Sulfonylamide compounds as CDK2 inhibitors

11919904 ยท 2024-03-05

Assignee

Inventors

Cpc classification

International classification

Abstract

The present application provides sulfonyl amide compounds, which are inhibitors of cyclin-dependent kinase 2 (CDK2), as well as pharmaceutical compositions thereof, and methods of treating cancer using the same.

Claims

1. A compound of Formula (I): ##STR00054## or a pharmaceutically acceptable salt thereof, wherein: X is N or CR.sup.9; Y is N or CR.sup.10; R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted by 1, 2, 3, 4, 5, or 6 independently selected R.sup.4 substituents; R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B; Ring B is a 3-7 membered cycloalkyl ring which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-10 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, NHOR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)NR.sup.c4(OR.sup.a4), C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4, NR.sup.c4NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4, C(NR.sup.e4)R.sup.b4, C(NR.sup.e4)NR.sup.c4R.sup.d4, NR.sup.c4C(NR.sup.e4)NR.sup.c4R.sup.d4, NR.sup.c4C(NR.sup.e4)R.sup.b4, NR.sup.c4S(O)NR.sup.c4R.sup.d4, NR.sup.c4S(O)R.sup.b4, NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O)(NR.sup.e4)R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O)R.sup.b4, S(O)NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, S(O).sub.2NR.sup.c4R.sup.d4, OS(O)(NR.sup.e4)R.sup.b4, OS(O).sub.2R.sup.b4, S(O)(NR.sup.e4)R.sup.b4, SF.sub.5, P(O)R.sup.f4R.sup.g4, OP(O)(OR.sup.h4)(OR.sup.i4), P(O)(OR.sup.h4)(OR.sup.i4), and BR.sup.j4R.sup.k4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; or, any R.sup.c4 and R.sup.d4 attached to the same N atom, together with the N atom to which they are attached, form a 4-10 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; each R.sup.e4 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.f4 and R.sup.g4 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.h4 and R.sup.i4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.j4 and R.sup.k4 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy; or any R.sup.j4 and R.sup.k4 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; each R.sup.4A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a41, SR.sup.a41, NHOR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)NR.sup.c41(OR.sup.a41), C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, C(NR.sup.e41)R.sup.b41, C(NR.sup.e41)NR.sup.c41R.sup.d41, NR.sup.c41C(NR.sup.e41)NR.sup.c41R.sup.d41, NR.sup.c41C(NR.sup.e41)R.sup.b41, NR.sup.c41S(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O)R.sup.b41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O)(NR.sup.e41)R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O)R.sup.b41, S(O)NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, S(O).sub.2NR.sup.c41R.sup.d41, OS(O)(NR.sup.e41)R.sup.b41, OS(O).sub.2R.sup.b41, S(O)(NR.sup.e41)R.sup.b41, SF.sub.5, P(O)R.sup.f41R.sup.g41, OP(O)(OR.sup.h41)(OR.sup.i41), P(O)(OR.sup.h41)(OR.sup.i41), and BR.sup.j41R.sup.k41, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents; each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents; or, any R.sup.c41 and R.sup.d41 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents; each R.sup.b41 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents; each R.sup.e41 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.f41 and R.sup.g41 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.h41 and R.sup.i41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.j41 and R.sup.k41 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy; or any R.sup.j41 and R.sup.k41 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; each R.sup.4B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a42, SR.sup.a42, NHOR.sup.a42, C(O)R.sup.b42, C(O)NR.sup.c42R.sup.d42, C(O)NR.sup.c42(OR.sup.a42), C(O)OR.sup.a42, OC(O)R.sup.b42, OC(O)NR.sup.c42R.sup.d42, NR.sup.c42R.sup.d42, NR.sup.c42NR.sup.c42R.sup.d42, NR.sup.c42C(O)R.sup.b42, NR.sup.c42C(O)OR.sup.a42, NR.sup.e42C(O)NR.sup.e42R.sup.d42, C(NR.sup.e42)R.sup.b42, C(NR.sup.e42)NR.sup.c42R.sup.d42, NR.sup.c42C(NR.sup.e42)NR.sup.c42R.sup.d42, NR.sup.c42C(NR.sup.e42)R.sup.b42, NR.sup.c42S(O)NR.sup.c42R.sup.d42, NR.sup.e42S(O)R.sup.b42, NR.sup.c42S(O).sub.2R.sup.b42, NR.sup.c42S(O)(NR.sup.e42)R.sup.b42, NR.sup.c42S(O).sub.2NR.sup.c42R.sup.d42, S(O)R.sup.b42, S(O)NR.sup.c42R.sup.d42, S(O).sub.2R.sup.b42, S(O).sub.2NR.sup.c42R.sup.d42, OS(O)(NR.sup.e42)R.sup.b42, OS(O).sub.2R.sup.b42, S(O)(NR.sup.e42)R.sup.b42, SF.sub.5, P(O)R.sup.f42R.sup.g42, OP(O)(OR.sup.h42)(OR.sup.i42), P(O)(OR.sup.h42)(OR.sup.i42), and BR.sup.j42R.sup.k42, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.a42, R.sup.c42, and R.sup.d42 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; or, any R.sup.c42 and R.sup.d42 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.b42 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.e42 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.f42 and R.sup.g42 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.h42 and R.sup.i42 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.j42 and R.sup.k42 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy; or any R.sup.j42 and R.sup.k42 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; R.sup.5 is selected from H, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents; each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, NHOR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)NR.sup.c51(OR.sup.a51), C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, C(NR.sup.e51)R.sup.b51, C(NR.sup.e51)NR.sup.c51R.sup.d51, NR.sup.c51C(NR.sup.e51)NR.sup.c51R.sup.d51, NR.sup.c51C(NR.sup.e51)R.sup.b51, NR.sup.c51S(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O)R.sup.b51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O)(NR.sup.e51)R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O)R.sup.b51, S(O)NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, S(O).sub.2NR.sup.c51R.sup.d51, OS(O)(NR.sup.e51)R.sup.b51, OS(O).sub.2R.sup.b51, S(O)(NR.sup.e51)R.sup.b51, SF.sub.5, P(O)R.sup.f51R.sup.g51, OP(O)(OR.sup.h51)(OR.sup.i51), P(O)(OR.sup.h51)(OR.sup.i51), and BR.sup.j51R.sup.k51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents; each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents; or, any R.sup.c51 and R.sup.d51 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents; each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents; each R.sup.e51 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.f51 and R.sup.g51 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.h51 and R.sup.i51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.j51 and R.sup.k51 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy; or any R.sup.j51 and R.sup.k51 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; each R.sup.5B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a52, SR.sup.a52, NHOR.sup.a52, C(O)R.sup.b52, C(O)NR.sup.c52R.sup.d52, C(O)NR.sup.c52(OR.sup.a52), C(O)OR.sup.a52, OC(O)R.sup.b52, OC(O)NR.sup.c52R.sup.d52, NR.sup.c52R.sup.d52, NR.sup.c52NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52C(O)OR.sup.a52, NR.sup.c52C(O)NR.sup.c52R.sup.d52, C(NR.sup.e52)R.sup.b52, C(NR.sup.e52)NR.sup.c52R.sup.d52, NR.sup.c52C(NR.sup.e52)NR.sup.c52R.sup.d52, NR.sup.c52C(NR.sup.e52)R.sup.b52, NR.sup.c52S(O)NR.sup.c52R.sup.d52, NR.sup.c52S(O)R.sup.b52, NR.sup.c52S(O).sub.2R.sup.b52, NR.sup.c52S(O)(NR.sup.e52)R.sup.b52, NR.sup.c52S(O).sub.2NR.sup.c52R.sup.d52, S(O)R.sup.b52, S(O)NR.sup.c52R.sup.d52, S(O).sub.2R.sup.b52, S(O).sub.2NR.sup.c52R.sup.d52, OS(O)(NR.sup.e52)R.sup.b52, OS(O).sub.2R.sup.b52, S(O)(NR.sup.e52)R.sup.b52, SF.sub.5, P(O)R.sup.f52R.sup.g52, OP(O)(OR.sup.h52)(OR.sup.i52), P(O)(OR.sup.h52)(OR.sup.i52), and BR.sup.j52R.sup.k52, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; or, any R.sup.c52 and R.sup.d52 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.b52 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.e52 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.f52 and R.sup.g52 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.h52 and R.sup.i52 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.j52 and R.sup.k52 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy; or any R.sup.j52 and R.sup.k52 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; R.sup.6 is H, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, and C.sub.3-4 cycloalkyl; R.sup.7 and R.sup.8 are each independently selected from H, D, OH, NO.sub.2, CN, halo, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, cyano-C.sub.1-6 alkyl, HOC.sub.1-6 alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.3-4 cycloalkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkoxy, amino, C.sub.1-6 alkylamino, and di(C.sub.1-6 alkyl)amino; R.sup.9 and R.sup.10 are each independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a9, SR.sup.a9, NHOR.sup.a9, C(O)R.sup.b9, C(O)NR.sup.c9R.sup.d9, C(O)NR.sup.c9(OR.sup.a9), C(O)OR.sup.a9, OC(O)R.sup.b9, OC(O)NR.sup.c9R.sup.d9, NR.sup.c9R.sup.d9, NR.sup.c9NR.sup.c9R.sup.d9, NR.sup.c9C(O)R.sup.b9, NR.sup.c9C(O)OR.sup.a9, NR.sup.c9C(O)NR.sup.c9R.sup.d9, C(NR.sup.e9)R.sup.b9, C(NR.sup.e9)NR.sup.c9R.sup.d9, NR.sup.c9C(NR.sup.e9)NR.sup.c9R.sup.d9, NR.sup.c9C(NR.sup.e9)R.sup.b9, NR.sup.c9S(O)NR.sup.c9R.sup.d9, NR.sup.c9S(O)R.sup.b9, NR.sup.c9S(O).sub.2R.sup.b9, NR.sup.c9S(O)(NR.sup.e9)R.sup.b9, NR.sup.c9S(O).sub.2NR.sup.c9R.sup.d9, S(O)R.sup.b9, S(O)NR.sup.c9R.sup.d9, S(O).sub.2R.sup.b9, S(O).sub.2NR.sup.c9R.sup.d9, OS(O)(NR.sup.e9)R.sup.b9, OS(O).sub.2R.sup.b9, S(O)(NR.sup.e9)R.sup.b9, SF.sub.5, P(O)R.sup.f9R.sup.g9, OP(O)(OR.sup.h9)(OR.sup.i9), P(O)(OR.sup.h9)(OR.sup.i9), and BR.sup.j9R.sup.k9, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; R.sup.a9, R.sup.c9, and R.sup.d9 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; or, any R.sup.c9 and R.sup.d9 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.b9 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents; each R.sup.e9 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.f9 and R.sup.g9 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.h9 and R.sup.i9 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl; each R.sup.j9 and R.sup.k9 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy; or any R.sup.j9 and R.sup.k9 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; and each R.sup.G is independently selected from H, D, OH, NO.sub.2, CN, halo, C.sub.1-3 alkyl, C.sub.2-3 alkenyl, C.sub.2-3 alkynyl, C.sub.1-3 haloalkyl, cyano-C.sub.1-3 alkyl, HOC.sub.1-3 alkyl, C.sub.1-3 alkoxy-C.sub.1-3 alkyl, C.sub.3-7 cycloalkyl, C.sub.1-3 alkoxy, C.sub.1-3 haloalkoxy, amino, C.sub.1-3 alkylamino, di(C.sub.1-3 alkyl)amino, thio, C.sub.1-3 alkylthio, C.sub.1-3 alkylsulfinyl, C.sub.1-3 alkylsulfonyl, carbamyl, C.sub.1-3 alkylcarbamyl, di(C.sub.1-3 alkyl)carbamyl, carboxy, C.sub.1-3 alkylcarbonyl, C.sub.1-3 alkoxycarbonyl, C.sub.1-3 alkylcarbonyloxy, C.sub.1-3 alkylcarbonylamino, C.sub.1-3 alkoxycarbonylamino, C.sub.1-3 alkylaminocarbonyloxy, C.sub.1-3 alkylsulfonylamino, aminosulfonyl, C.sub.1-3 alkylaminosulfonyl, di(C.sub.1-3 alkyl)aminosulfonyl, aminosulfonylamino, C.sub.1-3 alkylaminosulfonylamino, di(C.sub.1-3 alkyl)aminosulfonylamino, aminocarbonylamino, C.sub.1-3 alkylaminocarbonylamino, and di(C.sub.1-3 alkyl)aminocarbonylamino.

2. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted by 1, 2, or 3 independently selected R.sup.4 substituents.

3. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.1 is selected from C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, and C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, each of which is optionally substituted by 1 or 2 independently selected R.sup.4 substituents.

4. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: each R.sup.4 is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4, NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4; each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and each R.sup.b4 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

5. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: each R.sup.4 is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a4, and NR.sup.c4R.sup.d4; and each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

6. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.6 is H.

7. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, OH, CN, halo, C.sub.1-3 alkyl, and C.sub.1-3 haloalkyl.

8. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H and halo.

9. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.7 is H or halo; and R.sup.8, R.sup.9, and R.sup.10 are each H.

10. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents.

11. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, and 4-7 membered heterocycloalkyl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents.

12. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51S(O).sub.2R.sup.b51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51; each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

13. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: each R.sup.5A is independently selected from H, D, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a51, NR.sup.c51R.sup.d51; and each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

14. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein each R.sup.5A is independently selected from D, C.sub.1-6 alkyl, OR.sup.a51, and NR.sup.c51R.sup.d51; and each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H and C.sub.1-6 alkyl.

15. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: X is N or CR.sup.9; Y is N or CR.sup.10; R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl, each of which is optionally substituted by 1 or 2 independently selected R.sup.4 substituents; R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B; Ring B is a 3-7 membered cycloalkyl ring; each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4, NR.sup.c4S(O).sub.2R.sup.b4,NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents; each R.sup.4A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d41; each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; each R.sup.b41 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents; each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51; each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; R.sup.6 is H; and R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, OH, CN, halo, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

16. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: X is N or CR.sup.9; Y is N or CR.sup.10; R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl, each of which is optionally substituted 1 or 2 independently selected R.sup.4 substituents; R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B; Ring B is a 3-7 membered cycloalkyl ring; each R.sup.4 is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a4, and NR.sup.c4R.sup.d4; each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents; each R.sup.5A is independently selected from H, D, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a51, and NR.sup.c51R.sup.d51; each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; R.sup.6 is H; and R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, CN, halo, C.sub.1-3 alkyl, and C.sub.1-3 haloalkyl.

17. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein: X is N or CR.sup.9; Y is N or CR.sup.10; R.sup.1 is C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl or C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, each of which is optionally substituted by 1 or 2 independently selected R.sup.4 substituents; R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B; Ring B is a 3-4 membered cycloalkyl ring; each R.sup.4 is independently selected from H, halo, CN, OH, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, and C.sub.1-4 alkoxy; each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, and monocyclic 4-6 membered heterocycloalkyl having one nitrogen ring member; each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents; R.sup.5A is independently selected from D, C.sub.1-6 alkyl, OR.sub.a51, and NR.sup.c51R.sup.d51; each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H and C.sub.1-6 alkyl; R.sup.6 is H; and R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, F, and Cl.

18. The compound of claim 1, wherein ring B is cyclopropyl, cyclobutyl, or cyclopentyl.

19. Compound of claim 1, having Formula (III): ##STR00055## or a pharmaceutically acceptable salt thereof.

20. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein compound of Formula (IIIa): ##STR00056## or a pharmaceutically acceptable salt thereof.

21. The compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein R.sup.7 is H or halo; and R.sup.8 is H.

22. The compound of claim 1, selected from: 4-((7-((cis)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide; N-methyl-4-((7-((trans)-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)benzenesulfonamide; 4-((7-((cis)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(3-methylazetidin-3-yl)benzenesulfonamide; and (R)N-methyl-4-((6-oxo-7-(1,1,1-trifluorobutan-2-yl)-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)benzenesulfonamide; or a pharmaceutically acceptable salt thereof.

23. The compound of claim 1, selected from: 4-((7-(2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N((R)-1-methylpiperidin-3-yl) benzenesulfonamide; 4-((7-((1R,3R)-3-hydroxycyclohexyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzene sulfonamide; 4-((7-((1R,3R)-3-hydroxycyclohexyl)-6-oxo-6,7-dihydrospiro[cyclopro pane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d.sub.3)benzenesulfonamide; (S)-4-((7-(1-cyclopropylethyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d.sub.3)benzenesulfonamide; 4-((7-((trans)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d.sub.3)benzene sulfonamide; 4-((7-(2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(2-hydroxy-2-methylpropyl)benzenesulfonamide; 3-fluoro-4-((7-((trans)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide; 4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(2-(dimethylamino)ethyl)benzenesulfonamide; 4-((7-(7-chloro-1,2,3,4-tetrahydroisoquinolin-6-yl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide; 4-((7-(5-fluoro-2-methylphenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide; and 4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide; or a pharmaceutically acceptable salt thereof.

24. A pharmaceutical composition comprising the compound of claim 1, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.

25. A method of inhibiting CDK2, comprising contacting the CDK2 with the compound of claim 1, or a pharmaceutically acceptable salt thereof.

26. A method of inhibiting CDK2 in a patient, comprising administering to the patient the compound of claim 1, or a pharmaceutically acceptable salt thereof.

27. A method of treating a disease or disorder associated with CDK2 in a patient, comprising administering to the patient a therapeutically effective amount of the compound of claim 1, or a pharmaceutically acceptable salt thereof.

28. A method of treating a disease or disorder associated with CDK2 in a patient, comprising administering to the patient a therapeutically effective amount of the compound of claim 1, or pharmaceutically acceptable salt thereof, wherein the disease or disorder is associated with an amplification of the cyclin E1 (CCNE1) gene and/or overexpression of CCNE1.

29. A method of treating a human subject having a disease or disorder associated with cyclin-dependent kinase 2 (CDK2), comprising administering to the human subject a compound of claim 1, or a pharmaceutically acceptable salt thereof, wherein the human subject has been previously determined to: (i) (a) have a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1; and/or (b) have a cyclin dependent kinase inhibitor 2A (CDKN2A) gene lacking one or more inactivating nucleic acid substitutions and/or deletions; (ii) (a) have an amplification of the cyclin E1 (CCNE1) gene; and/or (b) have an expression level of CCNE1 in a biological sample obtained from the human subject that is higher than a control expression level of CCNE1.

30. A method of treating a human subject having a disease or disorder associated with cyclin-dependent kinase 2 (CDK2), comprising: (i) identifying, in a biological sample obtained from the human subject: (a) a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1; and/or (b) a cyclin dependent kinase inhibitor 2A (CDKN2A) gene lacking one or more inactivating nucleic acid substitutions and/or deletions; (ii) identifying, in a biological sample obtained from the human subject: (a) an amplification of the cyclin E1 (CCNE1) gene; and/or (b) an expression level of CCNE1 that is higher than a control expression level of CCNE1; and (iii) administering a compound of claim 1, or a pharmaceutically acceptable salt thereof, to the human subject.

31. The method of claim 30, comprising: (i) identifying, in a biological sample obtained from the human subject: (a) a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1; and/or (b) a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions; (ii) identifying, in a biological sample obtained from the human subject: (a) an amplification of the CCNE1 gene; and (iii) administering the compound or the salt to the human subject.

32. A method of evaluating the response of a human subject having a disease or disorder associated with cyclin-dependent kinase 2 (CDK2) to a compound of claim 1, or a pharmaceutically acceptable salt thereof, comprising: (a) administering the compound or the salt, to the human subject, wherein the human subject has been previously determined to have an amplification of the cyclin E1 (CCNE1) gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1; (b) measuring, in a biological sample of obtained from the subject subsequent to the administering of step (a), the level of retinoblastoma (Rb) protein phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, wherein a reduced level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, as compared to a control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, is indicative that the human subject responds to the compound or the salt.

33. The method of claim 27, wherein the disease or disorder is cancer.

34. The method of claim 33, wherein the cancer is selected from hematological cancer, sarcoma, carcinoma, genitourinary tract cancer, liver cancer, nervous system cancer, gynecological cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, metastatic cancer, renal cancer, prostate cancer, breast cancer, colon cancer, lung cancer, urothelial cancer, and gastrointestinal cancer.

35. The method of claim 33, wherein the cancer is selected from melanoma, cutaneous malignant melanoma, intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, endometrial cancer, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's disease, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, chronic leukemia, acute leukemia, acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally-induced cancer, asbestos-induced cancer, squamous cell head and neck cancer, cholangiocarcinoma, bile duct cancer, triple negative breast cancer, rhabdomyosarcoma, small cell lung cancer, leiomyosarcoma, hepatocellular carcinoma, Ewing's sarcoma, brain cancer, brain tumor, astrocytoma, neuroblastoma, neurofibroma, basal cell carcinoma, lung squamous cell carcinoma, lung adenocarcinoma, pancreatic adenocarcinoma, breast invasive carcinoma, uterine carcinosarcoma, ovarian serous cystadenocarcinoma, stomach adenocarcinoma, esophageal carcinoma, bladder urothelial carcinoma, chondrosarcoma, epithelioid sarcoma, eye cancer, fallopian tube cancer, gastrointestinal stromal tumors, hairy cell leukemia, intestinal cancer, islet cell cancer, oral cancer, mouth cancer, throat cancer, laryngeal cancer, lip cancer, mesothelioma, neck cancer, nasal cavity cancer, ocular cancer, ocular melanoma, pelvic cancer, rectal cancer, renal cell carcinoma, salivary gland cancer, sinus cancer, spinal cancer, tongue cancer, tubular carcinoma, urethral cancer, ureteral cancer, and cancers with high micro satellite instability (MSI.sup.high).

36. The method of claim 33, wherein the cancer is selected from ovarian cancer and breast cancer.

37. The method of claim 33, wherein the cancer is ovarian cancer.

38. The method of claim 33, wherein the cancer is breast cancer.

39. The method of claim 38, wherein the breast cancer is triple negative breast cancer.

40. The method of claim 33, wherein the cancer is uterine cancer.

41. The method of claim 33, wherein the cancer is endometrial cancer.

Description

DESCRIPTION OF DRAWINGS

(1) FIGS. 1A-1B: Characterization of ovarian and endometrial cell lines. FIG. 1A: Cell lines used for study included four cell lines with CCNE1 amplification and three cell lines with no CCNE1 amplification. CCNE1 amplification copy numbers are indicated. FIG. 1B: The expression of CCNE1 was determined by Western blot in indicated cell lines. This blot show cell lines with CCNE1 gain of function by copy number (CN>2) expressed higher levels of CCNE1 protein compared with cell lines with copy neutral or loss of function of the gene (CN2). GAPDH was detected as a loading control. Non-Amp, non-amplification; Amp, amplification.

(2) FIGS. 2A-2B: siRNA mediated CDK2 knockdown inhibits proliferation in CCNE1 amplified cell lines. FIG. 2A: CCNE1 amplified Fu-ovl (upper) and KLE (lower) cells were harvested and subjected to cell cycle analysis 72 hours after transfection with either scrambled siRNAs (Ctl) or CDK2 siRNAs. The cell cycle phase distribution was evaluated by FACS. Shown are representative images of three separate experiments. FIG. 2B: CDK2 knockdown was confirmed by Western blot analysis after transfection with CDK2 siRNA. GAPDH was used as a loading control.

(3) FIGS. 3A-3B: CDK2 knockdown does not inhibit proliferation in CCNE1 Non-Amp lines. FIG. 3A: CCNE1 non-amplified COV504 and Igrov1 cells were harvested and subjected to cell cycle analysis 72 hours after transfection with Ctl siRNAs and CDK2 siRNAs. The cell cycle phase distribution was evaluated by FACS. Shown are representative images of three separate experiments. FIG. 3B: CDK2 knockdown was confirmed by Western blot analysis after transfection with CDK2 siRNA. GAPDH was used as a loading control.

(4) FIG. 4: CDK2 knockdown by siRNA inhibits proliferation in CCNE1 amplified, but not in CCNE1 non-amplified, human cancer cell lines. Percentage of cells at the S phase 3 days after transfection of CDK2 siRNAs, relative to Ctl siRNA. The cell cycle phase distribution was evaluated by FACS. Means represent three independent experiments in four CCNE1 Amp cell lines and three Non-Amp lines.

(5) FIG. 5: Palbociclib treatment induces dose-dependent inhibition of proliferation in CCNE1 non-amplified, but not in amplified cell lines. Cell cycle analysis of CCNE1 non-amplified cell line COV504 (upper) and CCNE1 amplified OVCAR3 cells (lower) after Palbociclib treatment for 16 hours. The cell cycle phase distribution was evaluated by FACS.

(6) FIG. 6: Palbociclib treatment selectively inhibits proliferation in CCNE1 non-amplified cancer cell lines. Percentage of cells at the S phase after 16 hours of Palbociclib with the indicated doses, relative to DMSO.

(7) FIGS. 7A-7B: CDK2 knockdown by siRNAs blocks RB phosphorylation at S780 in CCNE1 amplified, but not in non-amplified ovarian cells. FIG. 7A: Four CCNE1 Amp cell lines, COV318, Fu-OV1, OVCAR3 and KLE cells, were transfected with CDK2 siRNAs for 72 hours. FIG. 7B: Three CCNE1 Non-Amp cell lines, COV504, OV56 and Igrov1, were transfected with CDK2 siRNAs for 72 hours. The total proteins were extracted from CDK2 siRNA or Ctl siRNA transfected cells and subjected to western blotting. GAPDH was used as a loading control.

(8) FIGS. 8A-8B: Palbociclib blocks RB phosphorylation at S780 in CCNE1 non-amplified, but not in amplified ovarian cells. FIG. 8A: CCNE1 Amp OVCAR3 and COV318 cells were treated at various concentrations of Palbociclib as indicated for 1 hour or 15 h. FIG. 8B: CCNE1 Non-Amp COV504 and OV56 were treated at various concentrations of Palbociclib as indicated for 1 hour or 15 h. The total proteins were extracted from these Palbociclib or DMSO (controls) treated cells and subjected to western blotting. p-RB, phosphorylated retinoblastoma protein. GAPDH was used as a loading control.

(9) FIGS. 9A-9B: CDK2 degradation by dTAG decreases RB phosphorylation at S780. FIG. 9A: Chemical structure of dTAG. FIG. 9B: CDK2-FKBP12(F36V) degradation by CDK2-dTAG treatment for 14 hours inhibited RB phosphorylation at S780 in CDK2 knockout OVCAR3 (right, Cas9+, CDK2-FKBP12(F36V)-HA+, CDK2-gRNA) cells, but not in OVCAR3 cells with endogenous CDK2 (left, Cas9+, CDK2-FKBP12(F36V)-HA+, Ctl-gRNA).

(10) FIGS. 10A-10B: p-RB S780 HTRF cellular Assay for identification of CDK2 inhibitors. FIG. 10A: IC.sub.50 in CDK2 biochemical kinase activity assay. FIG. 10B: Concentration response analysis of reference compounds tested in the p-RB S780 HTRF cellular assay. HTRF, homogeneous time-resolved fluorescence. IC.sub.50 from HTRF cellular Assay correlates with IC.sub.50 in CDK2 enzymatic assay.

(11) FIG. 11: Bioinformatics analysis of CCLE dataset reveals the sensitivity to CDK2 inhibition in CCNE1 amplified cells relies on functional p16. FIG. 11 shows the status of p16 in CDK2 sensitive verse insensitive cell lines. CCLE: Broad Institute Cancer Cell Line Encyclopedia (see Barretina, below).

(12) FIGS. 12A-12B: CCNE1 amplified cells with dysfunctional p16 do not respond to CDK2 inhibition. FIG. 12A: Western blot analysis of p16 in three gastric cell lines with CCNE1 Amp. FIG. 12B: Percentage of cells at the S phase 3 days after transfection of CDK2 siRNAs, relative to Ctl siRNA. The cell cycle phase distribution was evaluated by FACS.

(13) FIG. 13: p16 knockdown by siRNA abolishes CDK2 inhibition induced cell cycle suppression in CCNE1 amplified cells. The percentage of S phase cells following p16 knockdown and CDK2 inhibitor treatment, normalized to cell with Ctl siRNA and DMSO treatment. CCNE1 amplified COV318 cells were transfected with either Ctl siRNAs or p16 siRNA. 72 hours after transfection, cells were treated with 100 nM CDK2 inhibitor Compound A. Cells were harvested and subjected to cell cycle analysis 16 hours after treatment.

DETAILED DESCRIPTION

(14) Compounds

(15) The present application provides, inter alia, a compound of Formula (I):

(16) ##STR00002##
or a pharmaceutically acceptable salt thereof, wherein:

(17) X is N or CR.sup.9;

(18) Y is N or CR.sup.10;

(19) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted by 1, 2, 3, 4, 5, or 6 independently selected R.sup.4 substituents;

(20) R.sup.2 and R.sup.3 are each independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, wherein said C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl are each optionally substituted by 1, 2, 3, or 4 independently selected R.sup.G substituents;

(21) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(22) Ring B is a 3-7 membered cycloalkyl ring or a 4-7 membered heterocycloalkyl ring, each of which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.G substituents;

(23) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-10 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, NHOR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)NR.sup.c4(OR.sup.a4) C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4 NR.sup.c4NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4 NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4, C(NR.sup.c4)R.sup.b4, C(NR.sup.c4)NR.sup.c4R.sup.d4, NR.sup.c4C(NR.sup.c4)NR.sup.c4R.sup.d4 NR.sup.c4C(NR.sup.c4)R.sup.b4, NR.sup.c4S(O)NR.sup.c4R.sup.d4, NR.sup.c4S(O)R.sup.b4, NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O)(NR.sup.c4)R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O)R.sup.b4, S(O)NR.sup.c4R.sup.d4, S(O).sub.2R.sup.c4, S(O).sub.2NR.sup.c4R.sup.d4, OS(O)(NR.sup.c4)R.sup.b4, OS(O).sub.2R.sup.b4, S(O)(NR.sup.c4)R.sup.b4, SF.sub.5, P(O)R.sup.f4R.sup.g4, OP(O)(OR.sup.h4)(OR.sup.i4), P(O)(OR.sup.h4)(OR.sup.i4), and BR.sup.j4R.sup.k4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(24) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(25) or, any R.sup.c4 and R.sup.d4 attached to the same N atom, together with the N atom to which they are attached, form a 4-10 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(26) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(27) each R.sup.e4 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl;

(28) each R.sup.f4 and R.sup.g4 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl;

(29) each R.sup.h4 and R.sup.i4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl;

(30) each R.sup.j4 and R.sup.k4 is independently selected from OH, C.sub.1-6alkoxy, and C.sub.1-6 haloalkoxy;

(31) or any R.sup.j4 and R.sup.k4 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(32) each R.sup.4A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a41, SR.sup.a41, NHOR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)NR.sup.c41(OR.sup.a41), C(O)OR.sup.a41, OC(O)R.sup.b41 OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41 NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, C(NR.sup.e41)R.sup.b41, C(NR.sup.e41)NR.sup.c41R.sup.d41, NR.sup.c41C(NR.sup.e41)NR.sup.c41R.sup.d41, NR.sup.c41C(NR.sup.e41)R.sup.b41, NR.sup.c41S(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O)R.sup.b41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O)(NR.sup.c4)R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O)R.sup.b41, S(O)NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, S(O).sub.2NR.sup.c41R.sup.d41, OS(O)(NR.sup.e41)R.sup.b41, OS(O).sub.2R.sup.b41, S(O)(NR.sup.e41)R.sup.b41, SF.sub.5, P(O)R.sup.f41R.sup.g41, OP(O)(OR.sup.h41)(OR.sup.i41), P(O)(OR.sup.h41)(OR.sup.i41) and BR.sup.j41R.sup.k41, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(33) each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(34) or, any R.sup.c41 and R.sup.d41 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(35) each R.sup.b41 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(36) each R.sup.e41 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(37) each R.sup.f41 and R.sup.g41 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(38) each R.sup.h411 and R.sup.i41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(39) each R.sup.j41 and R.sup.k41 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy;

(40) or any R.sup.j41 and R.sup.k41 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(41) each R.sup.4B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a42, SR.sup.a42, NHOR.sup.a42, C(O)R.sup.b42, C(O)NR.sup.c42R.sup.d42, C(O)NR.sup.c42(OR.sup.a42), C(O)OR.sup.a42, OC(O)R.sup.b42, OC(O)NR.sup.c42R.sup.d42, NR.sup.c42R.sup.d42, NR.sup.c42NR.sup.c42R.sup.d42, NR.sup.c42C(O)R.sup.b42, NR.sup.c42C(O)OR.sup.a42, NR.sup.c42C(O)NR.sup.c2R.sup.d42, C(NR.sup.e42)R.sup.b42, C(NR.sup.e42)NR.sup.c42R.sup.d42, NR.sup.c42C(NR.sup.e42)NR.sup.c42R.sup.d42, NR.sup.c42C(NR.sup.e42)R.sup.b42, NR.sup.c42S(O)NR.sup.c42R.sup.d42, NR.sup.c42S(O)R.sup.b42, NR.sup.c42S(O).sub.2R.sup.b42, NR.sup.c42S(O)(NR.sup.e42)R.sup.b42, NR.sup.c42S(O).sub.2NR.sup.c42R.sup.d42, S(O)R.sup.b42, S(O)NR.sup.c42R.sup.d42, S(O).sub.2R.sup.b42, S(O).sub.2NR.sup.c42R.sup.d42, OS(O)(NR.sup.e42)R.sup.b42, OS(O).sub.2R.sup.b42, S(O)(NR.sup.e42)R.sup.b42, SF.sub.5, P(O)R.sup.f42R.sup.g42 OP(O)(OR.sup.h42)(OR.sup.i42), P(O)(OR.sup.h42)(OR.sup.i42) and BR.sup.j42R.sup.k42, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(42) each R.sup.a42, R.sup.c42, and R.sup.d42 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(43) or, any R.sup.c42 and R.sup.d42 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(44) each R.sup.b42 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(45) each R.sup.e42 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(46) each R.sup.f42 and R.sup.g42 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(47) each R.sup.h42 and R.sup.i42 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(48) each R.sup.j42 and R.sup.k42 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy;

(49) or any R.sup.j42 and R.sup.k42 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(50) R.sup.5 is selected from H, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-10 cycloalkyl, 6-10 membered aryl, 4-10 membered heterocycloalkyl, 5-10 membered heteroaryl, C.sub.3-10 cycloalkyl-C.sub.1-4 alkyl, 6-10 membered aryl-C.sub.1-4 alkyl, 4-10 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-10 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents;

(51) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, NHOR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)NR.sup.c51(OR.sup.a51), C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, C(NR.sup.e51)R.sup.b51, C(NR.sup.e51)NR.sup.c51R.sup.d51, NR.sup.c51C(NR.sup.e51)NR.sup.c51R.sup.d51, NR.sup.c51C(NR.sup.e51)R.sup.b51, NR.sup.c51S(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O)R.sup.b51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O)(NR.sup.e51)R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O)R.sup.b51, S(O)NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, S(O).sub.2NR.sup.c51R.sup.d51, OS(O)(NR.sup.e51)R.sup.b51, OS(O).sub.2R.sup.b51, S(O)(NR.sup.e51)R.sup.b51, SF.sub.5, P(O)R.sup.f51R.sup.g51, OP(O)(OR.sup.h51)(OR.sup.i51), P(O)(OR.sup.h51)(OR.sup.i51) and BR.sup.j51R.sup.k51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(52) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(53) or, any R.sup.c51 and R.sup.d51 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents; each R.sup.bsi is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(54) each R.sup.e51 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(55) each R.sup.f51 and R.sup.g51 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(56) each R.sup.h51 and R.sup.g51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(57) each R.sup.j51 and R.sup.k51 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy;

(58) or any R.sup.j51 and R.sup.k51 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(59) each R.sup.5B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a52, SR.sup.a52, NHOR.sup.a52, C(O)R.sup.b52, C(O)NR.sup.c52R.sup.d52, C(O)NR.sup.c52(OR.sup.a52), C(O)OR.sup.a52, OC(O)R.sup.b52 OC(O)NR.sup.c52R.sup.d52, NR.sup.e52R.sup.d52, NR.sup.c52NR.sup.c52R.sup.d52, NR.sup.e52C(O)R.sup.b52, NR.sup.e52C(O)OR.sup.a52, NR.sup.c52C(O)NR.sup.c52R.sup.d52, C(NR.sup.e52)R.sup.b52, C(NR.sup.e52)NR.sup.c52R.sup.d52, NR.sup.c52C(NR.sup.e52)NR.sup.c52R.sup.d52, NR.sup.c52C(NR.sup.e52)R.sup.b52, NR.sup.c52S(O)NR.sup.c52R.sup.d52, NR.sup.e52S(O)R.sup.b52, NR.sup.c52S(O).sub.2R.sup.b52, NR.sup.c52S(O)(NR.sup.e52)R.sup.b52, NR.sup.c52S(O).sub.2NR.sup.c52R.sup.d52, S(O)R.sup.b52, S(O)NR.sup.c52R.sup.d52, S(O).sub.2R.sup.b52, S(O).sub.2NR.sup.c52R.sup.d52, OS(O)(NR.sup.e52)R.sup.b52, OS(O).sub.2R.sup.b52, S(O)(NR.sup.e52)R.sup.b52, SF.sub.5, P(O)R.sup.f52R.sup.g52, OP(O)(OR.sup.h52)(OR.sup.i52), P(O)(OR.sup.h52)(OR.sup.i52), and BR.sup.j52R.sup.k52, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(60) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(61) or, any R.sup.c52 and R.sup.d52 attached to the same N atom, together with the N atom to which they are attached, form a 5 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(62) each R.sup.b52 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(63) each R.sup.e52 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(64) each R.sup.f52 and R.sup.g52 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(65) each R.sup.h52 and R.sup.i52 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(66) each R.sup.j52 and R.sup.k52 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy;

(67) or any R.sup.j52 and R.sup.k52 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(68) R.sup.6 is H, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, and C.sub.3-4 cycloalkyl;

(69) R.sup.7 and R.sup.8 are each independently selected from H, D, OH, NO.sub.2, CN, halo, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, cyano-C.sub.1-6 alkyl, HOC.sub.1-6 alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.3-4 cycloalkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkoxy, amino, C.sub.1-6 alkylamino, and di(C.sub.1-6 alkyl)amino;

(70) R.sup.9 and R.sup.10 are each independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a9, SR.sup.a9, NHOR.sup.a9, C(O)R.sup.b9, C(O)NR.sup.c9R.sup.d9, C(O)NR.sup.c9(OR.sup.a9), C(O)OR.sup.a9, OC(O)R.sup.b9, OC(O)NR.sup.c9R.sup.d9, NR.sup.c9R.sup.d9, NR.sup.c9NR.sup.c9R.sup.d9, NR.sup.c9C(O)R.sup.b9, NR.sup.c9C(O)OR.sup.a9, NR.sup.c9C(O)NR.sup.c9R.sup.d9, C(NR.sup.e9)R.sup.b9, C(NR.sup.e9)NR.sup.c9R.sup.d9, NR.sup.c9C(NR.sup.e9)NR.sup.c9R.sup.d9, NR.sup.c9C(NR.sup.e9)R.sup.b9, NR.sup.c9S(O)NR.sup.c9R.sup.d9, NR.sup.c9S(O)R.sup.b9, NR.sup.c9S(O).sub.2R.sup.b9, NR.sup.c9S(O)(NR.sup.e9)R.sup.b9 NR.sup.c9S(O).sub.2NR.sup.c9R.sup.d9, S(O)R.sup.b9, S(O)NR.sup.c9R.sup.d9, S(O).sub.2R.sup.b9, S(O).sub.2NR.sup.c9R.sup.d9, OS(O)(NR.sup.e9)R.sup.b9, OS(O).sub.2R.sup.b9, S(O)(NR.sup.e9)R.sup.b9, SF.sub.5, P(O)R.sup.f9R.sup.g9, OP(O)(OR.sup.h9)(OR.sup.i9), P(O)(OR.sup.h9)(OR.sup.i9), and BR.sup.j9R.sup.k9, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(71) R.sup.a9, R.sup.c9, and R.sup.d9 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(72) or, any R.sup.c9 and R.sup.d9 attached to the same N atom, together with the N atom to which they are attached, form a 4-7 membered heterocycloalkyl group, which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(73) each R.sup.b9 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(74) each R.sup.e9 is independently selected from H, OH, CN, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(75) each R.sup.f9 and R.sup.g9 are independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkyl, C.sub.1-6 haloalkoxy, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(76) each R.sup.h9 and R.sup.i9 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl;

(77) each R.sup.j9 and R.sup.i9 is independently selected from OH, C.sub.1-6 alkoxy, and C.sub.1-6 haloalkoxy;

(78) or any R.sup.j9 and R.sup.k9 attached to the same B atom, together with the B atom to which they are attached, form a 5- or 6-membered heterocycloalkyl group optionally substituted with 1, 2, 3, or 4 substituents independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl; and

(79) each R.sup.G is independently selected from H, D, OH, NO.sub.2, CN, halo, C.sub.1-3 alkyl, C.sub.2-3 alkenyl, C.sub.2-3 alkynyl, C.sub.1-3 haloalkyl, cyano-C.sub.1-3 alkyl, HOC.sub.1-3 alkyl, C.sub.1-3 alkoxy-C.sub.1-3 alkyl, C.sub.3-7 cycloalkyl, C.sub.1-3 alkoxy, C.sub.1-3 haloalkoxy, amino, C.sub.1-3 alkylamino, di(C.sub.1-3 alkyl)amino, thio, C.sub.1-3 alkylthio, C.sub.1-3 alkylsulfinyl, C.sub.1-3 alkylsulfonyl, carbamyl, C.sub.1-3 alkylcarbamyl, di(C.sub.1-3 alkyl)carbamyl, carboxy, C.sub.1-3 alkylcarbonyl, C.sub.1-3 alkoxycarbonyl, C.sub.1-3 alkylcarbonyloxy, C.sub.1-3 alkylcarbonylamino, C.sub.1-3 alkoxycarbonylamino, C.sub.1-3 alkylaminocarbonyloxy, C.sub.1-3 alkylsulfonylamino, aminosulfonyl, C.sub.1-3 alkylaminosulfonyl, di(C.sub.1-3 alkyl)aminosulfonyl, aminosulfonylamino, C.sub.1-3 alkylaminosulfonylamino, di(C.sub.1-3 alkyl)aminosulfonylamino, aminocarbonylamino, C.sub.1-3 alkylaminocarbonylamino, and di(C.sub.1-3 alkyl)aminocarbonylamino.

(80) In some embodiments, X is N.

(81) In some embodiments, X is CR.sup.9.

(82) In some embodiments, Y is N.

(83) In some embodiments, Y is CR.sup.10.

(84) In some embodiments, R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted by 1, 2, or 3, independently selected R.sup.4 substituents.

(85) In some embodiments, R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.4 substituents.

(86) In some embodiments, R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl, each of which is optionally substituted by 1, 2, or 3 independently selected R.sup.4 substituents.

(87) In some embodiments, R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.4 substituents.

(88) In some embodiments, R.sup.1 is selected from C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, and C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, each of which is optionally substituted by 1 or 2 independently selected R.sup.4 substituents.

(89) In some embodiments, R.sup.1 is selected from C.sub.1-6 haloalkyl and C.sub.3-7 cycloalkyl, each of which is optionally substituted by 1, 2, or 3 independently selected R.sup.4 substituents.

(90) In some embodiments, R.sup.1 is selected from 1,1,1-trifluorobutan-2-yl, cyclopropylmethyl, 1,2,3,4-tetrahydroisoquinolin-6-yl, cyclopentyl, cyclohexyl, and phenyl, wherein said cyclopropylmethyl, 1,2,3,4-tetrahydroisoquinolin-6-yl, cyclopentyl, cyclohexyl, and phenyl are optionally substituted with 1 or 2 R.sup.4 substituents independently selected from methyl, Cl, F, and OH.

(91) In some embodiments, R.sup.1 is selected from 1,1,1-trifluorobutan-2-yl and cyclopentyl, wherein said cyclopentyl is optionally substituted with 1 or 2 R.sup.4 substituents independently selected from methyl and OH.

(92) In some embodiments:

(93) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4 NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.c4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(94) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(95) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(96) each R.sup.4A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41 S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d41, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(97) each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(98) each R.sup.b41 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(99) each R.sup.4B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a42, SR.sup.a42, C(O)R.sup.b42, C(O)NR.sup.c42R.sup.d42, C(O)OR.sup.a42, OC(O)R.sup.b42, OC(O)NR.sup.c42R.sup.d42, NR.sup.c42R.sup.d42, NR.sup.c42C(O)R.sup.b42, NR.sup.c42C(O)OR.sup.a42, NR.sup.c42C(O)NR.sup.c42R.sup.d42, NR.sup.c42S(O).sub.2R.sup.b42, NR.sup.c42S(O).sub.2NR.sup.c42R.sup.d42 S(O).sub.2R.sup.b42, and S(O).sub.2NR.sup.c42R.sup.d42, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(100) each R.sup.a42, R.sup.c42, and R.sup.d42 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(101) each R.sup.b42 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(102) In some embodiments:

(103) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4 NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4 NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(104) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(105) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(106) each R.sup.4A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d41;

(107) each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(108) each R.sup.b41 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(109) In some embodiments:

(110) each R.sup.4 is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4 NR.sup.c4C(O)R.sup.b4, NR.sup.cC(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4, NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4;

(111) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(112) each R.sup.b4 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(113) In some embodiments:

(114) each R.sup.4 is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a4, and NR.sup.c4R.sup.d4; and

(115) each R.sup.a4, R.sup.c, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

(116) In some embodiments, each R.sup.4 is independently selected from H, OH, halo, and C.sub.1-3 alkyl.

(117) In some embodiments, each R.sup.4 is independently selected from OH, F, Cl, and CH.sub.3.

(118) In some embodiments, R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents.

(119) In some embodiments, R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents.

(120) In some embodiments, R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, and 4-7 membered heterocycloalkyl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents.

(121) In some embodiments, R.sup.5 is selected from methyl, ethyl, piperidin-3-yl, and azetidin-4-yl, wherein said methyl, ethyl, piperidin-3-yl, and azetidin-4-yl are optionally substituted by 1, 2, or 3 R.sup.5A substituents independently selected from D, methyl, OH, and N(CH.sub.3).sub.2.

(122) In some embodiments, R.sup.5 is selected from methyl and azetidin-4-yl, wherein said azetidin-4-yl is optionally substituted by methyl.

(123) In some embodiments:

(124) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51NR.sup.c51C(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(125) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(126) each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(127) each R.sup.5B is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a52, SR.sup.a52, C(O)R.sup.b52, C(O)NR.sup.c52R.sup.d52, C(O)OR.sup.a52, OC(O)R.sup.b52, OC(O)NR.sup.c52R.sup.d52, NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52C(O)OR.sup.a52, NR.sup.c52C(O)NR.sup.c52R.sup.d52, NR.sup.c52S(O).sub.2R.sup.b52, NR.sup.c52S(O).sub.2NR.sup.c52R.sup.d52, S(O).sub.2R.sup.b52, and S(O).sub.2NR.sup.c52R.sup.d52;

(128) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(129) each R.sup.b52 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(130) In some embodiments:

(131) each R.sup.5A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(132) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(133) each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(134) each R.sup.5B is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a52, SR.sup.a52, C(O)R.sup.b52, C(O)NR.sup.c52R.sup.d52, C(O)OR.sup.a52, OC(O)R.sup.b52, OC(O)NR.sup.c52R.sup.d52, NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52C(O)OR.sup.a52, NR.sup.c52C(O)NR.sup.c52R.sup.d52, NR.sup.c52S(O).sub.2R.sup.b52, NR.sup.c52S(O).sub.2NR.sup.c52R.sup.d52, S(O).sub.2R.sup.b52, and S(O).sub.2NR.sup.c52R.sup.d52;

(135) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(136) each R.sup.b52 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(137) In some embodiments:

(138) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(139) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(140) each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(141) each R.sup.5B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a52, C(O)NR.sup.c52R.sup.d52, C(O)OR.sup.a52, NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52S(O).sub.2R.sup.b52, S(O).sub.2R.sup.b52, and S(O).sub.2NR.sup.c52R.sup.d52;

(142) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(143) each R.sup.b52 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(144) In some embodiments:

(145) each R.sup.5A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.b51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sub.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sub.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sub.c51R.sup.d51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(146) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(147) each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(148) each R.sup.5B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a52, C(O)NR.sup.c52R.sup.d52, C(O)OR.sup.a52, NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52S(O).sub.2R.sup.b52, S(O).sub.2R.sup.b52, and S(O).sub.2NR.sup.c52R.sup.d52;

(149) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(150) each R.sup.b52 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(151) In some embodiments:

(152) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sub.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sub.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51;

(153) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(154) each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(155) In some embodiments:

(156) each R.sup.5A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sub.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51;

(157) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(158) each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(159) In some embodiments:

(160) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sub.c51R.sup.d51, NR.sub.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51S(O).sub.2R.sup.b51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51;

(161) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(162) each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(163) In some embodiments:

(164) each R.sup.5A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-4 cycloalkyl, OR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51S(O).sub.2R.sup.b51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51;

(165) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl; and

(166) each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl.

(167) In some embodiments:

(168) each R.sup.5A is independently selected from H, D, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a51, and NR.sup.c51R.sup.d51; and

(169) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

(170) In some embodiments:

(171) each R.sup.5A is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a51, and NR.sup.c51R.sup.d51; and

(172) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

(173) In some embodiments, each R.sup.5A is independently selected from D, C.sub.1-6 alkyl, OR.sup.a51, and NR.sup.c51R.sup.d51; and

(174) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H and C.sub.1-6 alkyl.

(175) In some embodiments, each R.sup.5A is independently selected from C.sub.1-6 alkyl.

(176) In some embodiments, R.sup.6 is H or methyl.

(177) In some embodiments, R.sup.6 is H.

(178) In some embodiments, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, OH, NO.sub.2, CN, halo, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, cyano-C.sub.1-6 alkyl, HOC.sub.1-6 alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.3-4 cycloalkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkoxy, amino, C.sub.1-6 alkylamino, and di(C.sub.1-6 alkyl)amino.

(179) In some embodiments, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, OH, CN, halo, C.sub.1-3 alkyl, and C.sub.1-3 haloalkyl.

(180) In some embodiments, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H and halo.

(181) In some embodiments, R.sup.7 is H or halo; and R.sup.8, R.sup.9, and R.sup.10 are each H.

(182) In some embodiments, R.sup.7 is H or F; and R.sup.8, R.sup.9, and R.sup.10 are each H.

(183) In some embodiments, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each H.

(184) In some embodiments:

(185) X is N or CR.sup.9;

(186) Y is N or CR.sup.10;

(187) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted by 1, 2, or 3 independently selected R.sup.4 substituents;

(188) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl;

(189) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(190) Ring B is a 3-7 membered cycloalkyl ring, which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.G substituents;

(191) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4 NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4, NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(192) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(193) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(194) each R.sup.4A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d41, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(195) each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(196) each R.sup.b41 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(197) each R.sup.4B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a42, SR.sup.a42, C(O)R.sup.b42, C(O)NR.sup.c42R.sup.d42, C(O)OR.sup.a42, OC(O)R.sup.b42, OC(O)NR.sup.c42R.sup.d42, NR.sup.c42R.sup.d42, NR.sup.c42C(O)R.sup.b42, NR.sup.c42C(O)OR.sup.a42, NR.sup.c42C(O)NR.sup.c42R.sup.d42, NR.sup.c42S(O).sub.2R.sup.b42, NR.sup.c42S(O).sub.2NR.sup.c42R.sup.d42, S(O).sub.2R.sup.b42, and S(O).sub.2NR.sup.c42R.sup.d42, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(198) each R.sup.a42, R.sup.c42, and R.sup.d42 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(199) each R.sup.b42 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(200) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents;

(201) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sup.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(202) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(203) each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(204) each R.sup.5B is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a52, SR.sup.a52, C(O)R.sup.b52, C(O)NR.sup.c52R.sup.d52, C(O)OR.sup.a52, OC(O)R.sup.b52, OC(O)NR.sup.c52R.sup.d52, NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52C(O)OR.sup.a52, NR.sup.c52C(O)NR.sup.c52R.sup.d52, NR.sup.c52S(O).sub.2R.sup.b52, NR.sup.c52S(O).sub.2NR.sup.c52R.sup.d52, S(O).sub.2R.sup.b52, and S(O).sub.2NR.sup.c52R.sup.d52;

(205) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(206) each R.sup.b52 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(207) R.sup.6 is H, C.sub.1-4 alkyl, and C.sub.1-4 haloalkyl;

(208) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected H, OH, NO.sub.2, CN, halo, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, cyano-C.sub.1-6 alkyl, HOC.sub.1-6 alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.3-4 cycloalkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkoxy, amino, C.sub.1-6 alkylamino, and di(C.sub.1-6 alkyl)amino; and

(209) each R.sup.G is independently selected from H, OH, NO.sub.2, CN, halo, C.sub.1-3 alkyl, C.sub.2-3 alkenyl, C.sub.2-3 alkynyl, C.sub.1-3 haloalkyl, cyano-C.sub.1-3 alkyl, HOC.sub.1-3 alkyl, C.sub.1-3 alkoxy-C.sub.1-3 alkyl, C.sub.3-7 cycloalkyl, C.sub.1-3 alkoxy, C.sub.1-3 haloalkoxy, amino, C.sub.1-3 alkylamino, di(C.sub.1-3 alkyl)amino, thio, C.sub.1-3 alkylthio, C.sub.1-3 alkylsulfinyl, C.sub.1-3 alkylsulfonyl, carbamyl, C.sub.1-3 alkylcarbamyl, di(C.sub.1-3 alkyl)carbamyl, carboxy, C.sub.1-3 alkylcarbonyl, C.sub.1-3 alkoxycarbonyl, C.sub.1-3 alkylcarbonyloxy, C.sub.1-3 alkylcarbonylamino, C.sub.1-3 alkoxycarbonylamino, C.sub.1-3 alkylaminocarbonyloxy, C.sub.1-3 alkylsulfonylamino, aminosulfonyl, C.sub.1-3 alkylaminosulfonyl, di(C.sub.1-3 alkyl)aminosulfonyl, aminosulfonylamino, C.sub.1-3 alkylaminosulfonylamino, di(C.sub.1-3 alkyl)aminosulfonylamino, aminocarbonylamino, C.sub.1-3 alkylaminocarbonylamino, and di(C.sub.1-3 alkyl)aminocarbonylamino.

(210) In some embodiments:

(211) X is N or CR.sup.9;

(212) Y is N or CR.sup.10;

(213) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.4 substituents;

(214) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl;

(215) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(216) Ring B is a 3-7 membered cycloalkyl ring, which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.G substituents;

(217) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.cR.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.cR.sup.d4, NR.sup.cR.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4 NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.b4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(218) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(219) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(220) each R.sup.4A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d41, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(221) each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(222) each R.sup.b41 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4B substituents;

(223) each R.sup.4B is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a42, SR.sup.a42, C(O)R.sup.b42, C(O)NR.sup.c42R.sup.d42, C(O)OR.sup.a42, OC(O)R.sup.b42, OC(O)NR.sup.c42R.sup.d42, NR.sup.c42R.sup.d42, NR.sup.c42C(O)R.sup.b42, NR.sup.c42C(O)OR.sup.a42, NR.sup.c42C(O)NR.sup.c42R.sup.d42, NR.sup.c42S(O).sub.2R.sup.b42, NR.sup.c42S(O).sub.2NR.sup.c42R.sup.d42, S(O).sub.2R.sup.b42, and S(O).sub.2NR.sup.c42R.sup.d42, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.G substituents;

(224) each R.sup.a42, R.sup.c42, and R.sup.d42 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(225) each R.sup.b42 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(226) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents;

(227) each R.sup.5A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sub.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sub.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sub.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sup.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(228) each R.sup.a51, R.sup.c51, and R.sup.d is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(229) each R.sup.b51 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5B substituents;

(230) each R.sup.5B is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a52, SR.sup.a52, C(O)R.sup.b52, C(O)NR.sup.c52R.sup.d52, C(O)OR.sup.a52, OC(O)R.sup.b52, OC(O)NR.sup.c52R.sup.d52, NR.sup.c52R.sup.d52, NR.sup.c52C(O)R.sup.b52, NR.sup.c52C(O)OR.sup.a52, NR.sup.c52C(O)NR.sup.c52R.sup.d52, NR.sup.c52S(O).sub.2R.sup.b52, NR.sup.c52S(O).sub.2NR.sup.c52R.sup.d52, S(O).sub.2R.sup.b52, and S(O).sub.2NR.sup.c52R.sup.d52;

(231) each R.sup.a52, R.sup.c52, and R.sup.d52 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(232) each R.sup.b52 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(233) R.sup.6 is H, C.sub.1-4 alkyl, and C.sub.1-4 haloalkyl;

(234) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected H, OH, NO.sub.2, CN, halo, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, cyano-C.sub.1-6 alkyl, HOC.sub.1-6 alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.3-4 cycloalkyl, C.sub.1-6 alkoxy, C.sub.1-6 haloalkoxy, amino, C.sub.1-6 alkylamino, and di(C.sub.1-6 alkyl)amino; and

(235) each R.sup.G is independently selected from H, OH, NO.sub.2, CN, halo, C.sub.1-3 alkyl, C.sub.2-3 alkenyl, C.sub.2-3 alkynyl, C.sub.1-3 haloalkyl, cyano-C.sub.1-3 alkyl, HOC.sub.1-3 alkyl, C.sub.1-3 alkoxy-C.sub.1-3 alkyl, C.sub.3-7 cycloalkyl, C.sub.1-3 alkoxy, C.sub.1-3 haloalkoxy, amino, C.sub.1-3 alkylamino, di(C.sub.1-3 alkyl)amino, thio, C.sub.1-3 alkylthio, C.sub.1-3 alkylsulfinyl, C.sub.1-3 alkylsulfonyl, carbamyl, C.sub.1-3 alkylcarbamyl, di(C.sub.1-3 alkyl)carbamyl, carboxy, C.sub.1-3 alkylcarbonyl, C.sub.1-3 alkoxycarbonyl, C.sub.1-3 alkylcarbonyloxy, C.sub.1-3 alkylcarbonylamino, C.sub.1-3 alkoxycarbonylamino, C.sub.1-3 alkylaminocarbonyloxy, C.sub.1-3 alkylsulfonylamino, aminosulfonyl, C.sub.1-3 alkylaminosulfonyl, di(C.sub.1-3 alkyl)aminosulfonyl, aminosulfonylamino, C.sub.1-3 alkylaminosulfonylamino, di(C.sub.1-3 alkyl)aminosulfonylamino, aminocarbonylamino, C.sub.1-3 alkylaminocarbonylamino, and di(C.sub.1-3 alkyl)aminocarbonylamino.

(236) In some embodiments:

(237) X is N or CR.sup.9;

(238) Y is N or CR.sup.10;

(239) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl, each of which is optionally substituted by 1 or 2 independently selected R.sup.4 substituents;

(240) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl;

(241) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(242) Ring B is a 3-7 membered cycloalkyl ring;

(243) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.cR.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4 NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4 S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(244) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(245) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(246) each R.sup.4A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41, NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d41,

(247) each R.sup.a41, R.sup.c1, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(248) each R.sup.b41 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(249) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents;

(250) each R.sup.5A is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sub.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sub.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sub.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sub.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51;

(251) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(252) each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(253) R.sup.6 is H; and

(254) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, OH, CN, halo, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

(255) In some embodiments:

(256) X is N or CR.sup.9;

(257) Y is N or CR.sup.10;

(258) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted by 1, 2, 3, or 4 independently selected R.sup.4 substituents;

(259) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl;

(260) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(261) Ring B is a 3-7 membered cycloalkyl ring;

(262) each R.sup.4 is independently selected from H, D, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a4, SR.sup.a4, C(O)R.sup.b4, C(O)NR.sup.c4R.sup.d4, C(O)OR.sup.a4, OC(O)R.sup.b4, OC(O)NR.sup.c4R.sup.d4, NR.sup.c4R.sup.d4, NR.sup.c4C(O)R.sup.b4, NR.sup.c4C(O)OR.sup.a4, NR.sup.c4C(O)NR.sup.c4R.sup.d4 NR.sup.c4S(O).sub.2R.sup.b4, NR.sup.c4S(O).sub.2NR.sup.c4R.sup.d4, S(O).sub.2R.sup.b4, and S(O).sub.2NR.sup.c4R.sup.d4, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(263) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, wherein said C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(264) each R.sup.b4 is independently selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, and 5-6 membered heteroaryl-C.sub.1-4 alkyl, which are each optionally substituted with 1, 2, 3, or 4 independently selected R.sup.4A substituents;

(265) each R.sup.4A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a41, SR.sup.a41, C(O)R.sup.b41, C(O)NR.sup.c41R.sup.d41, C(O)OR.sup.a41, OC(O)R.sup.b41, OC(O)NR.sup.c41R.sup.d41, NR.sup.c41R.sup.d41 NR.sup.c41C(O)R.sup.b41, NR.sup.c41C(O)OR.sup.a41, NR.sup.c41C(O)NR.sup.c41R.sup.d41, NR.sup.c41S(O).sub.2R.sup.b41, NR.sup.c41S(O).sub.2NR.sup.c41R.sup.d41, S(O).sub.2R.sup.b41, and S(O).sub.2NR.sup.c41R.sup.d4,

(266) each R.sup.a41, R.sup.c41, and R.sup.d41 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(267) each R.sup.b41 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(268) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents;

(269) each R.sup.5A is independently selected from H, halo, CN, NO.sub.2, C.sub.1-6 alkyl, C.sub.2-6 alkenyl, C.sub.2-6 alkynyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, 5-6 membered heteroaryl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, phenyl-C.sub.1-4 alkyl, 4-7 membered heterocycloalkyl-C.sub.1-4 alkyl, 5-6 membered heteroaryl-C.sub.1-4 alkyl, OR.sup.a51, SR.sup.a51, C(O)R.sup.b51, C(O)NR.sup.c51R.sup.d51, C(O)OR.sup.a51, OC(O)R.sup.b51, OC(O)NR.sup.c51R.sup.d51, NR.sup.c51R.sup.d51, NR.sup.c51C(O)R.sup.b51, NR.sup.c51C(O)OR.sup.a51, NR.sup.c51C(O)NR.sub.c51R.sup.d51, NR.sup.c51S(O).sub.2R.sup.b51, NR.sup.c51S(O).sub.2NR.sub.c51R.sup.d51, S(O).sub.2R.sup.b51, and S(O).sub.2NR.sup.c51R.sup.d51;

(270) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(271) each R.sup.b51 is independently selected from C.sub.1-6 alkyl and C.sub.1-6 haloalkyl;

(272) R.sup.6 is H; and

(273) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, OH, CN, halo, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl.

(274) In some embodiments:

(275) X is N or CR.sup.9;

(276) Y is N or CR.sup.10;

(277) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl and 5-6 membered heteroaryl, each of which is optionally substituted 1 or 2 independently selected R.sup.4 substituents;

(278) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl;

(279) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(280) Ring B is a 3-7 membered cycloalkyl ring;

(281) each R.sup.4 is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a4, and NR.sup.c4R.sup.d4;

(282) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(283) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents;

(284) each R.sup.5A is independently selected from H, D, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a51, and NR.sup.c51R.sup.d51;

(285) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(286) R.sup.6 is H; and

(287) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, CN, halo, C.sub.1-3 alkyl, and C.sub.1-3 haloalkyl.

(288) In some embodiments:

(289) X is N or CR.sup.9;

(290) Y is N or CR.sup.10;

(291) R.sup.1 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted 1 or 2 independently selected R.sup.4 substituents;

(292) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl;

(293) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(294) Ring B is a 3-7 membered cycloalkyl ring;

(295) each R.sup.4 is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a4, and NR.sup.c4R.sup.d4;

(296) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(297) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-7 membered heterocycloalkyl, and 5-6 membered heteroaryl, each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents;

(298) each R.sup.5A is independently selected from H, halo, CN, C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, OR.sup.a51, and NR.sup.c51R.sup.d51;

(299) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(300) R.sup.6 is H; and

(301) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, CN, halo, C.sub.1-3 alkyl, and C.sub.1-3 haloalkyl.

(302) In some embodiments:

(303) X is N or CR.sup.9;

(304) Y is N or CR.sup.10;

(305) R.sup.1 is C.sub.1-6 haloalkyl, C.sub.3-7 cycloalkyl, phenyl, 4-10 membered heterocycloalkyl, or C.sub.3-7 cycloalkyl-C.sub.1-4 alkyl, each of which is optionally substituted by 1 or 2 independently selected R.sup.4 substituents;

(306) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl;

(307) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(308) Ring B is a 3-4 membered cycloalkyl ring;

(309) each R.sup.4 is independently selected from H, halo, CN, OH, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, and C.sub.1-4 alkoxy;

(310) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(311) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, and monocyclic 4-6 membered heterocycloalkyl having one nitrogen ring member; each of which is optionally substituted with 1, 2, or 3 independently selected R.sup.5A substituents;

(312) R.sup.5A is independently selected from D, C.sub.1-6 alkyl, OR.sup.a51, and NR.sup.c51R.sup.d51

(313) each R.sup.a51, R.sup.c51, and R.sup.d51 is independently selected from H and C.sub.1-6 alkyl;

(314) R.sup.6 is H; and

(315) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, F, and Cl.

(316) In some embodiments:

(317) X is N or CR.sup.9;

(318) Y is N or CR.sup.10;

(319) R.sup.1 is C.sub.1-6 haloalkyl or C.sub.3-7 cycloalkyl, each of which is optionally substituted by 1, 2, or 3 independently selected R.sup.4 substituents;

(320) R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl;

(321) or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B;

(322) Ring B is a 3-4 membered cycloalkyl ring;

(323) each R.sup.4 is independently selected from H, halo, CN, OH, C.sub.1-4 alkyl, C.sub.1-4 haloalkyl, and C.sub.1-4 alkoxy;

(324) each R.sup.a4, R.sup.c4, and R.sup.d4 is independently selected from H, C.sub.1-6 alkyl, and C.sub.1-6 haloalkyl;

(325) R.sup.5 is selected from C.sub.1-6 alkyl, C.sub.1-6 haloalkyl, and monocyclic 4-6 membered heterocycloalkyl having one nitrogen ring member; each of which is optionally substituted with 1, 2, 3, or 4 independently selected R.sup.5A substituents;

(326) R.sup.5A is independently selected from C.sub.1-6 alkyl;

(327) R.sup.6 is H; and

(328) R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are each independently selected from H, F, and Cl.

(329) In some embodiments, R.sup.2 and R.sup.3 are independently selected from C.sub.1-3 alkyl and C.sub.1-3 haloalkyl; or R.sup.2 and R.sup.3, together with the carbon atom to which they are attached, form Ring B.

(330) In some embodiments, the compound is a compound of Formula (II):

(331) ##STR00003##
or a pharmaceutically acceptable salt thereof.

(332) In some embodiments, the compound is a compound of Formula (IIa):

(333) ##STR00004##
or a pharmaceutically acceptable salt thereof.

(334) In some embodiments, the compound is a compound of Formula (IIb):

(335) ##STR00005##
or a pharmaceutically acceptable salt thereof.

(336) In some embodiments, Ring B is C.sub.3-7 cycloalkyl.

(337) In some embodiments, Ring B is cyclopropyl, cyclobutyl, or cyclopentyl.

(338) In some embodiments, Ring B is monocyclic 4-7 membered heterocycloalkyl, which is optionally substituted by 1 or 2 independently selected R.sup.G substituents.

(339) In some embodiments, Ring B is monocyclic 4-7 membered heterocycloalkyl.

(340) In some embodiments, the compound is a compound of Formula (III):

(341) ##STR00006##
or a pharmaceutically acceptable salt thereof.

(342) In some embodiments, the compound is a compound of Formula (IIIa):

(343) ##STR00007##
or a pharmaceutically acceptable salt thereof. In some embodiments, R.sup.7 is H or halo; and R.sup.8 is H.

(344) In some embodiments, the compound is a compound of Formula (IIIb):

(345) ##STR00008##
or a pharmaceutically acceptable salt thereof.

(346) In some embodiments, 1, 2, 3, 4, 5, 6, 7, or 8 hydrogen atoms, attached to carbon atoms of any alkyl, alkenyl, alkynyl, aryl, phenyl, cycloalkyl, heterocycloalkyl, or heteroaryl substituents or C.sub.1-4 alkyl- and alkylene linking groups are optionally replaced by deuterium atoms.

(347) It is further appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, can also be provided in combination in a single embodiment. Conversely, various features of the invention which are, for brevity, described in the context of a single embodiment, can also be provided separately or in any suitable subcombination.

(348) At various places in the present specification, divalent linking substituents are described. Unless otherwise specified, is specifically intended that each divalent linking substituent include both the forward and backward forms of the linking substituent. For example, NR(CRR).sub.n includes both NR(CRR).sub.n and (CRR).sub.nNR. Where the structure clearly requires a linking group, the Markush variables listed for that group are understood to be linking groups.

(349) The term n-membered where n is an integer typically describes the number of ring-forming atoms in a moiety where the number of ring-forming atoms is n. For example, piperidinyl is an example of a 6-membered heterocycloalkyl ring, pyrazolyl is an example of a 5-membered heteroaryl ring, pyridyl is an example of a 6-membered heteroaryl ring, and 1,2,3,4-tetrahydro-naphthalene is an example of a 10-membered cycloalkyl group.

(350) As used herein, the phrase optionally substituted means unsubstituted or substituted. The substituents are independently selected, and substitution may be at any chemically accessible position. As used herein, the term substituted means that a hydrogen atom is removed and replaced by a substituent. A single divalent substituent, e.g., oxo, can replace two hydrogen atoms. It is to be understood that substitution at a given atom is limited by valency.

(351) As used herein, the phrase each variable is independently selected from means substantially the same as wherein at each occurrence variable is selected from.

(352) When any variable (e.g., R.sup.G) occurs more than one time in any constituent or formula for a compound, its definition at each occurrence is independent of its definition at every other occurrence. Thus, for example, if a group is shown to be substituted with 1, 2, 3, or 4 R.sup.G, then said group may optionally be substituted with up to four R.sup.G groups and R.sup.G at each occurrence is selected independently from the definition of R.sup.G. Also, combinations of substituents and/or variables are permissible only if such combinations result in stable compounds; for example the combination of a first M group and second M group in the combination of two R groups are permissible only if such combinations of M-M result in stable compounds (e.g., M-M is not permissible if it will form highly reactive compounds such as peroxides having OO bonds).

(353) In some embodiments, when an optionally multiple substituent is designated in the form:

(354) ##STR00009##
then it is to be understood that substituent R can occur p number of times on the ring, and R can be a different moiety at each occurrence. It is to be understood that each R group may replace any hydrogen atom attached to a ring atom, including one or both of the (CH.sub.2).sub.n hydrogen atoms. Further, in the above example, should the variable Q be defined to include hydrogens, such as when Q is said to be CH.sub.2, NH, etc., any floating substituent such as R in the above example, can replace a hydrogen of the Q variable as well as a hydrogen in any other non-variable component of the ring.

(355) Throughout the definitions, the term C.sub.n-m indicates a range which includes the endpoints, wherein n and m are integers and indicate the number of carbons. Examples include C.sub.1-3, C.sub.1-4, C.sub.1-6, and the like.

(356) As used herein, the term C.sub.n-m alkyl, employed alone or in combination with other terms, refers to a saturated hydrocarbon group that may be straight-chain or branched, having n to m carbons. Examples of alkyl moieties include, but are not limited to, chemical groups such as methyl (Me), ethyl (Et), n-propyl (n-Pr), isopropyl (i-Pr), n-butyl, tert-butyl, isobutyl, sec-butyl; higher homologs such as 2-methyl-1-butyl, n-pentyl, 3-pentyl, n-hexyl, 1,2,2-trimethylpropyl, and the like. In some embodiments, the alkyl group contains from 1 to 6 carbon atoms, from 1 to 4 carbon atoms, from 1 to 3 carbon atoms, or 1 to 2 carbon atoms.

(357) As used herein, C.sub.n-m alkenyl refers to an alkyl group having one or more double carbon-carbon bonds and having n to m carbons. Example alkenyl groups include, but are not limited to, ethenyl, n-propenyl, isopropenyl, n-butenyl, sec-butenyl, and the like. In some embodiments, the alkenyl moiety contains 2 to 6, 2 to 4, or 2 to 3 carbon atoms.

(358) As used herein, C.sub.n-m alkynyl refers to an alkyl group having one or more triple carbon-carbon bonds and having n to m carbons. Example alkynyl groups include, but are not limited to, ethynyl, propyn-1-yl, propyn-2-yl, and the like. In some embodiments, the alkynyl moiety contains 2 to 6, 2 to 4, or 2 to 3 carbon atoms. As used herein, the term C.sub.n-m alkoxy, employed alone or in combination with other terms, refers to a group of formula-O-alkyl, wherein the alkyl group has n to m carbons. Example alkoxy groups include, but are not limited to, methoxy, ethoxy, propoxy (e.g., n-propoxy and isopropoxy), butoxy (e.g., n-butoxy and tert-butoxy), and the like. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(359) As used herein, the term amino refers to a group of formula NH.sub.2.

(360) As used herein, the term aryl, employed alone or in combination with other terms, refers to an aromatic hydrocarbon group, which may be monocyclic or polycyclic (e.g., having 2 or 3 fused rings). The term C.sub.n-m aryl refers to an aryl group having from n to m ring carbon atoms. Aryl groups include, e.g., phenyl, naphthyl, anthracenyl, phenanthrenyl, indanyl, indenyl, and the like. In some embodiments, the aryl group has from 6 to 10 carbon atoms. In some embodiments, the aryl group is phenyl or naphthyl.

(361) In some embodiments, the aryl is phenyl.

(362) As used herein, halo refers to F, Cl, Br, or I. In some embodiments, halo is F, Cl, or Br. In some embodiments, halo is F or Cl. In some embodiments, halo is F. In some embodiments, halo is Cl.

(363) As used herein, C.sub.n-m haloalkoxy refers to a group of formula O-haloalkyl having n to m carbon atoms. Example haloalkoxy groups include OCF.sub.3 and OCHF.sub.2. In some embodiments, the haloalkoxy group is fluorinated only. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(364) As used herein, the term C.sub.n-m haloalkyl, employed alone or in combination with other terms, refers to an alkyl group having from one halogen atom to 2s+1 halogen atoms which may be the same or different, where s is the number of carbon atoms in the alkyl group, wherein the alkyl group has n to m carbon atoms. In some embodiments, the haloalkyl group is fluorinated only. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms. Example haloalkyl groups include CF.sub.3, C.sub.2F.sub.5, CHF.sub.2, CH.sub.2F, CCl.sub.3, CHCl.sub.2, C.sub.2Cl.sub.5 and the like.

(365) As used herein, the term thio refers to a group of formula SH.

(366) As used herein, the term carbamyl to a group of formula C(O)NH.sub.2.

(367) As used herein, the term carbonyl, employed alone or in combination with other terms, refers to a C(O) group.

(368) As used herein, the term C.sub.n-m alkylamino refers to a group of formula NH(alkyl), wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(369) As used herein, the term C.sub.n-m alkoxycarbonyl refers to a group of formula C(O)O-alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(370) As used herein, the term C.sub.n-m alkylcarbonyl refers to a group of formula C(O) alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(371) As used herein, the term C.sub.n-m alkylcarbonylamino refers to a group of formula NHC(O)-alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(372) As used herein, the term C.sub.n-m alkoxycarbonylamino refers to a group of formula NHC(O)O(C.sub.n-m alkyl), wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(373) As used herein, the term C.sub.n-m alkylsulfonylamino refers to a group of formula NHS(O).sub.2-alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(374) As used herein, the term aminosulfonyl refers to a group of formula S(O).sub.2NH.sub.2.

(375) As used herein, the term C.sub.n-m alkylaminosulfonyl refers to a group of formula S(O).sub.2NH(alkyl), wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(376) As used herein, the term di(C.sub.n-m alkyl)aminosulfonyl refers to a group of formula S(O).sub.2N(alkyl).sub.2, wherein each alkyl group independently has n to m carbon atoms. In some embodiments, each alkyl group has, independently, 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(377) As used herein, the term aminosulfonylamino refers to a group of formula NHS(O).sub.2NH.sub.2.

(378) As used herein, the term C.sub.n-m alkylaminosulfonylamino refers to a group of formula NHS(O).sub.2NH(alkyl), wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(379) As used herein, the term di(C.sub.n-m alkyl)aminosulfonylamino refers to a group of formula NHS(O).sub.2N(alkyl).sub.2, wherein each alkyl group independently has n to m carbon atoms. In some embodiments, each alkyl group has, independently, 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(380) As used herein, the term aminocarbonylamino, employed alone or in combination with other terms, refers to a group of formula NHC(O)NH.sub.2.

(381) As used herein, the term C.sub.n-m alkylaminocarbonylamino refers to a group of formula NHC(O)NH(alkyl), wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(382) As used herein, the term di(C.sub.n-m alkyl)aminocarbonylamino refers to a group of formula NHC(O)N(alkyl).sub.2, wherein each alkyl group independently has n to m carbon atoms. In some embodiments, each alkyl group has, independently, 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(383) As used herein, the term C.sub.n-m alkylcarbamyl refers to a group of formula C(O)NH(alkyl), wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(384) As used herein, the term C.sub.n-m alkylthio refers to a group of formula S-alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(385) As used herein, the term C.sub.n-m alkylsulfinyl refers to a group of formula S(O) alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(386) As used herein, the term C.sub.n-m alkylsulfonyl refers to a group of formula S(O).sub.2-alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(387) As used herein, the term cyano-C.sub.n-m alkyl refers to a group of formula (C.sub.n-m alkylene)-CN, wherein the alkylene group has n to m carbon atoms. As used herein, the term cyano-C.sub.1-3 alkyl refers to a group of formula (C.sub.1-3 alkylene)-CN.

(388) As used herein, the term HOC.sub.n-m alkyl refers to a group of formula C.sub.n-m alkylene)-OH, wherein the alkylene group has n to m carbon atoms. As used herein, the term HOC.sub.1-3 alkyl refers to a group of formula (C.sub.1-3 alkylene)-OH.

(389) As used herein, the term C.sub.n-m alkoxy-C.sub.o-p alkyl refers to a group of formula (C.sub.n-m alkylene)-O(C.sub.o-p alkyl), wherein the alkylene group has n to m carbon atoms and the alkyl group has o to p carbon atoms. As used herein, the term C.sub.1-3 alkoxy-C.sub.1-3 alkyl refers to a group of formula (C.sub.1-3 alkylene)-O(C.sub.1-3 alkyl).

(390) As used herein, the term carboxy refers to a group of formula C(O)OH.

(391) As used herein, the term di(C.sub.n-m-alkyl)amino refers to a group of formula N(alkyl).sub.2, wherein the two alkyl groups each has, independently, n to m carbon atoms. In some embodiments, each alkyl group independently has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(392) As used herein, the term di(C.sub.n-m-alkyl)carbamyl refers to a group of formula C(O)N(alkyl).sub.2, wherein the two alkyl groups each has, independently, n to m carbon atoms. In some embodiments, each alkyl group independently has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(393) As used herein, the term C.sub.n-m alkylcarbonyloxy is a group of formula OC(O) alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(394) As used herein, aminocarbonyloxy is a group of formula OC(O)NH.sub.2.

(395) As used herein, C.sub.n-m alkylaminocarbonyloxy is a group of formula OC(O)NH alkyl, wherein the alkyl group has n to m carbon atoms. In some embodiments, the alkyl group has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(396) As used herein, di(C.sub.n-malkyl)aminocarbonyloxy is a group of formula OC(O)N(alkyl).sub.2, wherein each alkyl group has, independently, n to m carbon atoms. In some embodiments, each alkyl group independently has 1 to 6, 1 to 4, or 1 to 3 carbon atoms.

(397) As used herein C.sub.n-m alkoxycarbonylamino refers to a group of formula NHC(O)O-alkyl, wherein the alkyl group has n to m carbon atoms.

(398) As used herein, cycloalkyl refers to non-aromatic cyclic hydrocarbons including cyclized alkyl and alkenyl groups. Cycloalkyl groups can include mono- or polycyclic (e.g., having 2, 3 or 4 fused rings) groups, spirocycles, and bridged rings (e.g., a bridged bicycloalkyl group). Ring-forming carbon atoms of a cycloalkyl group can be optionally substituted by oxo or sulfido (e.g., C(O) or C(S)). Also included in the definition of cycloalkyl are moieties that have one or more aromatic rings fused (i.e., having a bond in common with) to the cycloalkyl ring, for example, benzo or thienyl derivatives of cyclopentane, cyclohexane, and the like. A cycloalkyl group containing a fused aromatic ring can be attached through any ring-forming atom including a ring-forming atom of the fused aromatic ring. Cycloalkyl groups can have 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13 or 14 ring-forming carbons (i.e., C.sub.3-14). In some embodiments, cycloalkyl is C.sub.3-14 cycloalkyl, wherein 1, 2, 3, or 4 ring-forming carbon atoms of said C.sub.3-14 cycloalkyl can be optionally substituted by one or more oxo or sulfido. In some embodiments, the cycloalkyl is a C.sub.3-10 monocyclic or bicyclic cycloalkyl. In some embodiments, the cycloalkyl is a C.sub.3-7 monocyclic cycloalkyl. In some embodiments, the cycloalkyl is a C.sub.4-7 monocyclic cycloalkyl. In some embodiments, the cycloalkyl is a C.sub.4-14 spirocycle or bridged cycloalkyl (e.g., a bridged bicycloalkyl group). Example cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclopentenyl, cyclohexenyl, cyclohexadienyl, cycloheptatrienyl, norbornyl, norpinyl, norcarnyl, cubane, adamantane, bicyclo[1.1.1]pentyl, bicyclo[2.1.1]hexyl, bicyclo[2.2.1]heptanyl, bicyclo[3.1.1]heptanyl, bicyclo[2.2.2]octanyl, spiro[3.3]heptanyl, and the like. In some embodiments, cycloalkyl is cyclopropyl, cyclobutyl, cyclopentyl, or cyclohexyl.

(399) As used herein, heteroaryl refers to a monocyclic or polycyclic (e.g., having 2, 3, or 4 fused rings) aromatic heterocycle having at least one heteroatom ring member selected from N, O, S and B. In some embodiments, the heteroaryl ring has 1, 2, 3, or 4 heteroatom ring members independently selected from N, O, S and B. In some embodiments, any ring-forming N in a heteroaryl moiety can be an N-oxide. In some embodiments, the heteroaryl is a monocyclic, bicyclic, or tricyclic 5-14 membered heteroaryl having 1, 2, 3, or 4 heteroatom ring members independently selected from N, O, and S. In some embodiments, the heteroaryl is a 5-10 membered monocyclic or bicyclic heteroaryl having 1, 2, 3, or 4 heteroatom ring members independently selected from N, O, and S. In some embodiments, the heteroaryl is a 5-6 monocyclic heteroaryl having 1 or 2 heteroatom ring members independently selected from N, O, and S. In some embodiments, the heteroaryl is a 5-6 monocyclic heteroaryl having 1 or 2 heteroatom ring members independently selected from N, O, and S. In some embodiments, the heteroaryl group contains 5 to 14, 5 to 10, 5 to 6, or 5 to 6 ring-forming atoms. In some embodiments, the heteroaryl group has 1 to 4 ring-forming heteroatoms, 1 to 3 ring-forming heteroatoms, 1 to 2 ring-forming heteroatoms or 1 ring-forming heteroatom. When the heteroaryl group contains more than one heteroatom ring member, the heteroatoms may be the same or different. Example heteroaryl groups include, but are not limited to, pyridyl, pyrimidinyl, pyrazinyl, pyridazinyl, pyrrolyl, pyrazolyl, azolyl, oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, imidazolyl, furyl, thienyl, triazolyl (e.g., 1,2,3-triazolyl, 1,2,4-triazolyl, 1,3,4-triazolyl), tetrazolyl, thiadiazolyl (e.g., 1,2,3-thiadiazolyl, 1,2,4-thiadiazolyl, 1,3,4-thiadiazolyl), quinolinyl, isoquinolinyl, indolyl, benzothienyl, benzofuran, benzisoxazole, imidazo[1, 2-b]thiazolyl, purinyl, triazinyl, thieno[3,2-b]pyridinyl, imidazo[1,2-a]pyridinyl, 1,5-naphthyridinyl, 1H-pyrazolo[4,3-b]pyridinyl, and oxadiazolyl (e.g., 1,2,3-oxadiazolyl, 1,2,4-oxadiazolyl, 1,3,4-oxadiazolyl).

(400) As used herein, heterocycloalkyl refers to monocyclic or polycyclic heterocycles having at least one non-aromatic ring (saturated or partially unsaturated ring), wherein one or more of the ring-forming carbon atoms of the heterocycloalkyl is replaced by a heteroatom selected from N, O, S, and B, and wherein the ring-forming carbon atoms and heteroatoms of the heterocycloalkyl group can be optionally substituted by one or more oxo or sulfido (e.g., C(O), S(O), C(S), or S(O).sub.2, etc.). Heterocycloalkyl groups include monocyclic and polycyclic (e.g., having 2 fused rings) systems. Included in heterocycloalkyl are monocyclic and polycyclic 4-14, 4-12, 4-10, 5-7, 4-7, 4-6, and 5-6-membered heterocycloalkyl groups. Heterocycloalkyl groups can also include spirocycles and bridged rings (e.g., a 5-10 membered bridged biheterocycloalkyl ring having one or more of the ring-forming carbon atoms replaced by a heteroatom independently selected from N, O, S, and B). The heterocycloalkyl group can be attached through a ring-forming carbon atom or a ring-forming heteroatom. In some embodiments, the heterocycloalkyl group contains 0 to 3 double bonds. In some embodiments, the heterocycloalkyl group contains 0 to 2 double bonds.

(401) Also included in the definition of heterocycloalkyl are moieties that have one or more aromatic rings fused (i.e., having a bond in common with) to the non-aromatic heterocyclic ring, for example, benzo or thienyl derivatives of piperidine, morpholine, azepine, etc. A heterocycloalkyl group containing a fused aromatic ring can be attached through any ring-forming atom including a ring-forming atom of the fused aromatic ring.

(402) In some embodiments, the heterocycloalkyl group contains 4 to 14 ring-forming atoms, 4 to 10 ring-forming atoms, 4 to 7 ring-forming atoms, 4 to 6 ring-forming atoms, or 5 to 6 ring-forming atoms. In some embodiments, the heterocycloalkyl group has 1 to 4 heteroatoms, 1 to 3 heteroatoms, 1 to 2 heteroatoms or 1 heteroatom. In some embodiments, the heterocycloalkyl is a monocyclic 4-6 membered heterocycloalkyl having 1 or 2 heteroatoms independently selected from N, O, S, and B and having one or more oxidized ring members. In some embodiments, the heterocycloalkyl is a 4-10 membered monocyclic, bicyclic, or tricyclic heterocycloalkyl having 1, 2, 3, or 4 ring-forming heteroatoms independently selected from N, O, and S, wherein 1, 2, 3, or 4 ring-forming carbon or heteroatoms can be optionally substituted by one or more oxo or sulfido. In some embodiments, the heterocycloalkyl is a 4-7 membered monocyclic heterocycloalkyl having 1 or 2 ring-forming heteroatoms independently selected from N, O, and S, and wherein 1, 2 or 3 ring-forming carbon or heteroatoms can be optionally substituted by one or more oxo or sulfido.

(403) Non-limiting examples of heterocycloalkyl groups include pyrrolidin-2-one, 1,3-isoxazolidin-2-one, pyranyl, tetrahydropyran, oxetanyl, azetidinyl, morpholino, thiomorpholino, piperazinyl, tetrahydrofuranyl, tetrahydrothienyl, piperidinyl, pyrrolidinyl, isoxazolidinyl, isothiazolidinyl, pyrazolidinyl, oxazolidinyl, thiazolidinyl, imidazolidinyl, azepanyl, 1,2,3,4-tetrahydroisoquinoline, benzazapene, azabicyclo[3.1.0]hexanyl, diazabicyclo[3.1.0]hexanyl, oxabicyclo[2.1.1]hexanyl, azabicyclo[2.2.1]heptanyl, diazabicyclo[2.2.1]heptanyl, azabicyclo[3.1.1]heptanyl, diazabicyclo[3.1.1]heptanyl, azabicyclo[3.2.1]octanyl, diazabicyclo[3.2.1]octanyl, oxabicyclo[2.2.2]octanyl, azabicyclo[2.2.2]octanyl, azaadamantanyl, diazaadamantanyl, oxa-adamantanyl, azaspiro[3.3]heptanyl, diazaspiro[3.3]heptanyl, oxa-azaspiro[3.3]heptanyl, azaspiro[3.4]octanyl, diazaspiro[3.4]octanyl, oxa-azaspiro[3.4]octanyl, azaspiro[2.5]octanyl, diazaspiro[2.5]octanyl, azaspiro[4.4]nonanyl, diazaspiro[4.4]nonanyl, oxa-azaspiro[4.4]nonanyl, azaspiro[4.5]decanyl, diazaspiro[4.5]decanyl, diazaspiro[4.4]nonanyl, oxa-diazaspiro[4.4]nonanyl, 1,6-dihydropyridinyl, and the like.

(404) As used herein, C.sub.o-p cycloalkyl-C.sub.n-m alkyl- refers to a group of formula cycloalkyl-alkylene-, wherein the cycloalkyl has o to p carbon atoms and the alkylene linking group has n to m carbon atoms.

(405) As used herein C.sub.o-p aryl-C.sub.n-m alkyl- refers to a group of formula aryl-alkylene-, wherein the aryl has o to p carbon atoms and the alkylene linking group has n to m carbon atoms.

(406) As used herein, heteroaryl-C.sub.n-m alkyl- refers to a group of formula heteroaryl-alkylene-, wherein alkylene linking group has n to m carbon atoms.

(407) As used herein heterocycloalkyl-C.sub.n-m alkyl- refers to a group of formula heterocycloalkyl-alkylene-, wherein alkylene linking group has n to m carbon atoms.

(408) As used herein, an alkyl linking group is a bivalent straight chain or branched alkyl linking group (alkylene group). For example, C.sub.o-p cycloalkyl-C.sub.n-m alkyl-, C.sub.o-p aryl-C.sub.n-m alkyl-, phenyl-C.sub.n-m alkyl-, heteroaryl-C.sub.n-m alkyl-, and heterocycloalkyl-C.sub.n-m alkyl- contain alkyl linking groups. Examples of alkyl linking groups or alkylene groups include methylene, ethan-1,1-diyl, ethan-1,2-diyl, propan-1,3-dilyl, propan-1,2-diyl, propan-1,1-diyl and the like.

(409) As used herein, the term oxo refers to an oxygen atom (i.e., O) as a divalent substituent, forming a carbonyl group when attached to a carbon (e.g., CO or C(O)), or attached to a nitrogen or sulfur heteroatom forming a nitroso, sulfinyl or sulfonyl group.

(410) As used herein, the term independently selected from means that each occurrence of a variable or substituent are independently selected at each occurrence from the applicable list.

(411) At certain places, the definitions or embodiments refer to specific rings (e.g., an azetidine ring, a pyridine ring, etc.). Unless otherwise indicated, these rings can be attached to any ring member provided that the valency of the atom is not exceeded. For example, an azetidine ring may be attached at any position of the ring, whereas a pyridin-3-yl ring is attached at the 3-position.

(412) The compounds described herein can be asymmetric (e.g., having one or more stereocenters). All stereoisomers, such as enantiomers and diastereomers, are intended unless otherwise indicated. Compounds of the present disclosure that contain asymmetrically substituted carbon atoms can be isolated in optically active or racemic forms. Methods on how to prepare optically active forms from optically inactive starting materials are known in the art, such as by resolution of racemic mixtures or by stereoselective synthesis. Many geometric isomers of olefins, CN double bonds, and the like can also be present in the compounds described herein, and all such stable isomers are contemplated in the present invention. Cis and trans geometric isomers of the compounds of the present disclosure are described and may be isolated as a mixture of isomers or as separated isomeric forms. In some embodiments, the compound has the (R)-configuration. In some embodiments, the compound has the (S)-configuration. The Formulas (e.g., Formula (I), (II), etc.) provided herein include stereoisomers of the compounds.

(413) Resolution of racemic mixtures of compounds can be carried out by any of numerous methods known in the art. An example method includes fractional recrystallization using a chiral resolving acid which is an optically active, salt-forming organic acid. Suitable resolving agents for fractional recrystallization methods are, for example, optically active acids, such as the D and L forms of tartaric acid, diacetyltartaric acid, dibenzoyltartaric acid, mandelic acid, malic acid, lactic acid or the various optically active camphorsulfonic acids such as 0-camphorsulfonic acid. Other resolving agents suitable for fractional crystallization methods include stereoisomerically pure forms of -methylbenzylamine (e.g., S and R forms, or diastereomerically pure forms), 2-phenylglycinol, norephedrine, ephedrine, N-methylephedrine, cyclohexylethylamine, 1,2-diaminocyclohexane, and the like.

(414) Resolution of racemic mixtures can also be carried out by elution on a column packed with an optically active resolving agent (e.g., dinitrobenzoylphenylglycine). Suitable elution solvent composition can be determined by one skilled in the art.

(415) Compounds provided herein also include tautomeric forms. Tautomeric forms result from the swapping of a single bond with an adjacent double bond together with the concomitant migration of a proton. Tautomeric forms include prototropic tautomers which are isomeric protonation states having the same empirical formula and total charge. Example prototropic tautomers include ketoneenol pairs, amideimidic acid pairs, lactamlactim pairs, enamineimine pairs, and annular forms where a proton can occupy two or more positions of a heterocyclic system, for example, 1H- and 3H-imidazole, 1H-, 2H- and 4H-1,2,4-triazole, 1H- and 2H-isoindole, 2-hydroxypyridine and 2-pyridone, and 1H- and 2H-pyrazole. Tautomeric forms can be in equilibrium or sterically locked into one form by appropriate substitution.

(416) All compounds, and pharmaceutically acceptable salts thereof, can be found together with other substances such as water and solvents (e.g., hydrates and solvates) or can be isolated.

(417) In some embodiments, preparation of compounds can involve the addition of acids or bases to affect, for example, catalysis of a desired reaction or formation of salt forms such as acid addition salts.

(418) In some embodiments, the compounds provided herein, or salts thereof, are substantially isolated. By substantially isolated is meant that the compound is at least partially or substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compounds provided herein. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compounds provided herein, or salt thereof. Methods for isolating compounds and their salts are routine in the art.

(419) The term compound as used herein is meant to include all stereoisomers, geometric isomers, tautomers, and isotopes of the structures depicted. Compounds herein identified by name or structure as one particular tautomeric form are intended to include other tautomeric forms unless otherwise specified.

(420) The phrase pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.

(421) The present application also includes pharmaceutically acceptable salts of the compounds described herein. As used herein, pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form. Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. The pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. The pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, non-aqueous media like ether, ethyl acetate, alcohols (e.g., methanol, ethanol, iso-propanol, or butanol) or acetonitrile (ACN) are preferred. Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418 and Journal of Pharmaceutical Science, 66, 2 (1977), each of which is incorporated herein by reference in its entirety.

(422) Synthesis

(423) As will be appreciated by those skilled in the art, the compounds provided herein, including salts and stereoisomers thereof, can be prepared using known organic synthesis techniques and can be synthesized according to any of numerous possible synthetic routes, such as those provided in the in the Schemes below.

(424) The reactions for preparing compounds described herein can be carried out in suitable solvents which can be readily selected by one of skill in the art of organic synthesis. Suitable solvents can be substantially non-reactive with the starting materials (reactants), the intermediates or products at the temperatures at which the reactions are carried out, e.g., temperatures which can range from the solvent's freezing temperature to the solvent's boiling temperature. A given reaction can be carried out in one solvent or a mixture of more than one solvent. Depending on the particular reaction step, suitable solvents for a particular reaction step can be selected by the skilled artisan.

(425) The expressions, ambient temperature or room temperature or r.t. as used herein, are understood in the art, and refer generally to a temperature, e.g., a reaction temperature, that is about the temperature of the room in which the reaction is carried out, for example, a temperature from about 20 C. to about 30 C.

(426) Preparation of compounds described herein can involve the protection and deprotection of various chemical groups. The need for protection and deprotection, and the selection of appropriate protecting groups, can be readily determined by one skilled in the art. The chemistry of protecting groups can be found, for example, e.g., Wuts et al., Protective Groups in Organic Synthesis, 4th Ed., Wiley (2006).

(427) Reactions can be monitored according to any suitable method known in the art. For example, product formation can be monitored by spectroscopic means, such as nuclear magnetic resonance spectroscopy (e.g., .sup.1H or .sup.13C), infrared spectroscopy, spectrophotometry (e.g., UV-visible), mass spectrometry or by chromatographic methods such as high performance liquid chromatography (HPLC), liquid chromatography-mass spectroscopy (LCMS), or thin layer chromatography (TLC). Compounds can be purified by those skilled in the art by a variety of methods, including high performance liquid chromatography (HPLC) and normal phase silica chromatography.

(428) The Schemes below provide general guidance in connection with preparing the compounds of the invention. One skilled in the art would understand that the preparations shown in the Schemes can be modified or optimized using general knowledge of organic chemistry to prepare various compounds of the invention.

(429) For instance, compounds of Formula (I) with variation at Ring A can be prepared as shown in Scheme 1. In the process depicted in Scheme 1, selective displacement of the chloro group of the trihalo pyrimidine 1-1 with the desired amine provides compounds of formula 1-2. Intermediate 1-2 can be reacted via a selective Negishi cross coupling reaction (CCR) with an appropriate palladium precatalyst/ligand combination (e.g., Pd.sub.2(dba).sub.3 with QPhos or XPhos) to yield intermediate 1-3. Intermediate 1-3 can then be reacted via base promoted cyclization to provide a compound of formula 1-4. The desired substitution a to the amide of intermediate 1-4 can then be introduced (e.g., via successive alkylation or Pd catalyzed arylation) to provide a compound of formula 1-5. Alternatively, reaction with a bis electrophile (e.g., 1,2-dibromoethane) under standard alkylation conditions provides compounds of formula 1-5 where R.sub.2 and R.sub.3 combined to form a cycle. Finally, Buchwald-Hartwig amination with the appropriate substituted aniline derivative provides compounds of Formula (I).

(430) ##STR00010##

(431) Alternatively, if variation at R.sup.1 is desired, the general reaction sequence shown in Scheme 2 can be utilized. Thus, introduction of R.sup.2 and R.sup.3 of compound 2-1 as above provides compound 2-2, which can undergo selective oxidation of the sulfur by i.e., m-CPBA to provide compound 2-3. Selective SN.sub.Ar reaction at the resulting sulfone with the appropriate formyl amide of general formula 2-4 followed by sodium hydroxide treatment to cleave the formamide (i.e., with sodium hydroxide) provides compound 2-5. Finally, a substitution/cyclization sequence with the appropriate amine nucleophile provides compounds of general formula (I). The substitution can be achieved in two ways: tandem Buchwald-Hartwig amination and cyclization, catalyzed by the appropriate preformed catalyst (i.e., RuPhos 2.sup.nd generation precatalyst or XantPhos 2.sup.nd generation precatalyst) or a direct SN.sub.Ar reaction under appropriate acidic (i.e., TFA in 1,1,1-trifluoroethanol) or basic (i.e., Hunig's base in iso-amyl alcohol) conditions. Substitution is followed by cyclization, either directly with the appropriate base (i.e., sodium hydride) or through the corresponding acid via amide bond formation (with, for example, HATU as the coupling agent).

(432) ##STR00011##
Methods of Use

(433) Compounds of the present disclosure can inhibit CDK2 and therefore are useful for treating diseases wherein the underlying pathology is, wholly or partially, mediated by CDK2. Such diseases include cancer and other diseases with proliferation disorder. In some embodiments, the present disclosure provides treatment of an individual or a patient in vivo using a compound of Formula (I) or a salt or stereoisomer thereof such that growth of cancerous tumors is inhibited. A compound of Formula (I) or of any of the formulas as described herein, or a compound as recited in any of the claims and described herein, or a salt or stereoisomer thereof, can be used to inhibit the growth of cancerous tumors with aberrations that activate the CDK2 kinase activity. These include, but not limited to, disease (e.g., cancers) that are characterized by amplification or overexpression of CCNE1 such as ovarian cancer, uterine carcinosarcoma and breast cancer and p27 inactivation such as breast cancer and melanomas. Accordingly, in some embodiments of the methods, the patient has been previously determined to have an amplification of the cyclin E1 (CCNE1) gene and/or an expression level of CCNE1 in a biological sample obtained from the human subject that is higher than a control expression level of CCNE1. Alternatively, a compound of Formula (I) or of any of the formulas as described herein, or a compound as recited in any of the claims and described herein, or a salt or stereoisomer thereof, can be used in conjunction with other agents or standard cancer treatments, as described below. In one embodiment, the present disclosure provides a method for inhibiting growth of tumor cells in vitro. The method includes contacting the tumor cells in vitro with a compound of Formula (I) or of any of the formulas as described herein, or of a compound as recited in any of the claims and described herein, or of a salt or stereoisomer thereof. In another embodiment, the present disclosure provides a method for inhibiting growth of tumor cells with CCNE1 amplification and overexpression in an individual or a patient. The method includes administering to the individual or patient in need thereof a therapeutically effective amount of a compound of Formula (I) or of any of the formulas as described herein, or of a compound as recited in any of the claims and described herein, or a salt or a stereoisomer thereof.

(434) In some embodiments, provided herein is a method of inhibiting CDK2, comprising contacting the CDK2 with a compound of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or a salt thereof. In some embodiments, provided herein is a method of inhibiting CDK2 in a patient, comprising administering to the patient a compound of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or a salt thereof.

(435) In some embodiments, provided herein is a method for treating cancer. The method includes administering to a patient (in need thereof), a therapeutically effective amount of a compound of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or a salt thereof. In another embodiment, the cancer is characterized by amplification or overexpression of CCNE1. In some embodiments, the cancer is ovarian cancer or breast cancer, characterized by amplification or overexpression of CCNE1.

(436) In some embodiments, provided herein is a method of treating a disease or disorder associated with CDK2 in a patient, comprising administering to the patient a therapeutically effective amount of a compound of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or a salt thereof. In some embodiments, the disease or disorder associated with CDK2 is associated with an amplification of the cyclin E1 (CCNE1) gene and/or overexpression of CCNE1.

(437) In some embodiments, the disease or disorder associated with CDK2 is N-myc amplified neuroblastoma cells (see Molenaar et al., Proc. Natl. Acad. Sci. USA, 2009, 106(31):12968-12973), K-Ras mutant lung cancers (see Hu, S., et al., Mol. Cancer Ther., 2015, 14(11):2576-85), and cancers with FBW7 mutation and CCNE1 overexpression (see Takada et al., Cancer Res., 2017, 77(18):4881-4893).

(438) In some embodiments, the disease or disorder associated with CDK2 is lung squamous cell carcinoma, lung adenocarcinoma, pancreatic adenocarcinoma, breast invasive carcinoma, uterine carcinosarcoma, ovarian serous cystadenocarcinoma, stomach adenocarcinoma, esophageal carcinoma, bladder urothelial carcinoma, mesothelioma, or sarcoma.

(439) In some embodiments, the disease or disorder associated with CDK2 is lung adenocarcinoma, breast invasive carcinoma, uterine carcinosarcoma, ovarian serous cystadenocarcinoma, or stomach adenocarcinoma.

(440) In some embodiments, the disease or disorder associated with CDK2 is an adenocarcinoma, carcinoma, or cystadenocarcinoma.

(441) In some embodiments, the disease or disorder associated with CDK2 is uterine cancer, ovarian cancer, stomach cancer, esophageal cancer, lung cancer, bladder cancer, pancreatic cancer, or breast cancer.

(442) In some embodiments, the disease or disorder associated with CDK2 is a cancer.

(443) In some embodiments, the cancer is characterized by amplification or overexpression of CCNE1. In some embodiments, the cancer is ovarian cancer or breast cancer, characterized by amplification or overexpression of CCNE1.

(444) In some embodiments, the breast cancer is chemotherapy or radiotherapy resistant breast cancer, endocrine resistant breast cancer, trastuzumab resistant breast cancer, or breast cancer demonstrating primary or acquired resistance to CDK4/6 inhibition. In some embodiments, the breast cancer is advanced or metastatic breast cancer.

(445) Examples of cancers that are treatable using the compounds of the present disclosure include, but are not limited to, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, testicular cancer, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the endometrium, endometrial cancer, carcinoma of the cervix, carcinoma of the vagina, carcinoma of the vulva, Hodgkin's Disease, non-Hodgkin's lymphoma, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue, cancer of the urethra, cancer of the penis, chronic or acute leukemias including acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, solid tumors of childhood, lymphocytic lymphoma, cancer of the bladder, cancer of the kidney or urethra, carcinoma of the renal pelvis, neoplasm of the central nervous system (CNS), primary CNS lymphoma, tumor angiogenesis, spinal axis tumor, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid cancer, squamous cell cancer, T-cell lymphoma, environmentally induced cancers including those induced by asbestos, and combinations of said cancers. The compounds of the present disclosure are also useful for the treatment of metastatic cancers.

(446) In some embodiments, cancers treatable with compounds of the present disclosure include melanoma (e.g., metastatic malignant melanoma, BRAF and HSP90 inhibition-resistant melanoma), renal cancer (e.g., clear cell carcinoma), prostate cancer (e.g., hormone refractory prostate adenocarcinoma), breast cancer, colon cancer, lung cancer (e.g., non-small cell lung cancer and small cell lung cancer), squamous cell head and neck cancer, urothelial cancer (e.g., bladder) and cancers with high microsatellite instability (MSI.sup.high). Additionally, the disclosure includes refractory or recurrent malignancies whose growth may be inhibited using the compounds of the disclosure.

(447) In some embodiments, cancers that are treatable using the compounds of the present disclosure include, but are not limited to, solid tumors (e.g., prostate cancer, colon cancer, esophageal cancer, endometrial cancer, ovarian cancer, uterine cancer, renal cancer, hepatic cancer, pancreatic cancer, gastric cancer, breast cancer, lung cancer, cancers of the head and neck, thyroid cancer, glioblastoma, sarcoma, bladder cancer, etc.), hematological cancers (e.g., lymphoma, leukemia such as acute lymphoblastic leukemia (ALL), acute myelogenous leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), DLBCL, mantle cell lymphoma, Non-Hodgkin lymphoma (including relapsed or refractory NHL and recurrent follicular), Hodgkin lymphoma or multiple myeloma) and combinations of said cancers.

(448) In some embodiments, cancers that are treatable using the compounds of the present disclosure include, but are not limited to, cholangiocarcinoma, bile duct cancer, triple negative breast cancer, rhabdomyosarcoma, small cell lung cancer, leiomyosarcoma, hepatocellular carcinoma, Ewing's sarcoma, brain cancer, brain tumor, astrocytoma, neuroblastoma, neurofibroma, basal cell carcinoma, chondrosarcoma, epithelioid sarcoma, eye cancer, Fallopian tube cancer, gastrointestinal cancer, gastrointestinal stromal tumors, hairy cell leukemia, intestinal cancer, islet cell cancer, oral cancer, mouth cancer, throat cancer, laryngeal cancer, lip cancer, mesothelioma, neck cancer, nasal cavity cancer, ocular cancer, ocular melanoma, pelvic cancer, rectal cancer, renal cell carcinoma, salivary gland cancer, sinus cancer, spinal cancer, tongue cancer, tubular carcinoma, urethral cancer, and ureteral cancer.

(449) In some embodiments, the compounds of the present disclosure can be used to treat sickle cell disease and sickle cell anemia.

(450) In some embodiments, diseases and indications that are treatable using the compounds of the present disclosure include, but are not limited to hematological cancers, sarcomas, lung cancers, gastrointestinal cancers, genitourinary tract cancers, liver cancers, bone cancers, nervous system cancers, gynecological cancers, and skin cancers.

(451) Exemplary hematological cancers include lymphomas and leukemias such as acute lymphoblastic leukemia (ALL), acute myelogenous leukemia (AML), acute promyelocytic leukemia (APL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), diffuse large B-cell lymphoma (DLBCL), mantle cell lymphoma, Non-Hodgkin lymphoma (including relapsed or refractory NHL and recurrent follicular), Hodgkin lymphoma, myeloproliferative diseases (e.g., primary myelofibrosis (PMF), polycythemia vera (PV), and essential thrombocytosis (ET)), myelodysplasia syndrome (MDS), T-cell acute lymphoblastic lymphoma (T-ALL) and multiple myeloma (MM).

(452) Exemplary sarcomas include chondrosarcoma, Ewing's sarcoma, osteosarcoma, rhabdomyosarcoma, angiosarcoma, fibrosarcoma, liposarcoma, myxoma, rhabdomyoma, rhabdosarcoma, fibroma, lipoma, harmatoma, and teratoma.

(453) Exemplary lung cancers include non-small cell lung cancer (NSCLC), small cell lung cancer (SCLC), bronchogenic carcinoma, squamous cell, undifferentiated small cell, undifferentiated large cell, adenocarcinoma, alveolar (bronchiolar) carcinoma, bronchial adenoma, chondromatous hamartoma, and mesothelioma.

(454) Exemplary gastrointestinal cancers include cancers of the esophagus (squamous cell carcinoma, adenocarcinoma, leiomyosarcoma, lymphoma), stomach (carcinoma, lymphoma, leiomyosarcoma), pancreas (ductal adenocarcinoma, insulinoma, glucagonoma, gastrinoma, carcinoid tumors, vipoma), small bowel (adenocarcinoma, lymphoma, carcinoid tumors, Kaposi's sarcoma, leiomyoma, hemangioma, lipoma, neurofibroma, fibroma), large bowel (adenocarcinoma, tubular adenoma, villous adenoma, hamartoma, leiomyoma), and colorectal cancer.

(455) Exemplary genitourinary tract cancers include cancers of the kidney (adenocarcinoma, Wilm's tumor [nephroblastoma]), bladder and urethra (squamous cell carcinoma, transitional cell carcinoma, adenocarcinoma), prostate (adenocarcinoma, sarcoma), and testis (seminoma, teratoma, embryonal carcinoma, teratocarcinoma, choriocarcinoma, sarcoma, interstitial cell carcinoma, fibroma, fibroadenoma, adenomatoid tumors, lipoma).

(456) Exemplary liver cancers include hepatoma (hepatocellular carcinoma), cholangiocarcinoma, hepatoblastoma, angiosarcoma, hepatocellular adenoma, and hemangioma.

(457) Exemplary bone cancers include, for example, osteogenic sarcoma (osteosarcoma), fibrosarcoma, malignant fibrous histiocytoma, chondrosarcoma, Ewing's sarcoma, malignant lymphoma (reticulum cell sarcoma), multiple myeloma, malignant giant cell tumor chordoma, osteochronfroma (osteocartilaginous exostoses), benign chondroma, chondroblastoma, chondromyxofibroma, osteoid osteoma, and giant cell tumors

(458) Exemplary nervous system cancers include cancers of the skull (osteoma, hemangioma, granuloma, xanthoma, osteitis deformans), meninges (meningioma, meningiosarcoma, gliomatosis), brain (astrocytoma, medulloblastoma, glioma, ependymoma, germinoma (pinealoma), glioblastoma, glioblastoma multiform, oligodendroglioma, schwannoma, retinoblastoma, congenital tumors), and spinal cord (neurofibroma, meningioma, glioma, sarcoma), as well as neuroblastoma and Lhermitte-Duclos disease.

(459) Exemplary gynecological cancers include cancers of the uterus (endometrial carcinoma), cervix (cervical carcinoma, pre-tumor cervical dysplasia), ovaries (ovarian carcinoma (serous cystadenocarcinoma, mucinous cystadenocarcinoma, unclassified carcinoma), granulosa-thecal cell tumors, Sertoli-Leydig cell tumors, dysgerminoma, malignant teratoma), vulva (squamous cell carcinoma, intraepithelial carcinoma, adenocarcinoma, fibrosarcoma, melanoma), vagina (clear cell carcinoma, squamous cell carcinoma, botryoid sarcoma (embryonal rhabdomyosarcoma), and fallopian tubes (carcinoma).

(460) Exemplary skin cancers include melanoma, basal cell carcinoma, Merkel cell carcinoma, squamous cell carcinoma, Kaposi's sarcoma, moles dysplastic nevi, lipoma, angioma, dermatofibroma, and keloids. In some embodiments, diseases and indications that are treatable using the compounds of the present disclosure include, but are not limited to, sickle cell disease (e.g., sickle cell anemia), triple-negative breast cancer (TNBC), myelodysplastic syndromes, testicular cancer, bile duct cancer, esophageal cancer, and urothelial carcinoma.

(461) It is believed that compounds of Formula (I), or any of the embodiments thereof, may possess satisfactory pharmacological profile and promising biopharmaceutical properties, such as toxicological profile, metabolism and pharmacokinetic properties, solubility, and permeability. It will be understood that determination of appropriate biopharmaceutical properties is within the knowledge of a person skilled in the art, e.g., determination of cytotoxicity in cells or inhibition of certain targets or channels to determine potential toxicity.

(462) The terms individual or patient, used interchangeably, refer to any animal, including mammals, preferably mice, rats, other rodents, rabbits, dogs, cats, swine, cattle, sheep, horses, or primates, and most preferably humans.

(463) The phrase therapeutically effective amount refers to the amount of active compound or pharmaceutical agent that elicits the biological or medicinal response in a tissue, system, animal, individual or human that is being sought by a researcher, veterinarian, medical doctor or other clinician.

(464) As used herein, the term treating or treatment refers to one or more of (1) inhibiting the disease; e.g., inhibiting a disease, condition or disorder in an individual who is experiencing or displaying the pathology or symptomatology of the disease, condition or disorder (i.e., arresting further development of the pathology and/or symptomatology); and (2) ameliorating the disease; e.g., ameliorating a disease, condition or disorder in an individual who is experiencing or displaying the pathology or symptomatology of the disease, condition or disorder (i.e., reversing the pathology and/or symptomatology) such as decreasing the severity of disease.

(465) In some embodiments, the compounds of the invention are useful in preventing or reducing the risk of developing any of the diseases referred to herein; e.g., preventing or reducing the risk of developing a disease, condition or disorder in an individual who may be predisposed to the disease, condition or disorder but does not yet experience or display the pathology or symptomatology of the disease.

(466) Combination Therapies

(467) I. Cancer Therapies

(468) Cancer cell growth and survival can be impacted by dysfunction in multiple signaling pathways. Thus, it is useful to combine different enzyme/protein/receptor inhibitors, exhibiting different preferences in the targets which they modulate the activities of, to treat such conditions. Targeting more than one signaling pathway (or more than one biological molecule involved in a given signaling pathway) may reduce the likelihood of drug-resistance arising in a cell population, and/or reduce the toxicity of treatment.

(469) One or more additional pharmaceutical agents such as, for example, chemotherapeutics, anti-inflammatory agents, steroids, immunosuppressants, immune-oncology agents, metabolic enzyme inhibitors, chemokine receptor inhibitors, and phosphatase inhibitors, as well as targeted therapies such as Bcr-Abl, Flt-3, EGFR, HER2, JAK, c-MET, VEGFR, PDGFR, c-Kit, IGF-1R, RAF, FAK, and CDK4/6 kinase inhibitors such as, for example, those described in WO 2006/056399 can be used in combination with the compounds of the present disclosure for treatment of CDK2-associated diseases, disorders or conditions. Other agents such as therapeutic antibodies can be used in combination with the compounds of the present disclosure for treatment of CDK2-associated diseases, disorders or conditions. The one or more additional pharmaceutical agents can be administered to a patient simultaneously or sequentially.

(470) In some embodiments, the CDK2 inhibitor is administered or used in combination with a BCL2 inhibitor or a CDK4/6 inhibitor.

(471) The compounds as disclosed herein can be used in combination with one or more other enzyme/protein/receptor inhibitors therapies for the treatment of diseases, such as cancer and other diseases or disorders described herein. Examples of diseases and indications treatable with combination therapies include those as described herein. Examples of cancers include solid tumors and non-solid tumors, such as liquid tumors, blood cancers. Examples of infections include viral infections, bacterial infections, fungus infections or parasite infections. For example, the compounds of the present disclosure can be combined with one or more inhibitors of the following kinases for the treatment of cancer: Akt1, Akt2, Akt3, BCL2, CDK4/6, TGF-R, PKA, PKG, PKC, CaM-kinase, phosphorylase kinase, MEKK, ERK, MAPK, mTOR, EGFR, HER2, HER3, HER4, INS-R, IDH2, IGF-1R, IR-R, PDGFQR, PDGFQR, PI3K (alpha, beta, gamma, delta, and multiple or selective), CSF1R, KIT, FLK-II, KDR/FLK-1, FLK-4, fit-1, FGFR1, FGFR2, FGFR3, FGFR4, c-Met, PARP, Ron, Sea, TRKA, TRKB, TRKC, TAM kinases (Axl, Mer, Tyro3), FLT3, VEGFR/Flt2, Flt4, EphA1, EphA2, EphA3, EphB2, EphB4, Tie2, Src, Fyn, Lck, Fgr, Btk, Fak, SYK, FRK, JAK, ABL, ALK and B-Raf. In some embodiments, the compounds of the present disclosure can be combined with one or more of the following inhibitors for the treatment of cancer or infections. Non-limiting examples of inhibitors that can be combined with the compounds of the present disclosure for treatment of cancer and infections include an FGFR inhibitor (FGFR1, FGFR2, FGFR3 or FGFR4, e.g., pemigatinib (INCB54828), INCB62079), an EGFR inhibitor (also known as ErB-1 or HER-1; e.g., erlotinib, gefitinib, vandetanib, orsimertinib, cetuximab, necitumumab, or panitumumab), a VEGFR inhibitor or pathway blocker (e.g., bevacizumab, pazopanib, sunitinib, sorafenib, axitinib, regorafenib, ponatinib, cabozantinib, vandetanib, ramucirumab, lenvatinib, ziv-aflibercept), a PARP inhibitor (e.g., olaparib, rucaparib, veliparib or niraparib), a JAK inhibitor (JAK1 and/or JAK2, e.g., ruxolitinib or baricitinib; JAK1, e.g., itacitinib (INCB39110), INCB052793, or INCB054707), an IDO inhibitor (e.g., epacadostat, NLG919, or BMS-986205, MK7162), an LSD1 inhibitor (e.g., GSK2979552, INCB59872 and INCB60003), a TDO inhibitor, a PI3K-delta inhibitor (e.g., parsaclisib (INCB50465) or INCB50797), a PI3K-gamma inhibitor such as PI3K-gamma selective inhibitor, a Pim inhibitor (e.g., INCB53914), a CSF1R inhibitor, a TAM receptor tyrosine kinases (Tyro-3, Axl, and Mer; e.g., INCB081776), an adenosine receptor antagonist (e.g., A2a/A2b receptor antagonist), an HPK1 inhibitor, a chemokine receptor inhibitor (e.g., CCR2 or CCR5 inhibitor), a SHP1/2 phosphatase inhibitor, a histone deacetylase inhibitor (HDAC) such as an HDAC8 inhibitor, an angiogenesis inhibitor, an interleukin receptor inhibitor, bromo and extra terminal family members inhibitors (for example, bromodomain inhibitors or BET inhibitors such as INCB54329 and INCB57643), c-MET inhibitors (e.g., capmatinib), an anti-CD19 antibody (e.g., tafasitamab), an ALK2 inhibitor (e.g., INCB00928); or combinations thereof.

(472) In some embodiments, the compound or salt described herein is administered with a PI3K inhibitor. In some embodiments, the compound or salt described herein is administered with a JAK inhibitor. In some embodiments, the compound or salt described herein is administered with a JAK1 or JAK2 inhibitor (e.g., baricitinib or ruxolitinib). In some embodiments, the compound or salt described herein is administered with a JAK1 inhibitor. In some embodiments, the compound or salt described herein is administered with a JAK1 inhibitor, which is selective over JAK2.

(473) Example antibodies for use in combination therapy include, but are not limited to, trastuzumab (e.g., anti-HER2), ranibizumab (e.g., anti-VEGF-A), bevacizumab (AVASTIN, e.g., anti-VEGF), panitumumab (e.g., anti-EGFR), cetuximab (e.g., anti-EGFR), rituxan (e.g., anti-CD20), and antibodies directed to c-MET.

(474) One or more of the following agents may be used in combination with the compounds of the present disclosure and are presented as a non-limiting list: a cytostatic agent, cisplatin, doxorubicin, taxotere, taxol, etoposide, irinotecan, camptosar, topotecan, paclitaxel, docetaxel, epothilones, tamoxifen, 5-fluorouracil, methotrexate, temozolomide, cyclophosphamide, SCH 66336, R115777, L778,123, BMS 214662, IRESSA (gefitinib), TARCEVA (erlotinib), antibodies to EGFR, intron, ara-C, adriamycin, cytoxan, gemcitabine, uracil mustard, chlormethine, ifosfamide, melphalan, chlorambucil, pipobroman, triethylenemelamine, triethylenethiophosphoramine, busulfan, carmustine, lomustine, streptozocin, dacarbazine, floxuridine, cytarabine, 6-mercaptopurine, 6-thioguanine, fludarabine phosphate, oxaliplatin, leucovirin, ELOXATIN (oxaliplatin), pentostatine, vinblastine, vincristine, vindesine, bleomycin, dactinomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, mithramycin, deoxycoformycin, mitomycin-C, L-asparaginase, teniposide 17.alpha.-ethinylestradiol, diethylstilbestrol, testosterone, Prednisone, Fluoxymesterone, Dromostanolone propionate, testolactone, megestrolacetate, methylprednisolone, methyltestosterone, prednisolone, triamcinolone, chlorotrianisene, hydroxyprogesterone, aminoglutethimide, estramustine, medroxyprogesteroneacetate, leuprolide, flutamide, toremifene, goserelin, carboplatin, hydroxyurea, amsacrine, procarbazine, mitotane, mitoxantrone, levamisole, navelbene, anastrazole, letrazole, capecitabine, reloxafine, droloxafine, hexamethylmelamine, avastin, HERCEPTIN (trastuzumab), BEXXAR (tositumomab), VELCADE (bortezomib), ZEVALIN (ibritumomab tiuxetan), TRISENOX (arsenic trioxide), XELODA (capecitabine), vinorelbine, porfimer, ERBITUX (cetuximab), thiotepa, altretamine, melphalan, trastuzumab, lerozole, fulvestrant, exemestane, ifosfomide, rituximab, C225 (cetuximab), Campath (alemtuzumab), clofarabine, cladribine, aphidicolon, rituxan, sunitinib, dasatinib, tezacitabine, Smll, fludarabine, pentostatin, triapine, didox, trimidox, amidox, 3-AP, and MDL-101,731.

(475) The compounds of the present disclosure can further be used in combination with other methods of treating cancers, for example by chemotherapy, irradiation therapy, tumor-targeted therapy, adjuvant therapy, immunotherapy or surgery. Examples of immunotherapy include cytokine treatment (e.g., interferons, GM-CSF, G-CSF, IL-2), CRS-207 immunotherapy, cancer vaccine, monoclonal antibody, bispecific or multi-specific antibody, antibody drug conjugate, adoptive T cell transfer, Toll receptor agonists, RIG-I agonists, oncolytic virotherapy and immunomodulating small molecules, including thalidomide or JAK1/2 inhibitor, PI3K inhibitor and the like. The compounds can be administered in combination with one or more anti-cancer drugs, such as a chemotherapeutic agent. Examples of chemotherapeutics include any of abarelix, aldesleukin, alemtuzumab, alitretinoin, allopurinol, altretamine, anastrozole, arsenic trioxide, asparaginase, azacitidine, bevacizumab, bexarotene, baricitinib, bleomycin, bortezomib, busulfan intravenous, busulfan oral, calusterone, capecitabine, carboplatin, carmustine, cetuximab, chlorambucil, cisplatin, cladribine, clofarabine, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, dalteparin sodium, dasatinib, daunorubicin, decitabine, denileukin, denileukin diftitox, dexrazoxane, docetaxel, doxorubicin, dromostanolone propionate, eculizumab, epirubicin, erlotinib, estramustine, etoposide phosphate, etoposide, exemestane, fentanyl citrate, filgrastim, floxuridine, fludarabine, fluorouracil, fulvestrant, gefitinib, gemcitabine, gemtuzumab ozogamicin, goserelin acetate, histrelin acetate, ibritumomab tiuxetan, idarubicin, ifosfamide, imatinib mesylate, interferon alfa 2a, irinotecan, lapatinib ditosylate, lenalidomide, letrozole, leucovorin, leuprolide acetate, levamisole, lomustine, meclorethamine, megestrol acetate, melphalan, mercaptopurine, methotrexate, methoxsalen, mitomycin C, mitotane, mitoxantrone, nandrolone phenpropionate, nelarabine, nofetumomab, oxaliplatin, paclitaxel, pamidronate, panitumumab, pegaspargase, pegfilgrastim, pemetrexed disodium, pentostatin, pipobroman, plicamycin, procarbazine, quinacrine, rasburicase, rituximab, ruxolitinib, sorafenib, streptozocin, sunitinib, sunitinib maleate, tamoxifen, temozolomide, teniposide, testolactone, thalidomide, thioguanine, thiotepa, topotecan, toremifene, tositumomab, trastuzumab, tretinoin, uracil mustard, valrubicin, vinblastine, vincristine, vinorelbine, vorinostat, and zoledronate.

(476) Additional examples of chemotherapeutics include proteasome inhibitors (e.g., bortezomib), thalidomide, revlimid, and DNA-damaging agents such as melphalan, doxorubicin, cyclophosphamide, vincristine, etoposide, carmustine, and the like.

(477) Example steroids include corticosteroids such as dexamethasone or prednisone.

(478) Example Bcr-Abl inhibitors include imatinib mesylate (GLEEVAC), nilotinib, dasatinib, bosutinib, and ponatinib, and pharmaceutically acceptable salts. Other example suitable Bcr-Abl inhibitors include the compounds, and pharmaceutically acceptable salts thereof, of the genera and species disclosed in U.S. Pat. No. 5,521,184, WO 04/005281, and U.S. Ser. No. 60/578,491.

(479) Example suitable Flt-3 inhibitors include midostaurin, lestaurtinib, linifanib, sunitinib, sunitinib, maleate, sorafenib, quizartinib, crenolanib, pacritinib, tandutinib, PLX3397 and ASP2215, and their pharmaceutically acceptable salts. Other example suitable Flt-3 inhibitors include compounds, and their pharmaceutically acceptable salts, as disclosed in WO 03/037347, WO 03/099771, and WO 04/046120.

(480) Example suitable RAF inhibitors include dabrafenib, sorafenib, and vemurafenib, and their pharmaceutically acceptable salts. Other example suitable RAF inhibitors include compounds, and their pharmaceutically acceptable salts, as disclosed in WO 00/09495 and WO 05/028444.

(481) Example suitable FAK inhibitors include VS-4718, VS-5095, VS-6062, VS-6063, BI853520, and GSK2256098, and their pharmaceutically acceptable salts. Other example suitable FAK inhibitors include compounds, and their pharmaceutically acceptable salts, as disclosed in WO 04/080980, WO 04/056786, WO 03/024967, WO 01/064655, WO 00/053595, and WO 01/014402.

(482) Example suitable CDK4/6 inhibitors include palbociclib, ribociclib, trilaciclib, lerociclib, and abemaciclib, and their pharmaceutically acceptable salts. Other example suitable CDK4/6 inhibitors include compounds, and their pharmaceutically acceptable salts, as disclosed in WO 09/085185, WO 12/129344, WO 11/101409, WO 03/062236, WO 10/075074, and WO 12/061156.

(483) In some embodiments, the compounds of the disclosure can be used in combination with one or more other kinase inhibitors including imatinib, particularly for treating patients resistant to imatinib or other kinase inhibitors.

(484) In some embodiments, the compounds of the disclosure can be used in combination with a chemotherapeutic in the treatment of cancer, and may improve the treatment response as compared to the response to the chemotherapeutic agent alone, without exacerbation of its toxic effects. In some embodiments, the compounds of the disclosure can be used in combination with a chemotherapeutic provided herein. For example, additional pharmaceutical agents used in the treatment of multiple myeloma, can include, without limitation, melphalan, melphalan plus prednisone [MP], doxorubicin, dexamethasone, and Velcade (bortezomib). Further additional agents used in the treatment of multiple myeloma include Bcr-Abl, Flt-3, RAF and FAK kinase inhibitors. In some embodiments, the agent is an alkylating agent, a proteasome inhibitor, a corticosteroid, or an immunomodulatory agent. Examples of an alkylating agent include cyclophosphamide (CY), melphalan (MEL), and bendamustine. In some embodiments, the proteasome inhibitor is carfilzomib. In some embodiments, the corticosteroid is dexamethasone (DEX). In some embodiments, the immunomodulatory agent is lenalidomide (LEN) or pomalidomide (POM). Additive or synergistic effects are desirable outcomes of combining a CDK2 inhibitor of the present disclosure with an additional agent.

(485) The agents can be combined with the present compound in a single or continuous dosage form, or the agents can be administered simultaneously or sequentially as separate dosage forms.

(486) The compounds of the present disclosure can be used in combination with one or more other inhibitors or one or more therapies for the treatment of infections. Examples of infections include viral infections, bacterial infections, fungus infections or parasite infections.

(487) In some embodiments, a corticosteroid such as dexamethasone is administered to a patient in combination with the compounds of the disclosure where the dexamethasone is administered intermittently as opposed to continuously.

(488) The compounds of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or salts thereof can be combined with another immunogenic agent, such as cancerous cells, purified tumor antigens (including recombinant proteins, peptides, and carbohydrate molecules), cells, and cells transfected with genes encoding immune stimulating cytokines. Non-limiting examples of tumor vaccines that can be used include peptides of melanoma antigens, such as peptides of gp100, MAGE antigens, Trp-2, MARTI and/or tyrosinase, or tumor cells transfected to express the cytokine GM-CSF.

(489) The compounds of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or salts thereof can be used in combination with a vaccination protocol for the treatment of cancer. In some embodiments, the tumor cells are transduced to express GM-CSF. In some embodiments, tumor vaccines include the proteins from viruses implicated in human cancers such as Human Papilloma Viruses (HPV), Hepatitis Viruses (HBV and HCV) and Kaposi's Herpes Sarcoma Virus (KHSV). In some embodiments, the compounds of the present disclosure can be used in combination with tumor specific antigen such as heat shock proteins isolated from tumor tissue itself. In some embodiments, the compounds of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or salts thereof can be combined with dendritic cells immunization to activate potent anti-tumor responses.

(490) The compounds of the present disclosure can be used in combination with bispecific macrocyclic peptides that target Fe alpha or Fe gamma receptor-expressing effectors cells to tumor cells. The compounds of the present disclosure can also be combined with macrocyclic peptides that activate host immune responsiveness.

(491) In some further embodiments, combinations of the compounds of the disclosure with other therapeutic agents can be administered to a patient prior to, during, and/or after a bone marrow transplant or stem cell transplant. The compounds of the present disclosure can be used in combination with bone marrow transplant for the treatment of a variety of tumors of hematopoietic origin.

(492) The compounds of Formula (I) or any of the formulas as described herein, a compound as recited in any of the claims and described herein, or salts thereof can be used in combination with vaccines, to stimulate the immune response to pathogens, toxins, and self-antigens. Examples of pathogens for which this therapeutic approach may be particularly useful, include pathogens for which there is currently no effective vaccine, or pathogens for which conventional vaccines are less than completely effective. These include, but are not limited to, HIV, Hepatitis (A, B, & C), Influenza, Herpes, Giardia, Malaria, Leishmania, Staphylococcus aureus, Pseudomonas Aeruginosa.

(493) Viruses causing infections treatable by methods of the present disclosure include, but are not limit to human papillomavirus, influenza, hepatitis A, B, C or D viruses, adenovirus, poxvirus, herpes simplex viruses, human cytomegalovirus, severe acute respiratory syndrome virus, Ebola virus, measles virus, herpes virus (e.g., VZV, HSV-1, HAV-6, HSV-II, and CMV, Epstein Barr virus), flaviviruses, echovirus, rhinovirus, coxsackie virus, cornovirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus and arboviral encephalitis virus.

(494) Pathogenic bacteria causing infections treatable by methods of the disclosure include, but are not limited to, chlamydia, rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumococci, meningococci and conococci, klebsiella, proteus, serratia, pseudomonas, legionella, diphtheria, salmonella, bacilli, cholera, tetanus, botulism, anthrax, plague, leptospirosis, and Lyme's disease bacteria.

(495) Pathogenic fungi causing infections treatable by methods of the disclosure include, but are not limited to, Candida (albicans, krusei, glabrata, tropicalis, etc.), Cryptococcus neoformans, Aspergillus (fumigatus, niger, etc.), Genus Mucorales (mucor, absidia, rhizophus), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.

(496) Pathogenic parasites causing infections treatable by methods of the disclosure include, but are not limited to, Entamoeba histolytica, Balantidium coli, Naegleriafowleri, Acanthamoeba sp., Giardia lambia, Cryptosporidium sp., Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondi, and Nippostrongylus brasiliensis.

(497) When more than one pharmaceutical agent is administered to a patient, they can be administered simultaneously, separately, sequentially, or in combination (e.g., for more than two agents).

(498) Methods for the safe and effective administration of most of these chemotherapeutic agents are known to those skilled in the art. In addition, their administration is described in the standard literature. For example, the administration of many of the chemotherapeutic agents is described in the Physicians' Desk Reference (PDR, e.g., 1996 edition, Medical Economics Company, Montvale, NJ), the disclosure of which is incorporated herein by reference as if set forth in its entirety.

(499) II. Immune-Checkpoint Therapies

(500) Compounds of the present disclosure can be used in combination with one or more immune checkpoint inhibitors for the treatment of diseases, such as cancer or infections. Exemplary immune checkpoint inhibitors include inhibitors against immune checkpoint molecules such as CBL-B, CD20, CD28, CD40, CD122, CD96, CD73, CD47, GITR, CSF1R, JAK, PI3K delta, PI3K gamma, TAM, arginase, HPK1, CD137 (also known as 4-1BB), ICOS, A2AR, B7-H3, B7-H4, BTLA, CTLA-4, LAG3, TIM3, TIGIT, CD112R, VISTA, PD-1, PD-L1 and PD-L2. In some embodiments, the immune checkpoint molecule is a stimulatory checkpoint molecule selected from CD27, CD28, CD40, ICOS, OX40, GITR and CD137. In some embodiments, the immune checkpoint molecule is an inhibitory checkpoint molecule selected from A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, TIM3, TIGIT, and VISTA. In some embodiments, the compounds provided herein can be used in combination with one or more agents selected from KIR inhibitors, TIGIT inhibitors, LAIR1 inhibitors, CD160 inhibitors, 2B4 inhibitors and TGFR beta inhibitors.

(501) In some embodiments, the compounds provided herein can be used in combination with one or more agonists of immune checkpoint molecules, e.g., OX40, CD27, GITR, and CD137 (also known as 4-1BB).

(502) In some embodiments, the inhibitor of an immune checkpoint molecule is anti-PD1 antibody, anti-PD-L1 antibody, or anti-CTLA-4 antibody.

(503) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of PD-1, e.g., an anti-PD-1 monoclonal antibody. In some embodiments, the anti-PD-1 monoclonal antibody is nivolumab, pembrolizumab (also known as MK-3475), pidilizumab, SHR-1210, PDR001, MGA012, PDR001, AB122, or AMP-224. In some embodiments, the anti-PD-1 monoclonal antibody is nivolumab or pembrolizumab. In some embodiments, the anti-PD1 antibody is pembrolizumab. In some embodiments, the anti-PD-1 monoclonal antibody is MGA012. In some embodiments, the anti-PD1 antibody is SHR-1210. Other anti-cancer agent(s) include antibody therapeutics such as 4-1BB (e.g., urelumab, utomilumab).

(504) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of PD-L1, e.g., an anti-PD-L1 monoclonal antibody. In some embodiments, the anti-PD-L1 monoclonal antibody is BMS-935559, MEDI4736, MPDL3280A (also known as RG7446), or MSB0010718C. In some embodiments, the anti-PD-L1 monoclonal antibody is MPDL3280A or MEDI4736. In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of PD-1 and PD-L1, e.g., an anti-PD-1/PD-L1 bispecific antibody. In some embodiments, the anti-PD-1/PD-L1 is MCLA-136.

(505) In some embodiments, the inhibitor is MCLA-145.

(506) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of CTLA-4, e.g., an anti-CTLA-4 antibody. In some embodiments, the anti-CTLA-4 antibody is ipilimumab, tremelimumab, AGEN1884, or CP-675,206.

(507) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of LAG3, e.g., an anti-LAG3 antibody. In some embodiments, the anti-LAG3 antibody is BMS-986016, LAG525, or INCAGN2385.

(508) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of TIM3, e.g., an anti-TIM3 antibody. In some embodiments, the anti-TIM3 antibody is INCAGN2390, MBG453, or TSR-022.

(509) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of GITR, e.g., an anti-GITR antibody. In some embodiments, the anti-GITR antibody is TRX518, MK-4166, INCAGN1876, MK-1248, AMG228, BMS-986156, GWN323, or MEDI1873.

(510) In some embodiments, the inhibitor of an immune checkpoint molecule is an agonist of OX40, e.g., OX40 agonist antibody or OX40L fusion protein. In some embodiments, the anti-OX40 antibody is MEDI0562, MOXR-0916, PF-04518600, GSK3174998, or BMS-986178. In some embodiments, the OX40L fusion protein is MEDI6383.

(511) In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of CD20, e.g., an anti-CD20 antibody. In some embodiments, the anti-CD20 antibody is obinutuzumab or rituximab.

(512) The compounds of the present disclosure can be used in combination with bispecific antibodies. In some embodiments, one of the domains of the bispecific antibody targets PD-1, PD-L1, CTLA-4, GITR, OX40, TIM3, LAG3, CD137, ICOS, CD3 or TGF receptor.

(513) In some embodiments, the compounds of the disclosure can be used in combination with one or more metabolic enzyme inhibitors. In some embodiments, the metabolic enzyme inhibitor is an inhibitor of IDO1, TDO, or arginase. Examples of IDO1 inhibitors include epacadostat, NLG919, BMS-986205, PF-06840003, IOM2983, RG-70099 and LY338196.

(514) As provided throughout, the additional compounds, inhibitors, agents, etc. can be combined with the present compound in a single or continuous dosage form, or they can be administered simultaneously or sequentially as separate dosage forms.

(515) Pharmaceutical Formulations and Dosage Forms

(516) When employed as pharmaceuticals, the compounds of the disclosure can be administered in the form of pharmaceutical compositions. These compositions can be prepared in a manner well known in the pharmaceutical art, and can be administered by a variety of routes, depending upon whether local or systemic treatment is desired and upon the area to be treated. Administration may be topical (including transdermal, epidermal, ophthalmic and to mucous membranes including intranasal, vaginal and rectal delivery), pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal or intranasal), oral, or parenteral. Parenteral administration includes intravenous, intraarterial, subcutaneous, intraperitoneal intramuscular or injection or infusion; or intracranial, e.g., intrathecal or intraventricular, administration. Parenteral administration can be in the form of a single bolus dose, or may be, for example, by a continuous perfusion pump. Pharmaceutical compositions and formulations for topical administration may include transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.

(517) This disclosure also includes pharmaceutical compositions which contain, as the active ingredient, the compound of the disclosure or a pharmaceutically acceptable salt thereof, in combination with one or more pharmaceutically acceptable carriers (excipients). In some embodiments, the composition is suitable for topical administration. In making the compositions of the disclosure, the active ingredient is typically mixed with an excipient, diluted by an excipient or enclosed within such a carrier in the form of, for example, a capsule, sachet, paper, or other container. When the excipient serves as a diluent, it can be a solid, semi-solid, or liquid material, which acts as a vehicle, carrier or medium for the active ingredient. Thus, the compositions can be in the form of tablets, pills, powders, lozenges, sachets, cachets, elixirs, suspensions, emulsions, solutions, syrups, aerosols (as a solid or in a liquid medium), ointments containing, for example, up to 10% by weight of the active compound, soft and hard gelatin capsules, suppositories, sterile injectable solutions, and sterile packaged powders.

(518) In preparing a formulation, the active compound can be milled to provide the appropriate particle size prior to combining with the other ingredients. If the active compound is substantially insoluble, it can be milled to a particle size of less than 200 mesh. If the active compound is substantially water soluble, the particle size can be adjusted by milling to provide a substantially uniform distribution in the formulation, e.g., about 40 mesh.

(519) The compounds of the disclosure may be milled using known milling procedures such as wet milling to obtain a particle size appropriate for tablet formation and for other formulation types. Finely divided (nanoparticulate) preparations of the compounds of the disclosure can be prepared by processes known in the art, e.g., see International App. No. WO 2002/000196.

(520) Some examples of suitable excipients include lactose, dextrose, sucrose, sorbitol, mannitol, starches, gum acacia, calcium phosphate, alginates, tragacanth, gelatin, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, and methyl cellulose. The formulations can additionally include: lubricating agents such as talc, magnesium stearate, and mineral oil; wetting agents; emulsifying and suspending agents; preserving agents such as methyl- and propylhydroxy-benzoates; sweetening agents; and flavoring agents. The compositions of the disclosure can be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the patient by employing procedures known in the art.

(521) The compositions can be formulated in a unit dosage form, each dosage containing from about 5 to about 1000 mg (1 g), more usually about 100 to about 500 mg, of the active ingredient. The term unit dosage forms refers to physically discrete units suitable as unitary dosages for human subjects and other mammals, each unit containing a predetermined quantity of active material calculated to produce the desired therapeutic effect, in association with a suitable pharmaceutical excipient.

(522) In some embodiments, the compositions of the disclosure contain from about 5 to about 50 mg of the active ingredient. One having ordinary skill in the art will appreciate that this embodies compositions containing about 5 to about 10, about 10 to about 15, about 15 to about 20, about 20 to about 25, about 25 to about 30, about 30 to about 35, about 35 to about 40, about 40 to about 45, or about 45 to about 50 mg of the active ingredient.

(523) In some embodiments, the compositions of the disclosure contain from about 50 to about 500 mg of the active ingredient. One having ordinary skill in the art will appreciate that this embodies compositions containing about 50 to about 100, about 100 to about 150, about 150 to about 200, about 200 to about 250, about 250 to about 300, about 350 to about 400, or about 450 to about 500 mg of the active ingredient.

(524) In some embodiments, the compositions of the disclosure contain from about 500 to about 1000 mg of the active ingredient. One having ordinary skill in the art will appreciate that this embodies compositions containing about 500 to about 550, about 550 to about 600, about 600 to about 650, about 650 to about 700, about 700 to about 750, about 750 to about 800, about 800 to about 850, about 850 to about 900, about 900 to about 950, or about 950 to about 1000 mg of the active ingredient.

(525) Similar dosages may be used of the compounds described herein in the methods and uses of the disclosure.

(526) The active compound can be effective over a wide dosage range and is generally administered in a pharmaceutically effective amount. It will be understood, however, that the amount of the compound actually administered will usually be determined by a physician, according to the relevant circumstances, including the condition to be treated, the chosen route of administration, the actual compound administered, the age, weight, and response of the individual patient, the severity of the patient's symptoms, and the like.

(527) For preparing solid compositions such as tablets, the principal active ingredient is mixed with a pharmaceutical excipient to form a solid preformulation composition containing a homogeneous mixture of a compound of the present disclosure. When referring to these preformulation compositions as homogeneous, the active ingredient is typically dispersed evenly throughout the composition so that the composition can be readily subdivided into equally effective unit dosage forms such as tablets, pills and capsules. This solid preformulation is then subdivided into unit dosage forms of the type described above containing from, for example, about 0.1 to about 1000 mg of the active ingredient of the present disclosure.

(528) The tablets or pills of the present disclosure can be coated or otherwise compounded to provide a dosage form affording the advantage of prolonged action. For example, the tablet or pill can comprise an inner dosage and an outer dosage component, the latter being in the form of an envelope over the former. The two components can be separated by an enteric layer which serves to resist disintegration in the stomach and permit the inner component to pass intact into the duodenum or to be delayed in release. A variety of materials can be used for such enteric layers or coatings, such materials including a number of polymeric acids and mixtures of polymeric acids with such materials as shellac, cetyl alcohol, and cellulose acetate.

(529) The liquid forms in which the compounds and compositions of the present disclosure can be incorporated for administration orally or by injection include aqueous solutions, suitably flavored syrups, aqueous or oil suspensions, and flavored emulsions with edible oils such as cottonseed oil, sesame oil, coconut oil, or peanut oil, as well as elixirs and similar pharmaceutical vehicles.

(530) Compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as described supra. In some embodiments, the compositions are administered by the oral or nasal respiratory route for local or systemic effect. Compositions can be nebulized by use of inert gases. Nebulized solutions may be breathed directly from the nebulizing device or the nebulizing device can be attached to a face mask, tent, or intermittent positive pressure breathing machine. Solution, suspension, or powder compositions can be administered orally or nasally from devices which deliver the formulation in an appropriate manner.

(531) Topical formulations can contain one or more conventional carriers. In some embodiments, ointments can contain water and one or more hydrophobic carriers selected from, for example, liquid paraffin, polyoxyethylene alkyl ether, propylene glycol, white Vaseline, and the like. Carrier compositions of creams can be based on water in combination with glycerol and one or more other components, e.g., glycerinemonostearate, PEG-glycerinemonostearate and cetylstearyl alcohol. Gels can be formulated using isopropyl alcohol and water, suitably in combination with other components such as, for example, glycerol, hydroxyethyl cellulose, and the like. In some embodiments, topical formulations contain at least about 0.1, at least about 0.25, at least about 0.5, at least about 1, at least about 2, or at least about 5 wt % of the compound of the disclosure. The topical formulations can be suitably packaged in tubes of, for example, 100 g which are optionally associated with instructions for the treatment of the select indication, e.g., psoriasis or other skin condition.

(532) The amount of compound or composition administered to a patient will vary depending upon what is being administered, the purpose of the administration, such as prophylaxis or therapy, the state of the patient, the manner of administration, and the like. In therapeutic applications, compositions can be administered to a patient already suffering from a disease in an amount sufficient to cure or at least partially arrest the symptoms of the disease and its complications. Effective doses will depend on the disease condition being treated as well as by the judgment of the attending clinician depending upon factors such as the severity of the disease, the age, weight and general condition of the patient, and the like.

(533) The compositions administered to a patient can be in the form of pharmaceutical compositions described above. These compositions can be sterilized by conventional sterilization techniques, or may be sterile filtered. Aqueous solutions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile aqueous carrier prior to administration. The pH of the compound preparations typically will be between 3 and 11, more preferably from 5 to 9 and most preferably from 7 to 8. It will be understood that use of certain of the foregoing excipients, carriers, or stabilizers will result in the formation of pharmaceutical salts.

(534) The therapeutic dosage of a compound of the present disclosure can vary according to, for example, the particular use for which the treatment is made, the manner of administration of the compound, the health and condition of the patient, and the judgment of the prescribing physician. The proportion or concentration of a compound of the disclosure in a pharmaceutical composition can vary depending upon a number of factors including dosage, chemical characteristics (e.g., hydrophobicity), and the route of administration. For example, the compounds of the disclosure can be provided in an aqueous physiological buffer solution containing about 0.1 to about 10% w/v of the compound for parenteral administration. Some typical dose ranges are from about 1 g/kg to about 1 g/kg of body weight per day. In some embodiments, the dose range is from about 0.01 mg/kg to about 100 mg/kg of body weight per day. The dosage is likely to depend on such variables as the type and extent of progression of the disease or disorder, the overall health status of the particular patient, the relative biological efficacy of the compound selected, formulation of the excipient, and its route of administration. Effective doses can be extrapolated from dose-response curves derived from in vitro or animal model test systems.

(535) The compositions of the disclosure can further include one or more additional pharmaceutical agents such as a chemotherapeutic, steroid, anti-inflammatory compound, or immunosuppressant, examples of which are listed herein.

(536) Labeled Compounds and Assay Methods

(537) Another aspect of the present disclosure relates to labeled compounds of the disclosure (radio-labeled, fluorescent-labeled, etc.) that would be useful not only in imaging techniques but also in assays, both in vitro and in vivo, for localizing and quantitating CDK2 in tissue samples, including human, and for identifying CDK2 activators by inhibition binding of a labeled compound. Substitution of one or more of the atoms of the compounds of the present disclosure can also be useful in generating differentiated ADME (Adsorption, Distribution, Metabolism and Excretion.) Accordingly, the present disclosure includes CDK2 assays that contain such labeled or substituted compounds.

(538) The present disclosure further includes isotopically-labeled compounds of the disclosure. An isotopically or radio-labeled compound is a compound of the disclosure where one or more atoms are replaced or substituted by an atom having an atomic mass or mass number different from the atomic mass or mass number typically found in nature (i.e., naturally occurring). Suitable radionuclides that may be incorporated in compounds of the present disclosure include but are not limited to .sup.2H (also written as D for deuterium), .sup.3H (also written as T for tritium), .sup.11C, .sup.13C, .sup.14C, .sup.13N, .sup.15N, .sup.15O, .sup.17O, .sup.18O, .sup.18F, .sup.35S, .sup.36Cl, .sup.82Br, .sup.75Br, .sup.76Br, .sup.77Br, .sup.123I, .sup.124I, .sup.125I and .sup.131I. For example, one or more hydrogen atoms in a compound of the present disclosure can be replaced by deuterium atoms (e.g., one or more hydrogen atoms of a C.sub.1-6 alkyl group of Formula (I) can be optionally substituted with deuterium atoms, such as CD.sub.3 being substituted for CH.sub.3). In some embodiments, alkyl groups of the disclosed Formulas (e.g., Formula (I)) can be perdeuterated.

(539) One or more constituent atoms of the compounds presented herein can be replaced or substituted with isotopes of the atoms in natural or non-natural abundance. In some embodiments, the compound includes at least one deuterium atom. For example, one or more hydrogen atoms in a compound presented herein can be replaced or substituted by deuterium (e.g., one or more hydrogen atoms of a C.sub.1-6 alkyl group can be replaced by deuterium atoms, such as CD.sub.3 being substituted for CH.sub.3). In some embodiments, the compound includes two or more deuterium atoms. In some embodiments, the compound includes 1-2, 1-3, 1-4, 1-5, or 1-6 deuterium atoms. In some embodiments, all of the hydrogen atoms in a compound can be replaced or substituted by deuterium atoms.

(540) In some embodiments, 1, 2, 3, 4, 5, 6, 7, or 8 hydrogen atoms, attached to carbon atoms of alkyl, alkenyl, alkynyl, aryl, phenyl, cycloalkyl, heterocycloalkyl, or heteroaryl substituents or C.sub.1-4 alkyl-, alkylene, alkenylene and alkynylene linking groups, as described herein, are optionally replaced by deuterium atoms.

(541) Synthetic methods for including isotopes into organic compounds are known in the art (Deuterium Labeling in Organic Chemistry by Alan F. Thomas (New York, N.Y., Appleton-Century-Crofts, 1971; The Renaissance of H/D Exchange by Jens Atzrodt, Volker Derdau, Thorsten Fey and Jochen Zimmermann, Angew. Chem. Int. Ed. 2007, 7744-7765; The Organic Chemistry of Isotopic Labelling by James R. Hanson, Royal Society of Chemistry, 2011). Isotopically labeled compounds can be used in various studies such as NMR spectroscopy, metabolism experiments, and/or assays.

(542) Substitution with heavier isotopes, such as deuterium, may afford certain therapeutic advantages resulting from greater metabolic stability, for example, increased in vivo half-life or reduced dosage requirements, and hence may be preferred in some circumstances. (see e.g., A. Kerekes et al. J. Med. Chem. 2011, 54, 201-210; R. Xu et al. J. Label Compd. Radiopharm. 2015, 58, 308-312). In particular, substitution at one or more metabolism sites may afford one or more of the therapeutic advantages.

(543) The radionuclide that is incorporated in the instant radio-labeled compounds will depend on the specific application of that radio-labeled compound. For example, for in vitro CDK2 labeling and competition assays, compounds that incorporate .sup.3H, .sup.14C, .sup.82Br, .sup.125I, .sup.131I, or .sup.35S can be useful. For radio-imaging applications .sup.11C, .sup.18F, .sup.125I, .sup.123I, .sup.124I, .sup.131I, .sup.78Br, .sup.76Br, or .sup.77Br can be useful.

(544) It is understood that a radio-labeled or labeled compound is a compound that has incorporated at least one radionuclide. In some embodiments, the radionuclide is selected from the group consisting of .sup.3H, .sup.14C, .sup.125I, .sup.35S, and .sup.82Br.

(545) The present disclosure can further include synthetic methods for incorporating radio-isotopes into compounds of the disclosure. Synthetic methods for incorporating radio-isotopes into organic compounds are well known in the art, and an ordinary skill in the art will readily recognize the methods applicable for the compounds of disclosure.

(546) A labeled compound of the disclosure can be used in a screening assay to identify/evaluate compounds. For example, a newly synthesized or identified compound (i.e., test compound) which is labeled can be evaluated for its ability to bind activate CDK2 by monitoring its concentration variation when contacting with CDK2, through tracking of the labeling. For example, a test compound (labeled) can be evaluated for its ability to reduce binding of another compound which is known to inhibit CDK2 (i.e., standard compound). Accordingly, the ability of a test compound to compete with the standard compound for binding to CDK2 directly correlates to its binding affinity. Conversely, in some other screening assays, the standard compound is labeled and test compounds are unlabeled. Accordingly, the concentration of the labeled standard compound is monitored in order to evaluate the competition between the standard compound and the test compound, and the relative binding affinity of the test compound is thus ascertained.

(547) Kits

(548) The present disclosure also includes pharmaceutical kits useful, for example, in the treatment or prevention of CDK2-associated diseases or disorders (such as, e.g., cancer, an inflammatory disease, a cardiovascular disease, or a neurodegenerative disease) which include one or more containers containing a pharmaceutical composition comprising a therapeutically effective amount of a compound of the disclosure. Such kits can further include, if desired, one or more of various conventional pharmaceutical kit components, such as, for example, containers with one or more pharmaceutically acceptable carriers, additional containers, etc., as will be readily apparent to those skilled in the art. Instructions, either as inserts or as labels, indicating quantities of the components to be administered, guidelines for administration, and/or guidelines for mixing the components, can also be included in the kit.

(549) Biomarkers and Pharmacodynamics Markers

(550) The disclosure further provides predictive markers (e.g., biomarkers and pharmacodynamic markers, e.g., gene copy number, gene sequence, expression levels, or phosphorylation levels) to identify those human subjects having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 for whom administering a CDK2 inhibitor (a CDK2 inhibitor as used herein refers to a compound of the disclosure, or a pharmaceutically acceptable salt thereof) is likely to be effective. The disclosure also provides pharmacodynamic markers (e.g., phosphorylation levels) to identify those human subjects having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 whom are responding to a CDK2 inhibitor.

(551) The methods are based, at least in part, on the discovery that the functional status of cyclin dependent kinase inhibitor 2A (CDKN2A; also referred to as p16) is a biomarker for predicting sensitivity to CDK2-targeting therapies in G1/S-specific cyclin-E1- (CCNE1-) amplified cells suitable for use in patient stratification. In addition, the present invention is based, at least in part, on the discovery that, in CCNE1-amplified cell lines, the level of human retinoblastoma associated protein (Rb) phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is a pharmacodynamic marker for CDK2 activity and is suitable for use in measuring CDK2 enzymatic activity in cellular assay or preclinical and clinical applications, such as, e.g., monitoring the progress of or responsiveness to treatment with a CDK2 inhibitor.

(552) CCNE1 and p16

(553) CCNE1 and p16 have been identified in the Examples as genes, in combination, useful in predicting responsiveness (e.g., improvement in disease as evidenced by disease remission/resolution) of a subject having a disease or disorder associated with CDK2 to a CDK2 inhibitor.

(554) p16 (also known as cyclin-dependent kinase inhibitor 2A, cyclin-dependent kinase 4 inhibitor A, multiple tumor suppressor 1, and p16-INK4a) acts as a negative regulator of the proliferation of normal cells by interacting with CDK4 and CDK6. p16 is encoded by the cyclin dependent kinase inhibitor 2A (CDKN2A) gene (GenBank Accession No. NM_000077). The cytogenic location of the CDKN2A gene is 9p21.3, which is the short (p) arm of chromosome 9 at position 21.3. The molecular location of the CDKN2A gene is base pairs 21,967,752 to 21,995,043 on chromosome 9 (Homo sapiens Annotation Release 109, GRCh38.p12). Genetic and epigenetic abnormalities in the gene encoding p16 are believed to lead to escape from senescence and cancer formation (Okamoto et al., 1994, PNAS 91(23):11045-9). Nonlimiting examples of genetic abnormalities in the gene encoding p16 are described in Table A, below. The amino acid sequence of human p16 is provided below (GenBank Accession No. NP_000068/UniProtKB Accession No. P42771):

(555) TABLE-US-00001 (SEQIDNO:1) 1 MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA 61 ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE 121 LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD.

(556) CCNE1 is a cell cycle factor essential for the control of the cell cycle at the G1/S transition (Ohtsubo et al., 1995, Mol. Cell. Biol. 15:2612-2624). CCNE1 acts as a regulatory subunit of CDK2, interacting with CDK2 to form a serine/threonine kinase holoenzyme complex. The CCNE1 subunit of this holoenzyme complex provides the substrate specificity of the complex (Honda et al., 2005, EMBO 24:452-463). CCNE1 is encoded by the cyclin E1 (CCNE1) gene (GenBank Accession No. NM_001238). The amino acid sequence of human CCNE1 is provided below (GenBank Accession No. NP_001229/UniProtKB Accession No. P24864):

(557) TABLE-US-00002 (SEQIDNO:2) 1 mprerrerdakerdtmkedggaefsarsrkrkanvtvflqdpdeemakidrtardqcgsq 61 pwdnnavcadpcsliptpdkedddrvypnstckpriiapsrgsplpvlswanreevwkim 121 lnkektylrdqhfleghpllqpkmrailldwlmevcevyklhretfylaqdffdrymatq 181 envvktllqligisslfiaakleeiyppklhqfayvtdgacsgdeiltmelmimkalkwr 241 lspltivswlnvymqvaylndlhevllpqypgqifigiaelldlcvldvdclefpygila 301 asalyhfssselmqkvsgyqwcdiencvkwmvpfamviretgssklkhfrgvadedahni 361 qthrdsldlldkarakkamlseqnrasplpsglltppqsgkkqssgpema.

(558) The Examples demonstrate CDK2-knockdown inhibits proliferation of CCNE1-amplified cell lines, but not of CCNE-non-amplified cell lines. Conversely, the Examples show that CDK4/6 inhibition inhibits proliferation of CCNE-non-amplified cell lines, but not of CCNE-amplified cell lines. The Examples further demonstrate that presence of a normal (e.g., non-mutated or non-deleted) p16 gene is required for the observed inhibition of cell proliferation in CCNE1-amplified cells treated with a CDK2-inhibitor. Accordingly, CCNE1 and p16 are, together, a combination biomarker: cells that respond to treatment with a CDK2 inhibitor display an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, and have a nucleotide sequence (e.g., a gene or an mRNA) that encodes the p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1) and/or have p16 protein present, while control cells that do not respond to treatment with a CDK2 inhibitor do not have an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, and tend to have a mutated or deleted gene that encodes the p16 protein and/or lack expression of p16 protein.

(559) Thus, the disclosure provides a method of treating a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2, comprising administering to the human subject a CDK2 inhibitor, wherein the human subject has been previously determined to: (i) (a) have a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, (b) have a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or (c) express a p16 protein, and (ii) (a) have an amplification of the CCNE1 gene and/or (b) have an expression level of CCNE1 in a biological sample obtained from the human subject that is higher than a control expression level of CCNE1. In certain embodiments, the predictive methods described herein predict that the subject will respond to treatment with the CDK2 inhibitor with at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, at least 98% or 100% accuracy. For example, in some embodiments, if the predictive methods described herein are applied to 10 subjects having, suspected of having, or at risk of developing a disease or disorder associated with CDK2, and 8 of those 10 subjects are predicted to respond to treatment with a CDK2 inhibitor based on a predictive method described herein, and 7 of those 8 subjects do indeed respond to treatment with a CDK2 inhibitor, then the predictive method has an accuracy of 87.5% (7 divided by 8). A subject is considered to respond to the CDK2 inhibitor if the subject shows any improvement in disease status as evidenced by, e.g., reduction or alleviation in symptoms, disease remission/resolution, etc.

(560) In some embodiments, the subject has a disease or disorder associated with CDK2. In some embodiments, the human subject has been previously determined to: (i) (a) have a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 and/or (b) a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and (ii) have an amplification of the CCNE1 gene in abiological sample obtained from the human subject. In some embodiments, the CDKN2A gene encodes a protein comprising the amino acid sequence of SEQ ID NO:1. In specific embodiments, the CDKN2A gene encodes a protein comprising the amino acid sequence of SEQ ID NO: 1.

(561) In specificembodiments, theoneormoreinactivatingnucleicacidsubstitutions and/or deletions in the CDKN2A genes is as described in Table A. In specific embodiments, the one or more inactivating nucleic acid substitutions and/or deletions in the CDKN2A gene is as described in Yarbrough et al., Journal of the National Cancer Institute, 91(18):1569-1574, 1999; Liggett and Sidransky, Biology of Neoplasia, Journal of Oncology, 16(3):1197-1206, 1998, and Cairns et al., Nature Genetics, 11:210-212, 1995, each of which is incorporated by reference herein in its entirety.

(562) TABLE-US-00003 TABLE A CDKN2A gene substitutions, deletions, and modifications Description Reference(s) C to T transition converting codon 232 of the RefSNP Accession No. rs121913388; CDKN2A gene from an arginine codon to a stop Kamb et al., Science 264: 436-440, codon 1994 19-basepair germline deletion at nucleotide 225 RefSNP Accession No. rs587776716; causing a reading-frame shift predicted to severely Gruis et al., Nature Genet. 10: 351-353, truncate p16 protein 1995 6-basepair deletion at nucleotides 363-368 of the ClinVar Accession No. CDKN2A gene RCV000010017.2; Liu et al., Oncogene 11: 405-412, 1995 Mutation at chromosome 9: 21971058 predicted to RefSNP Accession No. rs104894094; substitute glycine corresponding to amino acid Ciotti et al., Am. J. Hum. Genet. 67: position 101 of SEQ ID NO: 1 with a tryptophan 311-319, 2000 Germline mutation constituting an in-frame 3- ClinVar Accession No. basepair duplication at nucleotide 332 in exon 2 of RCV000010020.3; Borg et al., Cancer the CDKN2A gene Res. 56: 2497-2500, 1996 Mutation predicted to substitute methionine RefSNP Accession No. rs104894095; corresponding to amino acid position 53 of SEQ ID Harland et al., Hum. Molec. Genet. 6: NO: 1 with an isoleucine 2061-2067, 1997 Mutation predicted to substitute arginine RefSNP Accession No. rs104894097; corresponding to amino acid position 24 of SEQ ID Monzon et al., New Eng. J. Med. 338: NO: 1 with a proline 879-887, 1998 24-basepair repeat inserted at chromosome 9 RefSNP Accession No. rs587780668; between 21974795 and 21974796 (forward strand) Pollock et al., Hum. Mutat. 11: 424- 431, 1998) G-to-T transversion at nucleotide 34 of the ClinVar Accession No. CDKN2A gene RCV000010024.5; Liu et al., Nature Genet. 21: 128-132, 1999 Deletion of the p14(ARF)-specific exon 1-beta of ClinVar Accession No. CDKN2A RCV000010026.2; Randerson-Moor et al., Hum. Molec. Genet. 10: 55-62, 2001 Mutation predicted to substitute valine RefSNP Accession No. rs104894098; corresponding to amino acid position 126 of SEQ Goldstein et al., Brit. J. Cancer 85: 527- ID NO: 1 with an isoleucine 530, 2001 Transition (IVS2-105 A-G) in intron 2 of the ClinVar Accession No. CDKN2A gene creating a false GT splice donor site RCV000010028.3; Harland et al., Hum. 105 bases 5-prime of exon 3 resulting in aberrant Molec. Genet. 10: 2679-2686, 2001 splicing of the mRNA Mutation predicted to result in substitution of RefSNP Accession No. rs113798404; glycine corresponding to amino acid position 122 of Hewitt et al., Hum. Molec. Genet. 11: SEQ ID NO: 1 with an arginine 1273-1279, 2002 Mutation predicted to result in substitution of valine RefSNP Accession No. rs113798404; corresponding to amino acid position 59 of SEQ ID Yakobson et al., Melanoma Res. 11: NO: 1 with an arginine 569-570, 2001 Tandem germline339G-C transversion and a 340C- RefSNP Accession Nos. rs113798404 T transition in the CDKN2A gene resulting in and rs104894104; Kannengiesser et al., substitution of proline corresponding to amino acid Genes Chromosomes Cancer 46: 751- position 114 of SEQ ID NO: 1 with a serine 760, 2007 Mutation predicted to result in substitution of serine RefSNP Accession No. rs104894109; corresponding to amino acid position 56 of SEQ ID Kannengiesser et al., Genes NO: 1 with an isoleucine Chromosomes Cancer 46: 751-760, 2007 Mutation predicted to result in substitution of RefSNP Accession No. rs137854599; glycine corresponding to amino acid position 89 of Goldstein et al., J. Med. Genet. 45: 284- SEQ ID NO: 1 with an aspartic acid 289, 2008 Heterozygous A-to-G transition in exon 1B of the ClinVar Accession no. CDKN2A gene, affecting splicing of the p14(ARF) RCV000022943.3; Binni et al., Clin. isoform Genet. 77: 581-586, 2010 Heterozygous 5-bp duplication (19_23dup) in the ClinVar Accession No. CDKN2A gene, resulting in a frameshift and RCV000030680.6; Harinck, F., Kluijt et premature termination al., J. Med. Genet. 49: 362-365, 2012 Mutation predicted to result in substitution of Yarbrough et al., Journal of the aspartic acid corresponding to amino acid position National Cancer Institute, 91(18): 1569- 84 of SEQ ID NO: 1 with a valine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the aspartic acid corresponding to amino acid position National Cancer Institute, 91(18): 1569- 84 of SEQ ID NO: 1 with a glycine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the arginine corresponding to amino acid position 87 of National Cancer Institute, 91(18): 1569- SEQ ID NO: 1 with a proline 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the proline corresponding to amino acid position 48 of National Cancer Institute, 91(18): 1569- SEQ ID NO: 1 with a leucine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the aspartic acid corresponding to amino acid position National Cancer Institute, 91(18): 1569- 74 of SEQ ID NO: 1 with a asparagine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the arginine corresponding to amino acid position 87 of National Cancer Institute, 91(18): 1569- SEQ ID NO: 1 with a leucine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the asparagine corresponding to amino acid position 71 National Cancer Institute, 91(18): 1569- of SEQ ID NO: 1 with a serine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the arginine corresponding to amino acid position 80 of National Cancer Institute, 91(18): 1569- SEQ ID NO: 1 with a leucine 1574 Mutation predicted to result in substitution of Yarbrough et al., Journal of the histidine corresponding to amino acid position 83 of National Cancer Institute, 91(18): 1569- SEQ ID NO: 1 with a tyrosine 1574

(563) The disclosure also features a method of treating a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2, comprising: (i) identifying, in a biological sample obtained from the human subject: (a) a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, (b) a CDKN2A gene lacking one or more inactivating nucleic acid substitutions, and/or (c) the presence of a p16 protein; (ii) identifying, in a biological sample obtained from the human subject: (a) an amplification of the CCNE1 gene and/or (b) an expression level of CCNE1 that is higher than a control expression level of CCNE1; and (iii) administering a CDK2 inhibitor to the human subject. In some embodiments, the subject has a disease or disorder associated with CDK2. In some embodiments, the subject is suspected of having or is at risk of developing a disease or disorder associated with CDK2. In some embodiments, the method comprises: (i) identifying, in a biological sample obtained from the human subject: (a) a nucleotide sequence encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, (b) a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or (c) the presence of a p16 protein; (ii) identifying, in a biological sample obtained from the human subject: (a) an amplification of the CCNE1 gene; and (iii) administering a CDK2 inhibitor to the human subject.

(564) The disclosure also features a method of predicting the response of a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 to a CDK2 inhibitor, comprising: (i) determining, from a biological sample obtained from the human subject: (a) the nucleotide sequence of a CDKN2A gene, (b) the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or (c) the presence of a p16 protein; and (ii) determining, from a biological sample obtained from the human subject: (a) the copy number of the CCNE1 gene and/or (b) the expression level of CCNE1, wherein (1) (a) the presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, (b) the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or (c) the presence of a p16 protein, and (2) (a) an amplification of the CCNE1 gene and/or (b) an expression level of CCNE1 that is higher than a control expression level of CCNE1, is predictive that the human subject will respond to the CDK2 inhibitor. In some embodiments, the subject has a disease or disorder associated with CDK2. In some embodiments, the subject is suspected of having or is at risk of developing a disease or disorder associated with CDK2. In some embodiments, the method comprises: (i) determining, from a biological sample obtained from the human subject: (a) the nucleotide sequence of a CDKN2A gene and/or (b) the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions; and (ii) determining, from a biological sample obtained from the human subject: (a) the copy number of the CCNE1 gene, wherein (1) (a) the presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 and/or (b) the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and (2) (a) an amplification of the CCNE1 gene, is predictive that the human subject will respond to the CDK2 inhibitor.

(565) In specific embodiments, the (i) determining of (a) the nucleotide sequence of a CDKN2A gene, (b) the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or (c) the presence of a p16 protein is performed before (e.g., at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days, at least 7 days, at least 2 weeks, at least 3 weeks, or at least 4 weeks, or from 6 hours to 16 hours, from 6 hours to 20 hours, or from 6 hours to 24 hours, from 2 days to 3 days, from 2 days to 4 days, from 2 days to 5 days, from 2 days to 6 days, from 2 days to 7 days, from 1 week to 2 weeks, from 1 week to 3 weeks, or from 1 week to 4 weeks before) administering to the human subject the CDK2 inhibitor. In specific embodiments, the (ii) determining of (a) the copy number of the CCNE1 gene and/or (b) the expression level of CCNE1 in the biological sample obtained from the human subject is performed before (e.g., at least 1 day, at least 2 days, at least 3 days, at least 4 days, at least 5 days, at least 6 days, at least 7 days, at least 2 weeks, at least 3 weeks, or at least 4 weeks, or from 6 hours to 16 hours, from 6 hours to 20 hours, or from 6 hours to 24 hours, from 2 days to 3 days, from 2 days to 4 days, from 2 days to 5 days, from 2 days to 6 days, from 2 days to 7 days, from 1 week to 2 weeks, from 1 week to 3 weeks, or from 1 week to 4 weeks before) administering to the human subject the CDK2 inhibitor.

(566) An amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, combined with the presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or the presence of a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1), is indicative/predictive that a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 will respond to a CDK2 inhibitor.

(567) In some embodiments, the CCNE1 gene is amplified to a gene copy number from 3 to 25. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 3. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 5. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 7. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 10. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 12. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 14. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 21.

(568) In specific embodiments, the expression level of CCNE1 is the level of CCNE1 mRNA. In specific embodiments, the expression level of CCNE1 is the level of CCNE1 protein.

(569) In some embodiments of the foregoing methods, the control expression level of CCNE1 is a pre-established cut-off value. In some embodiments of the foregoing methods, the control expression level of CCNE1 is the expression level of CCNE1 in a sample or samples obtained from one or more subjects that have not responded to treatment with the CDK2 inhibitor.

(570) In some embodiments of the foregoing methods, the expression level of CCNE1 is the expression level of CCNE1 mRNA. In some embodiments of the foregoing methods, the expression level of CCNE1 is the expression level of CCNE1 protein. In some embodiments in which the expression level of CCNE1 is the expression level of CCNE1 mRNA, the expression level of CCNE1 is measured by RNA sequencing, quantitative polymerase chain reaction (PCR), in situ hybridization, nucleic acid array or RNA sequencing. In some embodiments in which the expression level of CCNE1 is the expression level of CCNE1 protein, the expression level of CCNE1 is measured by western blot, enzyme-linked immunosorbent assay, or immunohistochemistry staining.

(571) Rb S780

(572) The disclosure also features a method for assessing the CDKN2A gene and the CCNE1 gene, comprising determining, from a biological sample or biological samples obtained from a human subject having a disease or disorder associated with CDK2, (i) (a) the nucleotide sequence of a CDKN2A gene or (b) the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and (ii) the copy number of the CCNE1 gene.

(573) The disclosure also features a method of evaluating the response of a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 to a CDK2 inhibitor, comprising: (a) administering a CDK2 inhibitor to the human subject, wherein the human subject has been previously determined to have an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1; (b) measuring, in a biological sample of obtained from the subject subsequent to the administering of step (a), the level of retinoblastoma (Rb) protein phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, wherein a reduced level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, as compared to a control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, is indicative that the human subject responds to the CDK2 inhibitor. In some embodiments, the subject has a disease or disorder associated with CDK2. In some embodiments, the subject is suspected of having or is at risk of developing a disease or disorder associated with CDK2. In some embodiments, the biological sample comprises a blood sample or a tumor biopsy sample.

(574) Phosphorylation of Rb at the serine corresponding to amino acid position 780 of SEQ ID NO:3 (referred to herein as Ser780 or S780) has been identified in the Examples as a pharmacodynamic marker useful in assessing responsiveness (e.g., inhibition by CDK2) of a human subject having a disease or disorder having CCNE1 amplification to a CDK2 inhibitor.

(575) Rb is a regulator of the cell cycle and acts as a tumor suppressor. Rb is activated upon phosphorylation by cyclin D-CDK4/6 at Ser780 and Ser795 and by cyclin E/CDK2 at Ser807 and Ser811. Rb is encoded by the RB transcriptional corepressor I (RB) gene (GenBank Accession No. NM_000321). The amino acid sequence of human Rb is provided below (GenBank Accession No. NP_000312/UniProtKB Accession No. P06400) (S780 is in bold and underlined):

(576) TABLE-US-00004 (SEQIDNO:3) 1 MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTAL 61 CQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTEL 121 QKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSS 181 ISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCYLDYFIKLSPPMLLKEPYK 241 TAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDSIDSVYFKNFIPFM 301 NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKS 361 NLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVK 421 DIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDN 481 IFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEG 541 NLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH 601 TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYL 661 RLNTLVERLLSEHPELEHIIWTLFAHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLK 721 FKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLS 781 PIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG 841 TSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK 901 LAEMTSTRTRMQKQKMNDSMDTSNKEEK

(577) As stated above, the Examples demonstrate CDK2-knockdown inhibits proliferation in CCNE1-amplified cell lines, but not in CCNE1-non-amplified cell lines. The Examples further demonstrate CDK2-knockdown or inhibition blocks Rb phosphorylation at the S780 in CCNE1-amplified cell lines, but not in CCNE1-non-amplified cell lines. Accordingly, Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is a pharmacodynamic marker for assessing response to CDK2 inhibition in CCNE1 amplified cancer cells or patients with diseases or disorders having CCNE1 amplification. Thus, provided herein are methods relating to the use of the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 in a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 as a marker for indicating the response of the human subject to a CDK2 inhibitor, wherein the human subject has an increased expression level of CCNE1.

(578) Thus, the disclosure features a method for measuring the amount of a protein in a sample, comprising: (a) providing a biological sample obtained from a human subject having a disease or disorder associated with CDK2; and (b) measuring the level of Rb protein phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 in the biological sample. In some embodiments, the biological sample comprises a blood sample or a tumor biopsy sample. In a specific embodiment, provided herein is a method of evaluating the response of a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 to a CDK2 inhibitor, comprising: (a) administering a CDK2 inhibitor to the human subject, wherein the human subject has been previously determined to have an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1; and (b) measuring, in a biological sample obtained from the human subject subsequent to the administering of step (a), the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, wherein a reduced level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, as compared to a control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, is indicative that the human subject responds to the CDK2 inhibitor. In specific embodiments, the human subject has a disease or disorder associated with CDK2.

(579) A reduced level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, as compared to a control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, combined with an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, is indicative that a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 responds to a CDK2 inhibitor. For example, in a subject having an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, a biological sample, obtained from the subject after treatment with a CDK2 inhibitor, having low (e.g., reduced as compared to a control) or undetectable levels of Rb phosphorylation at serine corresponding to amino acid position 780 of SEQ ID NO:3 is indicative that the subject responds to the CDK2 inhibitor.

(580) A biological sample, obtained from a subject after administration of a CDK2 inhibitor to the subject, having a reduced level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, as compared to a control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, combined with: (i) an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, and (ii) presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or presence of a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1), is indicative that a human subject having, suspected of having, or at risk of developing a disease or disorder associated with CDK2 responds to a CDK2 inhibitor. For example, in a human subject having (i) an amplification of the CCNE1 gene and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, and (ii) the presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, and/or the presence of a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1), a biological sample, obtained from the human subject after administration of a CDK2 inhibitor to the subject, having low (e.g., reduced as compared to a control) or undetectable levels of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is indicative that the human subject responds to the CDK2 inhibitor

(581) In some embodiments, the CCNE1 gene is amplified to a gene copy number from 3 to 25. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 3. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 5. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 7. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 10. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 12. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 14. In specific embodiments, the CCNE1 gene is amplified to a gene copy number of at least 21. In specific embodiments, the expression level of CCNE1 is the level of CCNE1 mRNA. In specific embodiments, the expression level of CCNE1 is the level of CCNE1 protein.

(582) Controls

(583) As described above, the methods related to biomarkers and pharmacodynamic markers can involve, measuring one or more markers (e.g., a biomarker or a pharmacodynamics marker, e.g., the amplification of the CCNE1 gene, the expression level of CCNE1, the presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1, the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions, the presence of a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1), and Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3) in a biological sample from a human subject having, suspected of having or at risk of developing a disease or disorder associated with CDK2. In specific embodiments, the human subject has a disease or disorder associated with CDK2. In specific embodiments, the human subject is suspected of having or is at risk of developing a disease or disorder associated with CDK2. In certain aspects, the level (e.g., amplification (e.g., for the CCNE1 gene), expression level (e.g., for CCNE1 or p16 protein), or phosphorylation level (e.g., for Rb)) of one or more biomarkers, compared to a control level of the one or more biomarkers, predicts/indicates the response of a human subject to treatment comprising a CDK2 inhibitor. In certain embodiments, when (i) the CCNE1 gene is amplified and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, and (ii) a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 is present, a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions is present, and/or a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1) is present, the human subject is identified as likely to respond to a CDK2 inhibitor. In other embodiments, when (i) the CCNE1 gene is amplified and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, and (ii) in a biological sample from the human subject after the human subject has been administered a CDK2 inhibitor, the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is less than the control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, the human subject is identified as responding to a CDK2 inhibitor. In yet another embodiment, when (i) the CCNE1 gene is amplified and/or an expression level of CCNE1 that is higher than a control expression level of CCNE1, (ii) a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 is present, a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions is present, and/or a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1) is present, and (iii) in a biological sample from the human subject after the human subject has been administered a CDK2 inhibitor, the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is less than the control level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3, the human subject is identified as responding to a CDK2 inhibitor. In this context, the term control includes a sample (from the same tissue type) obtained from a human subject who is known to not respond to a CDK2 inhibitor. The term control also includes a sample (from the same tissue type) obtained in the past from a human subject who is known to not respond to a CDK2 inhibitor and used as a reference for future comparisons to test samples taken from human subjects for which therapeutic responsiveness is to be predicted. The control level (e.g., gene copy number, expression level, or phosphorylation level) for a particular biomarker (e.g., CCNE1, p16, or Rb phosphorylation) in a particular cell type or tissue may be pre-established by an analysis of biomarker level (e.g., expression level or phosphorylation level) in one or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, or 40 or more) human subjects that have not responded to treatment with a CDK2 inhibitor. This pre-established reference value (which may be an average or median level (e.g., gene copy number, expression level, or phosphorylation level) taken from multiple human subjects that have not responded to the therapy) may then be used for the control level of the biomarker (e.g., CCNE, p16, or Rb phosphorylation) in the comparison with the test sample. In such a comparison, the human subject is predicted to respond to a CDK2 inhibitor if the CCNE1 gene is amplified and/or the expression level of CCNE is higher than the pre-established reference, and a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 is present, a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions is present, and/or a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1) is present. In another such a comparison, the human subject is predicted to respond to a CDK2 inhibitor if (i) CCNE1 gene is amplified and/or the expression level of CCNE is higher than the pre-established reference, and (ii) after administering to the human subject a CDK2 inhibitor, the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is lower than the pre-established reference. In yet another such a comparison, the human subject is indicated to respond to a CDK2 inhibitor if (i) CCNE1 gene is amplified and/or the expression level of CCNE is higher than the pre-established reference, (ii) a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 is present, a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions is present, and/or a p16 protein (e.g., a p16 protein comprising the amino acid sequence of SEQ ID NO:1) is present, and (iii) after administering to the human subject a CDK2 inhibitor, the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 is lower than the pre-established reference.

(584) The control level for a particular biomarker in a particular cell type or tissue may alternatively be pre-established by an analysis of biomarker level in one or more human subjects that have responded to treatment with a CDK2 inhibitor. This pre-established reference value (which may be an average or median level (e.g., expression level or phosphorylation level) taken from multiple human subjects that have responded to the therapy) may then be used as the control level (e.g., expression level or phosphorylation level) in the comparison with the test sample. In such a comparison, the human subject is indicated to respond to a CDK2 inhibitor if the level (e.g., copy number of the CCNE1 gene, expression level of CCNE1, expression level of p16, or phosphorylation level of Rb at the serine corresponding to amino acid position 780 of SEQ ID NO:3) of the biomarker being analyzed is equal or comparable to (e.g., at least 85% but less than 115% of), the pre-established reference.

(585) In certain embodiments, the control is a pre-established cut-off value. A cut-off value is typically a level (e.g., a copy number, an expression level, or a phosphorylation level) of a biomarker above or below which is considered predictive of responsiveness of a human subject to a therapy of interest. Thus, in accordance with the methods and compositions described herein, a reference level (e.g., of CCNE1 gene copy number, CCNE1 expression, p16 expression, or Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3) is identified as a cut-off value, above or below of which is predictive of responsiveness to a CDK2 inhibitor. Cut-off values determined for use in the methods described herein can be compared with, e.g., published ranges of concentrations but can be individualized to the methodology used and patient population.

(586) In some embodiments, the expression level of CCNE1 is increased as compared to the expression level of CCNE1 in a control. For example, the expression level of CCNE1 analyzed can be at least 1.5, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 25, at least 50, at least 75, or at least 100 times higher, or at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, at least 200%, at least 300%, at least 400%, at least 500%, at least 600%, at least 700%, at least 800%, at least 900%, at least 1,000%, at least 1,500%, at least 2,000%, at least 2,500%, at least 3,000%, at least 3,500%, at least 4,000%, at least 4,500%, or at least 5,000% higher, than the expression level of CCNE1 in a control.

(587) A p16 protein is present if the protein is detectable by any assay known in the art or described herein, such as, for example, western blot, immunohistochemistry, fluorescence-activated cell sorting, and enzyme-linked immunoassay. In some embodiments, a p16 protein is present at an expression level that is within at least 5%, at least 10%, at least 20%, or at least 30% of the p16 expression level in a healthy control.

(588) In some embodiments, the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 being analyzed is reduced as compared to the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 in a control. For example, the level of the Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 being analyzed can be at least 1.5, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 25, at least 50, at least 75, or at least 100 times lower, or at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or 100% lower, than the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 in a control.

(589) Biological Samples

(590) Suitable biological samples for the methods described herein include any sample that contains blood or tumor cells obtained or derived from the human subject in need of treatment. For example, a biological sample can contain tumor cells from biopsy from a patient suffering from a solid tumor. A tumor biopsy can be obtained by a variety of means known in the art. Alternatively, a blood sample can be obtained from a patients suffering from a hematological cancer.

(591) A biological sample can be obtained from a human subject having, suspected of having, or at risk of developing, a disease or disorder associated with CDK2. In some embodiments, the disease or disorder associated with CDK2 is a cancer (such as those described supra).

(592) Methods for obtaining and/or storing samples that preserve the activity or integrity of molecules (e.g., nucleic acids or proteins) in the sample are well known to those skilled in the art. For example, a biological sample can be further contacted with one or more additional agents such as buffers and/or inhibitors, including one or more of nuclease, protease, and phosphatase inhibitors, which preserve or minimize changes in the molecules in the sample.

(593) Evaluating Biomarkers and Pharmacodynamic Markers

(594) Expression levels of CCNE1 or p16 can be detected as, e.g., RNA expression of a target gene (i.e., the genes encoding CCNE1 or p16). That is, the expression level (amount) of CCNE1 or p16 can be determined by detecting and/or measuring the level of mRNA expression of the gene encoding CCNE1. Alternatively, expression levels of CCNE1 or p16 can be detected as, e.g., protein expression of target gene (i.e., the genes encoding CCNE1 or p16). That is, the expression level (amount) of CCNE1 or p16 can be determined by detecting and/or measuring the level of protein expression of the genes encoding CCNE1 or p16.

(595) In some embodiments, the expression level of CCNE1 or p16 is determined by measuring RNA levels. A variety of suitable methods can be employed to detect and/or measure the level of mRNA expression of a gene. For example, mRNA expression can be determined using Northern blot or dot blot analysis, reverse transcriptase-PCR (RT-PCR; e.g., quantitative RT-PCR), in situ hybridization (e.g., quantitative in situ hybridization), nucleic acid array (e.g., oligonucleotide arrays or gene chips) and RNA sequencing analysis. Details of such methods are described below and in, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual Second Edition vol. 1, 2 and 3. Cold Spring Harbor Laboratory Press: Cold Spring Harbor, New York, USA, November 1989; Gibson et al. (1999) Genome Res., 6(10):995-1001; and Zhang et al. (2005) Environ. Sci. Technol., 39(8):2777-2785; U.S. Publication No. 2004086915; European Patent No. 0543942; and U.S. Pat. No. 7,101,663; Kukurba et al. (2015) Cold Spring Harbor Protocols., 2015 (11): 951-69; the disclosures of each of which are incorporated herein by reference in their entirety.

(596) In one example, the presence or amount of one or more discrete mRNA populations in a biological sample can be determined by isolating total mRNA from the biological sample (see, e.g., Sambrook et al. (supra) and U.S. Pat. No. 6,812,341) and subjecting the isolated mRNA to agarose gel electrophoresis to separate the mRNA by size. The size-separated mRNAs are then transferred (e.g., by diffusion) to a solid support such as a nitrocellulose membrane. The presence or amount of one or more mRNA populations in the biological sample can then be determined using one or more detectably-labeled-polynucleotide probes, complementary to the mRNA sequence of interest, which bind to and thus render detectable their corresponding mRNA populations. Detectable-labels include, e.g., fluorescent (e.g., umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride, allophycocyanin, or phycoerythrin), luminescent (e.g., europium, terbium, Qdot nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, CA), radiological (e.g., 125I, 131I, 35S, 32P, 33P, or 3H), and enzymatic (horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase) labels.

(597) In some embodiments, the expression level of CCNE1 or p16 is determined by measuring protein levels. A variety of suitable methods can be employed to detect and/or measure the level of protein expression of target genes. For example, CCNE1 or p16 protein expression can be determined using western blot, enzyme-linked immunosorbent assay (ELISA), fluorescence activated cell sorting, or immunohistochemistry analysis (e.g., using a CCNE1-specific or p16-specific antibody, respectively). Details of such methods are described below and in, e.g., Sambrook et al., supra.

(598) In one example, the presence or amount of one or more discrete protein populations (e.g., CCNE1 or p16) in a biological sample can be determined by western blot analysis, e.g., by isolating total protein from the biological sample (see, e.g., Sambrook et al. (supra)) and subjecting the isolated protein to agarose gel electrophoresis to separate the protein by size. The size-separated proteins are then transferred (e.g., by diffusion) to a solid support such as a nitrocellulose membrane. The presence or amount of one or more protein populations in the biological sample can then be determined using one or more antibody probes, e.g., a first antibody specific for the protein of interest (e.g., CCNE1 or p16), and a second antibody, detectably labeled, specific for the first antibody, which binds to and thus renders detectable the corresponding protein population. Detectable-labels suitable for use in western blot analysis are known in the art.

(599) Methods for detecting or measuring gene expression (e.g., mRNA or protein expression) can optionally be performed in formats that allow for rapid preparation, processing, and analysis of multiple samples. This can be, for example, in multi-welled assay plates (e.g., 96 wells or 386 wells) or arrays (e.g., nucleic acid chips or protein chips). Stock solutions for various reagents can be provided manually or robotically, and subsequent sample preparation (e.g., RT-PCR, labeling, or cell fixation), pipetting, diluting, mixing, distribution, washing, incubating (e.g., hybridization), sample readout, data collection (optical data) and/or analysis (computer aided image analysis) can be done robotically using commercially available analysis software, robotics, and detection instrumentation capable of detecting the signal generated from the assay. Examples of such detectors include, but are not limited to, spectrophotometers, luminometers, fluorimeters, and devices that measure radioisotope decay. Exemplary high-throughput cell-based assays (e.g., detecting the presence or level of a target protein in a cell) can utilize ArrayScan VTI HCS Reader or KineticScan HCS Reader technology (Cellomics Inc., Pittsburgh, PA).

(600) In some embodiments, the presence of a CDKN2A gene encoding a p16 protein comprising the amino acid sequence of SEQ ID NO:1 and/or the presence of a CDKN2A gene lacking one or more inactivating nucleic acid substitutions and/or deletions is determined by evaluating the DNA sequence of the CDKN2A gene (e.g., genomic DNA or cDNA) or by evaluating the RNA sequence of the CDKN2A gene (e.g., RNA, e.g., mRNA). Methods of performing nucleic acid sequencing analyses are known in the art and described above. Nonlimiting examples of inactivating nucleic acid substitutions and/or deletions preventing the CDKN2A gene from encoding a protein comprising the amino acid sequence of SEQ ID NO:1 are described in Table A, above. In specific embodiments, the one or more inactivating nucleic acid substitutions and/or deletions in the CDKN2A gene is as described in Yarbrough et al., Journal of the National Cancer Institute, 91(18):1569-1574, 1999; Liggett and Sidransky, Biology of Neoplasia, Journal of Oncology, 16(3):1197-1206, 1998, and Cairns et al., Nature Genetics, 11:210-212, 1995, each of which is incorporated by reference herein in its entirety.

(601) In some embodiments, the expression level of a gene or the presence of a gene lacking one or more inactivating nucleic acid substitutions or deletions is determined by evaluating the copy number variation (CNV) of the gene. The CNV of genes (e.g., the CCNE1 gene and/or the CDKN2A gene) can be determined/identified by a variety of suitable methods. For example, CNV can be determined using fluorescent in situ hybridization (FISH), multiplex ligation dependent probe amplification (MLPA), array comparative genomic hybridization (aCGH), single-nucleotide polymorphisms (SNP) array, and next-generation sequencing (NGS) technologies.

(602) In one example, the copy number variation of one or more discrete genes in a biological sample can be determined by MLPA, e.g., by extracting DNA specimens from the biological sample (see, e.g., Sambrook et al. (supra) and U.S. Pat. No. 6,812,341), and amplifying DNA sequence of interest (e.g., CCNE1 or CDKN2A) using a mixture of MLPA probes. Each MLPA probe consists of two oligonucleotides that hybridize to immediately adjacent target DNA sequence (e.g., CCNE1 or CDKN2A) in order to be ligated into a single probe. Ligated probes are amplified though PCR with one PCR primer fluorescently labeled, enabling the amplification products to be visualized during fragment separation by capillary electrophoresis. The presence, absence or amplification of one or more genes of interest in the biological sample is calculated by measuring PCR derived fluorescence, quantifying the amount of PCR product after normalization and comparing it with control DNA samples.

(603) The level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 can be detected by a variety of suitable methods. For example, phosphorylation status can be determined using western blot, ELISA, fluorescence activated cell sorting, or immunohistochemistry analysis. Details of such methods are described below and in, e.g., Sambrook et al., supra.

(604) As with the methods for detecting or measuring gene expression (above), methods for detecting or measuring the level of Rb phosphorylation at the serine corresponding to amino acid position 780 of SEQ ID NO:3 can optionally be performed in formats that allow for rapid preparation, processing, and analysis of multiple samples.

(605) The invention will be described in greater detail by way of specific examples. The following examples are offered for illustrative purposes, and are not intended to limit the invention in any manner. Those of skill in the art will readily recognize a variety of non-critical parameters which can be changed or modified to yield essentially the same results.

EXAMPLES

(606) Experimental procedures for compounds of the invention are provided below.

(607) Preparatory LC-MS purifications of some of the compounds prepared were performed on Waters mass directed fractionation systems. The basic equipment setup, protocols, and control software for the operation of these systems have been described in detail in the literature. See e.g., Two-Pump At Column Dilution Configuration for Preparative LC-MS, K. Blom, J. Combi. Chem., 4, 295 (2002); Optimizing Preparative LC-MS Configurations and Methods for Parallel Synthesis Purification, K. Blom, R. Sparks, J. Doughty, G. Everlof, T. Haque, A. Combs, J. Combi. Chem., 5, 670 (2003); and Preparative LC-MS Purification: Improved Compound Specific Method Optimization, K. Blom, B. Glass, R. Sparks, A. Combs, J. Combi. Chem., 6, 874-883 (2004). The separated compounds were typically subjected to analytical liquid chromatography mass spectrometry (LCMS) for purity check under the following conditions: Instrument; Agilent 1100 series, LC/MSD, Column: Waters Sunfire C.sub.18 5 m particle size, 2.15.0 mm, Buffers: mobile phase A: 0.025% TFA in water and mobile phase B: acetonitrile; gradient 2% to 80% of B in 3 minutes with flow rate 2.0 mL/minute.

(608) Some of the compounds prepared were also separated on a preparative scale by reverse-phase high performance liquid chromatography (RP-HPLC) with MS detector or flash chromatography (silica gel) as indicated in the Examples. Typical preparative reverse-phase high performance liquid chromatography (RP-HPLC) column conditions are as follows:

(609) pH=2 purifications: Waters Sunfire C.sub.18 5 m particle size, 19100 mm column, eluting with mobile phase A: 0.1% TFA (trifluoroacetic acid) in water and mobile phase B: acetonitrile; the flow rate was 30 mL/minute, the separating gradient was optimized for each compound using the Compound Specific Method Optimization protocol as described in the literature (see Preparative LCMS Purification: Improved Compound Specific Method Optimization, K. Blom, B. Glass, R. Sparks, A. Combs, J. Comb. Chem., 6, 874-883 (2004)). Typically, the flow rate used with the 30100 mm column was 60 mL/minute.

(610) pH=10 purifications: Waters XBridge C.sub.18 5 m particle size, 19100 mm column, eluting with mobile phase A: 0.15% NH.sub.4OH in water and mobile phase B: acetonitrile; the flow rate was 30 mL/minute, the separating gradient was optimized for each compound using the Compound Specific Method Optimization protocol as described in the literature (See Preparative LCMS Purification: Improved Compound Specific Method Optimization, K. Blom, B. Glass, R. Sparks, A. Combs, J. Comb. Chem., 6, 874-883 (2004)). Typically, the flow rate used with 30100 mm column was 60 mL/minute.

Example 1. 4-((7-((cis)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide

(611) ##STR00012##

Step 1. 2-((5-bromo-2-chloropyrimidin-4-yl)amino)cyclopentan-1-ol

(612) ##STR00013##

(613) To a solution of 5-bromo-2,4-dichloropyrimidine (6 g, 26.3 mmol) in acetonitrile (65.8 mL) were added Hunig's base (11.50 mL, 65.8 mmol) and 2-aminocyclopentan-1-ol, HCl (3.99 g, 29.0 mmol) and the reaction mixture stirred at 80 C. for 1 hr, then was quenched with water. After standing for 30 mins, a solid precipitated which was collected by filtration, washed with water, air dried, then used in the next step without further purification (5.2 g, 62%). LCMS calculated for C.sub.9H.sub.12BrClN.sub.3O (M+H).sup.+: m/z=292.0/294.0; Found: 292.0/294.0.

Step 2. 2-((5-bromo-2-chloropyrimidin-4-yl)amino)cyclopentan-1-one

(614) ##STR00014##

(615) To a solution of 2-((5-bromo-2-chloropyrimidin-4-yl)amino)cyclopentan-1-ol (1.5 g, 5.13 mmol) in DCM (25.6 mL) was added Dess-Martin periodinane (2.61 g, 6.15 mmol) and the reaction mixture was stirred at r.t. for 1 hr, then quenched with sat. sodium bicarbonate and extracted with DCM. The organic layer was dried over sodium sulfate and concentrated. The residue was purified by Biotage Isolera (0-70% ethyl acetate in hexanes) to provide the desired product as a white solid (1.29 g, 87%). LCMS calculated for C.sub.9H.sub.10BrClN.sub.3O (M+H).sup.+: m/z=290.0/292.0; Found: 290.0/292.0.

Step 3. (cis)-2-((5-bromo-2-chloropyrimidin-4-yl)amino)-1-methylcyclopentan-1-ol

(616) ##STR00015##

(617) To a 0 C. solution of 2-((5-bromo-2-chloropyrimidin-4-yl)amino)cyclopentan-1-one (1.4 g, 4.82 mmol) in THF (24.09 mL) was added methylmagnesium bromide (3.0 M in diethyl ether, 4.82 mL, 14.46 mmol) and the reaction mixture was warmed up to r.t. then stirred for 1 hr. The reaction was quenched with sat. ammonium chloride and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (0-70% ethyl acetate in hexanes) to provide the desired product as a white solid (403 mg, 27%). LCMS calculated for C.sub.10H.sub.14BrClN.sub.3O (M+H).sup.+: m/z=306.0/308.0; Found: 306.0/308.0.

Step 4. (2-(tert-butoxy)-2-oxoethyl)zinc(II) Bromide

(618) ##STR00016##

(619) Zinc was activated by washing zinc dust in 2% HCl for 1 hr, then decanting. To the solid was added water and the supernatant decanted three times. The solid was then collected by filtration, washed with water, ethanol, acetone and ether, then dried in the oven for 15 mins. To this zinc (4.87 g, 74.4 mmol) was added THF (65 mL) and TMS-Cl (0.865 mL, 6.77 mmol). The reaction mixture was stirred at r.t for 1 hr then the tert-butyl 2-bromoacetate (10.00 mL, 67.7 mmol) was added dropwise. Addition was complete over 15 mins. The mixture was then heated to 50 C. for 1 hr at which point most of the zinc metal had dissolved. The mixture was cooled to r.t and used as a 0.9 M solution in subsequent steps.

Step 5. Tert-Butyl 2-(2-chloro-4-(((cis)-2-hydroxy-2-methylcyclopentyl)amino)pyrimidin-5-yl)acetate

(620) ##STR00017##

(621) To a mixture of (cis)-2-((5-bromo-2-chloropyrimidin-4-yl)amino)-1-methylcyclopentan-1-ol (403 mg, 1.314 mmol), Pd.sub.2(dba).sub.3 (36.1 mg, 0.039 mmol) and 1,2,3,4,5-pentaphenyl-1-(di-t-butylphosphino)ferrocene (QPhos, 28.0 mg, 0.039 mmol) were added 1,4-dioxane (2.63 mL) and (2-(tert-butoxy)-2-oxoethyl)zinc(II) bromide (0.9 M, 3067 L, 2.76 mmol) and the reaction flask was evacuated, back filled with nitrogen then stirred at 50 C. for 30 mins. The reaction was quenched with 1N HCl and allowed to stir at r.t. for 30 mins, then extracted with ethyl acetate. The organic layer was washed with sat. sodium bicarbonate, water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (0-100% ethyl acetate in hexanes) to provide the desired product (285 mg, 63%). LCMS calculated for C.sub.16H.sub.25ClN.sub.3O.sub.3 (M+H).sup.+: m/z=342.2; Found: 342.2.

Step 6. 2-chloro-7-((cis)-2-hydroxy-2-methylcyclopentyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one

(622) ##STR00018##

(623) To a solution of tert-butyl 2-(2-chloro-4-(((cis)-2-hydroxy-2-methylcyclopentyl)amino) pyrimidin-5-yl)acetate (285 mg, 0.834 mmol) in THE (4.17 mL) was added sodium hydride (60% in mineral oil, 66.7 mg, 1.667 mmol) and the reaction mixture stirred at 65 C. for 2 hr, then quenched with sat. ammonium chloride and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was used directly in the next step without further purification (214 mg, 96%). LCMS calculated for C.sub.12H.sub.15ClN.sub.3O.sub.2 (M+H).sup.+: m/z=268.2; Found: 268.2.

Step 7. 2-chloro-7-((cis)-2-methyl-2-((triethylsilyl)oxy)cyclopentyl)spiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one

(624) ##STR00019##

(625) To a solution of 2-chloro-7-((cis)-2-hydroxy-2-methylcyclopentyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one (535 mg, 1.998 mmol) in DCM (10 mL) at 0 C. were added 2,6-lutidine (349 l, 3.00 mmol) and triethylsilyltrifluoromethanesulfonate (497 L, 2.198 mmol) and the reaction mixture was stirred at r.t. for 30 mins, then quenched with sat. sodium bicarbonate and extracted with DCM. The organic layer was concentrated and the residue dissolved in 3:1 THF/MPA (12 mL). 1,2-dibromoethane (344 L, 4.00 mmol) and sodium hydride (60% in mineral oil, 144 mg, 6.00 mmol) were added and the reaction mixture stirred at r.t. for 2 hr, then was quenched with sat. ammonium chloride and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (15-100% ethyl acetate in hexanes) to provide the desired product as an oil (495 mg, 61%). LCMS calculated for C.sub.20H.sub.31ClN.sub.3O.sub.2Si (M+H).sup.+: m/z=408.2; Found: 408.2.

Step 8. 4-((7-(2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide

(626) To a mixture of 2-chloro-7-((cis)-2-methyl-2-((triethylsilyl)oxy)cyclopentyl)spiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one (100 mg, 0.245 mmol), 4-amino-N-methylbenzenesulfonamide (68.5 mg, 0.368 mmol), XantPhos Pd G2 (21.78 mg, 0.025 mmol) and cesium carbonate (240 mg, 0.735 mmol) was added 1,4-dioxane (1.225 mL) and the reaction flask was evacuated, back filled with nitrogen, then stirred at 100 C. for 1 hr. The mixture was filtered and purified by Biotage Isolera (20-100% ethyl acetate in hexanes). The intermediate was further purified by preparatory chiral LC-MS (Phenomenex Lux 5 m Cellulose-2, 21.2250 mm column, eluting with 28% EtOH in hexanes, flow rate 20 mL/min, Peak 2 retention time 16.5 min) to separate the enantiomers. Peak 2 was then treated with 4N HCl in dioxane (1 mL) for 1 hr at r.t., then diluted with MeOH and purified by prep-LCMS (XBridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product. LCMS calculated for C.sub.21H.sub.26N.sub.5O.sub.4S (M+H).sup.+: m/z=444.2; Found: 444.2.

Example 2. N-methyl-4-((7-((trans)-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)benzenesulfonamide

(627) ##STR00020##

Step 1. 5-bromo-2-chloro-N-(2-methylcyclopentyl)pyrimidin-4-amine

(628) ##STR00021##

(629) To a solution of 5-bromo-2,4-dichloropyrimidine (10 g, 43.9 mmol) in acetonitrile (146 mL) were added Hunig's base (19.16 mL, 110 mmol) and 2-methylcyclopentan-1-amine, HCl (4.35 g, 43.9 mmol) and the reaction mixture was stirred at 60 C. overnight, then quenched with water and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (0-50% ethyl acetate in hexanes) to provide the desired product as an orange oil. LCMS calculated for C.sub.10H.sub.14BrClN.sub.3 (M+H).sup.+: m/z=290.0/292.0; Found: 290.0/292.0.

Step 2. 2-chloro-7-(2-methylcyclopentyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one

(630) ##STR00022##

(631) This compound was prepared in an analogous fashion to Example 1, Steps 4-6, using 5-bromo-2-chloro-N-(2-methylcyclopentyl)pyrimidin-4-amine as the starting material. LCMS calculated for C.sub.12H.sub.15ClN.sub.3O (M+H).sup.+: m/z=252.2; Found: 252.2.

Step 3. trans-2-chloro-7-(2-methylcyclopentyl)spiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one

(632) ##STR00023##

(633) To a solution of 2-chloro-7-(2-methylcyclopentyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one (1.088 g, 4.32 mmol) and 1,2-dibromoethane (0.559 mL, 6.48 mmol) in THF (16.21 mL)/HMPA (5.40 mL) was added sodium hydride (60% in mineral oil, 0.432 g, 10.81 mmol) and the reaction mixture was stirred at r.t. for 1 hr, then quenched with sat. ammonium chloride and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (15-100% ethyl acetate in hexanes) to provide the desired product as a brown oil. This product was purified further by chiral preparatory SFC (column 1: Phenomenex LUX Amylose-1.5 m 21.2250 mm, eluting with 10% MeOH in CO.sub.2, flow rate 80 mL/min, retention time 3.8 minutes; column 2: Phenomenex LUX Cellulose-4 5 m 21.2250 mm, eluting with 15% MeOH in CO.sub.2, flow rate 65 mL/min, retention time 3.3 min) to obtain the most active enantiomer (peak 3 in column 1; peak 1 in column 2. Relative configuration trans, absolute configuration not known; 81 mg). LCMS calculated for C.sub.14H.sub.17ClN.sub.3O (M+H).sup.+: m/z=278.2; Found: 278.2.

Step 4. N-methyl-4-((7-((trans)-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)benzenesulfonamide

(634) To a mixture of 2-chloro-7-((trans)-2-methylcyclopentyl)spiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one (83 mg, 0.299 mmol), 4-amino-N-methylbenzenesulfonamide (83 mg, 0.448 mmol), XantPhos Pd G2 (26.6 mg, 0.030 mmol) and cesium carbonate (243 mg, 0.747 mmol) was added 1,4-dioxane (1494 L) and the reaction flask was evacuated, back filled with nitrogen, then stirred at 100 C. for 1 hr. The mixture was loaded onto a Biotage Isolera column and purified (30100% ethyl acetate in hexanes), then further purified by prep-LCMS (XBridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product. LCMS analysis showed the product to be 96:4 d.r. LCMS calculated for C.sub.21H.sub.26N.sub.5O.sub.3S (M+H).sup.+: m/z=428.2; Found: 428.2.

Example 3. 4-((7-((cis)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(3-methylazetidin-3-yl)benzenesulfonamide

(635) ##STR00024##

Step 1. tert-butyl 3-((4-aminophenyl)sulfonamido)-3-methylazetidine-1-carboxylate

(636) ##STR00025##

(637) To a solution of 4-nitrobenzenesulfonyl chloride (420 mg, 1.895 mmol) in DCM (9.48 mL) were added Hunig's base (828 L, 4.74 mmol) and tert-butyl 3-amino-3-methylazetidine-1-carboxylate, HCl (464 mg, 2.085 mmol) and the reaction mixture was stirred at r.t. for 30 mins, then quenched with sat. sodium bicarbonate and extracted with DCM. The organic layer was concentrated, then dissolved in a 1:1:1 mixture of MeOH/THF/water (12 mL) and iron (423 mg, 7.58 mmol) and ammonium chloride (608 mg, 11.37 mmol) were added. The reaction mixture was heated to 60 C. overnight, then diluted with ethyl acetate and filtered through a plug of Celite. The filtrate was washed with water and brine, dried over sodium sulfate and used in the next step without further purification. LCMS calculated for C.sub.15H.sub.24N.sub.3O.sub.4S (M+H).sup.+: m/z=342.2; Found: 342.2.

Step 2. 4-((7-((cis)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(3-methylazetidin-3-yl)benzenesulfonamide

(638) To a mixture of 2-chloro-7-((cis)-2-methyl-2-((triethylsilyl)oxy)cyclopentyl)spiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one (75 mg, 0.184 mmol), tert-butyl 3-((4-aminophenyl)sulfonamido)-3-methylazetidine-1-carboxylate (94 mg, 0.276 mmol), XantPhos Pd G2 (16.34 mg, 0.018 mmol) and cesium carbonate (180 mg, 0.551 mmol) was added 1,4-dioxane (0.919 mL) and the reaction flask was evacuated, back filled with nitrogen, then stirred at 100 C. for 1 hr. After cooling, 4N HCl in dioxane (1 mL) was added and the reaction mixture was heated at 60 C. for 1 hr, then diluted with MeOH and purified by prep-LCMS (XBridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product. LCMS calculated for C.sub.24H.sub.31N.sub.6O.sub.4S (M+H).sup.+: m/z=499.2; Found: 499.2.

Example 4. (R)N-methyl-4-((6-oxo-7-(1,1,1-trifluorobutan-2-yl)-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)benzenesulfonamide

(639) ##STR00026##

Step 1. ethyl 1-(4-chloro-2-(methylthio)pyrimidin-5-yl)cyclopropane-1-carboxylate

(640) ##STR00027##

(641) To a suspension of sodium hydride (2.006 g, 50.2 mmol) in DMF (60 mL) at 0 C. was added a solution of 1,2-dibromoethane (2.59 mL, 30.1 mmol) and ethyl 2-(4-chloro-2-(methylthio)pyrimidin-5-yl)acetate (4.95 g, 20.06 mmol) in DMF (40 mL) dropwise. The reaction mixture was warmed up to r.t. and stirred for 30 mins, then quenched with sat. ammonium chloride and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (0-50% ethyl acetate in hexanes) to provide the desired product as a yellow oil (3.2 g, 59%). LCMS calculated for C.sub.11H.sub.14ClN.sub.2O.sub.2S (M+H).sup.+: m/z=273.1; Found: 273.1.

Step 2. Ethyl 1-(4-chloro-2-(methylsulfonyl)pyrimidin-5-yl)cyclopropane-1-carboxylate

(642) ##STR00028##

(643) To a solution of ethyl 1-(4-chloro-2-(methylthio)pyrimidin-5-yl)cyclopropane-1-carboxylate (3.1 g, 11.37 mmol) in DCM (60 mL) was added m-CPBA (5.88 g, 34.1 mmol) and the reaction mixture was stirred at r.t. for 3 hr, then quenched with sat. sodium bicarbonate and extracted with DCM. The organic layer was washed with sat. sodium bicarbonate and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (0-100% ethyl acetate in hexanes) to provide the desired product as a white solid. LCMS calculated for C.sub.11H.sub.14ClN.sub.2O.sub.4S (M+H).sup.+: m/z=305.1; Found: 305.1.

Step 3. Tert-Butyl ((4-aminophenyl)sulfonyl)(methyl)carbamate

(644) ##STR00029##

(645) To a solution of 4-nitrobenzenesulfonyl chloride (5 g, 22.56 mmol) in THE (113 mL) were added Hunig's base (5.91 mL, 33.8 mmol) and methanamine (11.85 mL, 23.69 mmol) and the reaction mixture was stirred at r.t. for 30 mins, then concentrated. The residue was dissolved in acetonitrile (100 mL) and triethylamine (4.72 mL, 33.8 mmol), DMAP (0.276 g, 2.256 mmol) and Boc-anhydride (5.24 mL, 22.56 mmol) were added. The reaction mixture was stirred at r.t. for 2 hr, then quenched with water and extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was dissolved in THE (113 mL) and palladium on carbon (10% w/w, 2.401 g, 2.256 mmol) was added. The reaction flask was evacuated, back filled with hydrogen gas from a balloon, then stirred at r.t. for 4 hr. The mixture was diluted with ethyl acetate and filtered through a plug of Celite. The filtrate was concentrated. The residue was purified by Biotage Isolera (0-100% ethyl acetate in hexanes) to provide the desired product (3.5 g, 54%). LCMS calculated for C.sub.12H.sub.19N.sub.2O.sub.4S (M+H).sup.+: m/z=287.1; Found: 287.1.

Step 4. Tert-Butyl ((4-formamidophenyl)sulfonyl)(methyl)carbamate

(646) ##STR00030##

(647) To acetic anhydride (1.322 mL, 14.02 mmol) at 0 C. was added formic acid (0.888 mL, 23.16 mmol) dropwise and the mixture heated to 60 C. for 2 hr. This mixture was then added dropwise to a 0 C. solution of tert-butyl ((4-aminophenyl)sulfonyl)(methyl)carbamate (3.49 g, 12.19 mmol) in THF (30.5 mL)/toluene (30.5 mL). After addition was complete, the mixture was stirred at r.t. for 5 hr, then quenched with water and extracted with ethyl acetate. The organic layer was washed with water, sat. sodium bicarbonate and brine, then dried over sodium sulfate and concentrated. The crude product was used in the next step without further purification (3.56 g, 93%). LCMS calculated for C.sub.13H.sub.19N.sub.2O.sub.5S (M+H).sup.+: m/z=315.1; Found: 315.1.

Step 5. Ethyl-(2-((4-(N-(tert-butoxycarbonyl)-N-methylsulfamoyl)phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate

(648) ##STR00031##

(649) To a solution of ethyl 1-(4-chloro-2-(methylsulfonyl)pyrimidin-5-yl)cyclopropane-1-carboxylate (100 mg, 0.328 mmol) and tert-butyl ((4-formamidophenyl)sulfonyl)(methyl)carbamate (124 mg, 0.394 mmol) in THE (1.641 mL) was added sodium hydride (60% in mineral oil, 15.75 mg, 0.394 mmol) and the reaction mixture was stirred at 60 C. for 3 hr, then quenched with 1N NaOH and allowed to stir at 60 C. for 3 hr. The mixture was then extracted with ethyl acetate. The organic layer was washed with water and brine, dried over sodium sulfate and concentrated. The crude product was purified by Biotage Isolera (25-100% ethyl acetate in hexanes) to provide the desired product as a yellow oil (103 mg, 61%). LCMS calculated for C.sub.22H.sub.28ClN.sub.4O.sub.6S (M+H).sup.+: m/z=511.2; Found: 511.2.

Step 6. (R)N-methyl-4-((6-oxo-7-(1,1,1-trifluorobutan-2-yl)-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)benzenesulfonamide

(650) To a solution of ethyl 1-(2-((4-(N-(tert-butoxycarbonyl)-N-methylsulfamoyl)phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate (20 mg, 0.039 mmol) in 1,4-dioxane (0.391 mL) was added (S)-1,1,1-trifluorobutan-2-amine (10 mg, 0.078 mmol) and the reaction mixture was heated to 120 C. for 48 hr, then quenched with sat. sodium bicarbonate and extracted with DCM. The organic layer was concentrated. The residue was dissolved in THE (1 mL) and sodium hydride (60% in mineral oil, 3.13 mg, 0.078 mmol) was added. The reaction mixture was heated to 70 C. for 1 hr, then quenched with a few drops of 1N HCl, diluted with MeOH and purified by prep-LCMS (XBridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product. LCMS calculated for C.sub.19H.sub.21F.sub.3N.sub.5O.sub.3S (M+H).sup.+: m/z=456.2; Found: 456.2.

Example 5. 4-((7-(2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N((R)-1-methylpiperidin-3-yl) benzenesulfonamide

(651) ##STR00032##

(652) This compound was prepared in a similar manner to Example 3, with (R)-1-methylpiperidin-3-amine replacing tert-butyl 3-amino-3-methylazetidine-1-carboxylate, HCl in Step 1 and 2-chloro-7-(2-methylcyclopentyl)spiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one used as the coupling partner in Step 2. The compound was isolated as a mixture of diastereomers. LCMS calculated for C.sub.26H.sub.35N.sub.6O.sub.3S (M+H).sup.+: m/z=511.2; Found: 511.2.

Example 6. 4-((7-((1R,3R)-3-hydroxycyclohexyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzene sulfonamide

(653) ##STR00033##

(654) To a mixture of ethyl 1-(2-((4-(N-(tert-butoxycarbonyl)-N-methylsulfamoyl) phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate (20 mg, 0.039 mmol) and (1R,3R)-3-aminocyclohexan-1-ol, HCl (11.87 mg, 0.078 mmol) in isoamyl alcohol (0.5 mL) was added Hunig's base (20.51 L, 0.117 mmol) and the reaction mixture was heated to 120 C. for 48 hr, then cooled to r.t. and sodium hydride (4.70 mg, 0.117 mmol, 60% in mineral oil) was added and the reaction mixture was heated to 65 C. for 1 hr. The reaction mixture was then quenched with 1N HCl, diluted with MeOH and purified by prep-LCMS (XBridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product. LCMS calculated for C.sub.21H.sub.26N.sub.5O.sub.4S (M+H).sup.+: m/z=444.2; Found: 444.2.

Example 7. 4-((7-((1R,3R)-3-hydroxycyclohexyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d)benzenesulfonamide

(655) ##STR00034##

Step 1. Tert-Butyl ((4-formamidophenyl)sulfonyl)(methyl-d.SUB.3.)carbamate

(656) ##STR00035##

(657) This compound was prepared in a similar manner to Example 4, Steps 3 and 4, with d.sub.3-methylamine, HCl replacing methanamine. LCMS calculated for C.sub.13H.sub.16D.sub.3N.sub.2O.sub.5S (M+H).sup.+: m/z=318.2; Found: 318.2.

Step 2. Ethyl 1-(2-((4-(N-(tert-butoxycarbonyl)-N-(methyl-d)sulfamoyl)phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate

(658) ##STR00036##

(659) This compound was prepared in a similar manner to Example 4, Step 5, using tert-butyl ((4-formamidophenyl)sulfonyl)(methyl-d.sub.3)carbamate as the coupling partner. LCMS calculated for C.sub.22H.sub.25D.sub.3ClN.sub.4O.sub.6S (M+H).sup.+: m/z=514.2; Found: 514.2.

Step 3. 4-((7-((1R,3R)-3-hydroxycyclohexyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d.SUB.3.)benzenesulfonamide

(660) This compound was prepared in a similar manner to Example 6, with the appropriate deuterated starting material. LCMS calculated for C.sub.21H.sub.23D.sub.3N.sub.5O.sub.4S (M+H).sup.+: m/z=447.2; Found: 447.2. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 10.04 (s, 1H), 8.02 (s, 1H), 7.98 (d, J=8.9 Hz, 2H), 7.67 (d, J=0.4 Hz, 2H), 7.22 (s, 1H), 4.75 (tt, J=12.7, 3.9 Hz, 2H), 4.18-4.08 (m, 1H), 2.27 (qd, J=12.6, 3.8 Hz, 1H), 1.80 (qt, J=13.5, 3.5 Hz, 1H), 1.74-1.65 (m, 5H), 1.59 (dt, J=13.4, 3.1 Hz, 1H), 1.54 (q, J=3.6 Hz, 2H), 1.42 (tt, J=13.2, 3.5 Hz, 1H).

Example 8. (S)-4-((7-(1-cyclopropylethyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d)benzenesulfonamide

(661) ##STR00037##

(662) This compound was prepared in a similar manner to Example 6, with the appropriate deuterated starting material and (S)-1-cyclopropylethan-1-amine as the amine coupling partner. LCMS calculated for C.sub.20H.sub.21D.sub.3N.sub.5O.sub.3S (M+H).sup.+: m/z=417.2; Found: 417.2.

Example 9. 4-((7-((trans)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d)benzene sulfonamide

(663) ##STR00038##

Step 1. 2-chloro-7-((trans)-2-methyl-2-((triethylsilyl)oxy)cyclopentyl)spiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one, Peak 2

(664) ##STR00039##

(665) This compound was prepared as in Example 1, Steps 1-7. After initial purification, the compound was further purified by chiral preparatory SFC (column 1: Phenomenex LUX i-Cellulose-5 5 m 21.2250 mm, eluting with 10% MeOH in CO.sub.2, flow rate 70 mL/min, retention time 5.9 minutes, loading 30 mg). Peak 2 was collected and used in subsequent steps. The absolute stereochemistry was not assigned.

Step 2. 4-((7-(-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(methyl-d.SUB.3.)benzene sulfonamide

(666) This compound was prepared in a similar manner to Example 1, Step 8 using 4-amino-N-(methyl-d.sub.3)benzenesulfonamide as the coupling partner. The compound was isolated as a single enantiomer, the absolute stereochemistry was not assigned. LCMS calculated for C.sub.21H.sub.23D.sub.3N.sub.5O.sub.4S (M+H).sup.+: m/z=447.2; Found: 447.2. .sup.1H NMR (600 MHz, DMSO-d.sub.6) 9.97 (s, 1H), 8.04 (s, 1H), 7.97 (d, J=8.9 Hz, 2H), 7.68 (d, J=8.9 Hz, 2H), 7.21 (s, 1H), 4.69 (dd, J=9.5, 7.2 Hz, 1H), 2.49-2.44 (m, 1H), 2.12-2.03 (m, 1H), 2.01-1.93 (m, 1H), 1.91-1.80 (m, 2H), 1.73 (dq, J=10.1, 5.2, 4.5 Hz, 3H), 1.56 (dt, J=6.8, 2.7 Hz, 2H), 1.05 (s, 3H).

Example 10. 4-((7-(2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(2-hydroxy-2-methylpropyl)benzenesulfonamide

(667) ##STR00040##

(668) This compound was prepared from chiral 2-chloro-7-(2-methyl-2-((triethylsilyl)oxy)cyclopentyl)spiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-6(7H)-one using the procedure outlined in Example 1, Step 8. 4-amino-N-(2-hydroxy-2-methylpropyl)benzenesulfonamide was used as the coupling partner. LCMS calculated for C.sub.24H.sub.32N.sub.5O.sub.5S (M+H).sup.+: m/z=502.2; Found: 502.2.

Example 11. 3-fluoro-4-((7-((trans)-2-hydroxy-2-methylcyclopentyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide

(669) ##STR00041##

(670) This compound was prepared in a similar fashion to Example 1, Step 8, using racemic starting material. 4-amino-3-fluoro-N-methylbenzenesulfonamide was used as the coupling partner. LCMS calculated for C.sub.21H.sub.25FN.sub.5O.sub.4S (M+H).sup.+: m/z=462.2; Found: 462.2.

Example 12. 4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(2-(dimethylamino)ethyl)benzenesulfonamide

(671) ##STR00042##

Step 1. Tert-Butyl ((4-aminophenyl)sulfonyl)(2-(dimethylamino)ethyl)carbamate

(672) ##STR00043##

(673) A solution of 4-nitrobenzenesulfonyl chloride (3.0 g, 13 mmol), N.sup.1,N.sup.1-dimethylethane-1,2-diamine (1.48 mL, 13.5 mmol), and Hunig's base (3.55 mL, 20.3 mmol) in anhydrous THE (34.7 mL) was stirred at room temperature for 4 hr. Then the reaction mixture was concentrated under reduced pressure. The residue was dissolved in anhydrous acetonitrile (34.7 mL), and Boc-anhydride (3.14 mL, 13.5 mmol), triethylamine (2.83 mL, 20.3 mmol), and DMAP (0.165 g, 1.35 mmol) were added. The solution was stirred at room temperature overnight. Additional Boc-anhydride (900 mg) was added to the reaction and the reaction was stirred for 6 hr. Then the solution was washed with water, extracted into ethyl acetate, dried over sodium sulfate, and concentrated under reduced pressure. The residue was dissolved in THE (34.7 mL)/methanol (34.7 mL)/water (34.7 mL) (1:1:1), and iron (3.02 g, 54.1 mmol) and ammonium chloride (4.34 g, 81 mmol) were added. The solution was stirred at 60 C. for 2 hr. Then, the solution was filtered through Celite and rinsed with ethyl acetate and methanol. The filtrate was washed with water and brine, dried over sodium sulfate, and concentrated under reduced pressure. The residue was purified by Teledyne ISCO CombiFlash RF+ (0-20% methanol in dichloromethane) to provide the desired product (3.49 g, 75%). LCMS calculated for C.sub.15H.sub.26N.sub.3O.sub.4S (M+H).sup.+: m/z=344.2; Found: 344.3.

Step 2. Tert-Butyl (2-(dimethylamino)ethyl)((4-formamidophenyl)sulfonyl)carbamate

(674) ##STR00044##

(675) This compound was synthesized in a similar fashion to Example 4, Step 4 using tert-butyl ((4-aminophenyl)sulfonyl)(2-(dimethylamino)ethyl)carbamate (0.5 g) as the starting material. LCMS calculated for C.sub.11H.sub.18N.sub.3O.sub.3S (M-boc+H).sup.+: m/z=272.1; Found: 272.2.

Step 3. Ethyl 1-(2-((4-(N-(tert-butoxycarbonyl)-N-(2-(dimethylamino)ethyl) sulfamoyl)phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate

(676) ##STR00045##

(677) This compound was prepared in a similar fashion to Example 4, step 5 using tert-butyl (2-(dimethylamino)ethyl)((4-formamidophenyl)sulfonyl)carbamate as the formamide to provide the desired product as an orange solid (500 mg, 60%). LCMS calculated for C.sub.25H.sub.35ClN.sub.5O.sub.6S (M+H).sup.+: m/z=568.2; Found: 568.2.

Step 4. Tert-Butyl ((4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)phenyl)sulfonyl)(2-(dimethylamino)ethyl)carbamate

(678) ##STR00046##

(679) Ethyl 1-(2-((4-(N-(tert-butoxycarbonyl)-N-(2-(dimethylamino)ethyl)sulfamoyl) phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate (0.182 g, 0.320 mmol), cesium carbonate (0.313 g, 0.961 mmol), XantPhos Pd G2 (0.028 g, 0.032 mmol), and 2-chloro-5-fluoroaniline (0.070 g, 0.481 mmol) were added to a 40-mL scintillation flask. The solution was vacuum/nitrogen purged 3, and then anhydrous 1,4-dioxane (3.20 mL) was added. The solution was heated to 100 C. and the solution was stirred at 100 C. overnight. The solution was cooled and then concentrated under reduced pressure. The crude product was purified by Teledyne ISCO CombiFlash RF+(0-100% ethyl acetate in hexanes, then 0-20% methanol in dichloromethane) to provide the desired product. LCMS calculated for C.sub.29H.sub.33ClFN.sub.6O.sub.5S (M+H).sup.+: m/z=631.2; Found: 631.2.

Step 5. 4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(2-(dimethylamino)ethyl)benzenesulfonamide

(680) tert-Butyl ((4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro [cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)phenyl)sulfonyl)(2-(dimethylamino)ethyl)carbamate (0.32 mmol) and 4M HCl in dioxane (2 mL) in anhydrous methanol (3 mL) were stirred at room temperature for 3 hr. Additional 4M HCl in dioxane (2 mL) was added. The reaction was stirred for 2 hr. Then, the reaction was diluted with methanol and purified by prep LCMS (Xbridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product as a cream-colored solid. LCMS calculated for C.sub.24H.sub.25CFN.sub.6O.sub.3S (M+H).sup.+: m/z=531.1; Found: 531.1. .sup.1H NMR (400 MHz, dmso-d.sub.6) 10.08 (s, 1H), 8.19 (s, 1H), 7.92 (d, J=8.8 Hz, 2H), 7.81 (dd, J=9.0, 5.6 Hz, 1H), 7.77 (dd, J=8.8, 2.9 Hz, 1H), 7.73 (t, J=6.1. Hz, 1H), 7.65 (d, J=8.8 Hz, 2H), 7.51 (td, J=8.7, 2.9 Hz, 1H), 3.13 (appq, J=5.7 Hz, 2H), 3.01 (appq, J=6.1 Hz, 2H), 2.78 (d, J=4.4 Hz, 6H), 1.93-1.87 (m, 2H), 1.74-1.68 (m, 2H).

Example 13. 4-((7-(7-chloro-1,2,3,4-tetrahydroisoquinolin-6-yl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide

(681) ##STR00047##

Step 1. tert-butyl 6-amino-7-chloro-3,4-dihydroisoquinoline-2(1H)-carboxylate

(682) ##STR00048##

(683) A solution of tert-butyl 7-chloro-6-nitro-3,4-dihydroisoquinoline-2(1)-carboxylate (150.0 mg, 0.480 mmol), iron (0.107 g, 1.91 mmol), and ammonium chloride (0.154 g, 2.88 mmol) in THF (0.79 mL)/methanol (0.79 mL)/water (0.79 mL) was stirred at 60 C. for 2 hr. Then, the solution was filtered through Celite and rinsed with ethyl acetate and methanol. The filtrate was washed with water and brine, dried over sodium sulfate, and concentrated under reduced pressure. The crude product was purified by Teledyne ISCO CombiFlash RF+(0-100% ethyl acetate in hexanes) to provide the desired product as a white solid. LCMS calculated for C.sub.14H.sub.20CN.sub.2O.sub.2 (M+H).sup.+: m/z=283.1; Found: 283.2.

Step 2. Tert-Butyl 7-chloro-6-((5-(1-(ethoxycarbonyl)cyclopropyl)-2-((4-(N-methylsulfamoyl)phenyl)amino)pyrimidin-4-yl)amino)-3,4-dihydroisoquinoline-2(1H)-carboxylate

(684) ##STR00049##

(685) A solution of ethyl 1-(2-((4-(N-(tert-butoxycarbonyl)-N-methylsulfamoyl)phenyl)amino)-4-chloropyrimidin-5-yl)cyclopropane-1-carboxylate (Example 4, Step 5, 50 mg, 0.098 mmol), tert-butyl 6-amino-7-chloro-3,4-dihydroisoquinoline-2(1H)-carboxylate (55 mg, 0.196 mmol), and p-toluenesulfonic acid monohydrate (1.8 mg, 9.78 mol) in anhydrous 1,4-dioxane (1.25 mL) was stirred at 120 C. overnight. The reaction was cooled and concentrated under reduced pressure to provide the desired product, which was used immediately in the next step without further purification. LCMS calculated for C.sub.31H.sub.38ClN.sub.6O.sub.6S (M+H).sup.+: m/z=657.2; Found: 657.2.

Step 3. 1-(4-((2-(tert-butoxycarbonyl)-7-chloro-1,2,3,4-tetrahydroisoquinolin-6-yl)amino)-2-((4-(N-methylsulfamoyl)phenyl)amino)pyrimidin-5-yl)cyclopropane-1-carboxylic Acid

(686) ##STR00050##

(687) A solution of tert-butyl 7-chloro-6-((5-(1-(ethoxycarbonyl)cyclopropyl)-2-((4-(N-methylsulfamoyl)phenyl)amino)pyrimidin-4-yl)amino)-3,4-dihydroisoquinoline-2(1H)-carboxylate (0.098 mmol), lithium hydroxide (7.03 mg, 0.294 mmol) in THE (0.73 mL)/water (0.24 mL) (3:1) was stirred at room temperature overnight. The reaction was quenched with 1M HCl until acidic and the solution extracted into ethyl acetate 3. The organic phase was dried over sodium sulfate and was concentrated under reduced pressure to provide the desired product, which was used immediately in the next step without further purification. LCMS calculated for C.sub.29H.sub.34ClN.sub.6O.sub.6S (M+H).sup.+: m/z=629.2; Found: 629.2.

Step 4. 4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-(2-(dimethylamino)ethyl)benzenesulfonamide

(688) A solution of 1-(4-((2-(tert-butoxycarbonyl)-7-chloro-1,2,3,4-tetrahydroisoquinolin-6-yl)amino)-2-((4-(N-methylsulfamoyl)phenyl)amino)pyrimidin-5-yl)cyclopropane-1-carboxylic acid (0.098 mmol), HATU (45 mg, 0.117 mmol), and Hunig's base (0.034 mL, 0.196 mmol) in anhydrous DMF (0.5 mL) was stirred at room temperature for 2 hr. Then, the reaction was extracted into ethyl acetate 3, washed with water, 10% aqueous lithium chloride, and brine, dried over sodium sulfate, and concentrated under reduced pressure. The residue was dissolved in anhydrous methanol (0.5 mL) and 4M HCl in dioxane (0.416 mL, 1.66 mmol) was added. The solution was stirred at room temperature overnight. Then, the solution was diluted with methanol and acetonitrile and was purified by prep LCMS (Xbridge C18 column, eluting with a gradient of acetonitrile/water containing 0.1% TFA, at flow rate of 60 mL/min) to provide the desired product as a cream-colored solid. LCMS calculated for C.sub.24H.sub.24ClN.sub.6O.sub.3S (M+H).sup.+: m/z=511.1; Found: 511.1.

Example 14. 4-((7-(5-fluoro-2-methylphenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide

(689) ##STR00051##

(690) This compound was prepared in a similar manner to Example 13, using 5-fluoro-2-methylaniline as the coupling partner. LCMS calculated for C.sub.22H.sub.21FN.sub.5O.sub.3S (M+H).sup.+: m/z=454.1; Found: 454.1.

Example 15. 4-((7-(2-chloro-5-fluorophenyl)-6-oxo-6,7-dihydrospiro[cyclopropane-1,5-pyrrolo[2,3-d]pyrimidin]-2-yl)amino)-N-methylbenzenesulfonamide

(691) ##STR00052##

(692) This compound was prepared in a similar manner to Example 13, using 2-chloro-5-fluoroaniline as the coupling partner. LCMS calculated for C.sub.21H.sub.18ClFN.sub.5O.sub.3S (M+H).sup.+: m/z=474.1; Found: 474.1. .sup.1H NMR (400 MHz, dmso-d.sub.6) 10.03 (s, 1H), 8.18 (s, 1H), 7.90-7.87 (m, 2H), 7.81 (dd, J=9.0, 5.5 Hz, 1H), 7.77 (dd, J=8.8, 3.1 Hz, 1H), 7.60-7.57 (m, 2H), 7.53-7.48 (m, 1H), 7.22-7.17 (m, 1H), 2.36 (d, J=4.2 Hz, 3H), 1.92-1.86 (m, 2H), 1.73-1.67 (m, 2H).

Example A. CDK2/Cyclin E1 HTRF Enzyme Activity Assay

(693) CDK2/Cyclin E1 enzyme activity assays utilize full-length human CDK2 co-expressed as N-terminal GST-tagged protein with FLAG-Cyclin E1 in a baculovirus expression system (Carna Product Number 04-165). Assays are conducted in white 384-well polystyrene plates in a final reaction volume of 8 L. CDK2/Cyclin E1 (0.25 nM) is incubated with compounds (40 nL serially diluted in DMSO) in the presence of ATP (50 M or 1 mM) and 50 nM ULight-labeled eIF4E-binding protein 1 (THR37/46) peptide (PerkinElmer) in assay buffer (containing 50 mM HEPES pH 7.5, 1 mM EGTA, 10 mM MgCl.sub.2, 2 mM DTT, 0.05 mg/mL BSA, and 0.01% Tween 20) for 60 minutes at room temperature. The reactions are stopped by the addition of EDTA and Europium-labeled anti-phospho-4E-BP1 antibody (PerkinElmer), for a final concentration of 15 mM and 1.5 nM, respectively. HTRF signals are read after 1 hour at room temperature on a PHERAstar FS plate reader (BMG Labtech). Data is analyzed with IDBS XLFit and GraphPad Prism 5.0 software using a three or four parameter dose response curve to determine IC.sub.50 for each compound. The IC.sub.50 data as measured for the Examples at 1 mM ATP in the assay of Example A is shown in Table 1.

(694) TABLE-US-00005 TABLE 1 Example IC.sub.50 (nM) 1 + 2 + 3 + 4 + 5 + 6 + 7 + 8 + 9 + 10 + 11 + 12 + 13 + 14 + 15 + + refers to 50 nM ++ refers to >50 nM to 200 nM +++ refers to >200 nM to 500 nM ++++ refers to >500 nM to 1000 nM

Example B1. Characterization of Cyclin E1 in Ovarian and Endometrial Cancer Cell Lines

(695) The cyclin E1 (CCNE1) gene was evaluated in various ovarian and endometrial cancer cell lines (FIGS. 1A and 1). CCNE1 was amplified in COV318, OVCAR3 OVARY, Fu-OV1, and KLE cells, each of which displayed a CCNE1 gain of function by copy number (copy number (CN)>2) (FIG. 1A). In contrast, CCNE1 was not amplified in COV504, OV56, or Igrov1 cells, each of which displayed copy neutral (2) or loss of function of the gene (CN2). CN was obtained from the Broad Institute Cancer Cell Line Encyclopedia (CCLE) database (Barretina, et al., Nature, 2012, 483(7391):603-7, which is incorporated herein by reference in its entirety).

(696) Western blot analysis was performed on protein samples from COV318, OVCAR3_OVARY, Fu-OV1, KLE, COV504, OV56, and Igrov1 cells to evaluate CCNE1 protein levels. CCNE1 protein levels were higher in cell lines with CCNE1 gain of function by copy number (CN>2; i.e., COV318, OVCAR3 OVARY, Fu-OV1, and KLE cells) compared to cell lines with copy neutral or loss of function of the gene (CN2; i.e., COV504, OV56, and Igrov1 cells).

Example B2. CDK2-Knockdown by siRNA Inhibits Proliferation in CCNE1-Amplified, but not CCNE1-Non-Amplified Human Cancer Cell Lines

(697) The effect of CDK2-knockdown in CCNE1-amplified versus CCNE1-non-amplified cell lines was evaluated. CCNE1-amplified cell lines (Fu-OV1 and KLE) or CCNE1-non-amplified cell lines (COV504 and Igrov1) were treated with a control (ctrl) or CDK2-specific small interfering RNAs (siRNAs) (CDK2 siRNA-1 and CDK2 siRNA-2) (FIGS. 2A and 2B and 3A and 3B). Seventy-two hours after transfection with the siRNAs, the cells were harvested and subjected to cell cycle analysis by fluorescence activated cell sorting (FACS) (FIGS. 2A and 3A). Knockdown of CDK2 was confirmed by western blot (FIGS. 2B and 3B). CDK2-knockdown inhibited proliferation in CCNE1-amplified cell lines, but not in CCNE1-non-amplified cell lines (FIGS. 2A and 3A).

(698) A similar experiment was performed in additional CCNE1-amplified cell lines (COV318, OVCAR3, Fu-OV1, and KLE) and CCNE1-non-amplified cell lines (COV504, OV56, and Igrov1) (FIG. 4). The percentage of cells at the S phase three days after treatment with CDK2-specific siRNAs was significantly decreased in CCNE1-amplified cell lines as compared to treatment with control siRNA (FIG. 4). Consistent with the results of FIGS. 2A and 3A, the percentage of cells at the S phase three days after treatment with CDK2-specific siRNAs was not significantly different in CCNE1-non-amplified cell lines as compared to treatment with control siRNA (FIG. 4).

Example B3. Proliferation in CCNE1 Amplified and CCNE-Non-Amplified Cell Lines Upon CDK4/6 Inhibition

(699) The effect of CDK4/6-inhibition in CCNE1-amplified versus CCNE1-non-amplified cell lines was evaluated. CCNE1-amplified cells (OVCAR3) or CCNE1-non-amplified cells (COV504) were treated with dimethyl sulfoxide (DMSO) control or increasing concentrations of CDK4/6 inhibitor palbociclib (FIG. 5). Sixteen hours after treatment with DMSO or palbociclib, the cells were harvested and subjected to cell cycle analysis by FACS (FIG. 5). CDK4/6-inhibition resulted in dose-dependent inhibition of the proliferation in CCNE1-non-amplified cells, but not in CCNE1-amplified cells (FIG. 5).

(700) A similar experiment was performed in a larger set of CCNE1-amplified cell lines (COV318 and OVCAR3) and CCNE1-non-amplified cell lines (COV504, OV56, and Igrov1) (FIG. 6). The percentage of cells at the S phase 16 hours after treatment with palbociclib was decreased in CCNE1-non-amplified cell lines in a dose-dependent fashion as compared to treatment with DMSO (FIG. 6). Consistent with the results of FIG. 5, the percentage of cells at the S phase 16 hours after treatment with palbociclib was not significantly different in CCNE1-amplified cell lines as compared to treatment with DMSO (FIG. 6).

Example B4. CDK2-Knockdown Blocks Rb Phosphorylation at S780 in CCNE1-Amplified, but not in CCNE1-Non-Amplified, Cell Lines

(701) The effect of CDK2-knockdown on Rb phosphorylation at Ser-780 of SEQ ID NO:3 (S780) in CCNE1-amplified versus CCNE1-non-amplified cell lines was evaluated. CCNE1-amplified cell lines (COV318, Fu-OV1 and KLE) or CCNE1-non-amplified cell lines (COV504, OV56 and Igrov1) were treated with ctrl or CDK2-specific siRNAs (FIGS. 7A and 7B). 72 hours after transfection with the siRNAs, the cells were harvested and total protein was extracted and analyzed by western blot. Knockdown of CDK2 was confirmed by western blot. CDK2-knockdown blocked Rb phosphorylation at S780 in CCNE1-amplified cell lines (FIG. 7A), but not in CCNE-non-amplified cell lines (FIG. 7B).

Example B5. Palbociclib Blocks Rb Phosphorylation at S780 in CCNE1 Non-Amplified, but not in CCNE1-Amplified, Cell Lines

(702) The effect of CDK4/6-inhibition on Rb phosphorylation at S780 in CCNE1-amplified versus CCNE1-non-amplified cell lines was evaluated. CCNE1-amplified cell lines (OVCAR3 and COV318) or CCNE1-non-amplified cell lines (COV504 and OV56) were treated with DMSO or various doses of palbociclib (FIGS. 8A and 8B). One or 15 hours after treatment, the cells were harvested and total protein was extracted and analyzed by western blot (FIG. 8). Palbociclib treatment blocked Rb phosphorylation at S780 in CCNE1-non-amplified cell lines (FIG. 8B), but not in CCNE1-amplified cell lines (FIG. 8A).

Example B6. CDK2 Degradation by dTAG Decreases Rb Phosphorylation at S780

(703) To further confirm that CDK2 knockdown decreases Rb phosphorylation at S780 in CCNE1-amplified cells (see Example B4), the dTAG system was used to degrade CDK2 and the level of S780-phosphorylated Rb was evaluated (Erb et al., Nature, 2017, 543(7644):270-274, which is incorporated herein by reference in its entirety). Briefly, OVCAR3 cells were engineered to express Cas9 by lentiviral transduction of Cas9 construct. The OVCAR3-Cas9 cells were then engineered to express CDK2-FKBP12F36V-HA fusion protein by lentiviral transduction of CDK2-FKBP12F36V-HA expression construct. Next, to engineer the line to have endogenous CDK2 inactivated, OVCAR3 (Cas9, CDK2-FKBP12F36V-HA) cells were transduced with CDK2 sgRNA (CDK2-gRNA); OVCAR3 (Cas9, CDK2-FKBP12F36V-HA) cells transduced with non-targeting sgRNA (Ctl-gRNA; Cellecta) served as a control cell line.

(704) To degrade CDK2-FKBP12F36V-HA protein by dTAG (FIG. 9A), cells were treated with DMSO or with a titration of concentrations of dTAG for 14 hours. Cells were collected and processed for Western blot (FIG. 9B). A dose-responsive degradation of CDK2-FKBP12(F36V) was detected by western blot after treatment with dTAG in both control- and CDK2-gRNA treated cells (FIG. 9B). Degradation was further confirmed by western blot for HA-Tag. Endogenous CDK2 protein was detected in OVCAR3 cells treated with control gRNA, but not with CDK2-gRNA (FIG. 9B). CDK2-FKBP12(F36V) degradation inhibited Rb phosphorylation at S780 in CDK2 knockout OVCAR3 cells, but not in OVCAR3 cells with endogenous CDK2 expression.

Example B7. p-Rb S780 HTRF Cellular Assay for Identification of CDK2 Inhibitors

(705) An in vitro CDK2/CCNE1 enzyme activity assay was used to measure phosphorylation of a peptide substrate using homogenous time-resolved energy transfer (HTRF). First, the specificity of 8-((1R,2R)-2-hydroxy-2-methylcyclopentyl)-2-((1-(methylsulfonyl)piperidin-4-yl)amino)pyrido[2,3-d]pyrimidin-7(8H)-one (Compound A; see US Patent Application Publication No. 2018/0044344 at page 51, paragraph [0987], which is incorporated by reference herein in its entirety) for CDK2 inhibition was confirmed via a kinase activity assay (FIG. 10A). To this end, the LANCE Ultra kinase assay was used with a ULight-labeled EIF4E-binding protein 1 (Thr37/46) peptide (PerkinElmer, TRF0128-M) as substrate and an Europium-labeled anti-phospho-EIF4E binding protein1 (Thr37/46) antibody (PerkinElmer, TRF0216-M). A ratio of fluorescence transferred to the labeled substrate (665 nm) relative to fluorescence of the Europium donor (620 nm) represents the extent of phosphorylation. The IC.sub.50 for Compound A was determined to be 1.1 nM (FIG. 10A). In contrast, the IC.sub.50 for the CDK4/6 inhibitor palbociclib was 10,000 nM (FIG. 10A).

(706) Next, a CDK2 pRb (S780) HTRF cellular assay was performed, enabling the quantitative detection of Rb phosphorylated on serine 780 in CCNE1 amplified COV318 cells upon treatment with Compound A or palbociclib (FIG. 10B). Treatment with Compound A, but not palbociclib, inhibited Rb phosphorylation on serine 780 in CCNE1 amplified cells (FIG. 10B). The IC.sub.50 for Compound A in this assay was 37 nM, while the IC.sub.50 for palbociclib was >3,000 nM (FIG. 10B).

(707) ##STR00053##

Example B8. Bioinformatics Analysis of CCLE Dataset Reveals the Sensitivity to CDK2 Inhibition in CCNE1 Amplified Cells Relies on Functional p16

(708) In an attempt to identify a biomarker for predicting sensitivity to CDK2-inhibition in CCNE1-amplified cells, 460 cell lines from CCLE were analyzed (Barretina, supra). First, the cell lines were filtered based on CCNE1 copy number and expression and CDK2 sensitive score based on shRNA knockdown data. A total of 41 cell lines were identified as having CCNE1 copy number of >3 and CCNE1 expression score (CCLE: >3). Of these 41 cell lines, 18 (44%) were sensitive to CDK2 inhibition (CDK2 sensitive score3), while 23 (56%) were insensitive to CDK2 inhibition (CDK2 sensitive score>3).

(709) Next, the p16 status was evaluated in the CDK2-sensitive and CDK2-insensitive cell lines (FIG. 11). Of the 18 cell lines that were sensitive to CDK2-inhibition, 100% expressed normal p16 gene (FIG. 11). In contrast, only 4 of the 23 CDK2-insensitive cell lines expressed normal p16 gene (FIG. 11). The majority of the 23 CDK2-insensitive cell lines displayed dysfunctional p16 gene expression: the p16 gene was deleted in 10 of 23 cell lines; the p16 gene was silenced in 5 of the 23 cell lines, and the p16 gene was mutated in 4 of the 23 cell lines (FIG. 11).

(710) A summary of CDK2 sensitivity and CDKN2A/p16 status in CCNE1 amplified cell lines is provided in Table 2, below.

(711) TABLE-US-00006 TABLE 2 Cell lines with CDK2 sensitive Score 3 counted as CDK2 Sensitive lines; 3 as CDK2 insensitive line. Cell lines verified in experiments are in bold. NCIN87_STOMACH showed no CDKN2A/P16 protein expression in western blot. CCNE1 and CDKN2A/P16 copy number were calculated based on CCLE dataset. Expression Score <0 counted as gene silencing. CDKN2A/p16 CDK2 CCNE1 CDKN2 mRNA CDKN2a/ sensitive Copy A Copy Expression p16 Cell Lines Score No. No. Score Dysfunction HCC1569.sub.BREAST 9.6 16 2 5.11 OVISE_OVARY 9.4 3 2 4.17 MKN1.sub.STOMACH 8.9 5 1 4.28 EFE184_ENDOMETRIUM 8.7 3 2 3.97 KURAMOCHI_OVARY 8.2 3 2 3.60 MKN7.sub.STOMACH 7.7 21 1 4.37 MDAMB157_BREAST 7.6 6 2 5.01 HCC70_BREAST 7.6 4 4 4.88 NIHOVCAR3.sub.OVARY 7.4 10 2 4.15 FUOV1.sub.OVARY 7 10 3 5.19 KLE.sub.ENDOMETRIUM 7 7 2 6.24 COV318.sub.OVARY 7 14 2 5.09 CAOV4_OVARY 6.7 3 2 3.59 MFE280_ENDOMETRIUM 6.3 4 2 4.97 NCIH661_LUNG 6.2 5 2 3.73 OVCAR4_OVARY 4.3 4 1 4.77 SNU8_OVARY 3.8 5 3 5.35 OVCAR8_OVARY 3.7 3 2 5.21 RMUGS_OVARY 2.8 4 1 0.08 Silencing NCCSTCK140_STOMACH 2.7 3 0 4.70 Deletion NCIH2286_LUNG 1.6 3 1 3.63 Mutation HOP62_LUNG 1.4 4 0 1.21 Deletion LN340_CENTRAL_NERVOUS_SYSTEM 1.0 3 0 5.47 Deletion NCIH1339_LUNG 0.8 3 2 2.42 Unknown NCIN87.sub.STOMACH 0.1 3 2 4.67 No preteen U2OS_BONE 0.4 3 1 5.72 Silencing SF172_CENTRAL_NERVOUS_SYSTEM 0.5 3 0 2.35 Deletion CAL120_BREAST 0.6 4 1 4.86 RMGI_OVARY 0.9 3 0 3.33 Deletion OV90_OVARY 0.9 3 1 3.95 Mutation SNU601_STOMACH 1.1 4 2 3.79 Silencing EW8_BONE 1.5 5 1 3.11 JHESOAD1_OESOPHAGUS 1.7 5 0 5.52 Deletion HCC1806_BREAST 1.9 8 0 4.61 Deletion NCIH2170_LUNG 2.0 3 0 3.73 Deletion HCC1428_BREAST 2.3 3 2 2.28 A549_LUNG 2.5 4 0 6.13 Deletion LXF289_LUNG 2.6 4 3 4.10 Mutation AGS.sub.STOMACH 3.0 3 2 5.56 Silencing NCIH647_LUNG 3.0 4 0 5.07 Deletion HLF_LIVER 3.9 3 2 3.40

Example B9. CCNE1 Amplified Cells with Dysfunctional p16 do not Respond to CDK2 Inhibition

(712) To further evaluate the role of p16 in CDK2-sensitivity in CCNE-amplified cells, p16 protein expression in three gastric cell lines with CCNE1-amplification was evaluated by western blot. AGS and NCI-N87 cells displayed absent or dramatically reduced levels of p16 (FIG. 12A). In contrast, p16 protein was detected in MKN1 cellular protein extracts (FIG. 12A).

(713) Next, the impact of CDK2-knockdown in these cells was evaluated. Mknl, Ags, and NCI-N87 cells were treated with control or CDK2-specific siRNA. Three days-post-siRNA transfection, cell cycle phase distribution of the cells was evaluated by FACS. The percentage of cells at the S phase in the Mkn cells (CCNE-amplified, p16 protein detected) was significantly decreased in the CDK2 siRNA-treated cells as compared to control (FIG. 12B). In contrast, the percentage of cells at the S phase was not significantly decreased in Ags and NCI-N87 cells (CCNE1-amplified, dysfunctional p16 protein levels) after treatment with CDK2 siRNA as compared to control (FIG. 12B).

Example B10. p16 Knockdown by siRNA Abolishes CDK2 Inhibition Induced Cell Cycle Suppression in CCNE1 Amplified Cells

(714) To confirm the role of p16 in CDK2-sensitivity of CCNE-amplified cells, COV318 cells were treated with control or p16-specifict siRNA. Seventy-two hours after transfection, cells were treated with DMSO (control) or 100 nM of Compound A. Sixteen hours after treatment with DMSO or the CDK2-inhibitor, cells were harvested and subjected to cell cycle analysis by FACS. Consistent with the results described above, the percentage of S phase cells significantly decreased in the control siRNA-treated cells treated with CDK2-inhibitor (Compound A), but not with the DMSO control (FIG. 13). In contrast, the percentage of S phase cells was not significantly decreased after treatment with the CDK2-inhibitor (Compound A) in p16 knocked down cells as compared to DMSO control (FIG. 13).

(715) Materials and Methods Used in Examples B1-B10

(716) Cell Culture and Transfection

(717) Human cyclin E1 (CCNE1) amplified ovarian cell lines OVCAR3, COV318, Fu-OV1, endometrial cell line KLE, gastric cell lines MKN1, AGS, NCIN87, and CCNE1 non-amplified ovarian cell lines COV504, OV56, Igrov1 were cultured in RPMI 1640 medium. The complete growth medium was supplemented with 10% FBS, 0.1 mM non-essential amino acids, 2 mM L-glutamine, 100 units/mL penicillin G and 100 g/mL streptomycin in 37 C. humidified incubator and an atmosphere of 5% CO.sub.2 in air. Fu-OV1 line was purchased from Leibniz-Institute DSMZGerman Collection of Microorganisms and Cell Cultures; MKN1 was purchased from Japanese Cancer Research Resources Bank; and the rest of cell lines were purchased from American Type Culture Collection. For transfection, cells were seeded into 6-well for 24 hours and transiently transfected by Lipofectamine 2000 Reagent (Thermo Fisher, 11668027). ON-TARGETplus Human CKD2 siRNAs (GE Healthcare Dharmacon, J-003236-11-0002 and J-003236-12-0002) and ON-TARGETplus Human CDKN2A/p16 siRNAs (GE Healthcare Dharmacon, J-011007-08-0002) were used to knockdown the endogenous CDK2 and CDKN2A/p16. ON-TARGETplus Non-targeting Pool (GE Healthcare Dharmacon, D-001810-10-20) was used as a negative control.

(718) Western Blot Analysis

(719) Whole cell extracts were prepared using RIPA buffer (Thermo Scientific, 89900) with a Halt Protease and Phosphatase Inhibitor Cocktail (Thermo Scientific, 78440). Protein concentration was quantified with a BCA Protein Assay Kit (Thermo Scientific, 23225) and 40 g of protein lysates were loaded for SDS-PAGE using precast gradient gels (Bio-Rad, Hercules, No. 456-1094). Samples were diluted in 5Laemmli buffer (300 mM Tris-HCl pH 6.8, 10% SDS (w/v), 5% 2-mercaptoethanol, 25% glycerol (v/v), 0.1% bromophenol blue w/v) and boiled for 5 minutes. 35 g of proteins were separated by 8-15% SDS-PAGE and transferred onto polyvinylidene fluoride (PVDF) membranes. Unspecific binding sites on the PVDF membranes were blocked with 5% non-fat milk in TBST (20 mM Tris-HCl, pH 7.6, 137 mM NaCl, 1% Tween-20). Membranes were hybridized with antibodies against anti-CDKN2A/p16 (Cell Signaling Technology, 92803S), anti-Cas9 (Cell Signaling Technology, 97982S), anti-HA (Cell Signaling Technology, 3724S), anti-Rb (Cell Signaling Technology, 9309S), anti-phospho-Rb (Ser780) (Cell Signaling Technology, 8180S), anti-CDK2 (Cell Signaling Technology, 2546S), anti-CCNE1 (Cell Signaling Technology, 20808S) and anti-GAPDH (Cell Signaling Technology, 8884S) for overnight at 4 C., followed by incubation with horseradish peroxidase(HRP)-conjugated secondary antibodies for 1 hour at room temperature. The membranes were then developed using Immobilon Western chemiluminescence HRP substrates (Millipore, WBKLS0500). Images were captured by Luminescence/Fluorescence Imaging System Odyssey CLx Imager (LI-COR).

(720) Cell Cycle Analysis

(721) Cells were seeded in six-well tissue culture plates and 24 hours later were treated with a titration of concentrations of Palbociclib or Compound A. After overnight treatment, cells exposed to 10 M EdU for 3 hours before detection of EdU-DNA by Click-iT AlexaFluor 647 azide kit (Life Technology, C10424) following the manufacturer's instructions. Bulk DNA was stained with DAPI. Compound-treated and DMSO treated control cells were acquired with CytoFlex (Beckman Coulter) and were analyzed using the FlowJo software. For cell cycle analysis of cells with siRNA knockdown, 72 hours after siRNA transfection, cells exposed to 10 M EdU for 3 hours before detection of Click-iT Alexa Fluor 647 azide kit.

(722) Plasmids

(723) LentiCas9 plasmid pRCCH-CMV-Cas9-2A (Cellecta, SVC9-PS) was used for Cas9 expression. sgRNA-CDK2 lentiviral construct, designed to target AAGCAGAGATCTCTCGGA (SEQ ID NO:8) of CDK2, was cloned into sgRNA expression vector pRSG-U6 and purchased from Cellecta (93661). For CDK2-FKBP12F36V-HA expression, a 1306 base pair DNA fragment encoding CDK2 and FKBP12F36V-2HA tag at the C-terminus was synthesized and cloned into EcoRI and BamHI digested pCDH-EFla-MCS-T2A-Puro lentivector (Systembio, CD527A-1).

(724) Sequence of 1306 bp DNA Fragment:

(725) TABLE-US-00007 (SEQIDNO:4) CCTCGAATTCAGCTGCATGGAGAACTTCCAAAAGGTGGAAAAGATCGGAG AGGGCACGTACGGAGTTGTGTACAAAGCCAGAAACAAGTTGACGGGAGA GGTGGTGGCGCTTAAGAAAATCCGCCTGGACACTGAGACTGAGGGTGTG CCCAGTACTGCCATCCGAGAGATCTCTCTGCTTAAGGAGCTTAACCATCC TAATATTGTCAAGCTGCTGGATGTCATTCACACAGAAAATAAACTCTACC TGGTTTTTGAATTTCTGCACCAAGATCTCAAGAAATTCATGGATGCCTCT GCTCTCACTGGCATTCCTCTTCCCCTCATCAAGAGCTATCTGTTCCAGCT GCTCCAGGGCCTAGCTTTCTGCCATTCTCATCGGGTCCTCCACCGAGACC TTAAACCTCAGAATCTGCTTATTAACACAGAGGGGGCCATCAAGCTAGCA GACTTTGGACTAGCCAGAGCTTTTGGAGTACCTGTTCGTACTTACACCCA TGAAGTGGTGACCCTGTGGTACCGAGCTCCTGAAATCCTCCTGGGCTGCA AATATTATTCCACAGCTGTGGACATCTGGAGCCTGGGCTGCATCTTTGCT GAGATGGTGACTCGCCGGGCCCTATTCCCTGGAGATTCTGAGATTGACCA GCTCTTTCGGATCTTTCGGACTCTGGGGACCCCAGATGAGGTGGTGTGG CCAGGAGTTACTTCTATGCCTGATTACAAGCCAAGTTTCCCCAAGTGGGC CCGGCAAGATTTTAGTAAAGTTGTACCTCCCCTGGATGAAGATGGACGGA GCTTGTTATCGCAAATGCTGCACTACGACCCTAACAAGCGGATTTCGGCC AAGGCAGCCCTGGCTCACCCTTTCTTCCAGGATGTGACCAAGCCAGTAC CCCATCTTCGACTCGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGG CGCACCTTCCCCAAGCGCGGCCAGACCTGCGTGGTGCACTACACCGGGAT GCTTGAAGATGGAAAGAAAGTTGATTCCTCCCGGGACAGAAACAAGCCCT TTAAGTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGG GTTGCCCAGATGAGTGTGGGTCAGAGAGCCAAACTGACTATATCTCCAGA TTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCACCACATGCCA CTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAAGGATACCCTTACGAC GTTCCTGATTACGCTTACCCTTACGACGTTCCTGATTACGCTGGATCCTA ATTCGAAAGC

(726) GAATTC (SEQ ID NO:5; EcoRI), GGATCC (SEQ ID NO:6; BamHI) and TTCGAA (SEQ ID NO:7; BstBI) restriction enzyme sites were underlined. Sequence encoding CDK2 is in bold and sequence of FKBP12F36V-HA is in italics. Three nucleic acids underlined within the CDK2 sequence indicated modifications that abolished PAM sites to avoided CRISPR knockout effect. These changes did not change amino acids encoded.

(727) Lentivirus Production

(728) Production of lentivirus was performed in 293T cells by co-transfection of Lentiviral Packaging Mix (Sigma, SHP001), and a given lentiviral expression plasmid using Lipofectamine 2000. Viral supernatants were collected 48 and 72 hours after transfection, filtered through a 0.22 m membrane. All cells lines were transduced by spinoculation at 2000 revolutions per minute (rpm) for 1 hour at room temperature with 8 g/mL polybrene (Santa Cruz, sc-134220).

(729) CDK2-dTAG Cells

(730) OVCAR3 cells were first engineered to express Cas9 by lentiviral transduction of Cas9 construct. Cells were selected and maintained in 100 g/mL hygromycin (Life Technologies, 10687010) and verified to express Cas9 by immunoblot. OVCAR3-Cas9 cells were then engineered to express CDK2-FKBP12F36V-HA fusion protein by lentiviral transduction of CDK2-FKBP12F36V-HA expression construct and selection with 2 g/mL puromycin dihydrochloride (Life Technologies, A1113803). Expression of CDK2-FKBP12F36V-HA was verified by immunoblot using anti-CDK2 and anti-HA antibodies. Next, to engineer the line to have endogenous CDK2 inactivated, OVCAR3 (Cas9, CDK2-FKBP12F36V-HA) cells were transduced with CDK2 sgRNA and selected by 50 g/mL Zeocin (Life Technologies, R25001). Inactivated expression of endogenous CDK2 in the expanded clones was tested by immunoblotting. OVCAR3 (Cas9, CDK2-FKBP12F36V-HA) cells transduced with non-targeting sgRNA (Cellecta) were served as a control cell line.

(731) To degrade CDK2-FKBP12F36V-HA protein by dTAG, 200,000 cells were seeded in 1 mL media in triplicate in a 24-well plate and treated with dimethyl sulfoxide (DMSO) or with a titration of concentrations of dTAG for 14 hours. Cells were collected and processed for Western blot.

(732) CDK2/CCNE1 Enzymatic Assay

(733) In vitro CDK2/CCNE1 enzyme activity assay measures phosphorylation of a peptide substrate using homogeneous time-resolved energy transfer (HTRF). The LANCE Ultra kinase assay used a ULight-labeled EIF4E-binding protein 1 (Thr37/46) peptide (PerkinElmer, TRF0128-M) as substrate and an Europium-labeled anti-phospho-EIF4E binding protein1 (Thr37/46) antibody (PerkinElmer, TRF0216-M). A ratio of fluorescence transferred to the labeled substrate (665 nm) relative to fluorescence of the Europium donor (620 nm) represents the extent of phosphorylation. Ratios for treated wells are normalized to DMSO only (100% activity) and no enzyme (0% activity) controls. Normalized data is analyzed using a four parameter dose response curve to determine IC.sub.50 for each compound.

(734) CDK2 pRb (S780) HTRF Cellular Assay

(735) CDK2 pRb (S780) HTRF cellular assay enables the quantitative detection of Rb phosphorylated on serine 780 in CCNE1 amplified COV318 cells. The assay comprised two antibodies: Europium cryptate labeled anti-Phospho-Rb S780 antibody (donor) and d2 labeled anti-Rb antibody (acceptor). In brief, COV318 cells were seeded into the wells of 96-well plate at a density of 25,000 per well with 9-point, 3-fold serial diluted compounds and cultured overnight at 37 degree with 5% CO.sub.2. The final concentrations of compounds start from 3 M. The next day cells were lysed in 70 L 1Phospho-total protein lysis buffer #2 (Cisbio), supplemented with 0.7 L blocking buffer (Cisbio) and 1.4 L protease inhibitor cocktail set III, EDTA-free (Calbiochem, 539134). 16 L of cell lysates were mixed with 4 L of the fluorophore-conjugated antibodies to a final concentration of 0.188 nM cryptate-labeled anti-Phospho-Rb S780 antibody and 0.14 nM d2 labeled anti-Rb antibody. After 2 h of incubation at room temperature, HTRF signals were measured on the PHERAstar microplate reader (BMG Labtech), using 340 nm as excitation wavelength, a 620 nm filter for the Europium donor fluorescence, and a 665-nm filter for the acceptor fluorescence detection. HTRF signals were calculated as the HTRF ratio (ratio of fluorescence measured at 665 nm and 620 nm)10000.

(736) Various modifications of the invention, in addition to those described herein, will be apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims. Each reference, including all patent, patent applications, and publications, cited in the present application is incorporated herein by reference in its entirety.