CD123-specific chimeric antigen receptor redirected t cells and methods of their use
11918606 ยท 2024-03-05
Assignee
Inventors
Cpc classification
A61K39/4611
HUMAN NECESSITIES
C07K16/2866
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
A61P43/00
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
Abstract
A family of chimeric antigen receptors (CARs) containing a CD123 specific scFv was developed to target different epitopes on CD123. In some embodiments, such a CD123 chimeric antigen receptor (CD123CAR) gene includes an anti-CD123 scFv region fused in frame to a modified IgG4 hinge region comprising an S228P substitution, an L235E substitution, and optionally an N297Q substitution; a costimulatory signaling domain; and a T cell receptor (TCR) zeta chain signaling domain. When expressed in healthy donor T cells (CD4/CD8), the CD123CARs redirect T cell specificity and mediated potent effector activity against CD123+ cell lines as well as primary AML patient samples. Further, T cells obtained from patients with active AML can be modified to express CD123CAR genes and are able to lyse autologous AML blasts in vitro. Finally, a single dose of 5.0?10.sup.6 CAR123 T cells results in significantly delayed leukemic progression in mice. These results suggest that CD123CAR-transduced T cells may be used as an immunotherapy for the treatment of high risk AML.
Claims
1. A method of treating acute myeloid leukemia comprising administering to a patient in need thereof a pharmaceutical composition comprising a population of human T cells harboring an expression vector comprising a nucleic acid molecule encoding a chimeric antigen receptor comprising: an anti-CD123 scFv region, an IgG4 hinge region comprising SEQ ID NO: 13 having an N to Q amino acid substitution at position 79 and a L to E amino acid substitution at position 17 and, optionally, an S to P amino acid substitution at position 10, and a T cell receptor zeta chain signaling domain.
2. The method of claim 1, wherein the human T cells are allogenic or autologous to the patient.
3. The method of claim 1, further comprising treating the patient with one or more anticancer therapies selected from stem cell transplantation, radiation therapy, surgical resection, chemotherapeutics, immunotherapeutics, targeted therapeutics or a combination thereof.
4. The method of claim 1, wherein the IgG4 hinge region comprising SEQ ID NO:13 has a S to P amino acid substitution at position 10.
5. The method of claim 1, wherein the chimeric antigen receptor further comprises a co-stimulatory signaling domain selected from the group consisting of: a CD27 co-stimulatory signaling domain, a CD28 co-stimulatory signaling domain, a 4-1BB co-stimulatory signaling domain, and an OX40 co-stimulatory signaling domain.
6. The method of claim 1, wherein the anti-CD123 scFV domain comprises: the VL and VH domain of recombinant immunotoxin 26292 or the VL and VH domain of recombinant immunotoxin 32716.
7. The method of claim 1, wherein the chimeric antigen receptor comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:11 and SEQ ID NO:12.
8. The method of claim 1, wherein the expression vector comprises a nucleotide sequence selected from the group consisting of: SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4.
9. The method of claim 1, wherein the chimeric antigen receptor comprises a CD28 transmembrane domain.
10. The method of claim 1, wherein the expression vector is a viral vector.
11. The method of claim 10, wherein the viral vector is a lentiviral vector.
12. The method of claim 1, wherein the anti-CD123 scFv region is a humanized anti-CD123 scFv region.
13. The method of claim 1, wherein the wherein the anti-CD123 scFv region comprises amino acids 23-266 of SEQ ID NO:9.
14. The method of claim 1, wherein the anti-CD123 scFv region comprises amino acids 23-259 of SEQ ID NO:10.
15. The method of claim 1, wherein the wherein the IgG4 hinge region comprises amino 267-495 of SEQ ID NO:9.
16. The method of claim 1, wherein the chimeric antigen receptor further comprises a 4-IBB co-stimulatory signaling domain.
17. The method of claim 1, wherein the wherein the chimeric antigen receptor further comprises a CD28 co-stimulatory signaling domain.
18. The method of claim 1, wherein the CD28 co-stimulatory domain comprises amino acids 498-564 of SEQ ID NO:9.
19. The method of claim 1, wherein the CD28 co-stimulatory domain comprises amino acids 489-557 of SEQ ID NO:10.
20. The method of claim 1, wherein the T cell receptor zeta chain signaling domain comprises amino acids 568-679 of SEQ ID NO:9.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
DETAILED DESCRIPTION
(17) Certain embodiments of the invention are described in detail, using specific examples, sequences, and drawings. The enumerated embodiments are not intended to limit the invention to those embodiments, as the invention is intended to cover all alternatives, modifications, and equivalents, which may be included within the scope of the present invention as defined by the claims. One skilled in the art will recognize many methods and materials similar or equivalent to those described herein, which could be used in the practice of the present invention.
(18) In some embodiments, a gene encoding a tumor targeting chimeric antigen receptor (CAR) is provided. According to certain embodiments, the gene encodes a CD123-specific CAR (CD123CAR). A CD123CAR gene includes an anti-CD123 single-chain Fv (scFv) region and one or more of the following domains: a hinge region, a costimulatory signaling domain, an intracellular signaling domain, or a combination thereof.
(19) In some embodiments, a CD123CAR gene may include, but is not limited to, an anti-CD123 single-chain Fv (scFv) region, a hinge region, optionally, at least one costimulatory signaling domain, and optionally, an intracellular signaling domain.
(20) In certain embodiments, a CD123CAR gene may include, but is not limited to, an anti-CD123 single-chain Fv (scFv) region, a hinge region, at least one costimulatory signaling domain, and an intracellular signaling domain (
(21) The anti-CD123 scFv region may include a nucleotide sequence that, when expressed, may bind an epitope of CD123. In some embodiments, the scFv anti-CD123 scFv region includes a nucleotide which encodes a VH and a VL domain of recombinant immunotoxins (RITs) 26292 and 32716 [18]. A CD123CAR gene that targets 26292 and a CD123CAR gene that targets 32716 is also referred to herein as a 26292CAR and a 32716CAR, respectively. In certain embodiments, an anti-CD123 scFv region may include a nucleotide sequence selected from the following: nucleotides 82-814 of SEQ ID NO:1 or SEQ ID NO:3 for a 32716CAR nucleotides 82-792 of SEQ ID NO:2 or SEQ ID NO:4 for a 26292CAR; or
(22) Said nucleotide sequences encode amino acid sequences selected from the following: residues 23-266 of SEQ ID NO:9 or SEQ ID NO:11 when used in a 32716CAR; or residues 23-259 of SEQ ID NO:10 or SEQ ID NO:12 when used in a 26292CAR.
(23) In certain embodiments, the anti-CD123 scFv region may be modified to enhance binding or to reduce immunogenicity. For example, in one aspect, the anti-CD123 scFv region may be a humanized anti-CD123 scFv region.
(24) The hinge region may include at least a portion of an immunoglobulin (e.g., IgG1, IgG2, IgG3, IgG4) that falls between the CH2-CH3 domains. In some embodiments, the hinge regions is a modified hinge. The modified hinge may have one or more amino acid substitutions or modifications that contribute to reducing the CD123CAR's off-target effects, thereby increasing its specificity and efficacy. An amino acid modification or an amino acid substitution or a substitution, as used herein, mean an amino acid substitution, insertion, and/or deletion in a protein or peptide sequence. An amino acid substitution or substitution as used herein, means a replacement of an amino acid at a particular position in a parent peptide or protein sequence with another amino acid. For example, the substitution S228P refers to a variant protein or peptide, in which the serine at position 228 is replaced with proline.
(25) Amino acid substitutions can be made by mutation such that a particular codon in the nucleic acid sequence encoding the protein or peptide is changed to a codon which codes for a different amino acid. Such a mutation is generally made by making the fewest nucleotide changes possible. A substitution mutation of this sort can be made to change an amino acid in the resulting protein in a non-conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to another grouping) or in a conservative manner (i.e., by changing the codon from an amino acid belonging to a grouping of amino acids having a particular size or characteristic to an amino acid belonging to the same grouping). Such a conservative change generally leads to less change in the structure and function of the resulting protein.
(26) The following are examples of various groupings of amino acids: Amino acids with nonpolar R groups: Alanine, Valine, Leucine, Isoleucine, Proline, Phenylalanine, Tryptophan, Methionine Amino acids with uncharged polar R groups: Glycine, Serine, Threonine, Cysteine, Tyrosine, Asparagine, Glutamine Amino acids with charged polar R groups (negatively charged at Ph 6.0): Aspartic acid, Glutamic acid Basic amino acids (positively charged at pH 6.0): Lysine, Arginine, Histidine (at pH 6.0)
(27) Another grouping may be those amino acids with phenyl groups: Phenylalanine, Tryptophan, Tyrosine.
(28) Another grouping may be according to molecular weight (i.e., size of R groups) as shown below:
(29) TABLE-US-00001 Glycine 75 Alanine 89 Serine 105 Proline 115 Valine 117 Threonine 119 Cysteine 121 Leucine 131 Isoleucine 131 Asparagine 132 Aspartic acid 133 Glutamine 146 Lysine 146 Glutamic acid 147 Methionine 149 Histidine (at pH 6.0) 155 Phenylalanine 165 Arginine 174 Tyrosine 181 Tryptophan 204
(30) In certain embodiments, the modified hinge is derived from an IgG1, IgG2, IgG3, or IgG4 that includes one or more amino acid residues substituted with an amino acid residue different from that present in an unmodified hinge. The one or more substituted amino acid residues are selected from, but not limited to one or more amino acid residues at positions 220, 226, 228, 229, 230, 233, 234, 235, 234, 237, 238, 239, 243, 247, 267, 268, 280, 290, 292, 297, 298, 299, 300, 305, 309, 218, 326, 330, 331, 332, 333, 334, 336, 339, or a combination thereof.
(31) In some embodiments, the modified hinge is derived from an IgG1, IgG2, IgG3, or IgG4 that includes, but is not limited to, one or more of the following amino acid residue substitutions: C220S, C226S, S228P, C229S, P230S, E233P, V234A, L234V, L234F, L234A, L235A, L235E, G236A, G237A, P238S, S239D, F243L, P247I, S267E, H268Q, S280H, K290S, K290E, K290N, R292P, N297A, N297Q, S298A, S298G, S298D, S298V, T299A, Y300L, V305I, V309L, E318A, K326A, K326W, K326E, L328F, A330L, A330S, A331S, P331S, 1332E, E333A, E333S, E333S, K334A, A339D, A339Q, P396L, or a combination thereof (50).
(32) In some embodiments, the modified hinge is derived from an IgG4 hinge having the following amino acid sequence:
(33) TABLE-US-00002 (SEQIDNO:13) Pos.219 ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPE VTCVVVDVSQEDPEVQFNWY Pos.279 VDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKGLPSSIEKTISK Pos.339 AKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVL Pos.399 DSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQ KSLSLSLGK
(34) In certain embodiments, the modified hinge is derived from IgG4 that includes one or more amino acid residues substituted with an amino acid residue different from that present in an unmodified hinge. The one or more substituted amino acid residues are selected from, but not limited to one or more amino acid residues at positions 220, 226, 228, 229, 230, 233, 234, 235, 234, 237, 238, 239, 243, 247, 267, 268, 280, 290, 292, 297, 298, 299, 300, 305, 309, 218, 326, 330, 331, 332, 333, 334, 336, 339, or a combination thereof.
(35) In some embodiments, the modified hinge is derived from an IgG4 that includes, but is not limited to, one or more of the following amino acid residue substitutions: 220S, 226S, 228P, 229S, 230S, 233P, 234A, 234V, 234F, 234A, 235A, 235E, 236A, 237A, 238S, 239D, 243L, 247I, 267E, 268Q, 280H, 290S, 290E, 290N, 292P, 297A, 297Q, 298A, 298G, 298D, 298V, 299A, 300L, 305I, 309L, 318A, 326A, 326W, 326E, 328F, 330L, 330S, 331S, 331S, 332E, 333A, 333S, 333S, 334A, 339D, 339Q, 396L, or a combination thereof, wherein the amino acid in the unmodified hinge is substituted with the above identified amino acids at the indicated position.
(36) In some embodiments, the modified IgG4 hinge includes, but is not limited to, a substitution of proline (P) in place of serine (S) at position 228 (S228P), a substitution of leucine (L) in place of glutamic acid (E) at position 235 (L235E), a substitution of asparagine (N) in place of glutamine (Q) at position 297 (N297Q). In certain embodiments, a modified IgG4 hinge region may include a nucleotide sequence selected from the following: nucleotides 814-1500 of SEQ ID NO:1 or SEQ ID NO:3 for a 32716CAR; or nucleotides 793-1479 of SEQ ID NO:2 or SEQ ID NO:4 for a 26292CAR.
(37) Said nucleotide sequences encode amino acid sequences selected from the following: residues 267-495 of SEQ ID NO:1 or SEQ ID NO:3 when used in a 32716CAR; or residues 260-488 of SEQ ID NO:2 or SEQ ID NO:4 when used in a 26292CAR.
(38) In one embodiment, the modified IgG4 hinge region includes an S228P substitution and an L235E substitution (S228P+L235E) (See
(39) In some embodiments, the hinge may be modified to substitute the Fc spacer region in the C123CAR for a spacer that has no Fc binding, such as the hinge region of CD8a. Alternatively, the Fc spacer region of the hinge may be deleted. Such substitutions would reduce or eliminate Fc binding.
(40) The term position, as used herein, is a location in the sequence of a protein. Positions may be numbered sequentially, or according to an established format, for example a Kabat position or an EU position or EU index as in Kabat. For all positions discussed herein, numbering is according to the EU index or EU numbering scheme (Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed., United States Public Health Service, National Institutes of Health, Bethesda, hereby entirely incorporated by reference). The EU index or EU index as in Kabat or EU numbering scheme refers to the numbering of the EU antibody (Edelman et al., 1969, Proc Natl Acad Sci USA 63:78-85, which is hereby entirely incorporated by reference). Kabat positions, while also well known in the art, may vary from the EU position for a given position. For example, the S228P and L235E substitutions described above refer to the EU position. However, these substitutions may also correspond to Kabat positions 241 (S241P) and 248 (L248E) [21].
(41) The costimulatory signaling domain may include any suitable costimulatory domain including, but not limited to a 4-1BB costimulatory domain, an OX-40 costimulatory domain, a CD27 costimulatory domain, or a CD28 costimulatory domain. According to the embodiments described herein, a CD123CAR may include at least one costimulatory signaling domain. In one aspect the CD123CAR has a single costimulatory signaling domain, or it may include two or more costimulatory signaling domains such as those described above. In another aspect, the costimulatory domain may be made up of a single costimulatory domain such as those described above, or alternatively, may be made up of two or more portions of two or more costimulatory domains. Alternatively, in some embodiments, the CD123CAR does not include a costimulatory signaling domain.
(42) In one embodiment, the CD123CAR includes a costimulatory signaling domain which is a CD28 costimulatory domain. The CD28 signaling domain may include a modified CD28 transmembrane domain. In one embodiment, such a modified CD28 transmembrane domain has one or more amino acid substitutions or modifications including, but not limited to a substitution of leucine-leucine (LL) to glycine-glycine (GG) at amino acid residues 530-531 of SEQ ID NO:10 or SEQ ID NO:12; or residues 523-524 of SEQ ID NO:11 or SEQ ID NO:13 (e.g., RLLH.fwdarw.RGGH [22]). In certain embodiments, a modified costimulatory signaling domain region may include a nucleotide sequence selected from the following: nucleotides 1501-1707 of SEQ ID NO:1 or SEQ ID NO:3 for a 32716CAR; or nucleotides 1480-1686 of SEQ ID NO:2 or SEQ ID NO:4 for a 26292CAR.
(43) Said nucleotide sequences encode amino acid sequences selected from the following: residues 498-564 of SEQ ID NO:1 or SEQ ID NO:3 when used in a 32716CAR; or. residues 489-557 of SEQ ID NO:2 or SEQ ID NO:4 when used in a 26292CAR.
(44) The intracellular signaling domain may include any suitable T cell receptor (TCR) complex, signaling domain portion thereof. In some embodiments, the intracellular signaling domain is a TCR zeta-chain (?-chain) signaling domain. In certain embodiments, a ?-chain signaling domain may include a nucleotide sequence selected from the following: nucleotides 1717-2052 of SEQ ID NO:1 or SEQ ID NO:3 for a 32716CAR; or. nucleotides 1696-2031 of SEQ ID NO:2 or SEQ ID NO:4 for a 26292CAR.
(45) Said nucleotide sequences encode amino acid sequences selected from the following: residues 568-679 of SEQ ID NO:1 or SEQ ID NO:3 when used in a 32716CAR; residues 561-672 of SEQ ID NO:2 or SEQ ID NO:4 when used in a 26292CAR.
(46) Therefore, in accordance with the embodiments described above, the CD123CAR gene may include a nucleotide sequence selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4. In other embodiments, the CD123CAR gene may encode an amino acid sequence selected from SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11 or SEQ ID NO:12. (
Expression of CD123CAR Genes and Transduction of T Cells
(47) In some embodiments, the CD123CAR gene is part of an expression cassette. In some embodiments, the expression cassette mayin addition to the CD123CAR genealso include an accessory gene. When expressed by a T cell, the accessory gene may serve as a transduced T cell selection marker, an in vivo tracking marker, or a suicide gene for transduced T cells.
(48) In some embodiments, the accessory gene is a truncated EGFR gene (EGFRt). An EGFRt may be used as a non-immunogenic selection tool (e.g., immunomagnetic selection using biotinylated cetuximab in combination with anti-biotin microbeads for enrichment of T cells that have been lentivirally transduced with EGFRt-containing constructs), tracking marker (e.g., flow cytometric analysis for tracking T cell engraftment), and suicide gene (e.g., via Cetuximab/Erbitux? mediated antibody dependent cellular cytotoxicity (ADCC) pathways). An example of a truncated EGFR (EGFRt) gene that may be used in accordance with the embodiments described herein is described in International Application No. PCT/US2010/055329, the subject matter of which is hereby incorporated by reference as if fully set forth herein. In other embodiments, the accessory gene is a truncated CD19 gene (CD19t).
(49) In another embodiment, the accessory gene is an inducible suicide gene. A suicide gene is a recombinant gene that will cause the cell that the gene is expressed in to undergo programmed cell death or antibody mediated clearance at a desired time. In one embodiment, an inducible suicide gene that may be used as an accessory gene is an inducible caspase 9 gene (see Straathof et al. (2005) An inducible caspase 9 safety switch for T-cell therapy. Blood. June 1; 105(11): 4247-4254, the subject matter of which is hereby incorporated by reference as if fully set forth herein).
(50) In some embodiments, the expression cassette that include a CD123CAR gene described above may be inserted into a vector for deliveryvia transduction or transfectionof a target cell. Any suitable vector may be used, for example, a bacterial vector, a viral vector, or a plasmid. In some embodiments, the vector is a viral vector selected from a retroviral vector, a lentiviral vector, a poxvirus vector, an adenoviral vector, or an adeno-associated viral vector In some embodiments, the vector may transduce a population of healthy T cells. Successfully transduced or transfected target cells express the one or more genes that are part of the expression cassette.
(51) As such, one or more populations of T cells may be transduced with a CD123CAR gene. In some embodiments, the CD123CAR gene includes a nucleotide sequence selected from SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 or SEQ ID NO:4. Accordingly, in some embodiments, the transduced T cells express a CD123CAR gene that encodes an amino acid sequence selected from SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11 or SEQ ID NO:12. (
(52) Further, the one or more populations of T cells may be part of a pharmaceutically acceptable composition for delivery for administration to a subject. In addition to the CD123CAR-transduced T cells, the pharmaceutically effective composition may include one or more pharmaceutically effective carriers. A pharmaceutically acceptable carrier as used herein refers to a pharmaceutically acceptable material, composition, or vehicle that is involved in carrying or transporting a treatment of interest from one tissue, organ, or portion of the body to another tissue, organ, or portion of the body. Such a carrier may comprise, for example, a liquid, solid, or semi-solid filler, solvent, surfactant, diluent, excipient, adjuvant, binder, buffer, dissolution aid, solvent, encapsulating material, sequestering agent, dispersing agent, preservative, lubricant, disintegrant, thickener, emulsifier, antimicrobial agent, antioxidant, stabilizing agent, coloring agent, or some combination thereof.
(53) Each component of the carrier is pharmaceutically acceptable in that it must be compatible with the other ingredients of the composition and must be suitable for contact with any tissue, organ, or portion of the body that it may encounter, meaning that it must not carry a risk of toxicity, irritation, allergic response, immunogenicity, or any other complication that excessively outweighs its therapeutic benefits.
(54) Some examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as corn starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) natural polymers such as gelatin, collagen, fibrin, fibrinogen, laminin, decorin, hyaluronan, alginate and chitosan; (7) talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, corn oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol; (12) esters, such as trimethylene carbonate, ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid (or alginate); (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) alcohol, such as ethyl alcohol and propane alcohol; (20) phosphate buffer solutions; (21) thermoplastics, such as polylactic acid, polyglycolic acid, (22) polyesters, such as polycaprolactone; (23) self-assembling peptides; and (24) other non-toxic compatible substances employed in pharmaceutical formulations such as acetone.
(55) The pharmaceutical compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.
(56) In one embodiment, the pharmaceutically acceptable carrier is an aqueous carrier, e.g. buffered saline and the like. In certain embodiments, the pharmaceutically acceptable carrier is a polar solvent, e.g. acetone and alcohol.
(57) The concentration of CD123CAR-transduced T cells in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, organ size, body weight and the like in accordance with the particular mode of administration selected and the biological system's needs.
(58) In certain embodiments, populations of T cells transduced with a CD124CAR gene (i.e., CD124CAR-transduced T cells) such as those described herein cells used in the methods for targeting and killing AML cells may be grown in a cell culture. In certain aspects of this embodiment, the method may be used in an in vitro or research setting to investigate the role of CD123 in the etiology of AML, or to evaluate the targeting abilities of new CD123CAR constructs.
Treatment of AML with CD123CAR-Transduced T Cells
(59) According to some embodiments, CD123CAR genes and populations of T cells that are transduced with CD123CAR genes such as those described above may be used in methods for treating AML in a subject. Such methods may include a step of administering a therapeutically effective amount of at least one population of T cells transduced with at least one CD123CAR gene to the subject. In these embodiments, the population of CD123CAR-transduced T-cells express one or more CD123CAR genes, such as those described above. In certain embodiments, the T cells are transduced with and express a 32716CAR(S228P+L235E+N297Q) gene construct (
(60) The population or populations of T cells transduced with the CD123CAR gene or genes that may be used in accordance with the methods described herein may be administered, by any suitable route of administration, alone or as part of a pharmaceutical composition. A route of administration may refer to any administration pathway known in the art, including but not limited to intracranial, parenteral, or transdermal. Parenteral refers to a route of administration that is generally associated with injection, including infraorbital, infusion, intraarterial, intracapsular, intracardiac, intradermal, intramuscular, intraperitoneal, intrapulmonary, intraspinal, intrasternal, intrathecal, intratumoral, intrauterine, intravenous, subarachnoid, subcapsular, subcutaneous, transmucosal, or transtracheal. In certain embodiments, transduced T cells are administered intravenously or intrathecally.
(61) The term effective amount as used herein refers to an amount of an agent, compound, treatment or therapy that produces a desired effect. For example, a population of cells may be contacted with an effective amount of an agent, compound, treatment or therapy to study its effect in vitro (e.g., cell culture) or to produce a desired therapeutic effect ex vivo or in vitro. An effective amount of an agent, compound, treatment or therapy may be used to produce a therapeutic effect in a subject, such as preventing or treating a target condition, alleviating symptoms associated with the condition, or producing a desired physiological effect. In such a case, the effective amount of a compound is a therapeutically effective amount, therapeutically effective concentration or therapeutically effective dose. The precise effective amount or therapeutically effective amount is an amount of the composition that will yield the most effective results in terms of efficacy of treatment in a given subject or population of cells. This amount will vary depending upon a variety of factors, including but not limited to the characteristics of the compound (including activity, pharmacokinetics, pharmacodynamics, and bioavailability), the physiological condition of the subject (including age, sex, disease type and stage, general physical condition, responsiveness to a given dosage, and type of medication) or cells, the nature of the pharmaceutically acceptable carrier or carriers in the formulation, and the route of administration. Further an effective or therapeutically effective amount may vary depending on whether the compound is administered alone or in combination with another compound, drug, therapy or other therapeutic method or modality. One skilled in the clinical and pharmacological arts will be able to determine an effective amount or therapeutically effective amount through routine experimentation, namely by monitoring a cell's or subject's response to administration of a compound and adjusting the dosage accordingly. For additional guidance, see Remington: The Science and Practice of Pharmacy, 21.sup.st Edition, Univ. of Sciences in Philadelphia (USIP), Lippincott Williams & Wilkins, Philadelphia, PA, 2005, which is hereby incorporated by reference as if fully set forth herein. Agents, compounds treatments or therapies that may be used in an effective amount or therapeutically effective amount to produce a desired effect in accordance with the embodiments described herein may include, but are not limited to, a CD123CAR gene, an expression cassette that includes a CD123CAR gene, a vector that delivers an expression cassette that includes a CD123CAR gene to a target cell such as a T cell, and a population of T cells that are transduced with a CD123CAR gene.
(62) The terms treating or treatment of a condition may refer to preventing the condition, slowing the onset or rate of development of the condition, reducing the risk of developing the condition, preventing or delaying the development of symptoms associated with the condition, reducing or ending symptoms associated with the condition, generating a complete or partial regression of the condition, or some combination thereof. Treatment may also mean a prophylactic or preventative treatment of a condition.
(63) The term subject as used herein refers to a human or animal, including all mammals such as primates (particularly higher primates), sheep, dog, rodents (e.g., mouse or rat), guinea pig, goat, pig, cat, rabbit, and cow. In some embodiments, the subject is a human.
(64) In certain embodiments, the methods for treating AML may include a step of administering a therapeutically effective amount of a first population of T cells transduced with a first CD123CAR gene in combination with a therapeutically effective amount of a second population of T cells transduced with a second CD123CAR gene.
(65) In other embodiments, CD123CAR-transduced T cells may be administered in combination with one or more additional anti-cancer therapies. In combination or in combination with, as used herein, means in the course of treating the same cancer in the same subject using two or more agents, drugs, therapeutics, procedures, treatment regimens, treatment modalities or a combination thereof, in any order. This includes simultaneous administration, as well as in a temporally spaced order of up to several days apart. Such combination treatment may also include more than a single administration of any one or more of the agents, drugs, therapeutics, procedures, treatment regimens, and treatment modalities. Further, the administration of the two or more agents, drugs, therapeutics, procedures, treatment regimens, treatment modalities or a combination thereof may be by the same or different routes of administration.
(66) Additional anti-cancer therapies that may be used in accordance with the methods described herein may include one or more anti-cancer procedures, treatment modalities, anti-cancer therapeutics or a combination thereof. In some embodiments, the CD123CAR-transduced T cells may be administered in combination with one or more anti-cancer procedures or treatment modalities including, but not limited to, stem cell transplantation (e.g., bone marrow transplant or peripheral blood stem cell transplant using allogenic stem cells, autologous stem cells; or a non-myeloablative transplant), radiation therapy, or surgical resection. In other embodiments, the CD123CAR-transduced T cells may be administered in combination with one or more anti-cancer therapeutics or drugs that may be used to treat AML including, but not limited to, chemotherapeutics and other anti-cancer drugs, immunotherapeutics, targeted therapeutics, or a combination thereof.
(67) Chemotherapeutics and other anti-cancer drugs that may be administered in combination with the CD123CAR-transduced T cells in accordance with the embodiments described herein include, but are not limited to, all-trans-retinoic acid (ATRA), arsenic trioxide, anthracycline antibiotics and pharmaceutically acceptable salts thereof (e.g., doxorubicin hydrochloride, daunorubicin hydrochloride, idarubicin, mitoxantrone), alkylating agents (e.g., cyclophosphamide, laromustine), antimetabolite analogs (cytarabine, 6-thioguanine, 6-mercaptopurine, methotrexate), demethylating agents (e.g., decitabine, 5-azacytidine), nucleic acid synthesis inhibitors (e.g., hydroxyurea), topoisomerase inhibitors (e.g., etoposide), vinca alkaloids (e.g., vincristine sulfate), or a combination thereof (e.g., ADE, which is a combination treatment that includes a combination of Cytarabine (Ara-C), Daunorubicin Hydrochloride and Etoposide).
(68) Immunotherapeutics that may be administered in combination with the CD123CAR-transduced T cells in accordance with the embodiments described herein include, but are not limited to, immune modulatory reagents (e.g., STAT3 inhibitors, Lenalidomide) and therapeutic monoclonal antibodies. The therapeutic monoclonal antibodies may be designed (i) to target one or more AML antigens including, but not limited to, CD33 (e.g., gemtuzumab, lintuzumab), MUC1 (e.g., cantuzumab ravtansine, clivatuzumab tetraxetan, pemtumomab); (i) a B cell antigen (e.g., rituximab, ofatumumab); or a vasculature modulator such as VEGF or VEGFR (e.g., alacizumab pegol, bevacizumab, icrucumab, ramucirumab, ranibizumab).
(69) Targeted therapeutics that may be administered in combination with the CD123CAR-transduced T cells in accordance with the embodiments described herein include, but are not limited to, tyrosine kinase inhibitors (imatinib, dasatinib, nilotinib, sunitinib), farnesyl transferase inhibitors (e.g., tipifarnib), FLT inhibitors, and c-Kit (or CD117) inhibitors (imatinib, dasatinib, nilotinib).
Example 1: CD123Car-Transduced T Cells Exhibit Potent Cytolytic Activity and Multiple Effector Functions Against AML In Vitro
Materials and Methods
(70) Cell lines. Unless stated otherwise, all cell lines were maintained in RPMI 1640 (Irvine Scientific) supplemented with 2 mM L-glutamine, 25 mM HEPES, and 10% heat-inactivated FCS (Hyclone), hereafter referred to as complete media (CM). Peripheral blood mononuclear cells (PBMCs) were transformed with Epstein-Barr virus to generate lymphoblastoid cell lines (LCL) as previously described [19]. LCL-OKT3 cells express membrane bound OKT3 and are grown in CM supplemented with 0.4 mg/ml hygromycin [20]. K562 cells were obtained from ATCC and cultured as recommended. KG1a cells (kindly provided by Dr. Ravi Bhatia) were maintained in IMDM (Irvine Scientific) with 25 mM HEPES, 4 mM L-glutamine (Irvine Scientific), and 20% FCS. 293T cells (a kind gift from the Center for Biomedicine and Genetics at City of Hope) were maintained in DMEM+10% heat inactivated FCS.
(71) Primary AML samples. Primary AML samples were obtained from peripheral blood of patients (referred to herein as AML Sample ID Nos. 179. 373, 493, 519, 545, 559, 605, 722 and 813). The characteristics of the samples are summarized in Table 1 below. [Table 1 is on following page]
(72) TABLE-US-00003 TABLE 1 Characteristics of primary AML samples. AML Flt3 CD123 Sample Age/ Mutational Clinical Sample CD123 % ID Sex Cytogenetics Status Status Type (RFI).sup.a positive 179 74/M Intermediate- ND Relapsed PB 428.32 99.22 risk t(1; 7), t(14; 15) 373 47/M Poor-risk ND Relapsed PB 1052.83 99.66 Complex abnormalities in 3 cell lines 493 46/F Intermediate- ND Relapsed PB 23.98 76.80 risk Trisomy 8 519 44/F del(17p), dic ND Relapsed PB 63.18 97.40 (11; 7), clonal loss of TP53/17p13.1 545 58/M Intermediate- ND Induction PB 52.73 99.32 risk failure t(3; 6), del(7) 559 59/M Complex Negative Relapsed Apheresis 9.30 45.0 abnormalities, Massive hyperdiploidy 605 55/M Normal Negative Persistent PB 58.48 99.91 722 22/M Intermediate Negative Untreated PB 33.53 92.74 risk t(14; 21), del(9q) 813 48/F Complex ND Untreated PB 37.19 90.93 abnormalities, Trisomy 8, Trisomy 21, add(17) .sup.aRelative Fluorescence Index (RFI) is the ratio of the median of the 9F5-stained signal to isotype matched control stain in the CD34.sup.+ population .sup.bGated on CD34.sup.+ population NDnot determined PBperipheral blood
(73) Flow Cytometry. Fluorochrome conjugated isotype controls, anti-CD4, anti-CD8, anti-T-cell receptor-?? (TCR??), anti-CD123 (9F5), anti-CD34 (8G12), and anti-CD38 (HIT2) were purchased from BD Biosciences. Biotinylated anti-Fc was purchased from Jackson ImmunoResearch Laboratories. Biotinylated cetuximab (Erbitux) was purchased from the COH pharmacy and has been previously described [20]. Biotinylated anti-CD2, anti-CD3, anti-CD7, anti-CD10, anti-CD11b, anti-CD19, anti-CD33, and ant-CD235A were purchased from eBioscience. Data acquisition was performed on a FACSCalibur, LSRII (BD Biosciences), or MACSQuant Analyzer (Miltenyi Biotec) and analyzed using FCS Express, Version 3 (De Novo Software).
(74) Transfection of 293T cells with CD123. CD123 cDNA was amplified from CD123-pMD18-T (Sino Biological Inc.) using polymerase chain reaction and primers (CD123-F: 5-ATAAGGCCTGCCGCCACCATGGTCCTCCTTTGGCTCACG-3 and CD123-R 5-ATAGCTAGCTCAAGTTTTCTGCACGACCTGTACTTC-3). The PCR product was cloned into pMGPac using Stul and NheI restriction sites. 293T cells were transfected using Lipofectamine 2000 (Life Technologies) per manufacturer's instructions. 24 hours post-transfection, expression of CD123 was confirmed by flow cytometry
(75) Generation of Lentiviral vectors. To generate the CAR constructs used in this study, codon optimized DNA sequences encoding for the VH and VL chains, a modified IgG4 hinge and a modified CD28 transmembrane domain (RLLH.fwdarw.RGGH [22]) were synthesized (GENEART) and cloned into CD19RCAR-T2AEGFRt_epHIV7 [20] using NheI and RsrII sites to replace the CD19RCAR. Lentivirus was produced by transfecting 293T cells with a lentivrial vector and the packaging vectors pCMV-Rev2, pCHGP-2, and pCMV-G using CalPhos? mammalian cell transfection kit (Clontech). These 26292 and 32716 CAR constructs are also referred to herein as 26292CAR(S228P+L235E) or 26292CAR(S228P+L235EN297Q) (
(76) Transduction of healthy donor and AML Patient PBMCs. Deidentified PBMCs were obtained from consented healthy donors and patients under institutional review board approved protocols. For healthy donors, T cells were activated using OKT3 (30 ng/ml) in CM supplemented 3 times a week with 25 U/ml IL-2 and 0.5 ng/ml IL-15 (herein referred to as T cell media). 72 hours post-activation, T cells were spinoculated with lentivirus at MOI=3 by centrifuging for 30 minutes at 800 g and 32? C. CAR expression was analyzed by flow cytometry 12-14 days post lentiviral transduction. EGFRt expressing T cells were enriched as previously described [20]. T cells were expanded in T cell media by rapid expansion method [23].
(77) For genetic modification of T cells from AML patients, thawed peripheral blood or apheresis product were stimulated using Dynabeads? Human T-Expander CD3/CD28 (Life Technologies) at a 3:1 bead:CD3+ cell ratio in T cell media. 72 hours post-bead stimulation, cells were spinoculated with lentivirus at a MOI=3. Beads were removed 9-14 days after initial stimulation using a DynaMag?-50 magnet (Life Technologies) and T cells were maintained in T cell media. CAR-expressing AML patient derived T cell lines were not immunomagnetically selected prior to use in killing assays.
(78) CFSE proliferation assay. T cells were labeled with 0.5 ?M carboxyfluoroscein succinimidyl ester (CFSE; Molecular Probes) per manufacturer's instructions. Labeled T cells were cocultured with, or without, stimulator cells at an E:T ratio of 2:1 in CM supplemented with 10 U/ml IL-2. After 72-96 hours, cells were harvested and stained with biotinylated cetuximab as well as propidium iodide or DAPI to exclude dead cells from analysis. Samples were analyzed by flow cytometry to evaluate proliferation of live EGFRt-positive cells by CFSE dilution.
(79) Chromium-release assay and cytokine secretion assay. Target cells were labeled for 1 hour with 51Cr (PerkinElmer), washed five times, and aliquoted in triplicate at 5?103 cells/well with effector cells at various effector to target (E:T) ratios. Following a 4 hour co-culture, supernatants were harvested and radioactivity was measured using a gamma counter or a Topcount (PerkinElmer). Percent-specific lysis was calculated as previously described [24]. Cytokine production following a 24 hour co-culture at a 10:1 E:T ratio was measured as previously described [25].
(80) CD107a degranulation and intracellular cytokine production. T cells were cocultured with target cells at an E:T of 2:1 for six hours at 37? C. in the presence of GolgiStop? (BD Biosciences) and anti-CD107a clone H4A3 or isotype matched control antibody. At the completion of the six hour incubation, cells were harvested, washed and stained with anti-CD3, CD4, CD8, and biotinylated cetuximab followed by a secondary stain using PE-conjugated streptavidin. Cells were then fixed and permeabilized (Cytofix/Cytoperm? BD Biosciences) per manufacturer's instructions and stained with anti-IFN-_ (BD Biosciences clone B27) and anti-TNF-? (BD Biosciences clone MAb11). Data acquisition was performed using MACSQuant analyzer (Miltenyi Biotec) and analysis was done using FCS Express Version 3 (De Novo Software).
(81) Colony Forming Cell Assay. CD34+ cells from cord blood (CB) mononuclear cells or primary AML samples were selected using immunomagnetic column separation (Miltenyi Biotech). 103 CD34+ CB cells were cocultured with 25?103 effector cells for 4 hours prior to plating in semisolid methylcellulose progenitor culture in duplicate wells [26]. 14 to 18 days later, colonyforming unit granulocyte-macrophage (CFU-GM) and burst-forming unit erythroid (BFUE) colonies were enumerated. For AML samples, 5?103 CD34+ AML cells were cocultured with 125?103 effector cells for 4 hours prior to plating in semisolid methylcellulose progenitor culture in duplicate wells.
(82) Statistics analysis. Statistical analyses were performed using Graphpad Prism v5.04. Unpaired Student's t-test were used to identify significant differences between treatment groups.
Results
Generation of CD123 CAR Expression T Cells
(83) To redirect T cell specificity, lentiviral vectors encoding CD123 CARs were developed. Each of the CARs includes codon-optimized sequences encoding one of two CD123-specific scFvs, 26292 and 32716 [18], respectively. The scFvs are fused in-frame to the human IgG4 Fc region, a CD28 costimulatory domain, and the CD3? signaling domain. Just downstream of the CAR sequence is a T2A ribosome skip sequence and a truncated human EGFR (EGFRt) transduction marker (
CD123 CAR T Cells Specifically Target CD123 Expressing Tumor Cell Lines
(84) To confirm the specificity of the CD123 CAR T cells, the ability of the genetically modified T cells to lyse 293T cells transiently transfected to express CD123 was examined (293T-CD123;
CD123 CAR T Cells Activate Multiple Effector Functions when Cocultured with CD123-Positive Target Cells
(85) To examine the effector function of CD123-specific T cells, the secretion of IFN-? and TNF-? was measured following co-culture with various tumor cell lines (
CD123 CAR T Cells Activate Multiple Effector Functions when Cocultured with Primary AML Samples
(86) The over-expression of CD123 on primary AML samples is well documented [27-29] and confirmed in this study (
CD123 CAR Expressing T Cells Target Primary AML Cells In Vitro
CD123-Specific T Cells Do Not Eliminate Colony Formation by Cord Blood Cells In Vitro
(87) Given that CD123 is expressed on common myeloid progenitors (CMPs) [31], the effect of the engineered T cells on the colony forming ability of CD34-enriched normal cord blood (CB) samples was investigated. Myeloid and erythroid colony formation by CB samples was not significantly reduced following a 4 hour co-culture with CD123-CAR expressing T cells at an E:T of 25:1 when compared to pair-matched CD19R CAR T cells (
T Cells from AML Patients can be Genetically Modified to Express CD123 CARs and Specifically Target Autologous Tumor Cells
(88) AML patient derived T cells are known to poorly repolarize actin and form defective immune synapses with autologous blasts [32]. Additionally, to the best of our knowledge, CAR expressing T cells derived from AML patients have yet to be described. Therefore, it was determined whether T cells from AML patients could be genetically modified to express CD123 CARs. Cryopreserved PBMCs (AML 605 and AML 722) or apheresis product (AML 559) were CD3/CD28 bead stimulated, and lentivirally transduced to express either of the CD123 CARs or a CD19R control CAR. All three patient sample derived T cells expressed the 26292 CAR (40-65% transduction efficiency), the 32716 CAR (46-70% transduction efficiency) and the CD19R CAR (To evaluate the ability of CD123-specific T cells to kill primary AML cells, pair-matched CD19R CAR or CD123 CAR expressing T cells were cocultured with primary CD34-enriched AML patient samples in a 4 hour .sup.51Cr release assay. In contrast to pair-matched CD19R T cells, both CD123 CAR T cell lines robustly lysed all primary AML patient samples tested (
(89) 23-37% transduction efficiency). A representative example of the phenotype of AML patient derived CAR T cells is shown in
Discussion
(90) The embodiments described herein include the generation of two novel CD123 targeting CARs using scFvs from recombinant immunotoxins (RITs), 26292 and 32716, which bind distinct epitopes and have similar binding affinities for CD123 [18]. When expressed by a population of T cells, these CD123 targeting CARs redirect T cell specificity against CD123 expressing cells. Using a standard 4 hour chromium-51 (51Cr) release assay, healthy donor T cells that were engineered to express the CD123 CARs efficiently lysed CD123+ cell lines and primary AML patient samples. Additionally, both of the CD123 CAR T cells activated multiple effector functions following co-culture with CD123+ cell lines and primary AML patient samples. Further, CD123-targeting T cells did not significantly reduce the number of colony-forming unit granulocyte-macrophage (CFU-GM) or burst-forming unit erythroid (BFU-E) colonies from cord blood (CB) when compared to CD19 CAR T cells. Notably, while CD19-specific T cells had little impact on leukemic colony formation of primary AML samples, CD123-targeting T cells significantly reduced leukemic colony formation in vitro. It was also shown that AML patient derived T cells can express CD123 CARs and lyse autologous blasts in vitro.
(91) T cells expressing either of the two CD123-specific CARs can specifically lyse CD123 expressing cell lines and primary AML patient samples, and activate multiple effector functions in an antigen specific manner in vitro demonstrating that both epitopes are potential targets for treatment. No major differences were observed between the CD123 CAR engineered T cell lines with respect to target cell killing, cytokine secretion, or proliferation when cocultured with CD123+ cells. One possible explanation for this is the binding affinities of the CD123-specific scFvs used in the CD123-CARs are in the nanomolar range and differ by less than 3-fold and thus offer no significant advantage in target antigen binding is conferred by either scFv [18].
(92) The expression of multiple cell surface antigens on AML cells has been well documented [4, 27, 34]. Targeting some of these antigens via CAR-expressing T cells may not be feasible. For instance, the AML associated antigen TIM-3 is expressed on a subset of exhausted T cells [35, 36] and targeting TIM-3 using CAR-engineered T cells may result in the autolysis of genetically modified cells. Additionally, CD47 is ubiquitously expressed [37] and thus unlikely targetable by CAR-engineered T cells. The CD33 differentiation antigen is predominately expressed on myeloid cells and immunotherapies targeting CD33 such as Gemtuzumab ozogamicin, CD33/CD3 bispecific T cell engaging antibodies, and a CD33 CAR are currently used in clinical and pre-clinical settings [17, 38, 39]. Like TIM-3, CD33 is expressed on a subset of T cells making it a non-ideal target for a CAR based therapy [40]. Additionally, the antileukemic activity of CD33-targeting therapies was often accompanied with slow recovery of hematopoiesis and cytopenias likely the result of CD33 expression on long-term self-renewing normal hematopoietic stem cells (HSCs) [41]. Further, hepatotoxicities are a common side effect of CD33-targeted treatments and are possibly due to the unintended targeting of CD33+ Kupffer cells [42].
(93) Expression of CD123 is absent on T cells, predominantly restricted to cells of the myeloid lineage [43], and largely absent on HSCs [27]. Together, these observations made CD123 an attractive target for CAR mediated T cell therapy. Therapeutics specific for CD123 have displayed favorable safety profiles in phase I trials (ClinicalTrials.gov ID: NCT00401739 and NCT00397579). Unfortunately, these therapies have failed to induce responses in the vast majority of treated patients. The CD123-CAR expressing T cells generated here displayed potent cytolytic capacity in vitro against CD123+ cell lines and primary AML samples. The studies described below show that primary samples from patients with poor-risk AML were susceptible to CD123 CAR T cell mediated cytotoxicity. Collectively, in the small cohort of primary samples used for short-term cytotoxicity assays, AML patient samples that exhibited high-risk features at diagnosis and/or chemoresistant were sensitive to CD123 CAR killing similar to what was observed in experiments using CD123+ cell lines. Further analysis will need to be done to confirm that these results will hold true for a larger cohort of samples.
(94) Multifunctional T cell responses correlate with the control of virus infection and may be important in an anti-tumor CAR T cell response [44]. Indeed, patients responsive to CD19 CAR T cell therapy have detectable T cell responses (i.e. degranulation, cytokine secretion or proliferation) post-therapy in response to CD19+ targets ex vivo [11, 12, 14]. In the Examples below, it was demonstrated that the functionality of CD123-CAR expressing T cells by analyzing the upregulation of CD107a, production of inflammatory cytokines and proliferation of CD123-specific T cells in response to both CD123+ cell lines and primary AML samples. Further, multifunctionality was observed in both the CD4+ and CD8+ compartments, which may promote sustained anti-leukemic activity and boost anti-leukemic activity within the tumor microenvironment [45, 46]. The inclusion of other costimulatory domains such as 4-1BB, and the use of younger less differentiated T cells may further augment CD123 CAR responses and are an area of active research [9, 47].
(95) Further, CD123-specific T cells do not inhibit normal progenitor colony formationeven at an E:T of 25:1. Expression of CD123 on lineage-CD34+ CD38-cells is a hallmark of the common myeloid progenitor cell and thus a likely target of CD123 CAR T cells [31]. While a decrease in the relative percentage of myeloid-derived colonies was observed when CB cells were incubated with CD123-specific T cells, the decrease was not significantly less than pair-matched CD19R CAR T cells. It is possible that the limited sample size attributes to this result and further experimentation may reveal a significant decrease in CFU-GM formation in CD123 CAR T cell treated cord blood samples. Additionally, the 4 hour co-culture of T cells and CB cells prior to plating may not be a long enough time period to observe an effect on normal myeloid progenitor colony formation and that longer incubation times may decrease the number of observed myeloid derived colonies. However, using the same methodology as was used for CB cells, a substantial decrease in the number of leukemic colonies formed was observed when primary CD34-enriched AML patient samples were incubated with CD123 CAR T cells, suggesting that the 4 hour incubation time is sufficient to observe an effect between leukemic and normal colony formation. Alternatively, the lower relative expression of CD123 on CB cells compared to AML cells may in part result in the inability of CD123 CAR T cells to alter myeloid derived colony formation in vitro. While others have demonstrated that CD123 is expressed only in a small fraction of lineage-CD34+CD38-HSCs, and two phase I trials using agents targeting CD123 revealed no long term myelosuppression, further studies are needed to evaluate the effect of CD123 CAR T cell therapy on hematopoiesis. In order to control unwanted off-target toxicities, EGFRt was included in the lentiviral construct to allow for ablation of CAR expressing T cells. Other strategies to modulate CAR T cell activity such as the inducible caspase 9 apoptosis switch [48] or electroporation of CAR mRNA [49] are also of high interest given the potential for killing of normal cells expressing CD123.
(96) Further, it was demonstrated that cryopreserved PBMCs from AML patients with active disease can be genetically modified to express CD123 CARs and exhibit potent cytolytic activity against autologous leukemic blasts in ? of the samples. While CD123 CAR-expressing T cells from AML 559 failed to lyse autologous blasts which expressed low levels of CD123, these CAR T cells did lyse CD123+ LCL and KG1a cell lines (data not shown) suggesting that the generated T cells have the potential to target CD123-expressing target cells. To our knowledge, this is the first demonstration that AML patient-derived T cells can be engineered to express a CAR and exhibit redirected antigen specific cytotoxicity against autologous blasts.
(97) Collectively, the results of the studies described in the Examples below demonstrate that CD123 CAR T cells can distinguish between CD123+ and CD123-cells, and can activate multiple T cell effector functions against a panel of poor-risk primary AML patient samples. Notably, CD123-specific T cells did not significantly alter normal progenitor colony formation but considerably reduced the growth of clonogenic myeloid leukemic progenitors in vitro. It was also demonstrated that T cells derived from AML patients can be genetically modified to express CD123-specific CARs and lyse autologous blasts in vitro. Therefore, CD123 CAR T cells are a promising candidate for immunotherapy of AML.
Example 2: CD123CAR-Transduced T Cells Delay Leukemic Progression In Vivo
(98) CD123CAR Constructs. 26292CAR(S228P+L235E) and 32716CAR(S228P+L235E) constructs were generated as described in Example 1 above. Two additional CD123CAR constructs were also generated that included an additional mutation in the IgG4 hinge at position 297 (N297Q) for each scFv (26292CAR(S228P+L235E+N297Q) and 32716CAR(S228P+L235E+N297Q)) (
(99) NSG mice implanted with AML tumor cells (day 0), and were treated with 5.0?10.sup.6 CAR+ T cells expressing either the 26292CAR(S228P+L235E) or the 26292CAR(S228P+L235E+N297Q) on day 5, and leukemic progression was monitored by bioluminescent imaging. As shown in
REFERENCES
(100) The references, patents and published patent applications listed below, and all references cited in the specification above are hereby incorporated by reference in their entirety, as if fully set forth herein. 1. Eaves, C. J. and R. K. Humphries, Acute myeloid leukemia and the Wnt pathway. N Engl J Med, 2010. 362(24): p. 2326-7. 2. Dohner, H., et al., Diagnosis and management of acute myeloid leukemia in adults: recommendations from an international expert panel, on behalf of the European LeukemiaNet. Blood, 2010. 115(3): p. 453-74. 3. Majeti, R., Monoclonal antibody therapy directed against human acute myeloid leukemia stem cells. Oncogene, 2011. 30(9): p. 1009-19. 4. Kikushige, Y., et al., TIM-3 is a promising target to selectively kill acute myeloid leukemia stem cells. Cell Stem Cell, 2010. 7(6): p. 708-17. 5. Jena, B., G. Dotti, and L. J. Cooper, Redirecting T-cell specificity by introducing a tumor-specific chimeric antigen receptor. Blood, 2010. 116(7): p. 1035-44. 6. Cooper, L. J., et al., T-cell clones can be rendered specific for CD19: toward the selective augmentation of the graft-versus-B-lineage leukemia effect. Blood, 2003. 101(4): p. 1637-44. 7. Hudecek, M., et al., The B-cell tumor-associated antigen ROR1 can be targeted with T cells modified to express a ROR1-specific chimeric antigen receptor. Blood, 2010. 116(22): p. 4532-41. 8. Kochenderfer, J. N., et al., Construction and preclinical evaluation of an anti-CD19 chimeric antigen receptor. J Immunother, 2009. 32(7): p. 689-702. 9. Milone, M. C., et al., Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo. Mol Ther, 2009. 17(8): p. 1453-64. 10. Brentjens, R. J., et al., Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15. Nat Med, 2003. 9(3): p. 279-86. 11. Brentjens, R. J., et al., Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory Bcell leukemias. Blood, 2011. 118(18): p. 4817-28. 12. Kochenderfer, J. N., et al., B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric antigen-receptor-transduced T cells. Blood, 2011. 13. Savoldo, B., et al., CD28 costimulation improves expansion and persistence of chimeric antigen receptor-modified T cells in lymphoma patients. J Clin Invest, 2011. 121(5): p. 1822-6. 14. Kalos, M., et al., T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced Leukemia. Sci Transl Med, 2011. 3(95): p. 95ra73. 15. Till, B. G., et al., CD20-specific adoptive immunotherapy for lymphoma using a chimeric antigen receptor with both CD28 and 4-1BB domains: pilot clinical trial results. Blood, 2012. 16. Peinert, S., et al., Gene-modified T cells as immunotherapy for multiple myeloma and acute myeloid leukemia expressing the Lewis Y antigen. Gene Ther, 2010. 17(5): p. 678-86. 17. Dutour, A., et al., In Vitro and In Vivo Antitumor Effect of Anti-CD33 Chimeric Receptor-Expressing EBV-CTL against CD33 Acute Myeloid Leukemia. Adv Hematol, 2012. 2012: p. 683065. 18. Du, X., M. Ho, and I. Pastan, New immunotoxins targeting CD123, a stem cell antigen on acute myeloid leukemia cells. J Immunother, 2007. 30(6): p. 607-13. 19. Pelloquin, F., J. P. Lamelin, and G. M. Lenoir, Human B lymphocytes mmortalization by Epstein-Barr virus in the presence of cyclosporin A. In Vitro Cell Dev Biol, 1986. 22(12): p. 689-94. 20. Wang, X., et al., A transgene-encoded cell surface polypeptide for selection, in vivo tracking, and ablation of engineered cells. Blood, 2011. 118(5): p. 1255-63. 21. Reddy, M. P., et al., Elimination of Fc receptor-dependent effector functions of a modified IgG4 monoclonal antibody to human CD4. J Immunol, 2000. 164(4): p. 1925-33. 22. Nguyen, P., I. Moisini, and T. L. Geiger, Identification of a murine CD28 dileucine motif that suppresses single-chain chimeric T-cell receptor expression and function. Blood, 2003. 102(13): p. 4320-5. 23. Jensen, M. C., et al., Human T lymphocyte genetic modification with naked DNA. Mol Ther, 2000. 1(1): p. 49-55. 24. Riddell, S. R. and P. D. Greenberg, The use of anti-CD3 and anti-CD28 monoclonal antibodies to clone and expand human antigen-specific T cells. J Immunol Methods, 1990. 128(2): p. 189-201. 25. Brown, C. E., et al., Recognition and killing of brain tumor stem-like initiating cells by CD8+ cytolytic T cells. Cancer Res, 2009. 69(23): p. 8886-93. 26. Bhatia, R., et al., Abnormal function of the bone marrow microenvironment in chronic myelogenous leukemia: role of malignant stromal macrophages. Blood, 1995. 85(12): p. 3636-45. 27. Jordan, C. T., et al., The interleukin-3 receptor alpha chain is a unique marker for human acute myelogenous leukemia stem cells. Leukemia, 2000. 14(10): p. 1777-84. 28. Jin, L., et al., Monoclonal antibody-mediated targeting of CD123, IL-3 receptor alpha chain, eliminates human acute myeloid leukemic stem cells. Cell Stem Cell, 2009. 5(1): p. 31-42. 29. Munoz, L., et al., Interleukin-3 receptor alpha chain (CD123) is widely expressed in hematologic malignancies. Haematologica, 2001. 86(12): p. 1261-9. 30. Seder, R. A., P. A. Darrah, and M. Roederer, T-cell quality in memory and protection: implications for vaccine design. Nat Rev Immunol, 2008. 8(4): p. 247-58. 31. Manz, M. G., et al., Prospective isolation of human clonogenic common myeloid progenitors. Proc Natl Acad Sci USA, 2002. 99(18): p. 11872-7. 32. Le Dieu, R., et al., Peripheral blood T cells in acute myeloid leukemia (AML) patients at diagnosis have abnormal phenotype and genotype and form defective immune synapses with AML blasts. Blood, 2009. 114(18): p. 3909-16. 33. Oka, Y., et al., Induction of WT1 (Wilms' tumor gene)-specific cytotoxic T lymphocytes by WT1 peptide vaccine and the resultant cancer regression. Proc Natl Acad Sci USA, 2004. 101(38): p. 13885-90. 34. Majeti, R., et al., CD47 is an adverse prognostic factor and therapeutic antibody target on human acute myeloid leukemia stem cells. Cell, 2009. 138(2): p. 286-99. 35. Golden-Mason, L., et al., Negative immune regulator Tim-3 is overexpressed on T cells in hepatitis C virus infection and its blockade rescues dysfunctional CD4+ and CD8+ T cells. J Virol, 2009. 83(18): p. 9122-30. 36. Jin, H. T., et al., Cooperation of Tim-3 and PD-1 in CD8 T-cell exhaustion during chronic viral infection. Proc Natl Acad Sci USA, 2010. 107(33): p. 14733-8. 37. Brown, E. J. and W. A. Frazier, Integrin-associated protein (CD47) and its ligands. Trends Cell Biol, 2001. 11(3): p. 130-5. 38. Walter, R. B., et al., Acute myeloid leukemia stem cells and CD33-targeted immunotherapy. Blood, 2012. 119(26): p. 6198-208. 39. Aigner, M., et al., T lymphocytes can be effectively recruited for ex vivo and in vivo lysis of AML blasts by a novel CD33/CD3-bispecific BiTE((R)) antibody construct. Leukemia, 2012. 40. Hernandez-Caselles, T., et al., A study of CD33 (SIGLEC-3) antigen expression and function on activated human T and NK cells: two isoforms of CD33 are generated by alternative splicing. J Leukoc Biol, 2006. 79(1): p. 46-58. 41. Sievers, E. L., et al., Efficacy and safety of gemtuzumab ozogamicin in patients with CD33-positive acute myeloid leukemia in first relapse. J Clin Oncol, 2001. 19(13): p. 3244-54. 42. Tsimberidou, A. M., et al., The role of gemtuzumab ozogamicin in acute leukaemia therapy. Br J Haematol, 2006. 132(4): p. 398-409. 43. Sato, N., et al., Expression and factor-dependent modulation of the interleukin-3 receptor subunits on human hematopoietic cells. Blood, 1993. 82(3): p. 752-61. 44. Appay, V., D. C. Douek, and D. A. Price, CD8+ T cell efficacy in vaccination and disease. Nat Med, 2008. 14(6): p. 623-8. 45. Moeller, M., et al., Sustained antigen-specific antitumor recall response mediated by gene-modified CD4+T helper-1 and CD8+ T cells. Cancer Res, 2007. 67(23): p. 11428-37. 46. Schietinger, A., et al., Bystander killing of cancer requires the cooperation of CD4(+) and CD8(+) T cells during the effector phase. J Exp Med, 2010. 207(11): p. 2469-77. 47. Gattinoni, L., et al., A human memory T cell subset with stem cell-like properties. Nat Med, 2011. 17(10): p. 1290-7. 48. Straathof, K. C., et al., An inducible caspase 9 safety switch for T-cell therapy. Blood, 2005. 105(11): p. 4247-54. 49. Yoon, S. H., et al., Adoptive immunotherapy using human peripheral blood lymphocytes transferred with RNA encoding Her-2/neu-specific chimeric immune receptor in ovarian cancer xenograft model. Cancer Gene Ther, 2009. 16(6): p. 489-97. 50. Strohl, W. R., Optimization of Fc-mediated effector functions of monoclonal antibodies. Curr Op Biotech. 2009. 20:685-691.