strain had a gradual decrease in survival leading to 100% mortality at 192 hpi. The sap1 mutant showed a significant decrease in virulence, resulting in significantly less killing of C. elegans when compared to the wild-type K56-2 strain. Complementation restored virulence to wild-type levels. Similarly, the LO6 sap1 mutant was highly attenuated in C. elegans, and the complemented strain was restored to wild-type killing level. The wild-type LO6 strain was more virulent than the K56-2 strain and showed 100% mortality by 96 hpi, indicating some variation in pathogenesis between the two strains in this animal model. Taken together, the data indicate that Sap1 is a critical virulence factor for the pathogenesis of K56-2 and LO6 in vivo in C. elegans.
[0152] The LO6 sap1 Mutant is Attenuated in BALB/c Mice. Involvement of Sap1 in Bcc colonization and virulence in a more relevant vertebrate infection model (e.g., BALB/c mouse lung infection model) was subsequently determined. BALB/c mice were inoculated by intratracheal intubation to assay the CI of the sap1 mutant and its complement. In a pilot study, the K56-2 wild-type strain was not able to colonize the BALB/c lungs, and therefore was excluded from further examination. Inoculation was done with mixture of an equal amount of LO6 sap1 mutant and its complement, at a total inoculum of 710.sup.7 CFU/mouse. The CI at three dpi showed a five-fold decrease in fitness of the LO6 sap1 mutant with an average CI of 0.21. The CI was further reduced at day five-post infection to 0.1, translating to a 10-fold decrease in fitness. These data indicate that the complement was able to outcompete the sap1 mutant when colonizing the BALB/c lung.
[0153] Following the competitiveness assessment of the LO6 sap1 mutant, a survival study was then performed to determine if the LO6 sap1 mutant was attenuated. BALB/c mice were challenged by intratracheal intubation with an inoculum of 310.sup.8 CFU/mouse of the LO6 wild-type strain, the LO6 sap1 mutant, or its complement. Compared to the 710.sup.7 CFU/mouse in the CI study, the higher inoculum for the survival study was determined from a pilot study to induce mortality. Seventy-five percent of mice challenged with the LO6 sap1 mutant (n=4) survived the duration of the study. On the other hand, BALB/c mice challenged with the wild-type LO6 strain (n=5) or the sap1 complement (n=5) showed 20% and 40% survival, respectively. The lungs, livers, and spleens of the surviving mice were harvested to determine dissemination and bacterial burdens. Various levels of bacteria were recovered from all organs, except for the liver from one sapl mutant infected mouse. The lungs from the mice challenged with the LO6 wild-type and complement strain retained a bacterial load that was above or comparable to the initial inoculum. This indicated that LO6 was able to replicate and persist in the mouse lungs, while also disseminating to other organs. The LO6sap1 mutant colonized the lungs at a lower concentration than the LO6 wild-type and complement, indicating the involvement of Sap1 protein in Bcc attachment and initial colonization. However, even with the lower level of lung colonization, the LO6 sap1 mutant was able to disseminate to other organs at comparable levels to the wild-type and complement strains, suggesting that Sap1 is not critical for the subsequent dissemination process. Nonetheless, it is important to note that this reduction of the LO6 sap1 mutant in colonization in the mouse lungs led to lower virulence and fatality in BALB/c mice. Taken together, these data indicate that Sap1 is involved in Bcc colonization of BALB/c mouse lungs and required for complete pathogenesis.
Example 4: Live-Attenuated Vaccines
Materials and Methods
[0154] Bacterial Strains, Media and Culture Conditions. Bp strain 1026b was routinely grown in LB medium (Difco) or 1 M9 minimal medium supplemented with 20 mM glucose (MG) and with 0.3% glyphosate when appropriate.
[0155] Molecular Methods and Reagents. Molecular methods and reagents were used as described previously (Norris et al. (2011) Infect. Immun. 79:4010-4018; Kang et al. (2011) Nat. Protoc. 6:1085-1104; Norris et al. (2010) Appl. Environ. Microbiol. 76:7635-7640; Norris et al. (2009) Appl. Environ. Microbiol. 75:6062-6075. Mutants of genes BPSL0636, BPSS0015 and BPSS1818 were generated previously. Double mutant combinations were generated by using Flp recombinase to remove the glyphosate resistance gat-cassette, followed by PCR verification, and lambda red recombineering to generate the second deletion.
[0156] Animal Studies. BALB/c and C57BL/6 mice between four and six weeks of age were purchased from Charles River Laboratory. All vaccinations and challenges were administered via the intranasal (i.n.) inoculation route. Mice were anesthetized with a mixture of 100 mg ketamine and 10 mg xylazine/kg as described herein. Each mutant strain was used to vaccinate five mice per group with 4,500 CFU or 12,000 CFU for BALB/c and C57BL/6 mice, respectively. Primary vaccinations were carried out 30 or 60 days prior to challenge with wild-type Bp 1026b. Booster vaccinations were carried out 30 days prior to challenge. Vaccinated mice were challenged with 4,500 CFU (BALB/c) or 12,000 CFU (C57BL/6) of wild-type Bp 1026b. Animals were monitored for disease symptoms daily and euthanized at predetermined humane end points. Clinical scores are as follows: 1-questionable illness, 2-mild illness, 3-moderate but definitive illness, 4-severe illness-moribund (pre-determined humane end point), 5-found dead. Lungs, liver, and spleen of surviving mice were harvested, homogenized, serially diluted, and plated on LB and MG with glyphosate. Growth on LB represents total bacteria within each organ and MG represents any surviving mutant strain (gat+). Survival data was plotted using Prism software (GraphPad, La Jolla, CA) and statistical analysis carried out by Log-rank (Mantel-Cox) test.
Results and Discussion
[0157] Virulence factors BPSL0636, BPSS0015, and BPSS1818 encode a protein of unknown function, a protein involved in autophagy evasion, and a protein involved in host tubulin rearrangement, respectively. As demonstrated in Example 1, a mutant of BPSL0636 shows a 29% decrease in intracellular replication and 56% decrease in cell-to-cell spread at 24 hours when compared to wild-type Bp. A BPSS0015 mutant is able to replicate at or above wild-type levels during early stages of infection, but has an 85% decrease in intracellular replication and 38% decrease in cell-to-cell spread at 24 hours post infection. By comparison, BPSS1818 is involved in host cytoskeletal structure modifications, leading to an 84% decrease in intracellular replication and 46% decrease in cell-to-cell spread of the BPSS1818 mutant. Further, when BALB/c mice are infected with strains carrying a single mutation of BPSL0636, BPSS0015, or BPSS1818, all mice survived for 60 days, while BALB/c mice infected with an equivalent dose of the wild-type Bp 1026b are unable to survive beyond day five. Taken together, these data show that these virulence factors are differentially expressed during intracellular infection, important for intracellular survival, and single mutants of these virulence factors are attenuated in BALB/c mice. Accordingly, knockout mutants of these genes were tested for use as live-attenuated vaccines against Bp infection.
[0158] These virulence factors are highly conserved in Bp strains as well as other Burkholderia pathogens, including Bm and the B. cepacia complex (Bcc), the causative agents of glanders and cepacia syndrome, respectively (Table 10).
TABLE-US-00010 TABLE 10 Percent Amino Acid Identity Compared to Bp K96243 Genus species Strain BPSL0636 BPSS0015 BPSS1818 B. pseudomallei K96243 100 100 100 B. pseudomallei 1026b 100 100 100 B. pseudomallei MSHR487 100 100 100 B. pseudomallei MSHR503 100 100 99.54 B. pseudomallei NAU44A6 99.27 99.35 99.54 B. pseudomallei MSHR840 100 99.35 98.62 B. pseudomallei MSHR1655 99.27 100 99.54 B. pseudomallei MSHR87 99.27 100 99.54 B. mallei ATCC23344 0 100 0 B. mallei Ivan 100 100 0 B. mallei China 5 100 100 0 B. cenocepacia J2315 83.21 68.18 77.88 B. cenocepacia K56-2 83.21 68.18 77.88 B. cepacia LO6 83.21 68.83 79.26 B. multivorans ATCC 17616 83.94 65.58 77.42 B. vietnamiensis G4 83.21 69.48 78.34 B. ubonensis A21 82.48 66.23 78.34 B. oklahomensis C6786 91.97 87.01 95.39 B. thailandensis E264 95.62 94.07 97.24
[0159] Within the Burkholderia genus, BPSL0636, BPSS0015, and BPSS1818 have 652, 642, and 638 ortholog group members, respectively. Among a small set of Bp strains, conservation of all three proteins is observed with 98-100% amino acid identity (Table 10). BPSL0636 is present in Bm strains Ivan and China 5 at 100% identity and also showed strong conservation in Bcc and other pathogenic Burkholderia species (Table 10). BPSS1818 is absent in Bin but highly conserved in Bcc (77-80% amino acid identity) and other Burkholderia species (95-97% amino acid identity), indicating that it plays a role in the pathogenesis of multiple Burkholderia species (Table 10). The high level of conservation among a diverse group of pathogenic Burkholderia species indicates that these virulence factors have conserved function.
[0160] Vaccination with Virulence Factor Mutants Partially Protects Against Lethal Bp Challenge. To test the efficacies of these mutants as potential live-attenuated vaccines, BALB/c mice were used as a host in an infection model of melioidosis (Muller et al. (2012) Infect. Immun. 80:3247-3255). Using this model, unvaccinated mice infected with virulent wild-type Bp show signs of disease quickly, leading to 100% mortality within the first week post-infection (Norris et al. (2011) Infect. Immun. 79:4010-4018; Propst et al. (2010) Infect. Immun. 78:3136-3143). Groups of five mice were first vaccinated via the intranasal (i.n.) route with a single 4,500 CFU dose of each attenuated virulence factor mutant, as well as PBS as control, and monitored for 60 days. During these 60 days, vaccinated mice showed no significant sign of illness, comparable to PBS control mice. At day 60, mice were challenged (i.n.) with a lethal dose of wild-type Bp 1026b (4,500 CFU) and survival was monitored for 63 days. Within the first six days of challenge, control mice vaccinated with PBS showed signs of disease and were euthanized at predetermined humane end points. In contrast, the mice vaccinated with the BPSL0636 mutant showed 60% survival for the duration of the study, while 40% of the mice vaccinated with the BPSS0015 or BPSS1818 mutants survived the wild-type challenge. One mouse vaccinated with the BPSL0636 mutant showed a delay in mortality to day 22. All of the surviving mice were euthanized at the end of the study and their organs were harvested for bacterial burden determination. Of the surviving mice, some showed colonization of wild-type Bp in the lungs combined with dissemination to the liver and/or spleen . A single mouse vaccinated with the BPSL0636 mutant strain showed sterile immunity with no signs of infection in the lungs, liver, or spleen. Although mice vaccinated with the BPSL0636 mutant showed the highest rate of survival out of all strains tested and one mouse with sterile immunity, one surviving mouse did show persistence of the vaccine strain after 123 days. Mice vaccinated with the BPSS0015 and BPSS1818 mutant strains cleared the vaccination strain but did have residual wild-type Bp 1026b infection in the lungs, livers, and spleens.
[0161] Virulence Factor Double Mutants are Cleared and Give Partial Protection Against Lethal Bp Challenge. Double mutants of these virulence factors were generated in a Bp 1026b background, using X-Red recombineering to determine if they could be completely cleared from the host and maintain protection as potential live-attenuated vaccines against lethal wild-type pp infection. Mutants of all combinations of these virulence factors were made to fully evaluate the protective effect the mutants have on BALB/c mice. Three double mutant strains, BPSL0636/BPSS0015, BPSL0636/BPSS1818, and BPSS0015/BPSS1818, were used to vaccinate (i.n.) groups of five BALB/c mice 60 days prior to wild-type Bp challenge. Vaccinated mice were challenged (i.n.) with 4,500 CFU of wild-type Bp 1026b and monitored for 63 days. Control mice vaccinated with PBS showed signs of murine melioidosis and 100% mortality within the first week of infection, while 20-60% of mutant vaccinated mice were able to survive until the study was terminated. All double mutant strains were completely cleared from surviving mice indicating that the combined mutations reduced the persistence of these strains in the host. Mice vaccinated with the BPSL0636/BPSS0015 mutant showed the highest survival at 60% and one mouse with an extended survival to 22 days post-infection. Of the surviving mice vaccinated with the BPSL0636/BPSS0015 mutant, one showed sterile immunity while the others showed infection in the lungs, liver, and spleen. Mice vaccinated with the BPSL0636/BPSS1818 mutant showed 20% survival and the surviving mouse had 210.sup.7 CFU wild-type Bp 1026b in the spleen but had cleared the infection from the lungs and liver. Mice vaccinated with the BPSS0015/BPSS1818 mutant showed 40% survival (2 out of 5 survived), one surviving mouse with sterile immunity, and another with a persistent infection of wild-type Bp in the lungs, liver and spleen. The BPSS0015/BPSS1818 mutant strain also extended the survival of another mouse to 38 days post-infection . Creating mutants that were defective in two of the virulence factors allowed complete clearance of the mutant strains from the host, while maintaining various levels of protection against lethal Bp infection.
[0162] To further test these mutant strains as potential live-attenuated vaccines, the window between vaccination and challenge was shortened by 30 days to determine if this would impact their protective capabilities. As described above, groups of five BALB/c mice were vaccinated (i.n.) with BPSL0636/BPSS0015, BPSL0636/BPSS1818, or BPSS0015/BPSS18 double mutants and then challenged (i.n.) with wild-type Bp 30 days post-vaccination. As expected, BALB/c mice vaccinated with only PBS showed 100% mortality within the first 6 days post-infection. Interestingly, mice vaccinated with the BPSL0636/BPSS1818 mutant or the BPSS0015/BPSS1818 mutant also showed 100% mortality within the first week post-infection. However, BALB/c mice vaccinated with the BPSL0636/BPSS0015 double mutant showed 40% survival for the duration of the study and a mouse with an extended therapeutic window to day 62 post-infection. Both of the surviving mice cleared the BPSL0636/BPSS0015 double mutant. One surviving mouse showed complete clearance of wild-type Bp 1026b, while the other had infection in the lungs, liver and spleen. These data indicate that the BPSL0636/BPSS1818 and BPSS0015/BPSS1818 mutant strains are not as effective as live attenuated vaccines when challenged 30 days post-vaccination while the BPSL0636/BPSS0015 mutant was still able to provide protection.
[0163] The BPSL0636/BPSS0015 Mutant Protects BALB/c and C57BL/6 Mice Against Lethal Bp Challenge. To improve the BPSL0636/BPSS0015 mutant as a potential vaccine, a homologous booster immunization was added. Groups of five BALB/c mice were vaccinated (i.n.) with the BPSL0636/BPSS0015 mutant strain or PBS control and given an equivalent immunization 30 days later. Thirty-three days after the booster immunization, mice were challenged with a lethal dose of wild-type Bp 1026b (4,500 CPU) and monitored for 62 days. As expected, BALB/c mice vaccinated with PBS showed rapid disease progression with an average weight loss of 17% and worsening clinical symptoms post-challenge leading to 100% mortality two days post-challenge. In contrast, the BPSL0636/BPSS0015 mutant vaccinated mice lost an average of 7% body weight and only showed minor clinical symptoms post-challenge. Shortly after challenge, mice vaccinated with the BPSL0636/BPSS0015 mutant were able to recover lost weight and showed reduced clinical symptoms. One hundred percent of the BALB/c mice that were vaccinated and given a booster of the BPSL0636/BPSS0015 mutant strain were able to survive the entire length of the study (60 days) against a lethal Bp challenge. All surviving mice showed some level of persistence of wild-type Bp 1026b in the lungs, liver, and spleen but no detectable level of the BPSL0636/BPSS0015 mutant strain was present.
[0164] To validate the BPSL0636/BPSS0015 mutant strain as a live-attenuated vaccine, it was tested in another in vivo model. C57BL/6 mice have been widely used to study the pathogenesis of Bp, test attenuated vaccine strains, and are more resistant to Bp infection than BALB/c mice (Silva et al. (2013) Infect. Imrnun. 81:4626-4634; Khakhum et al. (2019) mSphere 4; Morici et al. (2019) Clin. Exp. Immunol. 196:178-188). Following the same schedule used for vaccine efficacy testing in BALB/c mice, C57BL/6 mice were vaccinated (i.n.) with the BPSL0636/BPSS0015 mutant strain and given a booster immunization 30 days later. BPSL0636/BPSS0015 mutant vaccinated mice and PBS vaccinated mice were challenged with a lethal dose of virulent Bp 1026b (12,000 CFU) and monitored for 62 days. As expected, C57BL/6 mice vaccinated with PBS showed an average of 14% body weight loss and rapidly increasing clinical symptoms within the first two days post-challenge. These factors led to 100% mortality of PBS vaccinated mice by day three post-challenge. All five C57BL/6 mice vaccinated with the BPSL0636/BPSS0015 mutant were protected from lethal challenge with virulent Bp for the duration of the study (60 days). Although all mice had some level of chronic wild-type Bp infection in the lungs, liver, and spleen, the BPSL0636/BPSS0015 mutant strain was cleared from the host, aligning with the results from the BALB/c challenge. No clinical symptoms were present in any of the BPSL0636/BPSS0015 mutant vaccinated C57BL/6 mice at the end of the study. Taken together, the protection provided by the BPSL0636/BPSS0015 mutant strain in two different mouse models extends the window of survival that could allow for antimicrobial treatment and supports the use of this mutant as a live-attenuated vaccine against melioidosis.