SPECIFICATION OF FUNCTIONAL CRANIAL PLACODE DERIVATIVES FROM HUMAN PLURIPOTENT STEM CELLS
20240067924 ยท 2024-02-29
Assignee
Inventors
- Stuart Chambers (San Francisco, CA, US)
- Lorenz Studer (New York, NY)
- Zehra Dincer (New York, NY)
- Bastian Zimmer (Hamburg, DE)
Cpc classification
C12N2501/119
CHEMISTRY; METALLURGY
C12N2506/45
CHEMISTRY; METALLURGY
C07D211/00
CHEMISTRY; METALLURGY
C07D243/36
CHEMISTRY; METALLURGY
A61K35/12
HUMAN NECESSITIES
C12N2501/13
CHEMISTRY; METALLURGY
C12N2501/999
CHEMISTRY; METALLURGY
C12N2501/41
CHEMISTRY; METALLURGY
C12N2501/155
CHEMISTRY; METALLURGY
International classification
Abstract
Cranial placodes are embryonic structures essential for sensory and endocrine organ development. The efficient derivation of cranial placodes from human pluripotent stem cells is disclosed where the timed removal of the BMP inhibitor Noggin, a component of the dual-SMAD inhibition strategy of neural induction, triggers placode induction at the expense of CNS fates. Further fate specification at the pre-placode stage enables the selective generation of placode-derived trigeminal ganglia capable of in vivo engraftment, mature lens fibers and anterior pituitary hormone-producing cells that upon transplantation produce hormones including, but not limited to, human growth hormone and adrenocortiocotropic hormone in vivo. Alternatively, anterior pituitary hormone-producing cells are generated in cell culture systems in vitro.
Claims
1. A method for inducing differentiation of cells, comprising: a) contacting a plurality of cells with an inhibitor of Small Mothers Against Decapentaplegic protein signaling (SMAD inhibitor); and b) contacting the cells with a bone morphogenetic protein (BMP); wherein the cells are contacted with the SMAD inhibitor and the BMP in an amount effective to induce detectable expression of SIX1 and PAX6 in the plurality of cells.
2. The method of claim 1, wherein the method comprises one or more of the following: (i) the cells are contacted with the SMAD inhibitor for up to about 11 days, and wherein the cells are contacted with the BMP for up to about 3 days; (ii) the cells are contacted with an activator of Wnt signaling (Wnt activator) in an amount effective to induce a detectable level of expression of SIX1 and PAX3 in the plurality of cells; (iii) the cells are contacted with an activator of sonic hedgehog signaling (SHH activator) in an amount effective to induce a detectable level of expression of SIX1 and PITX1 in the plurality of cells; and (iv) the cells are contacted with a BMP to induce a detectable level of expression of SIX1 and PITX3 in the plurality of cells.
3. The method of claim 2, wherein the cells expressing SIX1 and PAX3 are trigeminal placode cells.
4. The method of claim 3, wherein the cells expressing SIX1 and PAX3 further express a detectable level of GD2, CD57, or a combination thereof.
5. The method of claim 4, further comprising isolating the cells expressing a detectable level of GD2, CD57, or a combination thereof from the plurality of cells.
6. The method of claim 2, wherein the cells expressing SIX1 and PITX1 are pituitary placode cells.
7. The method of claim 2, further comprising contacting the cells with one or more activator of FGF signaling (FGF activator) in an amount effective to induce the expression levels of SIX1 and PITX1.
8. The method of claim 2, wherein the cells expressing SIX1 and PITX3 are lens placode cells.
9. The method of claim 1, further comprising contacting the cells with a compound selected from the group consisting of BRL-54443, parthenolide, phenantroline, and combinations thereof.
10. (canceled)
11. A method of inducing differentiation of cells, comprising contacting a plurality of cells expressing SIX1 and PAX6 with (i) an activator of Wnt signaling (Wnt activator) in an amount effective to induce a detectable level of expression of SIX1 and PAX3 in the plurality of cells; (ii) with an activator sonic hedgehog (SHH) in an amount effective to induce a detectable level of expression of SIX1 and PITX1 in the plurality of cells; or (iii) with a bone morphogenetic protein (BMP) in an amount effective to induce a detectable level of expression of SIX1 and PITX3 in the plurality of cells.
12. The method of claim 11, further comprising culturing the cells expressing SIX1 and PAX3 under conditions sufficient to induce the cells to differentiate into trigeminal neurons; culturing the cells expressing SIX1 and PITX1 under conditions sufficient to induce the cells to differentiate into pituitary cells selected from the group consisting of gonadotrophs, corticotrophs and somatotrophs; or culturing the cells expressing SIX1 and PAX3 under conditions sufficient to induce the cells to differentiate into lens fibers.
13. The method of claim 11, wherein the cells expressing SIX1 and PAX6 further express a detectable level of TFAP2A.
14. The method of claim 11, wherein the cells expressing SIX1 and PAX3 are trigeminal placodes; wherein the cells expressing SIX1 and PITX1 are pituitary placodes; and wherein the cells expressing SIX1 and PITX3 are lens placode cells.
15. (canceled)
16. (canceled)
17. (canceled)
18. A cell prepared according to the method of claim 1.
19. A method of treating a subject comprising grafting a cell to a subject in need thereof, wherein a) the cell expresses a detectable level of SIX1 and PAX3, and the subject expresses at least one symptom of a pain syndrome, wherein grafting the cell reduces the at least one symptom of the pain syndrome; b) the cell expresses a detectable level of SIX1 and PITX1, and the subject expresses at least one symptom of a neuroendocrine disorder, wherein grafting the cell reduces the at least one symptom of the neuroendocrine disorder; or c) the cell expresses a detectable level of SIX1 and PITX3, and the subject expresses at least one symptom of an ocular disorder, wherein grafting the cell reduces the at least one symptom of the ocular disorder.
20. A kit comprising a plurality of cells prepared according to the method of claim 1.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0072]
[0081]
[0087]
[0093]
[0099]
[0106]
[0113]
[0131]
[0137]
[0146]
[0149]
[0163]
[0168]
[0169]
[0170]
[0171]
[0172]
[0173]
[0174]
[0175]
[0176]
[0177]
[0178]
[0179]
[0180]
[0181]
[0182]
[0183]
[0184]
[0185]
[0186]
[0187]
[0188]
[0189]
[0190]
[0191]
[0192]
[0193]
[0194]
[0195]
[0196]
[0197]
[0198]
[0199]
DEFINITIONS
[0200] As used herein, the term inhibitor in reference to inhibiting a signaling target or a signaling target pathway refers to a compound that interferes with (i.e. reduces or eliminates or suppresses) a resulting target molecule or target compound or target process, such as a particular differentiation outcome, (for example, suppresses an active signaling pathway promoting a default cell type differentiation, thereby inducing differentiation into a non-default cell type) when compared to an untreated cell or a cell treated with a compound that does not inhibit a treated cell or tissue.
[0201] As used herein, the term Small Mothers Against Decapentaplegic or SMAD refers to a signaling molecule.
[0202] As used herein, the term neural cell or neuronal cell refers to a cell that in vivo would become part of the nervous system and in culture is obtained by methods of the present inventions, for example, CNS progenitor cells, patternable (i.e. a cell capable of undergoing further differentiation) neuronal populations of motorneurons and dopaminergic neurons, placodal precursor cells, high efficiency motor neuron cells, etc.
[0203] As used herein, the term high efficiency motor neuron cell refers to a neuronal cell capable of conducting an electric current.
[0204] As used herein, the term fate in reference to a cell, such as cell fate determination in general refers to a cell with a genetically determined lineage whose progeny cells are capable of becoming a variety of cell types or a few specific cell types depending upon in vivo or in vitro culture conditions. In other words, a cell's predetermined fate is determined by it's environment to be destined for a particular differentiation pathway such that a cell becomes one cell type instead of another cell type, for example, a stem cell's progeny cells whose neural fate is to become a nerve cell instead of a muscle cell or a skin cell. Typically, a cell's fate is irreversible except under highly specific conditions. In another example, a CNS fate refers to a cell capable of becoming a cell associated with the central nervous system. Conversely, a cell fated to become a neural cell can be called a neural progenitor cell.
[0205] As used herein, the term neural progenitor cell refers to a cell capable of forming a part of the nervous system, such as a nerve cell, a glial cell, etc.
[0206] As used herein, the term neuronal subtype refers to any cell of the neuronal system, such as a dopamine expression neuron, a peripherin.sup.+ neuron, a motor neuron cell, etc.
[0207] As used herein, the term cell of a neural lineage refers to a cell that differentiated along a nerual precursor pathway.
[0208] As used herein, the term placode in reference to a cell refers to a cell capable of becoming a cell associated with the sensory nervous system. In one embodiment, a placode cell is positive for Six1+, positive for p75 while negative for HNK1. In one embodiment, a placode cell obtained using methods of the present inventions is capable of forming a lens cell.
[0209] As used herein, the term adenohypophyseal precursor in reference to a cell refers to a cell whose in vivo progeny cells would be or become a part of the pituitary gland. An adenohypophyseal precursor cell of the present inventions refers to a cell capable of expressing Lhx3 and CGA.
[0210] As used herein, the term expressing in relation to a gene or protein refers to making an mRNA or protein which can be observed using assays such as microarray assays, antibody staining assays, and the like.
[0211] As used herein, the term SMAD inhibitor in reference to inhibiting a signaling molecule or a signaling molecule's pathway, such as an inhibitor of SMAD signaling, refers to a compound that interferes with (i.e. reduces or eliminates or suppresses) the signaling function of the molecule or pathway. In one embodiment, an inhibitor of the present inventions induces (changes) or alters differentiation from a default to a non-default cell type, for example, one of the methods of the present inventions comprising two inhibitors of SMAD signaling produces a non-default neural progenitor cell.
[0212] As used herein, the term Small Mothers Against Decapentaplegic or SMAD refers to a signaling molecule.
[0213] As used herein, the term cell differentiation refers to a pathway by which a less specialized cell (i.e. stem cell) develops or matures to possess a more distinct form and function (i.e. neural plate).
[0214] As used herein, the term differentiation as used with respect to cells in a differentiating cell system refers to the process by which cells differentiate from one cell type (e.g., a multipotent, totipotent or pluripotent differentiable cell) to another cell type such as a target differentiated cell.
[0215] As used herein, the term cell differentiation in reference to a pathway refers to a process by which a less specialized cell (i.e. stem cell) develops or matures or differentiates to possess a more distinct form and/or function into a more specialized cell or differentiated cell, (i.e. neural cell, neural plate cell, pituitary cell, adrenal cell, etc.).
[0216] As used herein, the term neural stem cell or NSC refers to a cell that is capable of becoming neurons, astrocytes, oligodendrocytes, glial cells, etc., in vivo, and neuronal cell progeny and glial progeny in culture however their in vitro differentiation potential toward multiple region-specific neuron types is low.
[0217] As used herein, the term default or passive in reference to a cell differentiation pathway refers to a pathway where a less specialized cell becomes a certain differentiated cell type in culture, when not treating with certain compounds, i.e., normal cell cultures conditions. In other words, a default cell results when a cell is not contacted by a molecule capable of changing the differentiated cell type (i.e. a morphogen). In contrast, non-default in reference to a cell refers to a differentiated cell type that results that is different from a default cell, i.e., a non-default cell is a differentiated cell type resulting from a non-default conditions, such as cell of the present inventions, including a dopamine positive nerve cell, a floor plate cell, posterior FP tissue, etc. A default cell may also be a default cell after a cell has contact with a morphogen to become a non-default cell without a subsequent morphogenic compound, such as a non-default floor plate cell that subsequently becomes a default posterior FP cell of the non-default cell of the present inventions.
[0218] As used herein, the term homodimer in reference to a SMAD molecule refers to at least two molecules of SMAD linked together, such as by disulfide linkages.
[0219] As used herein, the term Noggin refers a secreted homodimeric glycoprotein that binds to and inactivates members of the transforming growth factor-beta (TGF-) superfamily of signaling proteins, such as bone morphogenetic protein-4 (BMP4). Noggin is typically a 65 kDa protein expressed in human cells as a glycosylated, disulfide-linked dimer. (Groppe, et al., (2002). Nature 420, 636-642; Xu, et al., (2005) Nat Methods 2, 185-190; Wang, et al., (2005) Biochem Biophys Res Commun 330, 934-942). One example of a Noggin amino acid sequence is: Accession #U79163 single amino acid mouse Noggin (SEQ ID NO:1):
TABLE-US-00001 MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVDFTLIE HPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGA EDLAELFTDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQ MWLWSQTFCPVLYAWNDFTLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKP SKSVHLTVLRWRCQRRGGQRCGWIPIQYFTPIISECKCSC.
[0220] As used herein, the term SB431542 refers to a molecule with a number CAS 301836-41-9, a molecular formula of C.sub.22H.sub.18N.sub.4O.sub.3, and a name of 4-[4-(1,3-benzodioxol-5-yl)-5-(2-pyridinyl)-1H-imidazol-2-yl]-benzamide, for example, see structure below:
##STR00001##
[0221] As used herein, the term Dorsomorphin refers to a molecule with a number CAS 866405-64-3, a molecular formula C.sub.24H.sub.25N.sub.5O and a name of 6-[4-[2-(1-Piperidinyl)ethoxy]phenyl]-3-(4-pyridinyl)-pyrazolo[1,5-a]pyrimidine dihydrochloride, for example see structure below.
##STR00002##
[0222] As used herein, the term Lefty refers to a novel member of the transforming growth factor beta superfamily that inhibits TGF-beta, including but not limited to LEFTY1, LEFTY2, LEFTYA, etc., also known as EBAF or endometrial bleeding associated factor or left-right determination, factor A transforming growth factor beta superfamily)). A Lefty protein is required for left-right asymmetry determination of organ systems in mammals.
[0223] As used herein, the term Activin refers to a member of the transforming growth factor-beta (TGF-) superfamily, such as Activin A, Activin B, etc.
[0224] As used herein, the term transforming growth factor beta or TGF- refers to a cytokine that regulates growth and differentiation of diverse types of cells.
[0225] As used herein, the term nodal refers to a member of the TGF- family of signaling molecules. Nodal signaling inhibits differentiation of human embryonic stem cells along the neuroectodermal default pathway (Vallier, et al., Dev. Biol. 275, 403-421.
[0226] As used herein, the term ALK or anaplastic lymphoma kinase or anaplastic lymphoma receptor tyrosine kinase or Ki-1 refers to a membrane associated tyrosine kinase receptor.
[0227] As used herein, the term ALK4 in reference to a type I serine/threonine kinase receptor refer as to an anaplastic lymphoma receptor tyrosine kinase 4 receptor that binds to activin to function as an activin receptor.
[0228] As used herein, the term ALK5 in reference to a type I serine/threonine kinase receptor refer as to an anaplastic lymphoma receptor tyrosine kinase 5 receptor that binds to TGF-1 to function as a TGF-1 receptor.
[0229] As used herein, the term ALK7 in reference to a type I serine/threonine kinase receptor refer as to an anaplastic lymphoma receptor tyrosine kinase 7 receptor that binds to Nodal and Nodal-related proteins to function as a Nodal and Nodal-related protein receptor.
[0230] As used herein, the term paired box gene 6 or PAX6 refers to a marker of a nondefault neuroprogenitor cell.
[0231] As used herein, the term kit refers to any delivery system for delivering materials. In the context of cell differentiation, a kit may refer to a combination of materials for contacting stem cells, such delivery systems include systems that allow for the storage, transport, or delivery of reaction reagents (e.g., compounds, proteins, detection agents (such as PAX6 antibodies), etc. in the appropriate containers (such as tubes, etc.) and/or supporting materials (e.g., buffers, written instructions for performing cell differentiation, etc.) from one location to another. For example, kits include one or more enclosures (e.g., boxes, or bags, and the like) containing the relevant reaction reagents (such as Noggin (or a Noggin substitute) and SB431542 (or a SB431542 replacement), etc.) and/or supporting materials.
[0232] As used herein, the term inducing differentiation in reference to a cell refers to changing the default cell type (genotype and/or phenotype) to a non-default cell type (genotype and/or phenotype). Thus inducing differentiation in a stem cell refers to inducing the cell to divide into progeny cells with characteristics that are different from the stem cell, such as genotype (i.e. change in gene expression as determined by genetic analysis such as a microarray) and/or phenotype (i.e. change in expression of a protein, such as PAX6 or a set of proteins, such as HMB45 positive (+) while negative () for SOX10.
[0233] As used herein, the term contacting cells with a compound of the present inventions refers to placing the compound in a location that will allow it to touch the cell in order to produce contacted cells. The contacting may be accomplished using any suitable method. For example, in one embodiment, contacting is by adding the compound to a tube of cells. Contacting may also be accomplished by adding the compound to a culture of the cells.
[0234] As used herein, the term stem cell refers to a cell that is totipotent or pluripotent or multipotent and are capable of differentiating into one or more different cell types, such as embryonic stems cells, stem cells isolated from organs, for example, skin stem cells.
[0235] As used herein, the term embryonic stem cell refers to a cell of a stem cell line, such as WA-09, or a cell isolated from an embryo or placenta or umbilical cord.
[0236] As used herein, the term adult stem cell refers to a stem cell derived from an organism after birth.
[0237] As used herein, the term neural stem cell or NSC refers to a cell that is capable of becoming neurons, astrocytes, oligodendrocytes, and glial cells in vivo, and neuronal cell progeny and glial progeny in culture however their in vitro differentiation potential toward multiple region-specific neuron types is low.
[0238] As used herein, the term mesodermal cell line refers to a cell line displaying characteristics associated with mesodermal cells.
[0239] As used herein, the term endodermal cell line refers to a cell line displaying characteristics normally associated with endodermal cells.
[0240] As used herein, the term neural cell line refers to a cell line displaying characteristics normally associated with a neural cell. Examples of such characteristics include, but are not limited to, expression of FOXA2, SHH, Netrin-1, F-Spondin, and the like.
[0241] As used herein, the term totipotent refers to an ability of a cell to differentiate into any type of cell in a differentiated organism, as well as a cell of extra embryonic materials, such as placenta, etc.
[0242] As used herein, the term pluripotent refers to a cell line capable of differentiating into any differentiated cell type.
[0243] As used herein, the term multipotent refers to a cell line capable of differentiating into at least two differentiated cell types.
[0244] As used herein, the term differentiation as used with respect to cells in a differentiating cell system refers to the process by which cells differentiate from one cell type (e.g., a multipotent, totipotent or pluripotent differentiable cell) to another cell type such as a target differentiated cell.
[0245] As used herein, the term cell culture refers to any in vitro culture of cells. Included within this term are continuous cell lines (e.g., with an immortal phenotype), primary cell cultures, finite cell lines (e.g., non-transformed cells), and any other cell population maintained in vitro, including oocytes and embryos.
[0246] As used herein, the term in vitro refers to an artificial environment and to processes or reactions that occur within an artificial environment. In vitro environments can consist of, but are not limited to, test tubes and cell cultures. The term in vivo refers to the natural environment (e.g., an animal or a cell) and to processes or reaction that occur within a natural environment.
[0247] As used herein, the term neural plate or medullary plate refers to a thickened band of ectoderm (an unpaired ventral longitudinal zone of the neural tube) in the midbody region of the developing embryo, which develops (differentiates) into the neural tube and neural crest; see,
[0248] As used herein, the term floor plate or FP or ventral plate or basal plate or neural floor plate refers to an area of cells that develops at the midline of the neural plate and is located at the ventral midline of the neural tube, see,
[0249] As used herein, the term neural floor plate cell or FP cell or floor plate cell in reference to a cell refers to a cell group also called specialized neuroepithelial cells found in a developing embryo in the neural floor plate. FP cell in vitro are cells expressing certain cell markers also found in FP cells in vivo that are not found in other cells.
[0250] As used herein, the term roof plate or alar plate or dorsal roof plate refers to a cell group located in at the dorsal region of the forming and formed neural tube areas the unpaired dorsal longitudinal zone of the neural tube.
[0251] As used herein, the term neural tube refers to a hollow cylindrical structure of neuroepithelial cells formed from the neuroectoderm cells of an early embryo by the closure of the neural groove such that neuroectoderm cells can differentiate into brain cells and spinal cord cells.
[0252] As used herein, the term presumptive or progenitor in reference to a cell or an area of cells refers to the type of cell or area of cells that would develop (differentiate into) under the appropriate conditions, i.e. when contacted with a proper growth factor, compound, extracellular signal, intracellular signal, etc. For example, progenitor neuron refers to a cell that has the capability to develop into a neuron.
[0253] As used herein, the term dopamine neuron or dopaminergic neuron in general refers to a cell capable of expressing dopamine. Midbrain dopamine neurons or mDA refer to presumptive dopamine expressing cells in forebrain structures and dopamine expressing cells in forebrain structures.
[0254] As used herein, the term default in reference to a cell differentiation pathway refers to a pathway where a less specialized cell becomes a certain differentiated cell type when not contacted by a molecule which changes the differentiated cell type.
[0255] As used herein, the term cell differentiation refers to a pathway by which a less specialized cell (i.e. stem cell) develops or matures to possess a more distinct form and function (i.e. neural plate).
[0256] As used herein, the term neurite outgrowth refers to observation of elongated, membrane-enclosed protrusions of cytoplasm from cells.
[0257] As used herein, the term attached cell refers to a cell growing in vitro wherein the cell contacts the bottom or side of the culture dish, an attached cell may contact the dish via extracelluar matrix molecules and the like. As opposed to a cell in a suspension culture.
[0258] As used herein, the term marker or cell marker refers to gene or protein that identifies a particular cell or cell type. A marker for a cell may not be limited to one marker, markers may refer to a pattern of markers such that a designated group of markers may identity a cell or cell type from another cell or cell type. For example, FP cells of the present inventions express one or more markers that distinguish a FP cell, i.e. FOXA2 positive and BF1 negative, from a non-FP cell, i.e. FOXA2 negative and BF1 positive.
[0259] As used herein, the term test compound refers to any chemical entity, pharmaceutical, drug, and the like that were used to provide cells of the present inventions.
[0260] As used herein, the term rosette-stage neural cell or R-NSC refers to a neural stem cell type in vitro with broad differentiation potential capable of forming central nervous system (CNS) and peripheral nervous system (PNS) cells (fates) and capable of in vivo engraftment. In other words, a rosette-stage neural cell is capable of forming a rosette structure and rosette-stage neural cell populations have characteristics of neuronal differentiation.
[0261] As used herein, the term rosette structure or rosette in reference to a cell refers to a halo or spoke-wheel arrangement of cells.
[0262] As used herein, the term increasing in reference to a characteristic refers to a larger amount of a characteristic when compared to said characteristic in a control, such as when comparing an amount of a marker in human embryonic stems cells cultured with and without a test compound.
[0263] As used herein, the term decreasing in reference to a characteristic refers to a smaller amount of a characteristic when compared to said characteristic in a control, such as when comparing an amount of a marker in human embryonic stems cells cultured with and without a test compound.
[0264] As used herein, the term reducing protein function or loss of function refers to interfering with or blocking a function in order to lower that function, for example, lowering the function of DKK-1 by blocking antibodies.
[0265] As used herein, the term neuron inducing compound refers to a substance for causing differentiation along a cellular pathway leading to neuronal cell.
[0266] As used herein, the term agent for blocking phosphorylation of a receptor refers to a substance for reducing receptor function, i.e. by reducing phosphorylation.
[0267] As used herein, the term response, when used in reference to an assay, refers to the generation of a detectable signal (e.g., accumulation of reporter protein, increase in ion concentration, accumulation of a detectable chemical product).
[0268] The term sample is used in its broadest sense. In one sense it can refer to a cell or tissue. In another sense, it is meant to include a specimen or culture obtained from any source and encompasses fluids, solids and tissues. Environmental samples include environmental material such as surface matter, soil, water, and industrial samples. These examples are not to be construed as limiting the sample types applicable to the present invention.
[0269] The terms purified, to purify, purification, isolated, to isolate, isolation, and grammatical equivalents thereof as used herein, refer to the reduction in the amount of at least one contaminant from a sample. For example, a cell type is purified by at least a 10%, preferably by at least 30%, more preferably by at least 50%, yet more preferably by at least 75%, and most preferably by at least 90%, reduction in the amount of undesirable cell types, such as isolated differentiated FP cells from nonFP cells, such as cells present in a mixed cell culture. Thus purification of a cell type results in an enrichment, i.e., an increase in the amount, of the nucleotide sequence in the sample.
[0270] The term naturally occurring as used herein when applied to an object (such as cell, tissue, etc.) and/or chemical (such as a protein, amino acid sequence, nucleic acid sequence, codon, etc.) means that the object and/or compound are/were found in nature. For example, a naturally occurring cell refers to a cell that is present in an organism that can be isolated from a source in nature, such as an embryonic cell, wherein the cell has not been intentionally modified by man in the laboratory.
[0271] As used herein the term, in vitro refers to an artificial environment and to processes or reactions that occur within an artificial environment. In vitro environments exemplified, but are not limited to, test tubes and cell cultures.
[0272] As used herein the term, in vivo refers to the natural environment (e.g., an animal or a cell) and to processes or reactions that occur within a natural environment, such as embryonic development, cell differentiation, neural tube formation, etc.
[0273] As used herein, the term proliferation refers to an increase in cell number.
[0274] As used herein, the term ligand refers to a molecule that binds to a second molecule. A particular molecule may be referred to as either, or both, a ligand and second molecule. Examples of second molecules include a receptor of the ligand, and an antibody that binds to the ligand.
[0275] The term derived from or established from or differentiated from when made in reference to any cell disclosed herein refers to a cell that was obtained from (e.g., isolated, purified, etc.) a parent cell in a cell line, tissue (such as a dissociated embryo, or fluids using any manipulation, such as, without limitation, single cell isolation, cultured in vivo, treatment and/or mutagenesis using for example proteins, chemicals, radiation, infection with virus, transfection with DNA sequences, such as with a morphogen, etc., selection (such as by serial culture) of any cell that is contained in cultured parent cells. A derived cell can be selected from a mixed population by virtue of response to a growth factor, cytokine, selected progression of cytokine treatments, adhesiveness, lack of adhesiveness, sorting procedure, and the like.
[0276] As used herein, the term biologically active, refers to a molecule (e.g. peptide, nucleic acid sequence, carbohydrate molecule, organic or inorganic molecule, and the like) having structured, regulatory, and/or biochemical functions.
[0277] As used herein, the term primary cell is a cell that is directly obtained from a tissue (e.g. blood) or organ of an animal in the absence of culture. Typically, though not necessarily, a primary cell is capable of undergoing ten or fewer passages in vitro before senescence and/or cessation of proliferation. In contrast, a cultured cell is a cell that has been maintained and/or propagated in vitro for ten or more passages.
[0278] As used herein, the term cultured cells refer to cells that are capable of a greater number of passages in vitro before cessation of proliferation and/or senescence when compared to primary cells from the same source. Cultured cells include cell lines and primary cultured cells.
[0279] As used herein, the term cell culture refers to any in vitro culture of cells. Included within this term are continuous cell lines (e.g. with an immortal phenotype), primary cell cultures, finite cell lines (e.g., non-transformed cells), and any other cell population maintained in vitro, including embryos and embryonic cells.
[0280] As used herein, the term cell line, refers to cells that are cultured in vitro, including primary cell lines, finite cell lines, continuous cell lines, and transformed cell lines, but does not require, that the cells be capable of an infinite number of passages in culture. Cell lines may be generated spontaneously or by transformation.
[0281] As used herein, the terms primary cell culture, and primary culture, refer to cell cultures that have been directly obtained from cells in vivo, such as from animal tissue. These cultures may be derived from adults as well as fetal tissue.
[0282] As used herein, the terms monolayer, monolayer culture, and monolayer cell culture, refers to a cell that has adhered to a substrate and grow as a layer that is one cell in thickness, in other words, an attached cell. Monolayers may be grown in any format, including but not limited to flasks, tubes, coverslips (e.g., shell vials), roller bottles, et cetera.
[0283] As used herein, the terms feeder cell layer or feeder cell population refers to a monolayer of cells used to provide attachment molecules and/or growth factors for an adjacent cell, for example, used in co-culture to maintain pluripotent stem cells.
[0284] As used herein, the terms suspension and suspension culture refer to cells that survive and proliferate without being attached to a substrate. Suspension cultures are typically produced using hematopoietic cells, transformed cell lines, and cells from malignant tumors.
[0285] As used herein, the terms culture media, and cell culture media, refer to media that are suitable to support the growth of cells in vitro (i.e., cell cultures, cell lines, etc.). It is not intended that the term be limited to any particular culture medium. For example, it is intended that the definition encompass outgrowth as well as maintenance media. Indeed, it is intended that the term encompass any culture medium suitable for the growth of the cell cultures and cells of interest.
[0286] The term, cell biology or cellular biology refers to the study of a live cell, such as anatomy and function of a cell, for example, a cell's physiological properties, structure, organelles, interactions with their environment, their life cycle, division and death.
[0287] As used herein, the term cell refers to a single cell as well as to a population of (i.e., more than one) cells. The population may be a pure population comprising one cell type, such as a population of neuronal cells or a population of undifferentiated embryonic cells. Alternatively, the population may comprise more than one cell type, for example a mixed cell population. It is not meant to limit the number of cells in a population, for example, a mixed population of cells may comprise at least one differentiated cell. In one embodiment a mixed population may comprise at least one differentiated. In the present inventions, there is no limit on the number of cell types that a cell population may comprise.
[0288] As used herein, the term positive cell in relation to a stain refers to a cell that expresses a marker and thus stains for that marker in a detectable quantitative and/or qualitative amount above a control or comparative cell. A positive cell may also refer to a cell that stains for a molecule such as FOXA2, et cetera.
[0289] As used herein, the term negative cell, refers to a cell absent detectable signal for a marker, such as a cell failing to stain following contacting with a FOXA2 antibody detection method, et cetera.
[0290] As used herein, the term caudalization refers to initiation of posterior pathways of neural development in the dorsalized ectoderm during embronic development, for example, dorsalized ectorderm develops various levels of posterior neural tissues, depending on the extent of caudalization.
[0291] As used herein, the term caudalizing agent or caudalizing factor refers to a compound that induces caudalization, such as Wnt-1 and Retinoic Acid (RA) As used herein, the terms reporter gene or reporter construct refer to genetic constructs comprising a nucleic acid encoding a protein that is easily detectable or easily assayable, such as a colored protein, fluorescent protein or enzyme such as beta-galactosidase (lacZ gene).
[0292] As used herein, the term gene targeting refers the integration of exogenous DNA into the genome of a cell at sites where its expression can be suitably controlled. This integration occurs as a result of homologous recombination.
[0293] A knock-in approach as used herein refers to the procedure of inserting a desired nucleic acid sequence, such as a sequence encoding a reporter gene, into a specific locus in a host cell via homologous recombination.
[0294] As used herein, the term genome refers to the genetic material (e.g., chromosomes) of an organism.
[0295] The term nucleotide sequence of interest refers to any nucleotide sequence (e.g., RNA or DNA), the manipulation of which may be deemed desirable for any reason (e.g., treat disease, confer improved qualities, expression of a protein of interest in a host cell, expression of a ribozyme, etc.), by one of ordinary skill in the art. Such nucleotide sequences include, but are not limited to, coding sequences of structural genes (e.g., reporter genes, selection marker genes, oncogenes, drug resistance genes, growth factors, etc.), and non-coding regulatory sequences which do not encode an mRNA or protein product (e.g., promoter sequence, polyadenylation sequence, termination sequence, enhancer sequence, etc.).
[0296] As used herein, the term protein of interest refers to a protein encoded by a nucleic acid of interest.
[0297] As used herein, the term exogenous gene refers to a gene that is not naturally present in a host organism or cell, or is artificially introduced into a host organism or cell.
[0298] The term gene refers to a nucleic acid (e.g., DNA or RNA) sequence that comprises coding sequences necessary for the production of a polypeptide or precursor (e.g., proinsulin). The polypeptide can be encoded by a full length coding sequence or by any portion of the coding sequence so long as the desired activity or functional properties (e.g., enzymatic activity, ligand binding, signal transduction, etc.) of the full-length or fragment are retained. The term also encompasses the coding region of a structural gene and includes sequences located adjacent to the coding region on both the 5 and 3 ends for a distance of about 1 kb or more on either end such that the gene corresponds to the length of the full-length mRNA. The sequences that are located 5 of the coding region and which are present on the mRNA are referred to as 5 untranslated sequences. The sequences that are located 3 or downstream of the coding region and which are present on the mRNA are referred to as 3 untranslated sequences. The term gene encompasses both cDNA and genomic forms of a gene. A genomic form or clone of a gene contains the coding region interrupted with non-coding sequences termed introns or intervening regions or intervening sequences. Introns are segments of a gene that are transcribed into nuclear RNA (hnRNA); introns may contain regulatory elements such as enhancers. Introns are removed or spliced out from the nuclear or primary transcript; introns therefore are absent in the messenger RNA (mRNA) transcript. The mRNA functions during translation to specify the sequence or order of amino acids in a nascent polypeptide.
[0299] As used herein, the term gene expression refers to the process of converting genetic information encoded in a gene into RNA (e.g., mRNA, rRNA, tRNA, or snRNA) through transcription of the gene (i.e., via the enzymatic action of an RNA polymerase), and for protein encoding genes, into protein through translation of mRNA. Gene expression can be regulated at many stages in the process. Up-regulation or activation refers to regulation that increases the production of gene expression products (i.e., RNA or protein), while down-regulation or repression refers to regulation that decrease production. Molecules (e.g., transcription factors) that are involved in up-regulation or down-regulation are often called activators and repressors, respectively.
[0300] As used herein, the terms nucleic acid molecule encoding, DNA sequence encoding, DNA encoding, RNA sequence encoding, and RNA encoding refer to the order or sequence of deoxyribonucleotides or ribonucleotides along a strand of deoxyribonucleic acid or ribonucleic acid. The order of these deoxyribonucleotides or ribonucleotides determines the order of amino acids along the polypeptide (protein) chain. The DNA or RNA sequence thus codes for the amino acid sequence.
[0301] The term suspected of having, as used herein, refers a medical condition or set of medical conditions (e.g., preliminary symptoms) exhibited by a patient that is insufficient to provide a differential diagnosis. Nonetheless, the exhibited condition(s) would justify further testing (e.g., autoantibody testing) to obtain further information on which to base a diagnosis.
[0302] The term at risk for as used herein, refers to a medical condition or set of medical conditions exhibited by a patient which may predispose the patient to a particular disease or affliction. For example, these conditions may result from influences that include, but are not limited to, behavioral, emotional, chemical, biochemical, or environmental influences.
[0303] The term effective amount as used herein, refers to a particular amount of a pharmaceutical composition comprising a therapeutic agent that achieves a clinically beneficial result (i.e., for example, a reduction of symptoms). Toxicity and therapeutic efficacy of such compositions can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population). The dose ratio between toxic and therapeutic effects is the therapeutic index, and it can be expressed as the ratio LD50/ED50. Compounds that exhibit large therapeutic indices are preferred. The data obtained from these cell culture assays and additional animal studies can be used in formulating a range of dosage for human use. The dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity. The dosage varies within this range depending upon the dosage form employed, sensitivity of the patient, and the route of administration.
[0304] The term symptom, as used herein, refers to any subjective or objective evidence of disease or physical disturbance observed by the patient. For example, subjective evidence is usually based upon patient self-reporting and may include, but is not limited to, pain, headache, visual disturbances, nausea and/or vomiting. Alternatively, objective evidence is usually a result of medical testing including, but not limited to, body temperature, complete blood count, lipid panels, thyroid panels, blood pressure, heart rate, electrocardiogram, tissue and/or body imaging scans.
[0305] The term disease or medical condition, as used herein, refers to any impairment of the normal state of the living animal or plant body or one of its parts that interrupts or modifies the performance of the vital functions. Typically manifested by distinguishing signs and symptoms, it is usually a response to: i) environmental factors (as malnutrition, industrial hazards, or climate); ii) specific infective agents (as worms, bacteria, or viruses); iii) inherent defects of the organism (as genetic anomalies); and/or iv) combinations of these factors.
[0306] The terms reduce, inhibit, diminish, suppress, decrease, prevent and grammatical equivalents (including lower, smaller, etc.) when in reference to the expression of any symptom in an untreated subject relative to a treated subject, mean that the quantity and/or magnitude of the symptoms in the treated subject is lower than in the untreated subject by any amount that is recognized as clinically relevant by any medically trained personnel. In one embodiment, the quantity and/or magnitude of the symptoms in the treated subject is at least 10% lower than, at least 25% lower than, at least 50% lower than, at least 75% lower than, and/or at least 90% lower than the quantity and/or magnitude of the symptoms in the untreated subject.
[0307] The term patient or subject, as used herein, is a human or animal and need not be hospitalized. For example, out-patients, persons in nursing homes are patients. A patient may comprise any age of a human or non-human animal and therefore includes both adult and juveniles (i.e., children). It is not intended that the term patient connote a need for medical treatment, therefore, a patient may voluntarily or involuntarily be part of experimentation whether clinical or in support of basic science studies.
[0308] The term graft, engraft, engraftment, or transplant refers to any method that places a donor living tissue onto a recipient living tissue. For example, a plurality of living placode cells may be placed onto a recipient living tissue under conditions such that the donor cells become viably attached and develop normally.
DETAILED DESCRIPTION OF THE INVENTION
[0309] The present invention relates generally to the field of cell biology of stem cells, more specifically the directed differentiation of pluripotent or multipotent stem cells, including human embryonic stem cells (hESC), somatic stem cells, and induced human pluripotent stem cells (hiPSC) using novel culture conditions. In particular, cranial placodes are derived from human pluripotent stem cells by a dual-SMAD inhibition strategy of neural induction coupled with further fate specification at the pre-placode stage. The method generates placode-derived trigeminal ganglia, mature lens fibers and anterior pituitary hormone-producing cells. Applications of these cells include, but are not limited to, human cell-based therapies in sensory and endocrine disease.
I. Neuronal Differentiation Pathways
[0310] Transforming growth factor (TGF-beta) and their family members including, but not limited to, bone morphogenetic proteins (BMPs), Nodal, and activins, may be involved in the development and maintenance of various organs, in which stem cells play useful roles. The ectoderm germ layer of the embryo is believed to give rise to the neuroectoderm (the central and peripheral nervous system, neural crest cells, and derivatives). Several lines of evidence suggest a role for Smad signaling during neural induction. Generally, Smad proteins are downstream of TGF-beta superfamily ligands, and when their specific receptors are activated they stimulate the phosphorylation of the receptor-regulated Smads (R-Smads: Smad1, Smad2, Smad3, Smad5 and Smad 8, with Smads 2 and 3 specifically activated by activin/nodal and TGF-beta type I receptors and Smads 1, 5, and 8 activated by BMP type I receptors). Two distinct pathways converse on Smad 4.
[0311] Studies in frog identified bone morphogenic protein (BMP) inhibitors including chordin (Sasai, et al., Cell 79(5):779 (1994)), follistatin (Hemmati-Brivanlou, et al., Cell 77(2):283 (1994)), and noggin (Smith, et al., Cell 70(5):829 (1992)) as the critical neural inducing factors in the Spearman organizer. Mammalian noggin (Valenzuela, et al., J Neurosci 15(9):6077 (1995)) has comparable neural inducing properties, and treatment with recombinant Noggin has been used in several hESC neural induction protocols (Lee, et al., Stem Cells 25(8):1931 (2007); Elkabetz, et al., Genes Dev 22(2):152 (2008)). More recently, the drug SB431542 was shown to enhance neural induction in an embryoid body (EB) based hESC neural induction protocol (Smith, et al., Dev Biol 313(1):107 (2008)). SB431542 inhibits the Lefty/Activin/TGF pathways by blocking phosphorylation of ALK4, ALK5, ALK7 receptors. While Noggin or SB431542 treatment improve the efficiency of neural induction, neither treatment alone is sufficient to neurally convert hESCs under defined or adherent conditions.
II. Stem Cell Culture Techniques
[0312] Efforts to culture stem cells under conditions that are robust and highly repeatable, and minimize opportunities of cross contamination have not been completely successful. Efforts towards establishing well-defined media and methods may allow for repeatability and accuracy for use of stem cells as a therapeutic agent, and there has been a move to establish media and culture conditions that are free of non-human additives and undefined factors. Modifications of the cell culture system have been the focus of a number of recent patents. U.S. Pat. No. 7,005,252, herein incorporated by reference, discusses the growth of primate embryonic stem cells in the present of Fibroblast Growth Factor (FGF) and a feeder cell layer, but in the absence of any animal serum. U.S. Pat. No. 7,297,539, herein incorporated by reference, discusses the growth of pluripotent stem cells utilizing a system containing an extracellular matrix in a Fibroblast Growth Factor containing medium, but without a feeder layer. U.S. Pat. No. 7,211,434, herein incorporated by reference, describes a method for culturing mammalian embryonic stem cells in a serum for free and feeder-layer free media containing leukemia inhibitory factor, another cytokine used to maintain pluripotency. Identification of specific and defined compounds as additives to media to control the fate of embryonic stem cells are the focus of a number of used patents, including U.S. Pat. Nos. 7,332,336, 7,294,510 and 7,252,995, each of which are herein incorporated by reference.
[0313] Human stem cells have been suggested for use in cell-replacement therapies, and recent advances in somatic cell reprogramming to induced pluripotent stem cells (hiPSCs) has opened the door to generating patient-specific cells for regenerative medicine and disease modeling (Takahasi et al, 2007; Kim, et al., Cell, 136(3):411-419 (2009)). However, to realize the full potential of these approaches improved differentiation protocols are required that eliminate the use of undefined factors such as neural-inducing stoma (PAX6 or MS5 cells (Kawasaki et al., 2000; Lee et al 2007)), the heterogeneous nature of EB differentiation of the poor yield of protocols based on selective survival of neural progeny. Understanding and selectively triggering the signaling pathways necessary and sufficient for neural indication in hESCs is a goal in this effort.
[0314] Neural stem cell progenitors and neural subtypes as derived from stem cells have been the focus of numerous scientific publications and patent applications, but these disclosures lack the most desirable conditions for controlling stem cell fate including the ability to start with a large number of cells, achieve highly homogenous desired cell fates, and use a feeder-free protocol and under adherent conditions. Shang et al., and Reubinoff, et al., Nature Biotechnology 19, 1134-1140 (2001) allow for passive development of neural cell types, but cannot control the neural differentiation.
III. Stem Cell Differentiation
[0315] United States Patent Application Publication No. 2009/0035285, herein incorporated by reference, teaches methods of producing neural cells, relying on EB and rosette formation. U.S. Pat. No. 6,833,269, herein incorporated by reference, provides differentiation of cells rely on the use of feeder cells and EB formation. U.S. Pat. No. 7,011,828, herein incorporated by reference, and Application Publication No. 2005026747, herein incorporated by reference, teaches and 20060078543, herein incorporated by reference, teach the proliferation of an enrich population of hESCs, which are differentiated to neural progenitor cells, neurons, or glial cells. U.S. Pat. No. 6,887,706, herein incorporated by reference, teaches a method of differentiating heESCs intor neural precursor cells using FGF2, whereby in vitro differentiation was induced by withdrawal of FGF2 and plating on ornithine and laminin substrate. U.S. Pat. No. 7,368,115 teaches differentiation of neural stem cells or neural stem cell progeny with pituitary adenylate cyclase-activating polypeptide.
[0316] In a review by Erceg et al., Stem Cells. January; 27(1): 78-87 (2009), herein incorporated by reference, the author noted that the most important concern of the recently published protocols of stem cell differentiation towards neural lineages is (i) the risk of non-neural cell contamination; (ii) that the use of stem cell lines, Matrigel or conditioned media, including procedures relying on EB formation bears the risk of pathogen cross-transfer. None of the foregoing patents or patent applications teaches the derivatization of homogenous population of neural cell lineage from stem cells under the conditions present in this invention.
[0317] The present invention further relates to methods of obtaining populations of neural progenitor cells derived from human embryonic stem cells (hESCs), in particular for obtaining neural plate floor tissue. Specifically, some methods of the present invention induce neural plate floor development in hESCs for obtaining dopamine (DA) nerve cells. Further, neural plate floor tissue obtained using some methods of the present invention are contemplated for use in co-cultures with other tissues as inducers for shifting differentiation pathways, i.e. patterning.
[0318] Current neural induction protocols in human ES cells (hESs) rely embryoid body formation, stromal feeder co-culture, or selective survival conditions; each strategy displaying significant drawbacks such as poorly defined culture conditions, protracted differentiation and low yield.
[0319] In one embodiment, the present invention contemplates a method comprising a synergistic action of two inhibitors of SMAD signaling. For example, Noggin and SB431542 were discovered to be sufficient for inducing rapid and completed neural conversion of hESCs under adherent culture conditions (dual SMAD inhibition protocol). Temporal fate analysis reveals a transient FGF5+ epiblast-like stage followed by PAX6+ neural cells competent of rosette formation. Initial cell density determines the ratio of CNS versus neural crest progeny. Directed differentiation of hiPSC into midbrain dopamine and spinal motor neurons confirm robustness and general applicability of the novel induction protocol. Noggin/SB4315242 based neural induction should greatly facilitate the use of hESC and hiPSCs in regenerative medicine and disease modeling and obviate the need for stromal feeder or EB-based protocols. Further, this method was adapted to culture systems which may enhance the ease, yield efficiency, speed at which neural cells are derived. This should not be considered limiting and culture with additional molecules or growth factors, or incorporating other methods in the art were considered.
[0320] Several lines of evidence demonstrate a role for SMAD signaling during neural induction. While Noggin or SB431542 co-treatment improve the efficiency of neural induction, neither treatment alone is sufficient to neurally convert hESCs under defined or adherent conditions. The data presented herein tests whether combined blockade of SMAD signaling using Noggin and SB431542 is sufficient to achieve full neural conversion and to obviate the need for EB- or stromal-feeder based protocols.
[0321] In one embodiment, the present invention contemplates a method establishing an even cell distribution for inducing homogenous neural differentiation of hESCs. To this end, undifferentiated hESC were dissociated into single cells and re-plated onto Matrigel coated dishes in conditioned medium supplement with ROCK inhibitor, Y-27632 (Wananabe et al., 2007). After 72 hours, cells were switched from hESC conditions to knock-out serum replacement medium (KSR) containing either Noggin, SB4315242, or both factors and allowed to differentiate for a total of 11 days (
[0322] Combined treatment with Noggin and SB431542 dramatically increased the efficiency of neural induction to greater than 80% of total cells, compared with less than 10% PAX6.sup.+ cells when Noggin or SB431542 were used alone (
[0323] Temporal analysis of gene expression revealed that treatment with SB431542 induced a rapid loss of Nanog expression (
[0324] Lineage progression of hESC progeny after the addition of the two inhibitors was characterized. Immunocytochemical analysis showed loss of OCT4 expression by day 5 and strong expression of PAX 6 by day 7 (
[0325] Recently, methods for were described for establishing stable mouse (Munoz-Sanjuan, et al., Nat Rev Neurosci 3(4):271 (2002)) and hESC (Placantonakis, et al., Stem Cells 27(3):521-532 (2009)) transgenic reporter lines carrying bacterial artificial chromosomes (BACs) engineered to express GFP under control of cell type specific promoters. The data presented herein used the HES5::eGFP BAC transgenic hESC reporter line, marking neural stem and precursor cell progeny to measure the efficiency of neural induction (Tesar, Nature 448:196-199 (2007); (Placantonakis, et al., Stem Cells 27(3):521-532 (2009)).
[0326] The dual SMAD inhibition protocol was compared to the standard MS5 protocol in the presence of Noggin (Perrier, et al., Proc Natl Acad Sci USA 101(34):12543 (2004)). To this end HES5::eGFP cells were plated in media supplemented with Noggin either in the presence of MS5 feeder cells or SB431542 and allowed to differentiate for 13 days, a stage when the GFP.sup.+ cells were readily observed under both conditions (
[0327] In contrast to the MS5 protocol which requires plating of hESC colonies at low density (Li, et al., Nat Biotechnol 23(2):215 (2005)), the Noggin/SB431542 condition allowed for high plating densities. Therefore, in addition to higher percentages, the dual SMAD inhibition protocol also resulted in larger absolute numbers of Hes5::eGFP.sup.+ cells per each culture plate.
[0328] Isolation of rosette neural stem cells was reported (Elkabetz, et al., Genes Dev. 22, 152-165 (2008)) (R-NSCs) in addition to development of neural crest stem cells (Lee, et al., Stem Cells 25 (8), 1931 (2007)) (NCSCs) from hESCs. The presently disclosed data determines a lineage relationship of the early PAX6.sup.+ neuroectodermal cells observed in the dual SMAD inhibition protocol to the R-NSCs and NCSCs populations as described previously. Immunocytochemical analysis showed that, similar to R-NSCs, PAX6.sup.+ neuroectodermal cells express general NSC markers such as Nestin and R-NSC markers including PLZF (
[0329] However, cytoarchitecture and ZO1 expression indicated that neuroepithelial cells, under these conditions, were non-polarized and exhibited an ESC-like cytoarchitecture. These non-polarized areas were interspersed with R-NSC like areas composed of polarized columnar epithelial cells (
[0330] Anterior-posterior (AP) and dorso-ventral (DV) identity and neuronal subtype potential is dependent on early exposure to morphogenic factors such as retinoic acid, FGF8, and SHH. The patterning potential of cells generated via the dual SMAD inhibition protocol was also assessed. For example, day 5 of differentiation may present an appropriate developmental window for neural patterning since Oct4 expression is silenced between day 3 and 5 and the neural marker PAX6 is activated in the majority of cells between day 5 and 7 (
[0331] Nuclear expression of the motor neuron markers ISL1 and HB9 was observed two weeks upon exposure to BDNF, ascorbic acid, SHH, and retinoic acid (BASR; day 19 of differentiation) confirming the derivation of somatic type motor neurons (
[0332] As an alternative to the specific Smad inhibitors used here, it is possible to block both distinct Smad pathways using alternative inhibitors or mechanisms. Dorsomorphin is a small molecule alternative to Noggin, targeting the same pathway. Concentrations ranged from 10 uM to 30 nM, each individual amount added to 10 uM of SB431542. The efficiency was not as high as used with Noggin/SB431542 based on the percentage of PAX6+ cells, but combinations of dorsomorphin with SB431542 allowed for a 15 fold reduction in the concentration of Noggin necessary to obtain equivalent efficiency and cell viability. It is possible to utilize other molecules as well, although there is currently no known alternative small molecule to SB431542 that blocks the entire range of targets, but this example demonstrates that total Smad cloaked the two known pathways and can result in robust and synergistic effects that yield a highly homogenous population of neural cells. These alternative methods could also include Smad blockade through mechanism including, but not limited to, interfering DNA (to include antisense, siRNA, shRNA, and standard methods known to the art), or overexpression of a protein that can block, compete or otherwise present Smad 4 function (such as overexpression of Smad 7).
[0333] Specific cell fates were tested for their ability to survive, migrate, and function as desired in mammals. Transplantation of neurogenic tissue from hiPSCs that are differentiated using Noggin and SB431542 protocol followed by a dopamine neuron induction protocol can be made into the brains of recipient mice (specifically, Nod/SCID) and assessment of the engraftment potential of the cells is assessed.
[0334] Further, it is possible to observe pigmented cells when the cells are further differentiated from the Noggin and SB431542 protocol towards more mature neurons (both motor neurons and dopamine neurons). This data suggests that both melanocytes and retinal-pigmented epithelium are being produced. Additionally, PAX6+ central nervous system progenitor cells and a PAX6-HNK1+ peripheral nervous system progenitor cell were observed. Recent publications have reported the reprogramming of human somatic cells into induced pluripotency stem cells (hiPSCs) (Takahashi, et al., Cell 131 (5), 861 (2007); Suter, et al., Stem Cells 27, 49-58 (2008)).
[0335] Next it was determined if dual SMAD inhibition could be used to reliably generate a broad repertoire of hiPSC derived neural cell types. Given the expected intrinsic variability among hiPSC clones, reproducible differentiation results would confirm the robustness of the presently disclosed differentiation protocol. For example, two hiPS clones (IPS.sup.C14, IPS.sup.C17;
[0336] Thus a novel method of neural differentiation was discovered by combining at least two signaling inhibitors, i.e. SB431542 and Noggin. While for most of the studies presented herein used a 11-day treatment period, subsequent studies showed that comparable levels of neural induction were achieved when the treatment is shortened to the first 5 days of differentiation (
##STR00003##
(another example, Stemolecule BMP Inhibitor LDN-193189 StemGent, Cambridge, Massachusetts).
[0337] Cranial placodes are transient developmental structures critical for the formation of the lens, nasal epithelium, otic structures, cells of the adenohypophysis, and multiple cranial nerves including the trigeminal ganglion. Little is known about human placode biology due to the inaccessibility of the tissue during development and the lack of validated markers. The art is limited to extrapolating from other species such as Xenopus, zebrafish, chick, and to lesser extent mouse development.
[0338] In one embodiment, the present invention contemplates a derivation of cranial placodes and placode derived sensory neurons from human embryonic stem cells (hESCs). Six1+ hESC derived placode precursors are obtained at high yield (71% of total cells) within 11 days of differentiation using a modified dual SMAD inhibitor protocol. Six1+ cells co-express other putative placode markers such as eyes absent homolog 1 (Drosophila) (Eya1), Dachshund homolog 1 (Dach1), eyes absent homolog 4 (Drosophila) (Eya4), and SIX homeobox 3 (Six3; sine oculis homeobox homolog 3 (Drosophila)) and temporal transcriptome analysis identifies additional placode and sub-placode specific markers. Prospective pan-placode precursor cells were isolated based on the expression of p75 in the absence of HNK1 expression. Specific enhancer GFP constructs enable marking placodal cells with putative specificity to a subset of placodal regions. Human ESC derived placodal cells were highly efficiently converted into pure populations of sensory neurons expressing insulin gene enhancer protein ISL-1 (Isl1), brain-specific homeobox/POU domain protein 3A (Brn3a), 0-III-tubulin (Tuj1) and peripherin. The isolation of hESC-derived placodal represents a novel model system to study human placode development and enable the derivation of unlimited numbers of previously inaccessible sensory neuron population for the study of sensory function and pain.
[0339] Cranial placodes are transient developmental structures that give rise to the peripheral olfactory system, the lens, the anterior pituitary, otic structures, and sensory ganglia including trigeminal neurons. Defects in placode development are involved in a range of human congenital malformations, including blindness, deafness and loss of the sense of smell (Baker, et al., Dev Biol, 232(1):1-61 (2001); Bailey, et al., Curr Top Dev Biol, 72:167-204 (2001), herein incorporated by reference). Cranial placode development has been well characterized in various model organisms including Xenopus, chick and zebrafish (Baker, et al., Dev Biol, 232(1):1-61 (2001); Bailey, et al., Curr Top Dev Biol, 72:167-204 (2006); Bhattacharyya, et al., Curr Opin Genet Dev. 14(5): 520-6 (2004); and Baker, et al., Development, 2000. 127(14): p. 3045-56, all of which are herein incorporated by reference). Despite the importance of placode biology in development and disease, however, human placode development has remained unexplored. This is largely due to inaccessibility of early human placode tissue and the associated lack of appropriate markers and techniques.
[0340] Embryonic stem cells have the unique ability to self-renew in a nearly unlimited fashion while retaining the ability to differentiate into all the various cell types that make up an adult organism. During human development, pluripotent cells of the inner cell mass (ICM) and epiblast from which human ES cells are derived gives rise to the three germ layers and all subsequent derivatives, including placode cells. One question is whether the in vivo differentiation potential of the human ICM were harnessed using human ES cell-based culture systems in vitro.
[0341] Over the last few years a number of protocols have been developed for the directed differentiation of human ES cells into various tissue specific cell types, such as midbrain dopamine neurons, Perrier, et al., Proc Natl Acad Sci USA, 101(34):12543-8 (2004), herein incorporated by reference, spinal motoneurons Li, et al., Nat Biotechnol, 23(2): 215-21 (2005), herein incorporated by reference, multipotent mesenchymal precursors, Barberi, et al., PLoS Med, 2(6):e161 (2005); Barberi, et al., Nat Med, 2007. 13(5):642-8, herein incorporated by reference, cardiac cells, Laflamme, et al., Nat Biotechnol, 25(9):1015-24 (2007), herein incorporated by reference, and hepatocyte-like cells Agarwal, et al., Stem Cells, 26(5):1117-27 (2008), herein incorporated by reference. Directed differentiation into cells of peripheral neuron identity has been achieved via a neural crest precursor intermediate. The initial protocols on generating human ES cell-derived neural crest cells, Lee, et al., Nat Biotechnol, 25(12):1468-75 (2007), herein incorporated by reference were based on a MS5 co-culture system promoting neural induction, Perrier, et al., Proc Natl Acad Sci USA, 101(34):12543-8 (2004); Barberi, et al., Nat Biotechnol, 21(10):1200-7 (2003), herein incorporated by reference. The MS5 culture system was used successfully for deriving and isolating various neural crest fates from human ES cells and human IPS cells, and for modeling a familial dysautonomia (FD), a rare human genetic disorder affecting neural crest-derived neurons, Lee, et al., Nature, 461(7262):402-6 (Epub 2009 Aug. 19) herein incorporated by reference.
[0342] Recently, a defined neural induction strategy that is based on the concomitant inhibition of the BMP and TGFb/Activin/Nodal signaling pathways was reported. Chambers, et al., Nat Biotechnol, 27(3):275-80 (2009), herein incorporated by reference. Exposure to Noggin (N) and SB431542 (SB) leads to a synchronized and rapid differentiation of human ES cells or IPS cells towards neural fates under adherent culture conditions and therefore obviates the need for both co-culture and embryoid body formation during the induction process. The more rapid and synchronized differentiation response using the N-SB protocol enables testing of the precise relationship of specific morphogens in biasing developmental fate in vitro.
[0343] In some embodiments, a modified N-SB protocol allow the efficient derivation of highly enriched populations of placodal precursors. Placodal fate is induced at the expense of neuroectodermal cells upon withdrawal of noggin treatment 48 hours after N-SB induction. These data illustrated the use of the N-SB induction system to optimize the generation of non-CNS derivatives, demonstrate the importance of endogenous BMP signaling during hESC differentiation and enable the derivation of unlimited numbers of placode derivates such as cranial sensory neurons for the study of sensory function and pain.
[0344] Several observations from the studies described herein are presented as follows for use in some of the methods of the present invention.
[0345] A. BMP Dependent Specification of Placodal Fates During HESC Differentiation
[0346] BMPs exert wide-ranging effects on early embryonic fate specification in vivo and are involved in the specification of various extra-embryonic structures, determination of definitive mesodermal cells, specification of non-neural ectoderm, placode and neural crest tissues. The use of the N-SB culture system enables a highly synchronized and efficient differentiation of human ES cells. The data herein studies the N-SB system reveals both BMP dose and timing of application can modulate the specification of placodal fates. Important questions remain as to whether the system was used similarly to optimize differentiation towards non-neural ectoderm fates and the generation of primitive skin precursor cells. Data indicated that a subset of Six1 negative cells under the modified N-SB culture conditions express p63, a known marker of early epidermal precursors during development.
[0347] B. The Emergence of Putative Pan-Placodal Fates During Human Embryonic Stem (ES) Cell Differentiation
[0348] Highly efficient differentiation towards Six1+ fates and the rapid emergence of insulin gene enhancer protein ISL-1, also known as ISL LIM homeobox 1, (Isl1)+ cells during human ES cell differentiation suggest that hESC derived cells may initially adopt a pre-placodal precursor fate. The emergence of a pre-placodal region has been described during Xenopus and zebrafish development marking a horseshoe shaped area in the most anterior region of the embryo surrounding the anterior neuroectodermal cells. The data presented herein reports on the generation of sensory neuron precursors from the Six1+ placodal regions. However, future studies may address the plasticity of these placodal cells upon exposure to alternative differentiation regimens. Of particular interest may be the derivation of adenohypophyseal cells to study specification of various hormone producing cell types. Such cells are of interest for developmental studies and for studies aimed at defining pharmacological control of hormone release. Approximately, 15% of the cells at the Six1+ stage express Lhx3, a marker of adenohypophyseal precursor cells. Expression of CGA, the precursor protein in the production of adenohypophyseal hormones, was observed during human ES cell differentiation in the modified N-SB protocol at day 11 of differentiation (
[0349] C. Sensory Neuron Specification From Six1+ Placodal Precursors
[0350] The presently disclosed findings indicate a placodal origin of the sensory neuron populations generated in the modified N-SB protocol. This is based on the expression of Six1 in the precursor clusters isolated for subsequent sensory neuron generation and the co-expression of Six-1 in early stage sensory neurons. Placode derived sensory neurons share various markers with sensory neurons derived from neural crest lineages such as Brn3A, Isl1 and Peripherin. However, the modified N-SB protocol shows highly efficient induction of FoxG1B and other anterior markers expressed in placodal precursor and not expressed in early neural crest lineages. Initial cell density (Chambers et al., Nature Biotechnology 27(3) 275-280, 2009, Corrigendum: in Nature Biotechnology 27(4):1) and modulation of Wnt signaling (reference) may enable specification of placodal versus neural crest derived sensory neuron populations. Access to highly purified populations of cranial sensory neurons represent a novel tool for the future development high throughput drug discovery assays. For example, compounds modulating placode derived trigeminal neurons may be of particular interest given the well known clinical syndromes associated with trigeminal nerve dysfunction.
[0351] D. Specification of Functional Floor Plate Tissue from Human Embryonic Stem Cells Occurs at the Expense of Anterior Neurectoderm
[0352] The floor plate (FP) is a critical signaling center during neural development located along the ventral midline of the embryo. Little is known about FP development in humans, due the lack of tissue accessibility. This disclosure describes the derivation of human embryonic stem cells (hESC) and subsequently derived FP tissue capable of secreting Netrin-1 and SHH and influencing patterning of primary and hESC derived tissues. Induction of FP in hESCs is dependent on early SHH exposure and occurs at the expense of anterior neurectoderm (AN). Global gene expression and functional studies identify SHH-mediated inhibition of DKK-1 as key factor in AN repression. hESC derived FP tissue is shown to be of anterior SIX6+ character but responsive to caudalizing factors suppressing SIX6 expression and inducing a shift in expression of region-specific SHH enhancers. These data established hESC derived FP as an experimental model system and define early signaling events that modulate FP versus AN specification.
[0353] Neural development is dictated in time and space by a complex set of signals that instruct neural precursor identity. While significant progress has been made in animal models, human neural development remains much less understood. Human embryonic stem cells (hESCs) offer an accessible and manipulatable cell platform to model the early stages of human development.
[0354] Previous studies have reported the directed differentiation of mouse (Wichterle et al., 2002; Barberi et al., 2003; Watanabe et al., 2005) and human (Perrier et al., 2004; Li et al., 2008; Eiraku et al., 2008) ESCs into specific neuron types in response to patterning factors defining anterior/posterior (A/P) and dorso-/ventral (D/V) CNS identity. These studies demonstrate evolutionary conservation of signaling systems that specify the major CNS regions. In mammals, sonic hedgehog (SHH) is a ventralizing factor acting in a dose-dependent manner to specify the various ventral cell types including cells expressing floor plate (FP) in primary neural explants (Briscoe and Ericson, 1999) and in mouse ES cells (Mizuseki et al., 2003). While application of SHH to hESC-derived neural cells has been shown to induce various ventral neuron types, the derivation of floor plate (FP) tissue itself has not yet been reported. As FP is one signaling center, the ability to produce FP from human ES cells will be a step forward in furthering an understanding of early human neural development.
[0355] The FP runs along the most medial aspect of the ventral neural tube extending most caudally from the spinal cord, through the midbrain, up to the diencephalon with its anterior limit being just below the zona limitans intrathalamica (Jessell et al., 1989). At the most anterior aspect the FP stops where the anterior neurectoderm (AN) begins studies have shown that AN commitment renders cells incapable of responding to FP inductive signals (Placzek et al., 2003). Classic studies have shown FP cells to exhibit a unique, flat morphology, and to express FP specific markers including SHH, FOXA2, F-Spondin, and Netrin-1 (Placzek, 1995). Studies in mouse and chick embryos have identified two major organizer functions for the FP: the secretion of the morphogen SHH patterning the ventral neural tube (Placzek and Briscoe, 2005), and the expression of Netrin-1 guiding commissural axons across the midline (Charron et al., 2003). The FP is generally considered a non-neurogenic region. However, genetic lineage mapping studies in the mouse have recently reported that the midbrain FP selectively exhibits neurogenic potential and is the source of ventral midbrain dopamine neurons (Kittappa et al, 2007; Ono et al., 2007; Joksimovic et al., 2009).
[0356] To date, little is known about FP development in humans, due to lack of accessibility to tissue. In animals, the FP is a major site of SHH production and several human developmental disorders are related to alterations in midline SHH signaling (Mullor et al., 2002) including certain forms of holoprosencephaly and microphthalmia, skeletal disorders including various cleft plate syndromes, and tumor conditions such as Gorlin's syndrome; a rare genetic disorder caused by a mutation in the SHH receptor Patched 1. Thus, understanding how human FP is generated will assist comparative developmental studies of human neural patterning and axonal pathfinding and the resulting cells could potentially serve as a source of specific neuron types that have a FP origin.
[0357] The data provided herein demonstrate exemplary directed differentiation of hESCs into FP tissue, as the first example of generating a human developmental organizer structure in vitro. For example, human FP specification may be dependent on early high-dose SHH signaling that represses DKK1-mediated specification of AN. Functionality of the FP is demonstrated by secretion of Netrin-1 and SHH and the ability to induce ectopic FP tissue and neurite outgrowth in primary mouse and rat explants.
[0358] Human ESC-derived FP adopts anterior identity by default but were specified to posterior fates in response to caudalizing cues providing access to region-specific FP tissue. The experimental system presented here, and in combination with compositions and methods described for highly efficient neural conversion of human ES and iPS cells by dual inhibition of SMAD signaling, Nat. Biotechnol. 26, 275-280 (2009); published online 1 Mar. 2009; corrected after print 16 Mar. 2009, Corrigendum: Chambers, et al., should facilitate studies on FP-mediated signaling events critical during early human neural development.
IV. Stem Cell Lines
[0359] The present invention is not limited to the use of any particular type of human stem cells. Indeed, the use of a variety of types of human stem cells is contemplated. Methods for obtaining totipotent or pluripotent cells from humans, monkeys, mice, rats, pigs, cattle and sheep have been previously described. See, e.g., U.S. Pat. Nos. 5,453,357; 5,523,226; 5,589,376; 5,340,740; and 5,166,065 (all of which are specifically incorporated herein by reference); as well as, Evans, et al., Theriogenology 33(1):125-128, 1990; Evans, et al., Theriogenology 33(1):125-128, 1990; Notarianni, et al., J. Reprod. Fertil. 41(Suppl.):51-56, 1990; Giles, et al., Mol. Reprod. Dev. 36:130-138, 1993; Graves, et al., Mol. Reprod. Dev. 36:424-433, 1993; Sukoyan, et al., Mol. Reprod. Dev. 33:418-431, 1992; Sukoyan, et al., Mol. Reprod. Dev. 36:148-158, 1993; Iannaccone, et al., Dev. Biol. 163:288-292, 1994; Evans & Kaufman, Nature 292:154-156, 1981; Martin, Proc Natl Acad Sci USA 78:7634-7638, 1981; Doetschman et al. Dev Biol 127:224-227, 1988); Giles et al. Mol Reprod Dev 36:130-138, 1993; Graves & Moreadith, Mol Reprod Dev 36:424-433, 1993 and Bradley, et al., Nature 309:255-256, 1984.
[0360] In some embodiments, undifferentiated human embryonic cells lines are contemplated for use, for examples, cell line WA09, and the like.
V. Dual SMAD Differentiation
[0361] One finding of the studies described herein, is the default nature and anterior bias of the embryonic cell derived FP tissue. The lack of any obvious mesodermal intermediates in both NSB (Chambers et al., 2009;
[0362] To date, it has not been clearly shown whether expression of AN markers inhibits the ability of cells to yield certain lineages. In hESC derived neural rosette cells, expression of BF1 does not preclude patterning towards posterior CNS fates including HB9+ somatic motoneurons.
[0363] However, the efficiency of generating caudal neuron fates is significantly reduced as compared to BF1-negative rosettes (Elkabetz, et al., 2008). Previous studies in primary mouse explants showed that AN cells are not competent to differentiate into FP cells in response to SHH alone (Placzek, et al., 1993). The methods and results described herein during the development of the present inventions showed an AN commitment that was not capable of FP specification.
[0364] An additional key finding described herein is a dramatic (strong) induction of DKK-1 during NSB-mediated neural differentiation. During neural differentiation of mouse ESCs exposed to extrinsic DKK-1 enhanced AN induction under serum-free embryoid body (SFEB) conditions (Watanabe et al., 2005). Thus, some embodiments of the present invention contemplate that early induction of endogenous DKK-1 during neural differentiation is least in part responsible for the AN default phenotype observed in hESCs. Functional studies demonstrated herein that inhibition of DKK-1 using blocking antibodies significantly improved FP yield. Further, addition of DKK-1 antibodies along with SHH at day 5 or later time-points was not sufficient to extend the temporal window of FP competency (
[0365] Additional data in BF1 knockdown hESC lines showed enhanced FP yield with improved yield of posterior CNS cell types such as HB9+ motoneurons. Thus a model system presented herein is contemplated to be suitable to assess the contribution of other molecules with WNT inhibitory function such as Cerberus (Bouwmeester, et al., 1996) to AN specification and repression of FP fate. Finally, the system and methods described herein are contemplated to allow the identification of potential upstream regulators of DKK-1 expression regulating AN default in hESCs.
[0366] Suppression of DKK-1 and subsequently AN fates via early exposure to high levels of extrinsic SHH results was a surprising result, as SHH is a classic ventralizing factor and not known to exert effects on AP specification during neural development. Our studies did not address whether regulation of DKK-1 by SHH is direct or caused by inducing an alternative precursor population devoid of DKK-1 expression. While DKK-1 inhibited FP induction, exposure to WNT1 enhanced the derivation of FP tissue from hESCs. These data raised the question whether RA that induce a similar increase in FP yield would affect WNT signaling or whether induction of posterior fates enhances FP yield independently of Wnt signaling.
[0367] The availability of an unlimited number of FP cells of defined regional identity provides a valuable tool for studying human neural development. Recent studies in the mouse suggest that some regions of the FP, beyond roles in neural patterning and axonal path finding, may serve as a source of specific neuron types including midbrain dopamine neurons. Re-specification of regional identity of hESC derived FP was demonstrated towards midbrain character based on the expression of midbrain specific markers and the activation of midbrain specific SHH enhancer elements. Evidence was found that hESC derived FP tissue is capable of yielding TH+/FOXA2+ putative midbrain DA neurons (
[0368] In conclusion, exemplary data shown herein showed that neural differentiation hESCs default towards an AN fate by upregulating DKK-1 and subsequently BF1, while AN commitment actively repressed FP competency in hESC progeny. However, an early high level of SHH reduced DKK-1 levels enabling FP induction at the expense of AN while loss-of-function of DKK-1 or BF1 increased FP production. Thus human ESC derived FP is anterior by default but was posteriorized in response to caudalizing factors. This is summarized in
[0369] Thus, numerous embodiments of the present inventions are summarized in the following Tables.
TABLE-US-00002 TABLE A Exemplary ranges of amounts of compounds for obtaining neural cells of the present inventions. Sonic C25H Noggin Dorsomorphin SB431542 (SHH) Concentration Concentration Concentration Concentration Noggin with 125-500 ng/ml NA 0.001 to 1000 NA SB431542 microM Noggin with 500 ng/ml NA 0.001 to 1000 200-2000 SB431542 and microM ng/ml SHH Dorsomorphin NA 100-5000 nM, 0.001 to 1000 NA with SB431542 best results 600 microM nM Noggin with 25-500 ng/ml, 100-5000 nM, 0.001 t0 1000 NA Dorsomorphin high efficiency best results 600 microM with SB431542 to 30 ng/ml nM
TABLE-US-00003 TABLE B Exemplary time of addition of compounds of the present inventions for producing neural cell types of the present inventions. Stem cells Stem cells Stem cells N-SB including iPS including iPS and including iPS and treated and hESC. hESC. hESC. hESC or Low density of High density of Low or high Modified N-SB iPS in cells: KSR cells: density of cells: treated hESC or non- Start Cell medium or KSR medium KSR medium or iPS: KSR medium adherent Type and conditioned or conditioned conditioned or conditioned embryoid conditions medium medium medium medium bodies N-SB: Noggin Add both day 0 Add both day 0 of Add both day 0 of NA Add both and/or of culture of culture and culture and day 0 of Dorsomorphin culture and continue adding continue adding culture with SB431542 continue adding fresh aliquots when fresh aliquots and fresh aliquots feeding cells when feeding cells continue when feeding adding cells fresh aliquots when feeding cells; SB withdraw at or around Day 7 Modified N-SB NA NA NA Add both day 0 of NA Noggin/ culture and replace Dorsomorphin with cell media withdrawal 2 days without Noggin (1-3) after N-SB and/or induction Dorsomorphin day 1 (ranging from 6 hours to 4 days after day 0) SHH or C25Il NA NA Add day 1 after N- NA NA SB additions (ranging 0-5 days) Gradually replacing KSR media with N2 media between Day 5 and 11. Resulting cells CNS progenitor CNS progenitor FOXA2+ (BF1 Six1+ placodal High cells (PAX6+) cells (PAX6+) (R- reduced) SOX17- precursors leading efficiency and PNS NS cells and neural cells to motor progenitor cells patternable i.e. FP Brn3a+ progenitor neuron (p75+, HNK-1+) neuronal differentiation cells, leading to cells populations of with FP anterior immature neuronal motoneurons and cells as a default cells, Tuj1+, dopaminergic type but posterior peripherin+ and neurons within FP tissue can be mature neurons. 19 d of initiating induced in the differentiation) presence of caudalizing factors such as Wnt-1, FGFF8 or RA.
VI. Speciation of Cranial Placode Cells
[0370] In one embodiment, the present invention contemplates a method comprising the specification of trigeminal, lens and anterior pituitary placode lineages. In one embodiment, the method further comprises specification of precursor placode cells using a modified PIP condition. Although it is not necessary to understand the mechanism of an invention, it is believed that other placode fates are also accessible as well using modified PIP conditions. For example, exposure of pre-placode cells to FGF8 enriches for ASCL1 expression compatible with olfactory placode fate (Balmer and LaMantia, 2005). Exposure to caudalizing cues such as WNT3A leads to the induction of a population of cells coexpressing SIX1 and SOX10 compatible of otic placode fates. Those conditions, while requiring further optimization, support the notion that PIP represents a universal platform for cranial placode fate specification.
[0371] Cranial placodes are embryonic structures essential for sensory and endocrine organ development. Human placode development has remained largely inaccessible despite the serious medical conditions caused by the dysfunction of placode-derived tissues. In some embodiments, the efficient derivation of cranial placodes from human pluripotent stem cells is disclosed. For example, a timed removal of the BMP inhibitor Noggin, a component of the dual-SMAD inhibition strategy of neural induction, triggers placode induction at the expense of other CNS fates. Alternatively, a concomitant inhibition of FGF signaling may disrupt placode derivation and induces surface ectoderm. Further fate specification at the pre-placode stage enables the selective generation of cranial placode cells including, but not limited to, placode-derived trigeminal ganglia capable of in vivo engraftment, mature lens fibers and anterior pituitary hormone-producing cells that upon transplantation produce human GH and ACTH in vivo. The data disclosed herein establish a powerful experimental platform to study human cranial placode development and set the stage for the development of human cell-based therapies in sensory and endocrine disease.
[0372] An understanding of human cranial placode development has been challenging due to the lack of a tractable experimental system, the inaccessibility of this transient structure during early human development and the absence of validated human placode markers. The presently disclosed data resolve those major challenges and establish a versatile platform for the study of human placode and ectoderm development (
[0373] Very recent studies have reported an ability to direct pluripotent stem cells towards placode fates (Leung et al., 2013; Mengarelli and Barberi, 2013; Shi et al., 2007). However, no functional human placode derivatives have been generated under those conditions. In contrast, studies in mouse ESCs have successfully derived functional otic (Koehler et al., 2013) and pituitary (Suga et al., 2011) placode derivatives.
[0374] A developmental question of particular interest is the origin of placode cells. The prevalent hypothesis in the art is that placode tissue originates from non-neural ectoderm upon response to inductive signals from the adjacent neural tissue (Schlosser, 2006). The presently disclosed data indicate that human placode development similarly originates from non-neural ectoderm based on the result that TFAP2A expression precedes the induction of SIX1 while TFAP2A is suppressed during N-SB induction. BMP-based induction of TFAP2A and GATA3 may be useful in establishing non-neural ectoderm lineage competent for placode induction (Kwon et al., 2010).
[0375] The ability to block placode induction at the expense of non-neural ectoderm by inhibition of FGF signaling further supports a non-neural ectoderm origin and suggests that endogenous FGF signals may be the neural signal responsible for the placode default in PIP. In one embodiment, a method delineates a time point of developmental commitment to placodal fate by day 7, given that treatment of cells at day 7 of differentiation (pre-placode) induced a switch between various placode fates but did not affect the ratio of cells of placode versus non-neural ectoderm fate.
[0376] Previous work described FOXG1 and DACH1 as markers of anterior neuroectoderm and neural rosette stage cells during hPSC differentiation (Chambers et al., 2009; Elkabetz et al., 2008). The data presented herein demonstrates that a small percentage of SIX1+ cells emerge spontaneously under NSB conditions. Therefore, differentiation studies aimed at generating CNS lineages should address whether contaminating placodal tissues are present in hPSC derived neural cultures.
[0377] Although it is not necessary to understand the mechanism of an invention, it is believed that those spontaneously emerging placodal cells are likely the source of lentoid bodies and other placode derivatives observed in past neural differentiation studies. The gene expression data presented herein define a broad set of placode markers. For example, OVOL2 has been previously reported to be expressed in the mouse epiblast and surface ectoderm, and loss of OVOL2 leads to early embryonic lethality (Mackay et al., 2006).
[0378] In one embodiment, the present invention contemplates that OVOL2 as a human pre-placode marker. In other embodiment, FOXC1 and ISL1 are additional transcription factors specifically expressed at the pre-placode stage. The presently disclosed data provide a framework for defining transcriptional networks that distinguish cranial placode identity from early CNS, neural crest and surface ectoderm identity.
[0379] In one embodiment, the present invention contemplates a method comprising a transient pre-placode population competent to adopt various specific placode identities. The emergence of a pre-placodal region has been described during Xenopus and zebrafish development (Bailey et al., 2006; Martin and Groves, 2006; Schlosser, 2006). The data described herein show that PIP initially yields a PAX6+/SIX1+ anterior pre-placode population that spontaneously adopts a more posterior, PAX3+ ophthalmic trigeminal fate upon further differentiation, likely due to the caudalizing effects of endogenous FGF and WNT signals.
[0380] In other embodiment, exposure to SHH or suppression of FGF signaling at day 7 of differentiation directs the putative pre-placode precursors into anterior pituitary and lens placodes fates. Lens placode has been suggested as the default state during chick placode development with FGF8 being necessary and sufficient to specify olfactory placode fate (Bailey et al., 2006). Other studies in mouse ESCs (Koehler et al., 2013; Suga et al., 2011) have shown the feasibility of generating hormone-producing pituitary cells and otic sensory neurons respectively using sophisticated 3D culture systems.
[0381] The presently disclosed data demonstrate that modified PIP conditions yield human pituitary precursors efficiently without the need for complex 3D culture conditions. While a bias was observed in generating preferentially TBX19-related pituitary lineages including ACTH producing cells, all three major precursor lineages (GATA-2, TBX19, and PIT1 lineages,
[0382] In one embodiment, the present invention contemplates a method comprising engrafting cranial placode cells in vivo. In one embodiment, the cranial placode cells comprise anterior pituitary cells. In one embodiment, the engraftment is on a leg muscle. In one embodiment, the engraftment is on the hypothalamic-pituitary axis. In one embodiment, the engraftment is on the hypothalamus. In one embodiment, the engraftment is on the sella. In one embodiment, the engrafted pituitary placode cells produce and secrete pituitary hormones.
[0383] In one embodiment, the present invention contemplated a method comprising a PIP-based differentiation capable of deriving trigeminal sensory neurons. It has been reported that trigeminal neurons are involved in several pain syndromes such as trigeminal nerve palsy, trigeminal neuralgia and migraine pain (Love and Coakham, 2001). Therefore, an ability to generate large numbers of trigeminal neurons will be particularly useful for modeling human nociception and for the development of cell-based drug screens in pain research. Another important application will be modeling Herpes simplex encephalitis using human iPSCs (Lafaille et al., 2012). HSV-1 is a virus that specifically persists in a latent form within the trigeminal ganglia (Barnett et al., 1994).
[0384] The ability to derive trigeminal neurons from patient-specific iPSCs should address whether defects in the control of viral latency contributes to Herpes simplex encephalitis. The robust in vivo survival of trigeminal placode precursors raises the possibility for developing future regenerative approaches with the goal of nerve repair following mechanical, radiation or chemotherapy-induced damage.
[0385] Although it is not necessary to understand the mechanism of an invention it is believed that a potential large impact on regenerative medicine may come from deriving functional hormone producing cells. For example, hypopituitarism is a common consequence of congenital defects, head injury or therapeutic intervention in patients with pituitary tumors or patients receiving radiation therapy (Tabar, 2011). While replacement hormones can be given to normalize resting serum levels in patients, the financial, logistic and medical costs for such life-long treatments are considerable. Furthermore, hormone replacement therapy does not allow for dynamic release in response to circadian rhythms, or rapid adjustments to physiological changes in the environment or stressful challenges. Therefore, an ability to generate large numbers of functional ACTH and GH producing cells launches the possibility of long-term therapeutic cell replacement strategies in pediatric and adult patients for restoring endocrine function.
[0386] A. Cranial Placode Development
[0387] Cranial placodes are believed to give rise to cells of the sensory organs, including, but not limited to, the optic lens, the nasal epithelium, otic structures, the adenohypophysis, and a subset of cranial nerves such as the trigeminal ganglia. During development, sensory placodes are formed at the interface of the non-neural ectoderm and neural plate, surrounding the anterior portion of the future central nervous system (CNS) (
[0388] Defects in placode development may cause a wide spectrum of human congenital malformations ranging from blindness and deafness to hormone imbalance or loss of smell (Abdelhak et al., 1997; Baker and Bronner-Fraser, 2001; Ruf et al., 2004). To date, cranial placode development has been characterized in model organisms, including the frog, zebrafish, chicken and to a lesser extent, the mouse (Baker and Bronner-Fraser, 2001; Bhattacharyya and Bronner-Fraser, 2004; Schlosser, 2006). However, human placode development has remained largely unexplored due to lack of access to early human tissue and specific placode markers. Human pluripotent stem cells (hPSCs), including human embryonic (hESCs) and human induced pluripotent stem cells (hiPSCs) have the potential to self-renew, while retaining a very broad differentiation potential. Over the last few years, protocols have been developed for directing the fate of hESCs into specific cell lineages. For example, the derivation of CNS cells was among the first hESC differentiation protocols developed in the field (Reubinoff et al., 2001; Zhang et al., 2001). The differentiation of hESCs into cells of the peripheral nervous system has also been achieved (Lee et al., 2007; Menendez et al., 2011).
[0389] In contrast to the successful derivation and application of defined CNS and NC derived cell types, there has been limited success on modeling cranial placode development in hPSCs. Recently, a neural induction strategy based on the concomitant inhibition of the Bone Morphogenetic Protein (BMP) and TGF/Activin/Nodal signaling pathways (dual-SMAD inhibition (dSMADi) was reported (Chambers et al., 2009)). This strategy exposes hPSCs to Noggin (N) and SB431542 (SB) that leads to a synchronized, rapid and efficient differentiation of hPSCs into a variety of CNS cell fates.
[0390] In one embodiment, the present invention contemplates a method comprising a de-repression of endogenous BMP signaling during dSMADi induced differentiation that is sufficient for the selective induction of human cranial placodes. In one embodiment, a novel placode induction protocol (PIP) induces >70% of all cells to adopt a SIX1+ cranial placode precursor fate by day 11 of differentiation.
[0391] In one embodiment, the present invention contemplates a method to identify a pre-placodal lineage competent to differentiate into selective placode fates including, but not limited to, trigeminal sensory neurons, mature lens fibers and/or hormone-producing anterior pituitary cells. In one embodiment, trigeminal sensory neurons are characterized by techniques including, but not limited to, marker expression, electrophysiology and transplantation into the developing chick embryo and/or the adult mouse CNS. In other embodiments, the method is capable of deriving human pituitary cells producing growth hormone (GH) and/or adrenocorticotropic hormone (ACTH) either in vitro and/or in vivo.
[0392] B. De-Repression of Endogenous BMP Signaling Induces Placode at the Expense of Neuroectoderm
[0393] To address whether the previously reported dSMADi protocol (supra) is suitable for derivation of placodal cells, a set of appropriate placode markers was defined. Based on studies in model organisms, members of the SIX, EYA, and DLX family of transcription factors have been reported to mark human placode fate (Baker and Bronner-Fraser, 2001; Schlosser, 2006). Within the ectodermal lineage, SIX1 is placode-specific, marking both the early pre-placodal region and the various specific placodes (Schlosser, 2006). Based on studies in the chick embryo, placode induction relies on a complex interplay of FGF, BMP and WNT signals during early ectodermal patterning in vivo (Litsiou et al., 2005). Activity of BMPs within the ectoderm is also thought to be particularly useful in allocating fates. For example, a model has been proposed initially whereby high levels of signaling promote an epidermal fate, moderate levels induce placodes, intermediate levels specify NC and a complete absence of BMP activity is required for neural plate formation (Wilson et al., 1997). More recent studies have revised the above model by confirming an early role for BMP signaling in establishing placode competence (Kwon et al., 2010) while the subsequent stage was shown to require BMP-inhibition rather than BMP activation (Ahrens and Schlosser, 2005; Kwon et al., 2010; Litsiou et al., 2005).
[0394] To test whether early BMP exposure promotes the derivation of SIX1+ placodal cells, SB (the TGF inhibitor) treated hESCs were exposed to various concentrations of BMP4. However, addition of BMP4 in the presence of SB caused a dramatic morphological change and triggered induction of CDX2 (
[0395] A timed withdrawal of the BMP inhibitor Noggin during N-SB differentiation was also tested to determine if placodal fates could be induced via derepressing endogenous BMP signaling. A time course analysis was performed during which Noggin was removed at different time points of the N-SB protocol (
[0396] These data indicate that EYA1 is expressed in both trophectodermal and placodal lineages, and that co-expression with SIX1 can define a placodal lineage. Immunocytochemical analysis of hESC progeny at day 11 of differentiation demonstrated that Noggin withdrawal at day 3 (PIP conditions) induced a switch from 82% PAX6+ neuroectodermal cells under N-SB conditions to 71% SIX1+ putative placode precursor cells under PIP (
[0397] DACH1 is also expressed in anterior neuroectodermal cells (Elkabetz et al., 2008) marking neural rosettes while in PIP treated cultures DACH1 marks placodal clusters (
[0398] However, expression of skeletal muscle (MYOD), endoderm (SOX17), or mesoderm (Brachyury (T)) markers were not detected during PIP confirming that the hESC-derived SIX1+ cells are of placode identity. Very few (<1%) NC lineage cells were observed under PIP conditions based on SOX10 expression by immunocytochemistry and SOX10::GFP (Chambers et al., 2012; Mica et al., 2013) reporter line expression (
[0399] Induction of cranial placode markers was observed by day 5 with FOXG1 preceding expression of SIX1 and DLX3 (
[0400] C. Microarray Analysis Reveals Novel Human Placode Progenitor Gene Expression
[0401] A temporal transcriptome analysis was performed to establish an unbiased molecular assessment of the in vitro placode induction process. RNA was collected at five time points in triplicate (day 1, 3, 5, 7, and 11) in control N-SB versus PIP treated cultures (
[0402] Cluster and principal component analyses showed a temporal segregation of the transcriptome data in PIP versus N-SB treated cells by day 7 of differentiation (
[0403] A significant transcriptional change was observed in WNT and BMP pathway components such as an increase in the WNT pathway inhibitor DKK-1 and BMP antagonists, such as GREMLIN-1 and BAMBI (
[0404] Another novel placode marker identified in the presently disclosed microarray expression data is OVOL2, a member of the Ovo family of zinc-finger transcription factors. OVOL2 was enriched during PIP by day 5 of differentiation and placode clusters showed strong immunoreactivity for OVOL2 (
[0405] Also identified were additional differentially expressed genes during anterior placode specification, including FOXC1 and HAPNL1 (also known as CRTL1). FOXC1 marks the lens placode during chick development (Bailey et al., 2006) but may also be expressed at the pre-placode stage (Sasaki and Hogan, 1993). HAPNL1 was one of the most differentially expressed genes in PIP and was previously shown to be expressed in the surface ectoderm and chick neural plate border (Colas and Schoenwolf, 2003). Gene ontology (GO) analysis, using DAVID (david.abcc.ncifcrf.gov/; (Dennis et al., 2003)) indicated that BMP and WNT pathways transcripts are highly enriched in PIP versus N-SB conditions at day 7 and day 9 of differentiation that are associated with sensory organ, ectoderm and epidermis development (
[0406] D. Early Treatment with FGF-Inhibitor Suppresses Placode and Induces Surface Ectoderm Fate
[0407] Lineage studies in several vertebrate species indicate that cranial placode precursors originate from the surface ectoderm and are induced by signals emanating from the adjacent neuroectoderm (Pieper et al., 2012), rather than being of neural origin. However, no such data are available for human development.
[0408] The putative timing of human placode induction (day 20 p.c.) (O'Rahilly, 1987)) makes this a stage largely inaccessible to experimental manipulations. Gene expression data during PIP indicate that TFAP2A is one of the earliest upregulated and differentially expressed genes (
[0409] The data presented herein demonstrates an initial detection of TFAP2A induction at day 5 of PIP while absent in N-SB protocol (
[0410] In vivo genetic studies indicate that high levels of BMPs, in the absence of FGF signaling, promote epidermal fate whereas placodal cells are established at reduced levels of BMPs upon activation of FGFs (Kudoh et al., 2004; Litsiou et al., 2005). Although it is not necessary to understand the mechanism of an invention, it is believed that blocking endogenous FGF signaling under PIP conditions may disrupt placode induction and trigger epidermal fate. For example, the present data show that SU5402, a small molecule inhibiting FGF signaling, from day 3-11 of differentiation (
[0411] Quantification of SIX1 and TFAP2A gene expression at day 11 confirmed a complete loss of placode marker expression (
[0412] E. Placode Precursors Efficiently Differentiate into Trigeminal-Type Sensory Neurons
[0413] Cranial placodes are believed give rise to a broad range of specialized cell types including, but not limited to, hormone producing cells of the anterior pituitary gland, structural cells such as lens fibers in the eye and sensory neurons including, but not limited to, trigeminal neurons (
[0414] Diagnostic markers of nociceptive neuron identity include expression of specific sodium channels (SCN9A, SCN10A, SCN11A;
[0415] A functional analysis of placode-derived sensory neurons was performed by whole-cell patch-clamp recordings (
[0416] F. In Vivo Analysis of hESC-Derived Trigeminal Neurons in the Developing Chick Embryo and Adult Mouse CNS
[0417] To assess the in vivo properties of hESC-derived trigeminal placode precursors, PIP-induced neuronal clusters, derived from a constitutively GFP expressing hESC line (
[0418] hESC-derived trigeminal neurons were assessed as to whether they can engraft in the adult mouse CNS and project towards a physiological target. The trigeminal nuclei in the brainstem receive afferent innervation from the trigeminal sensory ganglion that is relayed to the contralateral thalamus. The pons was selected as site for transplantation, as it is surgically accessible and located within proximity of the trigeminal brain stem nuclei that receive afferent input from the trigeminal ganglia. Hence, GFP+ human trigeminal neuron clusters were injected into adult NOD/SCID mice via stereotactic surgery. Histological analysis 4 weeks after transplantation showed survival of GFP+ human cell graft in the ventral pons. While GFP+ cell bodies remained tightly clustered at injection site, GFP+ fibers showed extensive projections into the host brain (N=6) including the endogenous trigeminal nuclei. Expression of BRN3A confirmed the sensory neuron identity of the cells. Graft-derived human fiber bundles (hNCAM+ and GFP+) were observed emanating from the graft core.
[0419] These data demonstrate in vivo survival of trigeminal placode derivatives, differentiation along sensory neuron lineage and the establishment of axonal projections towards relevant endogenous targets in the embryonic chick and adult mouse brain. The data suggests that trigeminal sensory neurons may be useful for drug screening for pain syndromes and migraines. For example, a read out could be done by in vitro electrophysiology on trigeminal neurons generated from trigeminal placode cells. The data presented herein shows that placodal-trigeminal sensory neurons has single action potentials matching the functional properties recorded for primary trigeminal sensory neurons. Moreover, these cells express diagnostic markers of noniceptive neuron identity include expression of specific sodium channels.
[0420] G. Identification of a Putative Pre-Placode Stage
[0421] The data presented herein indicate that PIP conditions efficiently induce ophthalmic trigeminal placode fates. To investigate whether other placodal fates can be generated using modified PIP conditions, the presence of putative pre-placode cells in the culture system was addressed.
[0422] During vertebrate development, the pre-placode is characterized as the developmental anlage containing precursor cells competent to respond to signals determining placode identity (Martin and Groves, 2006). Pre-placodal cells in various model organisms have been shown to express Six1 and to co-express markers of both ectodermal and neural fate. However, the development of a human pre-placode remains unexplored.
[0423] A time-course co-expression analysis was performed for TFAP2A (early ectodermal marker) and PAX6 (early neuroectoderm marker (Zhang et al., 2010)). During the first three days of differentiation only a few sparse patches of PAX6 or TFAP2A expressing cells were observed without evidence of co-expression (
[0424] These results indicate that endogenous signals contribute to the transition from an anterior PAX6+ pre-placode to a posterior PAX3+ placode lineage. The small number of TFAP2A cells in day 11 N-SB cultures (
[0425] H. Treatment with FGF-Inhibitor SU5402 at Pre-Placode Stage Induces Lens Fates
[0426] Putative pre-placode cells were tested as to whether they can be differentiated into specific placode fates other then trigeminal neurons. The spontaneous appearance of lens precursors (lentoid bodies) from primate and hESCs has been previously reported (Ooto et al., 2003; Zhang et al., 2010), although the lineage origin and inducing signals remained unexplored in those studies.
[0427] The impact of four developmental signaling pathways on lens placode specification was tested by using activators and inhibitors of BMP, FGF, WNT, and Hedgehog signaling. To quantify the induction of lens placode fate, the lens precursor marker PITX3 expression was monitored at day 16 of differentiation (
[0428] I. Treatment with SHH at Pre-Placode Stage Induces Anterior Pituitary Cells
[0429] The data presented herein show that pre-placodal cells can be differentiated into anterior pituitary placode and recreate the various pituitary precursors and hormone producing cell types (
[0430] Endocrine cells of the anterior pituitary gland are derived from three main precursors lineages (Scully and Rosenfeld, 2002). Following PIP+SHH treatment, a robust induction of TBX19 was observed (
[0431] Immunocytochemistry for pituitary hormones showed expression of CGA by 16 days while protein expression of FSH, ACTH and GH was first observed by day 25-30 of differentiation (
[0432] Furthermore, these hESC-derived pituitary cells are capable of in vivo survival and function in mouse and rat xenograft models (
[0433] Longer-term survival studies in nude male rats (n=8; 4-6 weeks post grafting) showed significant increases in serum ACTH levels (
[0434] Transplantation into rat hosts allowed for repeated blood draws and showed a consistent increase of ACTH and GH levels in grafted as compared to sham injected (matrigel-only) animals. Finally, histological analysis demonstrated an average 0.460.015 million surviving hNCAM+ cells (
[0435] The ability to derive functional hormone producing pituitary cells from hESCs via modified PIP conditions is particularly intriguing given previous work in mouse ESCs suggesting the need for complex co-culture systems to induce pituitary lineages (Suga et al., 2011). In vivo survival and production of graft-derived ACTH and GH suggest translational potential for patients suffering from genetic, surgical or radiation induced hypopituitarism (Tabar, 2011).
[0436] ACTH producing in vitro pituitary cells derived from pituitary placode cells could be used to generate ACTH in vitro. ACTH is very important for treating the infantile spasms. Furthermore, one commercially available composition (Acthar Gel) is a long lasting animal product used to treat infantile spasms. Acthar Gel has an disadvantage in that it is currently an extremely expensive pharmaceutical product. Prices per vial have been as high as $36,000. Growth hormone could be also used for metabolic disorders such as growth hormone insufficiency.
VII. Induction of Placode Cells from Non-placode Cells
[0437] In certain embodiments, the present invention provides for compositions, kits and methods for inducing placode precursor cells from non-placode cells, such as, for example, embryonic stem cells (ESCs) including human embryonic stem cells (hESCs), or induced pluripotent stem cells (iPSCs), including human iPSCs. In certain embodiments, the placode precursor cells are induced by culturing the non-placode cells with an inhibitor of SMAD, as described herein. In certain embodiments, the SMAD inhibitor is an ALK inhibitor. In certain embodiments, the ALK inhibitor inhibits the Lefty/Activin/TGFbeta pathways by blocking phosphorylation of the ALK4, ALK5 and/or ALK7 receptors. In certain embodiments, the SMAD inhibitor is SB431542. In certain embodiments, the compositions, kits and methods further include a BMP active agent, for example, BMP4. In certain embodiments, the non-placode cells are cultured in media comprising the SMAD inhibitor and the BMP active agent, wherein the BMP active agent is withdrawn from the media after 1, or 2, or 3, or 4, or 5, or 6, or 7, or 8, or 9, or 10 days of culture. In certain embodiments, the BMP active agent is withdrawn from the media after 3 days of culture. In certain embodiments, the BMP active agent is present in the culture media at a concentration of between about 0.5 and about 20 ng/mL, or between about 1 and about 15 ng/ml, or between about 2 and about 10 ng/ml, or between about 3 and about 5 ng/ml. In certain embodiments the BMP active agent is present in the culture media at a concentration of about 5 ng/ml.
[0438] In certain embodiments, culturing the non-placode cells according to the methods described herein induces differentiation of cells expressing detectable levels of SIX1 and PAX6. In certain embodiments the cells also express a detectable level of TFAP2A. In certain embodiments, the cells expressing detectable levels of SIX1 and PAX6 are placode precursor cells.
[0439] In certain embodiments, culturing the non-placode cells according to the methods described herein induces cells expressing detectable levels of SIX1 and PAX3. In certain embodiments, the cells expressing detectable levels of SIX1 and PAX3 are trigeminal placode cells. in certain embodiments, the cells expressing detectable levels of SIX1 and PAX3 are induced by culturing cells expressing detectable levels of SIX1 and PAX6 (for example, placode precursor cells) with a trigeminal placode inducing agent such as brain-derived neurotrophic factor (BDNF) and/or a Wnt. In certain embodiments, the BDNF and Wnt are human BDNF and Wnt. In certain embodiments, the trigeminal placode inducing agents are added to the culture media at day 3, or day 4, or day 5, or day 6, or day 7, or day 8, or day 9, or day 10 of the placode inducing cell culture protocol described herein.
[0440] In certain embodiments, the induced cells expressing SIX1 and PAX3 also express detectable levels of GD2. In certain embodiments, the cells expressing SIX1, PAX3 and GD2 are trigeminal placode cells. In certain embodiments, the present invention provides for methods of isolating or sorting cells expressing detectable levels of GD2 from a mixture of cells not expressing detectable levels of GD2. In certain embodiments, said methods include FACS sorting or any other cell sorting method known in the art.
[0441] In certain embodiments, the induced cells expressing SIX1 and PAX3 also express detectable levels of CD57 (HNK1). In certain embodiments, the cells expressing SIX1, PAX3 and CD57 (HNK1) are trigeminal placode cells. In certain embodiments, the present invention provides for methods of isolating or sorting cells expressing detectable levels of CD57 (HNK1) from a mixture of cells not expressing detectable levels of CD57 (HNK1). In certain embodiments, said methods include FACS sorting or any other cell sorting method known in the art.
[0442] In certain embodiments, culturing the non-placode cells according to the methods described herein induces cells expressing detectable levels of SIX1 and PITX3. In certain embodiments, the cells expressing detectable levels of SIX1 and PITX3 are lens placode cells. In certain embodiments, the cells expressing detectable levels of SIX1 and PITX3 are induced by culturing cells expressing detectable levels of SIX1 and PAX6 (for example, placode precursor cells) with a lens placode inducing agent such as sonic hedgehog (SHH), purmorphamine, a -secretase inhibitor and/or an FGF inhibitor. In certain embodiments, the SHH is human SHH. In certain embodiments, the lens placode inducing agents are added to the culture media at day 3, or day 4, or day 5, or day 6, or day 7, or day 8, or day 9, or day 10 of the placode inducing cell culture protocol described herein.
[0443] In certain embodiments, culturing the non-placode cells according to the methods described herein induces cells expressing detectable levels of SIX1 and PITX1. In certain embodiments, the cells expressing detectable levels of SIX1 and PITX1 are pituitary placode cells. In certain embodiments, the cells expressing detectable levels of SIX1 and PITX1 are induced by culturing cells expressing detectable levels of SIX1 and PAX6 (for example, placode precursor cells) with a pituitary patterning factor, for example, sonic hedgehog (SHH), purmorphamine, a -secretase inhibitor, FGF8, FGF10, BMP2, and/or hypothalamus CM. In certain embodiments, the SHH, FGF8, FGF10, BMP2 and hypothalamus CM are human SHH, FGF8, FGF10, BMP2, and hypothalamus CM. In certain embodiments, the pituitary patterning factors are added to the culture media at day 3, or day 4, or day 5, or day 6, or day 7, or day 8, or day 9, or day 10 of the placode inducing culture protocol described herein. In certain embodiments, the pituitary placodes cultured under the conditions described herein further differentiate into pituitary hormone expressing cells.
[0444] In certain embodiments, the present invention provides for methods of grafting pituitary placode cells and/or pituitary hormone expressing cells induced according to the methods described herein into a subject in need thereof, for example, in a subject diagnosed or at risk for hypopituitarism. In certain embodiments, the cells are grafted into the brain or pituitary gland of the subject.
[0445] In certain embodiments, the invention provides for cells prepared according to the methods described herein.
[0446] In certain embodiments, detectable levels of proteins means that the proteins are detectable by immunocytochemical techniques known in the art.
[0447] In certain embodiments, an induced pluripotent stem cell refers to a pluripotent stem cell that is generated from a non-pluripotent cell, such as from an adult cell, for example, and adult somatic cell, or from any other differentiated or mature cell.
[0448] In certain embodiments, the cells prepared according to the methods described herein, and administered or grafted to a recipient subject for therapeutic purposes, as described herein, are heterologous, autologous, allogenic, xenogeneic, or syngeneic to the recipient of the cells.
VIII. Screen for Placode Inducing Agents
[0449] In certain embodiments, the present invention provides for methods of screening for compounds that enhance the induction of placode and placode precursor cells induced from non-placode cells cultured according to the methods described herein.
[0450] In certain embodiments the screening method comprises culturing non-placode cells according to the methods described herein, wherein a test compound is added to the culture media at day 1, or day 2, or day 3, or day 4, or day 5, or day 6, or day 7. In certain embodiments, the test compound is added to the culture media at day 3. In certain embodiments, the screening method comprises determining the level of detectable expression of placode precursor markers, such as SIX1 and/or PAX6 and/or TFAP2A, in cells cultured with the test compound and comparing said levels to the level of expression of the same markers in cells cultured in media without the test compound, wherein an increase in the level of marker expression in the cells cultured with the test compound indicates that the test compound enhances placode precursor induction.
[0451] In certain embodiments, the present invention provides for compounds that enhance placode precursor induction as described herein. In certain embodiments, the compound is BRL-54443, or a salt thereof, such as BRL-54443 maleate.
[0452] In certain embodiments, the compound is parthenolide.
[0453] In certain embodiments, the compound is phenantroline.
[0454] In certain embodiments, the invention provides for methods of enhancing the induction of placode precursor cells, wherein non-placode cells are cultured according to the methods described herein, and wherein the cell culture media is supplemented with a compound that enhances placode precursor induction at a concentration of between about 0.001 and about 20 mM, or between about 0.01 and about 15 mm, or between about 0.1 and about 10 mM, or between about 1 and about 10 mM, or between about 2 and 5 mM.
REFERENCES
Reference List 1
[0455] The following references are herein incorporated in their entirety. Barberi, et al., (2003). Nat Biotechnol. 10:1200-1207; Bouwmeester, et al., (1996). Nature 382:595-601; Briscoe, J., and Ericson, J. (1999). Semin Cell Dev Biol. 3:353-62; Chambers, et al., (2009). Nat Biotechnol 27, 275-280; Charrier, et al., (2002). Development 129:4785-4796; Charron, et al., (2003). Cell 113:11-23; D'Amour, et al., (2005). Nat Biotechnol 23, 1534-1541; Dennis, et al., (2003). DAVID: Database for Annotation, Visualization, and Integrated Discovery. Genome Biol 4, P3; Eiraku, et al., (2008). Cell Stem Cell 3, 519-53; Elkabetz, et al., (2008). Genes Dev 22:152-165; Ericson, et al., (1996). Cell 87, 661-673; Fasano, et al., (2007). Cell Stem Cell 1, 87-99; Fasano, et al., (2009). Genes Dev 23, 561-574; Glinka, et al., (1998). Nature 391, 357-362; Haung, et al., (2009). Nat Protoc 4, 44-57; Hunter, et al., (1991). Proc Natl Acad Sci USA 88, 3666-3670; Ivanova, et al., (2006). Nature 442, 533-538; Jeong, et al., (2003). Development 130, 3891-3902; Jeong, et al., (2005). Development. 133, 7761-7772; Jeong, et al., (2008) Nat Genet 40, 1348-1353; Jessell, (2000). Nat Rev Genet 1, 20-29; Jessell, et al., (1989). Ciba Found Symp 144, 255-276; discussion 276-280, 290-255; Joksimovic, et al., (2009). Nat Neurosci 12, 125-131; Kimura-Yoshida, et al., (2006). PNAS 104, 5919-59249; Kittappa, et al., (2007). PLoS Biol 5, e325; Li, et al., (2008). Stem Cells 4, 886-89399; Lois, et al., (2002). Science 295, 868-872; Lyuksyutova, et al., (2003). Science 302, 1903-1904; Matise, et al., (1998). Development 125, 2759-2770; Mizuseki, et al., (2003). Proc Natl Acad Sci USA 100, 5828-5833; Mukhopadhyay, et al., (2001). Dev Cell 3, 423-434; Mullor, et al., (2002). Trends Cell Biol 12, 562-569; Ono, et al., (2007). Development 134, 3213-3225; Perrier, et al., (2004). Proc Natl Acad Sci USA 101, 12543-12548; Placzek, et al., (1993). Development 117, 205-218; Placzek, M. (1995). Curr Opin Genet Dev 5, 499-506; Placzek, et al., (2003). Development 130, 4809-4821; Placzek, et al., (2005). Nat Rev Neurosci 6, 230-240; Roelink, et al., (1994). Cell 76, 761-775; Shen, et al., (2006). Nat Neurosci 9, 743-751; Shirasaki, et al., (1995). Neuron 14, 961-972; Suter, et al., Stem Cells, 27(1):49-58 (2009); Venezia, et al., (2003). PLoS Biol 10, e301; Watanabe, et al., (2005). Nat Neuro 3, 288-296; Weinstein, et al., (1999). Annu Rev Cell Dev Biol 15, 411-433; Wichterle, et al., (2002). Cell 110, 385-397; Zhang, et al., Nature Biotechnology 19, 1129-1133 (2001); and Zoltewicz, et al., (1999). Development 126, 5085-5095.
Reference List 2
[0456] Abdelhak, S., Kalatzis, V., Heilig, R., Compain, S., Samson, D., Vincent, C., Weil, D., Cruaud, C., Sahly, I., Leibovici, M., et al. (1997). A human homologue of the Drosophila eyes absent gene underlies branchio-oto-renal (BOR) syndrome and identifies a novel gene family. Nature genetics 15, 157-164. [0457] Ahrens, K., and Schlosser, G. (2005). Tissues and signals involved in the induction of placodal Six1 expression in Xenopus laevis. Developmental biology 288, 40-59. [0458] Arkell, R., and Beddington, R. S. (1997). BMP-7 influences pattern and growth of the developing hindbrain of mouse embryos. Development 124, 1-12. [0459] Bailey, A. P., Bhattacharyya, S., Bronner-Fraser, M., and Streit, A. (2006). Lens specification is the ground state of all sensory placodes, from which FGF promotes olfactory identity. Dev Cell 11, 505-517. [0460] Baker, C. V., and Bronner-Fraser, M. (2001). Vertebrate cranial placodes I. Embryonic induction. Dev Biol 232, 1-61. [0461] Balmer, C. W., and LaMantia, A. S. (2005). Noses and neurons: induction, morphogenesis, and neuronal differentiation in the peripheral olfactory pathway. Developmental dynamics: an official publication of the American Association of Anatomists 234, 464-481. [0462] Barnett, E. M., Jacobsen, G., Evans, G., Cassell, M., and Perlman, S. (1994). Herpes simplex encephalitis in the temporal cortex and limbic system after trigeminal nerve inoculation. J Infect Dis 169, 782-786. [0463] Bernardo, A. S., Faial, T., Gardner, L., Niakan, K. K., Ortmann, D., Senner, C. E., Callery, E. M., Trotter, M. W., Hemberger, M., Smith, J. C., et al. (2011). BRACHYURY and CDX2 mediate BMP-induced differentiation of human and mouse pluripotent stem cells into embryonic and extraembryonic lineages. Cell Stem Cell 9, 144-155. [0464] Bhattacharyya, S., and Bronner-Fraser, M. (2004). Hierarchy of regulatory events in sensory placode development. Curr Opin Genet Dev 14, 520-526. [0465] Chambers, S. M., Fasano, C. A., Papapetrou, E. P., Tomishima, M., Sadelain, M., and Studer, L. (2009). Highly efficient neural conversion of human ES and iPS cells by dual inhibition of SMAD signaling. Nat Biotechnol 27, 275-280. [0466] Chambers, S. M., Qi, Y., Mica, Y., Lee, G., Zhang, X. J., Niu, L., Bilsland, J., Cao, L., Stevens, E., Whiting, P., et al. (2012). Combined small-molecule inhibition accelerates developmental timing and converts human pluripotent stem cells into nociceptors. Nat Biotechnol 30, 715-720. [0467] Chen, W., Jongkamonwiwat, N., Abbas, L., Eshtan, S. J., Johnson, S. L., Kuhn, S., Milo, M., Thurlow, J. K., Andrews, P. W., Marcotti, W., et al. (2012). Restoration of auditory evoked responses by human EScell-derived otic progenitors. Nature 490, 278-282. [0468] Colas, J. F., and Schoenwolf, G. C. (2003). Localization of cartilage linking protein 1 during primary neurulation in the chick embryo. Brain Res Dev Brain Res 141, 141-148. [0469] Dennis, G., Sherman, B. T., Hosack, D. A., Yang, J., Gao, W., Lane, H. C., and Lempicki, R. A. (2003). DAVID: Database for Annotation, Visualization, and Integrated Discovery. Genome Biology 2003 4:P3 4, P3. [0470] Elkabetz, Y., Panagiotakos, G., Al Shamy, G., Socci, N. D., Tabar, V., and Studer, L. (2008). Human ES cell-derived neural rosettes reveal a functionally distinct early neural stem cell stage. Genes Dev 22, 152-165. [0471] Grigaliunas, A., Bradley, R. M., MacCallum, D. K., and Mistretta, C. M. (2002). Distinctive neurophysiological properties of embryonic trigeminal and geniculate neurons in culture. Journal of Neurophysiology 88, 2058-2074. [0472] Grotewold, L., Plum, M., Dildrop, R., Peters, T., and RUther, U. (2001). Bambi is coexpressed with Bmp-4 during mouse embryogenesis. Mech Dev 100, 327-330. [0473] Hunter, C. S., and Rhodes, S. J. (2005). LIM-homeodomain genes in mammalian development andhuman disease. Mol Biol Rep 32, 67-77. [0474] Ishihara, T., Sato, S., Ikeda, K., Yajima, H., and Kawakami, K. (2008). Multiple evolutionarily conservedenhancers control expression of Eya1. Dev Dyn 237, 3142-3156. [0475] Koehler, K. R., Mikosz, A. M., Molosh, A. I., Patel, D., and Hashino, E. (2013). Generation of inner ear sensory epithelia from pluripotent stem cells in 3D culture. Nature doi: 10.1038/nature12298. [0476] Kudoh, T., Concha, M. L., Houart, C., Dawid, I. B., and Wilson, S. W. (2004). Combinatorial Fgf andBmp signalling patterns the gastrula ectoderm into prospective neural and epidermal domains. Development 131, 3581-3592. [0477] Kwon, H. J., Bhat, N., Sweet, E. M., Cornell, R. A., and Riley, B. B. (2010). Identification of early requirements for preplacodal ectoderm and sensory organ development. PLoS Genet 6, e1001133. [0478] Lafaille, F. G., Pessach, I. M., Zhang, S.-Y., Ciancanelli, M. J., Herman, M., Abhyankar, A., Ying, S.-Y., Keros, S., Goldstein, P. A., Mostoslavsky, G., et al. (2012). Impaired intrinsic immunity to HSV-1 in human iPSC-derived TLR3-deficient CNS cells. Nature 491, 769-773. [0479] Lee, G., Kim, H., Elkabetz, Y., Al Shamy, G., Panagiotakos, G., Barberi, T., Tabar, V., and Studer, L. (2007). Isolation and directed differentiation of neural crest stem cells derived from human embryonic stem cells. Nat Biotechnol 25, 1468-1475. [0480] Leung, A. W., Kent Morest, D., and Li, J. Y. (2013). Differential BMP signaling controls formation and differentiation of multipotent preplacodal ectoderm progenitors from human embryonic stem cells. Dev Biol 379, 208-220. [0481] Litsiou, A., Hanson, S., and Streit, A. (2005). A balance of FGF, BMP and WNT signalling positions the future placode territory in the head. Development 132, 4051-4062. [0482] Love, S., and Coakham, H. B. (2001). Trigeminal neuralgia: pathology and pathogenesis. Brain 124, 2347-2360. [0483] Mackay, D. R., Hu, M., Li, B., Rhaume, C., and Dai, X. (2006). The mouse Ovol2 gene is required for cranial neural tube development. Dev Biol 291, 38-52. [0484] Martin, K., and Groves, A. K. (2006). Competence of cranial ectoderm to respond to Fgf signaling suggests a two-step model of otic placode induction. Development 133, 877-887. [0485] McCabe, K. L., Manzo, A., Gammill, L. S., and Bronner-Fraser, M. (2004). Discovery of genes implicated in placode formation. Dev Biol 274, 462-477. [0486] McCauley, D. W., and Bronner-Fraser, M. (2002). Conservation of Pax gene expression in ectodermal mplacodes of the lamprey. Gene 287, 129-139. [0487] Menendez, L., Yatskievych, T. A., Antin, P. B., and Dalton, S. (2011). Wnt signaling and a Smad pathway blockade direct the differentiation of human pluripotent stem cells to multipotent neural crest cells. Proceedings of the National Academy of Sciences of the United States of America 108, 19240-19245. [0488] Mengarelli, I., and Barberi, T. (2013). Derivation of multiple cranial tissues and isolation of lens epithelium-like cells from human embryonic stem cells. Stem Cells Transl Med 2, 94-106. [0489] Metcalfe, W. K., Myers, P. Z., Trevarrow, B., Bass, M. B., and Kimmel, C. B. (1990). Primary neurons that express the L2/HNK-1 carbohydrate during early development in the zebrafish. Development 110, 491-504. [0490] Mica, Y., Lee, G., Chambers, S. M., Tomishima, M. J., and Studer, L. (2013). Modeling neural crest induction, melanocyte specification, and disease-related pigmentation defects in hESCs and patient specific iPSCs. Cell Rep 3, 1140-1152. [0491] O'Rahilly, R. M., F. (1987). Developmental stages in human embryos, Vol 637, (Washington, D.C.: Carnegie Institution of Washington). [0492] Ooto, S., Haruta, M., Honda, Y., Kawasaki, H., Sasai, Y., and Takahashi, M. (2003). Induction of the differentiation of lentoids from primate embryonic stem cells. Invest Ophthalmol Vis Sci 44, 2689-2693. [0493] Oshima, K., Shin, K., Diensthuber, M., Peng, A. W., Ricci, A. J., and Heller, S. (2010). Mechanosensitive hair cell-like cells from embryonic and induced pluripotent stem cells. Cell 141, 704-716. [0494] Pieper, M., Ahrens, K., Rink, E., Peter, A., and Schlosser, G. (2012). Differential distribution of competence for panplacodal and neural crest induction to non-neural and neural ectoderm. Development 139, 1175-1187. [0495] Reubinoff, B. E., Itsykson, P., Turetsky, T., Pera, M. F., Reinhartz, E., Itzik, A., and Ben-Hur, T. (2001). Neural progenitors from human embryonic stem cells. Nature biotechnology 19, 1134-1140. [0496] Ruf, R. G., Xu, P. X., Silvius, D., Otto, E. A., Beekmann, F., Muerb, U. T., Kumar, S., Neuhaus, T. J., Kemper, M. J., Raymond, R. M., Jr., et al. (2004). SIX1 mutations cause branchio-oto-renal syndrome by disruption of EYA1-SIX1-DNA complexes. Proceedings of the National Academy of Sciences of the United States of America 101, 8090-8095. [0497] Sasaki, H., and Hogan, B. L. (1993). Differential expression of multiple fork head related genes during gastrulation and axial pattern formation in the mouse embryo. Development 118, 47-59. [0498] Schlosser, G. (2006). Induction and specification of cranial placodes. Dev Biol 294, 303-351. Scully, K. M., and Rosenfeld, M. G. (2002). Pituitary development: regulatory codes in mammalian organogenesis. Science 295, 2231-2235. [0499] Shi, F., Corrales, C. E., Liberman, M. C., and Edge, A. S. (2007). BMP4 induction of sensory neurons from human embryonic stem cells and reinnervation of sensory epithelium. Eur J Neurosci 26, 3016-3023. [0500] Sjdal, M., Edlund, T., and Gunhaga, L. (2007). Time of exposure to BMP signals plays a key role in the specification of the olfactory and lens placodes ex vivo. Dev Cell 13, 141-149. [0501] Stark, M. R., Sechrist, J., Bronner-Fraser, M., and Marcelle, C. (1997). Neural tube-ectoderm interactions are required for trigeminal placode formation. Development 124, 4287-4295. [0502] Suga, H., Kadoshima, T., Minaguchi, M., Ohgushi, M., Soen, M., Nakano, T., Takata, N., Wataya, T., Muguruma, K., Miyoshi, H., et al. (2011). Self-formation of functional adenohypophysis in three-dimensional culture. Nature 480, 57-62. [0503] Tabar, V. (2011). Making a pituitary gland in a dish. Cell Stem Cell 9, 490-491. [0504] Tremblay, J. J., Lanctot, C., and Drouin, J. (1998). The pan-pituitary activator of transcription, Ptx1 (pituitary homeobox 1), acts in synergy with SF-1 and Pit1 and is an upstream regulator of the Limhomeodomain gene Lim3/Lhx3. Mol Endocrinol 12, 428-441. [0505] Wilson, P. A., Lagna, G., Suzuki, A., and Hemmati-Brivanlou, A. (1997). Concentration-dependent patterning of the Xenopus ectoderm by BMP4 and its signal transducer Smad1. Development 124, 3177-3184. [0506] Xu, R. H., Chen, X., Li, D. S., Li, R., Addicks, G. C., Glennon, C., Zwaka, T. P., and Thomson, J. A. (2002). BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol 20, 1261-1264. [0507] Zhang, S. C., Wernig, M., Duncan, I. D., Brustle, O., and Thomson, J. A. (2001). In vitro differentiation of transplantable neural precursors from human embryonic stem cells. Nat Biotechnol 19, 1129-1133. [0508] Zhang, X., Huang, C. T., Chen, J., Pankratz, M. T., Xi, J., Li, J., Yang, Y., Lavaute, T. M., Li, X., Ayala, M., et al. (2010). Pax6 is a human neuroectoderm cell fate determinant. Cell Stem Cell 7, 90-100.
Reference List 3
[0509] Amit, M., and Itskovitz-Eldor, J. (2002). Derivation and spontaneous differentiation of human embryonic stem cells. Journal of Anatomy 200, 225-232. [0510] Chambers, S. M., Fasano, C. A., Papapetrou, E. P., Tomishima, M., Sadelain, M., and Studer, L. (2009). Highly efficient neural conversion of human ES and iPS cells by dual inhibition of SMAD signaling. Nat Biotechnol 27, 275-280. [0511] Chen, G., Gulbranson, D. R., Hou, Z., Bolin, J. M., Ruotti, V., Probasco, M. D., Smuga-Otto, K., Howden, S. E., Diol, N. R., Propson, N. E., et al. (2011). Chemically defined conditions for human iPSC derivation and culture. Nat Methods 8, 424-429. [0512] Dennis, G., Sherman, B. T., Hosack, D. A., Yang, J., Gao, W., Lane, H. C., and Lempicki, R. A. (2003). DAVID: Database for Annotation, Visualization, and Integrated Discovery. Genome Biology 2003 4:P3 4, P3. [0513] Downey, T. (2006). Analysis of a multifactor microarray study using Partek genomics solution. Methods Enzymol 411, 256-270. [0514] Huang, D. W., Sherman, B. T., and Lempicki, R. A. (2009). Systematic and integrative analysis of large gene lists using DAVID bioinformatics resources. Nature Protocols 4, 44-57. [0515] O'Rahilly, R. M., F. (1987). Developmental stages in human embryos, Vol 637, (Washington, D.C.: Carnegie Institution of Washington).
EXPERIMENTAL
[0516] The following examples serve to illustrate certain embodiments and aspects of the present invention and are not to be construed as limiting the scope thereof. In the experimental disclosures which follow, the following abbreviations apply: N (normal); M (molar); mM (millimolar); M (micromolar); mol (moles); mmol (millimoles); mol (micromoles); nmol (nanomoles); pmol (picomoles); g (grams); mg (milligrams); g (micrograms); ng (nanograms); pg (picograms); L and (liters); ml (milliliters); l (microliters); cm (centimeters); mm (millimeters); m (micrometers); nm (nanometers); U (units); min (minute); s and sec (second); deg (degree); and C. (degrees Centigrade/Celsius).
[0517] The following are general cell culture formulations:
hESC Medium for Maintenance (1 Liter):
[0518] 800 mL DMEM/F12, 200 mL of Knockout Serum Replacement, 5 mL of 200 mM L-Glutamine, 5 mL of Pen/Strep, 10 mL of 10 mM MEM minimum non-essential amino acids solution, 1000 L of -mercaptoethanol, bFGF (final concentration is 4 ng/mL)
KSR Medium for hESC Differentiation (1 Liter):
[0519] 820 mL of Knock out DMEM, 150 mL of Knock out Serum Replacement, 10 mL of 200 mM L-Glutamine, 10 mL of Pen/Strep, 10 mL of 10 mM MEM, 1 mL of 3-mercaptoethanol
N2 Medium for hESC Differentiation (1 Liter):
[0520] 985 ml dist. H.sub.2O with DMEM/F12 powder, 1.55 g Glucose, 2.00 g NaHCO.sub.3, 25 mg insulin, 0.1 g apotransferrin, 30 nM sodium selenite, 100 M putrescine, 20 nM progesterone
DMEM with 10% FBS for Preparing PMEF (1 Liter):
[0521] 885 mL of DMEM, 100 mL of FBS, 10 mL of Pen/Strep, 5 mL of L-Glutamine Alpha MEM with 10% FBS for preparing MS-5 feeder (1 liter): 890 mL of Alpha MEM, 100 mL of FBS, 10 mL of Pen/Strep
Gelatin Solution (500 ml):
[0522] Dissolve 0.5 g of gelatin in 500 ml of warm (50-60 C.) Milli-Q water. Cool to room temperature.
[0523] Noggin was purchased from R&D system as Catalog Number: 719-NG, Recombinant Mouse Noggin Fc Chimera.
Example I
[0524] Bone morphogenetic protein (BMP) Levels Determine Placode Fate Identity: Sensory placodes are developmental structures formed at the interface of early neuroectodermal and non-neural ectoderm tissue. To address whether the N-SB culture system is suitable for the derivation of placodal cells, a set of markers was established to identify placode identity in human embryonic stem cells (hESCs)-derived cultures. From studies in other model organisms, a number of candidate markers to identify human placodal precursor during hESC differentiation include, but are not limited to, members of the Six, Eya, and Dlx family of transcription factors. Six1 marks a pre-placodal region and placodal cells in model organisms but is also expressed in skeletal muscle precursors.
[0525] Immunocytochemical analyses revealed 6%4% Six1+ cells at day 11 of N-SB differentiation. The absence of the expression of skeletal muscle markers in Six1+ cells suggested placodal precursor cell identity.
[0526] A large number of developmental studies have demonstrated a role for BMP signaling during early ectodermal patterning in vivo. One model suggests that a gradient of BMP activity within the ectoderm allocates different cell fates, with high levels of signaling promoting epidermis, moderate levels inducing placodes, intermediate levels specifying neural crest and complete absence of BMP activity being required for neural plate formation in vivo Streit, et al., Dev Biol, 2004. 276(1): p. 1-15, herein incorporated by reference. To test whether addition of exogenous BMPs enhances the derivation of Six1+ cells, SB431542 (1 M) treated hESCs were exposed to various concentration of BMP4. However, early addition of BMP4 caused a dramatic morphological chance of the cells and induction of cdx2 suggesting differentiation towards trophoectodermal fates. The absence of SB431542 has demonstrated that early exposure to BMPs can drive trophoectodermal fates during hESC differentiation. Chambers, et al., Nat Biotechnol, 2009. 27(3): p. 275-80; Xu, et al., Nat Biotechnol, 2002. 20(12): p. 1261-4, herein incorporated by reference.
[0527] Withdrawal of the BMP inhibitor noggin during N-SB differentiation may enhance the emergence of placodal fates by de-repressing endogenous BMP signaling. To this end, a time course study was performed by removing noggin at different time points of the NSB protocol (
[0528] Microarray analysis reveals novel human placode progenitor gene expression: To obtain an unbiased measure of placode induction of placode precursor cell identity, the inventors performed a time course analysis of global gene expression using the Illumina bead array platform. RNA was collected at five time points during differentiation (Day1, 3, 5, 7, and 11) in control N-SB cultures (yielding anterior neural plate cells; noggin/SB431542 treatment for day 1-11) and under conditions promoting placodal fates (anterior placode cells; SB431542 treatment for 11 days; Noggin treatment from day 1-3). Prior to a microarray analysis the quality of each sample was verified for expression of a panel of placode markers (Six1, Dlx3, Eya1) and the absence of other lineages such as Foxa2 (endoderm), Sox17 (endoderm), MyoD (skeletal muscle), cdx2 (trophoblast), and T (Brachyury)(mesoderm). Global gene expression studies were carried out in three independent samples for each time point and culture condition. Data were converted into log 2 ratios comparing levels of gene expression in placode versus N-SB protocol during differentiation (
[0529] The time course data were subjected to gene ontology (GO) enrichment analysis using DAVID (http://david.abcc.ncifcrf.gov/; Dennis, et al., Genome Biology 2003 4:P3, 2003. 4(5): p. P3, herein incorporated by reference) as unbiased assessment of placode transcription profile. Among the transcripts highly enriched in placode conditions versus NSB control cultures at day 5 and day 7 of differentiation were genes associated with the sensory organ development, BMP and Wnt pathways, inner ear development and neural patterning. Enrichment for sensory organ development and neural patterning factors further confirm anterior placode identity of cultures derived using the modified N-SB protocol. Neural plate markers and neuronal markers were also down-regulated in the modified N-SB (noggin withdrawal after 2 days of differentiation) versus NSB (i.e. treatment of cells with at least 2 SMAD or BMP signaling compounds) protocol.
[0530] To gain insight into specific genes differentially expressed during placode specification, the inventors performed pair-wise comparisons at for each differentiation stage. While the majority of genes significantly regulated at day 5 and day 7 of differentiation (as compared to day1) were shared in NSB and modified N-SB protocol, a subset of transcripts was differentially regulated. In particular, an increase in Islet-1, a very well known marker for sensory neuron development was observed in the modified N-SB protocol. Isl1 is also expressed in other lineages such as motoneuron, heart progenitors and pancreatic islet cells. The early expression onset of expression during hESC differentiation suggests that Islet-1 marks early placode precursor cells similar to its expression during zebrafish development where it marks the horseshoe shaped at the anterior pre-placodal region. Thus, Islet-1 is one of the first placode markers expressed during differentiation of human pluripotent stem cells. The modified N-SB protocol induced highly enriched expression for Islet-1 at day 5, day 7, day 9 and day 11 when compared to NSB conditions. In microarray data, placode genes, GATA3, Dlx5, TFAP2a, and TFAP2c are enriched. Significant changes in Wnt pathway and BMP pathway components were also observed. For example, as early as Day5, there was a significant increase of the Wnt pathway inhibitor DKK-1 and this increase was sustained over the course of the protocol. A significant down-regulation of several Wnt receptors was observed in response to removal of Noggin. Induction of BMP antagonists such as gremlin-land BAMBI that are activated in response to BMP signaling confirm that noggin withdrawal causes changes in endogenous BMP signaling during hESC differentiation with a corresponding increase of downstream genes.
[0531] Furthermore, a number of additional genes were identified that were differentially expressed during anterior placode specification including Shisa2, Ovol2 and Foxc1. Differential expression for these and additional genes was verified by qRT-PCR. Ovol2 is a known marker of surface ectoderm and placodal fates in various model organisms. In mice, the Ovol2 knockout is lethal and Ovol2/ mouse embryos do not develop placode-derived tissues such as optic cup, and otic vesicle.
[0532] A gene cluster analysis showed when genes were expressed the highest; time of maximum (TOM) and the lowest; time of minimum expression (TIM). GO ontology terms were mapped into this analysis and were able to identify precise developmental windows during placode precursor cell specification. These data additionally confirmed the identity of hESC derived placodal tissue and revealed markers and pathways involved in placode versus anterior neural plate (AN) specification.
[0533] Clustering of differentially expressed transcripts (
[0534] Placode progenitors are believed give rise to sensory neurons. Isolation of Six1+ placodal precursors followed by culture under serum free conditions revealed efficient differentiation into neurons that retain Six1 expression (
[0535] Results showed that simple modifications in the N-SB protocol induce a switch in differentiation from neuroectoderm to placodal precursors. Using timed-noggin withdrawal, the inventors obtained a yield of 71% of total cells expressing Six1. The isolation of pure placodal precursors requires markers that prospectively identify placode fate. The identification of prospective markers is also useful to reliably distinguish placodal cells from other alternative lineages such as CNS precursor, neural crest lineages and non-neural ectoderm. Of particular interest is the separation of placode derived from neural crest derived precursors to reliably separate neural crest from placode derived neuronal populations. Previously, it was demonstrated that isolation of p75+/HNK1+ cells during neural early neural differentiation marks a population of cells fated towards neural crest identity (Lee et al., Nature Biotechnology, 25(12):1468-75 (2007), herein incorporated by reference). Here, a relationship of those markers within the placodal lineages was tested. It was observed that NGFR efficiently marks placodal cultures in a modified N-SB protocol (
Example II
IPS Cell Generation:
[0536] The cDNAs encoding hOct4, hSox2, hKlf4 and c-myc (purchased from Open Biosystems) were subcloned into self-inactivating lentiviral vectors driven by the human phosphoglycerate kinase (PGK) promoter. Lentiviral vector supernatants were produced by triple co-transfection of the plasmid DNA encoding the vector, pCMVAR8.91 and pUCMD.G into 293T cells. Human fetal lung fibroblasts (MRC-5) purchased from ATCC (CCL-171) were seeded at 1.510.sup.4 cells/cm.sup.2 in Eagle's Minimum Essential Medium supplemented with 10% fetal bovine serum (FBS). The following day the fibroblasts were transduced with equal amounts of supernatants of the four lentiviral vectors in the presence of 4 ug/ml polybrene for 16 hours. Six days after transduction, fibroblasts were harvested by trypsinization and plated at 210.sup.4 cells per 60 mm dish on a feeder layer of mytomycin C-treated mouse embryonic fibroblasts (CF-1). The next day, the medium was switched to hESC medium. The hiPS lines were confirmed positive for Tra-1-81, Tra-1-60, SSEA-4 and Nanog by immunoflouresence and flow cytometry. In both hips clones the 4 vector-encoded transgenes were found to be silenced.
Materials and Methods:
[0537] Cells and Culture Conditions (dual SMAD and floor plate). hESCs (WA-09; passages 35-45) were cultured on mouse embryonic fibroblasts plated at 12-15,000 cells/cm2 (MEFs, Global Stem). A medium of DMEM/F12, 20% knockout serum replacement (GIBCO), 0.1 mM b-mercaptoethanol, 6 ng/mL FGF-2 was changed daily. Cells were passaged using 6 U/mL of dispase in hESCs media, washed and re-plated at a dilution of 1:5 to 1:10.
Neural Induction (Dual SMAD).
[0538] hESC cultures were disaggregated using accutase for 20 minutes, washed using hESC media and pre-plated on gelatin for 1 hour at 37 C. in the presence of ROCK inhibitor to remove MEFs. The nonadherent hESC were washed and plated on matrigel at a density of 10,000-25,000 cells/cm.sup.2 on matrigel (BD) coated dishes in MEF conditioned hESC media (CM) spiked with 10 ng/mL of FGF-2 and ROCK-inhibitor. Ideal cell density was found to be 18,000 cells/cm.sup.2. The ROCK inhibitor was withdrawn, and hESC were allowed to expand in CM for 3 days or until they were nearly confluent. The initial differentiation media conditions included knock out serum replacement (KSR) media with 10 nM TGF-beta inhibitor (SB431542, Tocris) and 500 ng/mL of Noggin (R&D).
[0539] Upon day 5 of differentiation, the TGF-b inhibitor was withdrawn and increasing amounts of N2 media (25%, 50%, 75%) was added to the KSR media every two days while maintaining 500 ng/mL of Noggin. For MS5 induction, established methods previously reported were used..sup.18
Quantitative Real-Time (Dual SMAD).
[0540] Total RNA was extracted using an RNeasy kit (Qiagen). For each sample, 1 ug of total RNA was treated for DNA contamination and reverse transcribed using the Quantitect RT kit (Qiagen). Amplified material was detected using Quantitect SYBR green probes and PCR kit (Qiagen) on a Mastercycler RealPlex2 (Eppendorf). Results were normalized to a HPRT control and are from 4-6 technical replicates of 2-3 independent biological samples at each data point.
Neuronal Patterning and Differentiation (Dual SMAD).
[0541] Dopaminergic patterning was initiated using BDNF, ascorbic acid, sonic hedgehog, and FGF8 in N2 media as previously reported,.sup.18 and maturation was performed in the presence of BDNF, ascorbic acid, GDNF, TGFb-1, and cyclic-AMP. Motor neuron patterning was performed using BDNF, ascorbic acid, sonic hedgehog, and retinoic acid in N2 media as previously reported..sup.16
Microscopy, Antibodies, and Flow Cytometry (Dual SMAD).
[0542] Tissue was fixed using 4% paraformaldehyde for 20 minutes, washed with PBS, permeablized using 0.5% Triton X in PBS, and blocked using 1% BSA in PBS. Primary antibodies used for microscopy included PAX6 (Covance), Oct4 (Biovision), AP2 (Novus Biologicals), GBX2 (Sigma), HNK1 (Sigma), HOXB4 (Developmental Studies Hybridoma Bank (DSHB)), Nestin (R&D), NKX6.1 (DSHB), OTX2 (gift), p75 (Advanced Target Systems), PAX7 (DSHB), PLZF (Calbiochem), TUJ1 (Covance), ZO1 (Zymed), BF1 (FOXG1, gift Esseng Lai), TH (Sigma), HB9 (DSHB), ISL1 (DSHB). CD105-PE (eBioscience) was used for excluding MS5 stromal cells for flow cytometery on a FACScan (BD).
Floor Plate: Neural Induction.
[0543] For MS5 induction, established methods previously reported were used (Perrier et al., 2004). Feeder free neural induction was carried out as previously described (Chambers et al., 2009). Briefly, hESCs cultures were disaggregated using accutase for 20 minutes, washed using hESCs media and pre-plated on gelatin for 1 hour at 37 C. in the presence of ROCK inhibitor to remove MEFs. The nonadherent hESCs were washed and plated on matrigel at a density of 20,000 cells/cm2 on matrigel (BD) coated dishes in MEF conditioned hESCs media (CM) spiked with 10 ng/mL of FGF-2 and ROCK-inhibitor. The ROCK inhibitor was withdrawn, and hESCs were allowed to expand in CM for 3 days or until they were nearly confluent. The initial differentiation media conditions included knock out serum replacement (KSR) media with 10 nM TGF-b inhibitor (SB431542, Tocris) and 500 ng/mL of Noggin (R&D). Upon day 5 of differentiation, increasing amounts of N2 media (25%, 50%, 75%) was added to the KSR media every two days while maintaining 500 ng/mL of Noggin and TGF-b inhibitor. For FP induction, Sonic C25II was added at 200 ng/ml. In some experiments, DKK-1 (R&D 100 ng/ml) FGF8 (R&D 50 ng/ml), Wnt-1 (Peprotech 50 ng/ml) and Retinoic Acid (R&D 1 uM) were added.
Quantitative Real-Time PCR.
[0544] Total RNA was extracted using an RNeasy kit (Qiagen). For each sample, 1 ug of total RNA was treated for DNA contamination and reverse transcribed using the Superscript III (Invitrogen). Amplified material was detected using Taqman probes and PCR mix (ABI) on a Mastercycler RealPlex2 (Eppendorf). All results were normalized to a HPRT control and are from 3 technical replicates of 3 independent biological samples at each data point.
Microarray Analysis.
[0545] Total RNA was isolated at Days 2, 3, 5, 7, and 11 of differentiation from both control (NSB) and FP (NSB+Shh C25II) using Trizol (Invitrogen). Three biological replicates per time point were used. All samples were processed by the MSKCC Genomics Core Facility and hybridized on Illumina human 6 oligonucleotide arrays. Normalization and model-based expression measurements were performed with using the Illumina analysis package (LUMI) available through open-source Bioconductor project(www.bioconductor.org) with in the statistical programming language R (http://cran.r-project.org/). A pairwise comparison between NSB and
[0546] NSB+Sonic was performed using the Linear Models for Microarray Data package (LIMMA) available through Bioconductor. Genes found to have an adjusted p-value <0.05 and a fold change greater than 2 were considered significant. Expression differences are reported as the log 2 of the fold change. Gene Ontology enrichment was determined by entering gene lists into the Database for Annotation, Visualization, and Integrated Discovery (DAVID; http://www.david.niaid.nih.gov) (Huang et al., 2009 and Dennis et al., 2003). Timing of maximal and minimal expression was calculated as previously reported (Venezia et al., 2004).
[0547] Briefly, a regression line was fit to both the NSB+Sonic C25II and NSB conditions. From these trend lines, genes were categorized based on at which time point its maximal and minimal expression occurred.
Microscopy, Antibodies, and Flow Cytometery.
[0548] Tissue was fixed using 4% paraformaldehyde and Picric acid for 15 minutes, washed with PBS, permeabalized using 0.3% Triton X in PBS, and blocked using 10% Donkey Serum. Primary antibodies used for microscopy included PAX6 (Covance), TUJ1 (Covance), ZO1 (Zymed), BF1 (FOXG1, gift E.Lai), TH (Pelfreez), NKX6.1 (DSHB) and FOXA2 (SantaCruz).
Vector Design and Lentiviral Production.
[0549] A third generation lentiviral vector (Lois et al., 2002) was modified to express a BF1 ORF from the Ub-C promoter (Fasano et al., 2009) and a BF1 shRNA from the H1 promoter as described (Fasano et al., 2007; Ivanova et al., 2006). Foxg1 shRNA constructs were used as previously described (Shen et al., 2006). The shRNA expressing lentiviral plasmid was co-transfected with plasmids pVSV-G and pCMVd8.9 into 293FT cells. Viral containing media were collected, filtered, and concentrated by ultracentrifugation. Viral titers were measured by serial dilution on NIH 3T3 cells followed by flow cytometric analysis after 72 hours.
Generation of BF1 shRNA and Over-Expressing Human ES Lines.
[0550] hESCs (WA-09; passages 35) were dissociated and plated on Matrigel with the ROCK inhibitor as singles cells. 24 hrs post plating the ES cells were transduced with either control (empty vector), BF1 shRNA, or BF-1 ORF containing vectors. 1 week later, GFP expressing colonies were manually picked and plated on MEFs. Cells were then expanded, tested for mycoplasma, and a normal karyotype.
Dissection of Primary Explants.
[0551] E8.5, TP Taconic Swiss Webster females were dissected and embryos were removed. Neurectodermal tissues were dissected and left as chunks plated on top of FP cells. For neurite growth assay E12.5 Sprague-Dawley rat cerebellar plate tissue was dissected and plated on top of hESC derived FP cells or control neuroectodermal cells (NSB protocol). Outgrowth from rat explants tissue was analyzed at day 3 of co-culture.
Conditioned Media and ELISA.
[0552] hESCs were differentiated to neural or FP cells, Shh was removed a day 6, and the media was harvested at both day 9 and day 11 of cultures. Using a human Netrin-1 ELISA kit (Axxora) according to the manufactures protocol, Netrin-1 protein levels were detected. For co-culture experiments, the media was filtered and added to cultures straight or a 1:2 dilution in fresh media.
Statistical Analysis.
[0553] Results shown are mean+s.e.m. Asterisks and pound signs identify experimental groups that were significantly different from control groups by a t-test, one way ANOVA, or two way ANOVA with a Bonferroni correction for multiple comparisons (p-value, 0.05), where applicable.
Example III
Early High-Dose SHH Exposure Induces FOXA2 and Represses BF1.
[0554] hESC derived neural cells at the rosette stage were differentiated into both CNS and PNS progeny and patterned towards multiple cells fates along the A/P and D/V axis (Elkabetz et al., 2008). These results demonstrated that rosette stage cells were highly plastic and responsive to patterning cues including SHH. Specification of progenitor cells into FP tissue and cells during mouse development was thought to depend on SHH signaling within early neural lineages. The inventors tested whether rosette-stage neural cells were competent to undergo FP specification in response to SHH. High concentrations of SHH were needed to induce FP during mouse development (Roelink et al., 1994; Ericson et al., 1996). Recombinant N-terminal SHH has a limited activity range due to the lack of posttranslational modifications required for full SHH action. Recently, a modified version of recombinant SHH became available where SHH was tethered to two Isoleucines (Sonic C25II, R&D Systems), mimicking more closely the potency of mammalian SHH protein. In most functional assays C25II was 10 times more potent than non-modified N-terminal SHH.
[0555] However, dose-response studies done during the development of the present inventions with both conventional SHH and SHH-C25II on established rosette-stage neural cells did not yield cells expressing FP markers such as FOXA2 (FP marker) under any of the conditions tested. The majority of cells retained rosette cytoarchitecture and staining for the AN marker BF1 as described previously (
[0556] Based on the hypothesis that FP specification in the mouse occurs at early developmental stages, at the time of or prior to neural induction, the inventors repeated SHH induction studies at Day 9, the time of rosette specification, using classic stromal-feeder mediated neural induction protocols (Elkabetz et al., 2008). Under this paradigm the inventors noticed a drastic change in cell morphology restricted to the cells treated with SHH-C25II (
Example IV
The Competency for FP Induction is Restricted to a Narrow Window of Differentiation.
[0557] While a robust (strong observed signal, such as staining) upregulation of FOXA2 was induced with the initial procedures, merely around 30% of the cells were positive after about 21 days of culture using classic stromal-feeder mediated neural induction. Therefore the inventors tested several types of culture compositions and methods for increasing the total number of cultured cells expressing FOXA2.
[0558] Recently the inventors developed and described a rapid and defined neural induction paradigm yielding significantly higher numbers of neural cells based on inhibiting SMAD signaling via exposure to noggin and SB431542 (NSB protocol; (Chambers et al., 2009)). Using this protocol, in combination with compositions and methods of the present inventions, the inventors aimed to optimize FP differentiation by adding Sonic C25II at different time points during neural induction and assaying for FOXA2 expression. Differentiation was initiated upon NSB exposure, and Sonic C25II was added at Day 1, Day 3, Day 5, or Day 7 (
[0559] FOXA2 is a key marker of FP development. However, FOXA2 is also highly expressed in the endoderm. To further characterize the hESC derived putative FP tissue, the inventors performed qRT-PCR analyses for candidate markers at Day 11. Using the NSB protocol as a control, the inventors confirmed a dramatic increase in the expression of FOXA2 and other FP markers including SHH, F-Spondin, and Netrin-1 (
Example V
[0560] hESCs Derived FP Cells are Functional
[0561] The FP has important functional roles during development in neural patterning and axonal path finding (Jessell, 2000). To assess the functional properties of hESCs derived FP conditioned media was isolated at days 9 and 11 and tested for expression of Netrin-1 in the medium using ELISA (
[0562] To see if this result was SHH-mediated, the inventors demonstrated increased expression of GLI2 upon exposure to CM from hESC derived FP. When this experiment was repeated in the presence of the SHH antagonist cyclopamine, all three genes, NKX2.1, NKX6.1, and GLI2 were significantly reduced (
[0563] Classical studies demonstrated that FP explants can induce an ectopic FP in early neuroectodermal tissue (Placzek et al., 1993). To test if the hESCs derived FP is capable of inducing FP markers in primary mouse explants, neuroectodermal tissue was isolated from an E8.5 mouse embryo and placed it in direct contact with hESC derived FP cells. After 3 days of co-culture explants were identified based on expression of the mouse specific M6 marker, rinsed and mounted on slides to be stained for FOXA2. As a control condition, mouse explants were co-cultured with hESC derived neural tissue using the NSB protocol. While co-culture with control hESC derived neural tissue did not yield FOXA2+ cells, explants co-cultured with hESC derived FP cells showed robust induction of FOXA2+ cells, particularly at the periphery of the explant (
[0564] Neurite growth promoting effects of hESC derived FP cells was observed in primary rat E12.5 rat cerebellar plate explants (
[0565] These experiments demonstrated that hESCs derived FP can mimic the functional properties of primary FP tissue as an organizer by secreting Netrin-1 and SHH capable of ventralizing nave hESC derived and primary mouse neural precursor cells.
Example VI
[0566] Temporal Transcriptome Analysis Reveals that FP Specification Occurs at the Expense of AN.
[0567] To gain further insight into the factors critical for human FP specification, high resolution temporal gene expression profiles of candidate markers were performed at 6 time points during the 11 day protocol. FOXA2 expression was observed as steady increase in transcript levels starting at day 3 of differentiation (compared to NSB) consistent with immunostaining data (
[0568] PTCH1 expression is used commonly as a transcriptional readout of SHH activity. Dramatic increase in PTCH1 expression was observed as early as day 3 of differentiation with levels further increasing by a factor of 3 over the next 2 days (
[0569] SOX1 is an early neural marker and is not expressed in the medial FP (Charrier et al., 2002). Consistent with a rapid neural induction, SOX1 was rapidly up regulated in NSB conditions and continued to increase with time. Upon addition of SHH a much smaller increase in SOX1 levels is observed at day 3 compared with control NSB conditions (
Example VII
[0570] Global Transcriptome Analysis During hESC Derived FP Specification.
[0571] Temporal profiles of global gene expression at 5 time points during differentiation was established during the development of the present inventions (Day 1, 3, 5, 7 and 11) in control NSB cultures (yielding AN) and in Sonic C25II treated cultures (yielding FP; see FIGS. 18M18R). Prior to microarray analysis the quality of each sample was verified for expression of a panel of FP markers (
[0572] The time course data were subjected to gene ontology (GO) enrichment analysis using DAVID (http://david.abcc.ncifcrf.gov/; Dennis et al., 2003) as unbiased assessment of the FP transcriptional profile. Among the transcripts highly enriched in SHH treated versus NSB control cultures at day 7 and 11 of differentiation were genes associated with the Wnt and hedgehog pathways, axon guidance, and secreted proteins (
[0573] Pairwise comparisons at for each differentiation stage was done to gain insight into specific genes differentially expressed during FP specification. While the majority of genes significantly regulated at day 3 and day 5 of differentiation (as compared to day 1) were shared in NSB and FP protocol, a subset of transcripts was differentially regulated (
[0574] The inventors observed significant changes in the Wnt pathway components. As early as Day 5 there was a significant decrease of the Wnt pathway inhibitor DKK-1 and this decrease was sustained over the course of the protocol (
[0575] Differential expression for these and additional genes was verified by qRT-PCR (
Example VIII
[0576] A gene cluster analysis was also done that showed when genes are expressed the highest; time of maximum (TOM) and the lowest; time of minimum (TIM) expression. GO ontology terms were mapped during this analysis and were able to identify precise developmental windows during the FP specification process. These data further confirmed the identity of hESC derived FP tissue and provides insight into genes differentially expressed during FP versus neuroectodermal fate specification.
Example IX
Suppression of DKK-1 Blocks AN Commitment and Enhances FP Generation.
[0577] The inventors observation that FP commitment occurs at the expense of AN was strengthened by the global gene expression profiles obtained herein that revealed a rapid down regulation of the Wnt signaling inhibitor DKK-1. DKK-1 was initially identified as a factor expressed in the xenopus head organizer that was necessary and sufficient to induce head development (Glinka et al., 1998). DKK-1-mediated inhibition of Wnt signaling during mouse development is essential for anterior brain development (Mukhopadhyay et al., 2001), and FOXA2 knockout embryos show increased expression of DKK-1 in the ectoderm at E7.5 (Kimura-Yoshida et al., 2006). During NSB induction it was observed that DKK-1 transcript levels rise sharply at day 5 from 200 to 5000 fold and then drop back down consistent with the role of DKK-1 as an AN inducer. ELISA assays were done to measure DKK-1 protein levels in the medium and found levels as high as 12 ng/ml (
[0578] To test whether DKK-1 is functionally involved during hESC differentiation in FP specification, the inventors added recombinant DKK-1 in combination with Sonic C25II and assessed FP marker expression. While treatment with Sonic C25II alone resulted in a decrease of the AN marker BF1 and an upregulation of FOXA2 (
[0579] The data obtained during the development of the present inventions revealed a critical window for FP specification during neural induction. With the observation that DKK-1 expression can inhibit FOXA2 expression, the following test was designed to demonstrate whether the addition of DKK-1 blocking antibody extends the window of competency for SHH mediated FP induction. DKK-1 antibody was added at Day1, Day 5, and Day 9 of differentiation. Exposure to SHH was initiated at the same time points and the expression of FOXA2 was assayed following 9 days of SHH exposure. When DKK-1 was added along with SHH at Day1 an increase in FOXA2+ cells was observed. However, when added at Day 5 or Day 9, DKK-1 antibody FOXA2+ cells were not observed (
[0580] Early treatment with SHH repressed DKK-1 mediated AN specification and enabled differentiation towards FP lineage. However, inhibition of DKK-1 at day 5 of later stages did not extend the temporal window for FP induction.
Example X
Bf1 Expression Represses Fp Commitment.
[0581] The inventors discovered that SHH addition to stem cell cultures caused FP differentiation at the expense of AN, mediated at least in part, through inhibition of DKK-1. DKK-1 was shown to specify BF1+ neurectoderm BF1 (Mukhopadhyay et al., 2001), and BF1 is expressed in most neural cells upon NSB induction (
[0582] However, upon neural differentiation of hESCs there was a decrease in BF1 protein expression (
[0583] hESC lines were generated by overexpression of BF1 using a previous described vector (Fasano et al., 2009). These transgenic cells were then cultured under conditions that induced differentiation towards FP lineage. At Day 11, compared to a control GFP expressing clones, there was a reduction of FOXA2+ cells and a decrease in FP marker expression (
Example XI
[0584] The A/P Axis of the FP were Altered by Caudalizing Agents.
[0585] While certain characteristics are shared among all FP cells, such as FOXA2 and Netrin-1 expression, differences have been reported between different regions of the floor plate along the A/P axis (Placzek and Briscoe, 2005). In particular, recent studies have shown that the midbrain FP expresses markers such as CORIN (Ono et al., 2007) and NOV (Placzek and Briscoe, 2005).
[0586] Additionally, the midbrain FP was shown to be neurogenic giving rise to midbrain DA neurons and expressing markers of DA progenitors such as LMX1B and NGN2 (Joksimovic et al., 2009). In contrast both the hindbrain and spinal cord FP appear to be non-neurogenic. To better understand the A/P identity of the FP cells generated from hESCs qRT-PCR analysis for the midbrain FP markers CORIN and NOV was done, as well as analysis of DA progenitor markers LMX1B and EN1. However expression of these markers was not detected. Next gene expression data sets were used to identify differentially regulated transcripts markers that could shed light onto the positional identity of the FP cells.
[0587] Elegant studies in the mouse showed that specific enhancer elements direct Shh expression in different regions along the A/P axis of the FP (Jeong et al., 2005). SIX6 were dramatically increased during FP induction compared with NSB control conditions (About 50,000-fold increase in mRNA levels at Day 5 of differentiation;
Example XII
[0588] This example shows exemplary experiments designed to determine whether any of the methods (conditions) used herein would lead to an upregulation of midbrain FP and DA progenitor markers. The inventors discovered that different factors had varied effects on marker expression (
[0589] As mentioned above, studies had identified different enhancers that directed SHH expression to different A/P region along ventral axis (Jeong et al., 2008). To further demonstrate that the addition of caudilizing factors re-specifies A/P identity of the resulting FP tissue, hESCs derived FP were generated in the presence or absence of Wnt-1 or FGF8, and transfected the resulting tissue with two SHH enhancer constructs driving LacZ expression in different A/P domains of the FP. The SBE1 construct directs SHH expression to the midbrain region of the floor plate while the SBE2 enhancer directs SHH expression to the most anterior region of the FP where Six6 has been shown to bind. In the absence of caudalizing factors (SHH C25II alone), LacZ expression was observed herein following transfection with the SBE2 but not the SBE1 enhancer supporting the hypothesis that hESC derived FP is anterior by default (
[0590] In conclusion, our data demonstrated that upon neural differentiation hESCs default towards an AN fate by upregulating DKK-1 and subsequently BF1, and that AN commitment actively represses FP competency in hESC progeny. However, an early high level of SHH reduces DKK-1 levels enabling FP induction at the expense of AN while loss-of-function of DKK-1 or BF1 increases FP production. Human ESC derived FP is anterior by default but were posteriorized in response to caudalizing factors. This is summarized in
Example XIII
[0591] Cell culture: hESCs (WA-09; passages 35-45), hiPSC lines (iPS-14, iPS-27; passages 20-30), and 16 were maintained at undifferentiated state and differentiated towards CNS lineages using dual-SMAD inhibition protocol described previously. For placode induction protocol (PIP), Noggin was removed at day 3 of differentiation. In some experiments, BMP-4, Noggin, DKK-1, FGF8, SU5402, Wnt-3a, DAPT, CHIR99021, Cyclopamine, Sonic Hedgehog (SHH) and Purmorphamine were added. For differentiation towards trigeminal sensory fate placode clusters were maintained in N2 medium supplemented with ascorbic acid and BDNF. Pituitary fate was induced by exposure to SHH and Purmorphamine from day 7-11 of PIP followed by treatment with DAPT to promote PIT1+ fate.
Example IVX
[0592] Cell characterization: qRT-PCR data were normalized to HPRT and are based on 4-6 technical replicates from at least 3 independent experiments. Global gene expression analysis was performed by the MSKCC genomics core according to the specification of the manufacturer (Illumina Human-6 oligonucleotide arrays). Detailed information on the use of primary antibodies for immunocytochemistry and flow analysis and on the electrophysiological analyses is presented in extended supplementary methods.
Example XV
[0593] Animal studies: Animal studies were done in accordance with protocols approved by our institutional Animal Care and Use Committee and following NIH guidelines. Hormone producing cells were injected subcutaneously into adult male NOD-SCID IL2Rgc mice and adult 8 male nude rats. Blood was collected at 4-6 weeks after the transplantation followed by ELISA analysis for determining hormone levels. Chick transplantation studies were performed at HH Stage 9-10 and embryos were harvested at HH Stage 20. Injections into pons of adult NOD-SCID IL2Rgc mice were performed by stereotactic surgery.
Example XVI
[0594] Statistical analysis: Statistical analysis was performed using GraphPad Prism version 5.0b (GraphPad Software). All data were derived from at least 3 independent experiments. Asterisks mark experimental groups that were significantly different from control groups by a two-tailed Students t-test, or by ANOVA followed by Dunnett test to compare control against multiple independent treatment groups. Data are presented as meanSEM unless indicated otherwise.
Example XVII
[0595] Cells and culture conditions: hESCs (WA-09; XX, passages 35-45), hiPSC lines (iPS-14, iPS-27; passages 20-30) (Chambers et al., 2009), and 16 (Amit and Itskovitz-Eldor, 2002) were cultured on mouse embryonic fibroblasts plated at 12-15,000 cells/cm2 (MEFs, Global Stem) and maintained in medium consisting of DMEM/F12, 20% knockout serum replacement (GIBCO), 0.1 mM b-mercaptoethanol, 6 ng/mL FGF-2 changed daily or in mTeSR1 (StemCell Technologies, Inc., Vancouver, Canada) on hESC-qualified Matrigel (BD Biosciences, San Jose, CA) coated plates. Cells were passaged using 6 U/mL of dispase in hESCs media, washed and re-plated at a dilution of 1:10 to 1:15.
Example XVIII
[0596] Neural Induction and placode induction: Feeder-free neural induction was carried out as previously described (Chambers et al., 2009). Briefly, hESCs cultures were disaggregated using accutase for 20 minutes, washed using hESCs media and pre-plated on gelatin for 1 hour at 37 C. in the presence of ROCK inhibitor to remove MEFs. The non-adherent hESCs were washed and plated on matrigel at a density of 60,000 cells/cm2 on matrigel (BD) coated dishes in MEF conditioned hESCs media (CM) spiked with 10 ng/mL of FGF-2 and ROCK-inhibitor. The ROCK inhibitor was withdrawn after 24 hours, and hESCs were allowed to expand in CM for 2 days or until they were 95% confluent. The initial differentiation media conditions included knock out serum replacement (KSR) media with 10 M TGF- inhibitor (SB431542, Tocris) and 250 ng/mL of Noggin (R&D). Upon day 5 of differentiation, increasing amounts of N2 media (25%, 50%, and 75%) were added to the KSR media every two days while maintaining 500 ng/mL of Noggin and TGF- inhibitor. Similar results could be obtained when using KSR-free conditions (E6 medium (Chen et al., 2011)) following adjustments in BMP signaling; data not shown). For placode induction, Noggin was removed at day3 of differentiation. In some experiments, BMP-4 (R&D 50 ng/ml), Noggin (R&D 250 ng/ml), DKK-1 (R&D 100 ng/ml), FGF8 (R&D 50 ng/ml), SU5402 (Tocris 10 M), Wnt-3a (R&D 50 ng/ml), DAPT (Tocris, 10 M), CHIR99021 (Stemgent, 3 M), Cyclopamine (Tocris, 10 M), Sonic Hedgehog (C25II-R&D 100 ng/ml), and Purmorphamine (Stemgent, 1 M), were added.
Example IXX
[0597] Terminal differentiation of trigeminal sensory neurons: The placode clusters were isolated manually at day 13-17. Clusters were replated onto culture dishes pre-coated with 15 g/mL polyornithine, 1 g/mL laminin (Po/Lam) and maintained in N2 medium supplemented with ascorbic acid (AA, 0.2 mM), and BDNF (20 ng/mL). For electrophysiology experiments, NGF and ROCK inhibitor was used in the ACSF, which increases the survival of cells within the chamber.
Example XX
[0598] Differentiation of hormone producing cells: During placode induction protocol, Sonic Hedgehog (C25II-R&D 100 ng/ml) and Purmorphamine (Stemgent, 1 M) were added between days 7-11 of PIP to promote differentiation towards pituitary placode anlage. The cells were maintained without passaging in N2 medium and treated with additional factors such as DAPT (Tocris, 10 M), between day 13 and day 17 of differentiation to induce PIT1+ and GATA2+ precursor cells (see
Example XXI
[0599] Quantitative Real-time PCR: Total RNA was extracted using an RNeasy kit (Qiagen) or Trizol. For each sample, 1 g of total RNA was DNAase treated and reverse transcribed using the Quantitect RT kit (Qiagen). Amplified material was detected using Taqman probes and PCR mix (ABI) on a Mastercycler RealPlex2 (Eppendorf). All results were normalized to a HPRT housekeeping gene control and are based on 4-6 technical replicates from each of at least 3 independent experiments.
Example XXII
[0600] Microarray Analysis: Total RNA was isolated at day 1, 3, 5, 7, 9 and 11 of differentiation from both control (NSB) and PIP using Trizol (Invitrogen). Three biological replicates per time point were used. All samples were processed by the MSKCC Genomics Core Facility and hybridized on Illumina Human-6 oligonucleotide arrays. Quantile Normalization and model-based expression measurements were performed by using the Partek Genomic Suite (Partek GS) (Downey, 2006). A pair-wise comparison between NSB and PIP was performed. Genes found to have an adjusted p-value <0.001 and a fold change greater than 2 were considered significant. Expression differences are reported as the log 2 of the fold change. Gene Ontology enrichment was determined by entering gene lists into the Database for Annotation, Visualization, and Integrated Discovery (DAVID; david.niaid.nih.gov) (Dennis et al., 2003; Huang et al., 2009).
Example XXIII
[0601] Microscopy, antibodies, and flow cytometry: Cells were fixed using 4% paraformaldehyde for 15 minutes, washed with PBS, permeabilized using 0.3% Triton X in PBS, and blocked using 1% BSA. Primary antibodies used for microscopy included PAX6 (Covance, DSHB), TUJ1 (Covance), BRN3A (Chemicon), AP2a (DSHB), HNK1 (Sigma), PAX3 (DSHB), SIX1 (ABR, Atlas), ISL1 (DSHB), PERIPHERIN (Santa Cruz), GSU (gift A. McNeilly), CRYAB (Chemicon), DACH1 (Proteintech), EYA1 (gift Kawakami), E-CADHERIN (Abcam), FSH (gift A. McNeilly), GATA2 (Abcam), chick GFP (Abcam), hNCAM (Santa Cruz), GLUTAMATE (Sigma), KRT14 (Labvision), SIX6 (Atlas), LHX3 (Abcam), OVOL2 (Aviva), TFAP2A (DSHB), FOXG1 (gift E. Lai), hCA (Stem Cells), and Ki67 (Sigma). Appropriate Alexa 488, Alexa 568, Alexa 647 secondary antibodies (Molecular Probes) and/or DAPI counterstaining was used for visualization. For Flow Cytometry, cells were mechanically dissociated after exposure to accutase for 20 min at 25 C. To eliminate dead cell populations in FACS analysis, we used DAPI or 7-AAD according to manufacturer's recommendation. Cells were analyzed using FACScan (Becton Dickinson) and FlowJo software (Tree Star, Inc.).
Example IVXX
[0602] Electrophysiology: The clusters were seeded on glass slides. Slides are recovered in artificial CSF (ACSF) containing the following: 119 mM NaCl, 2.5 mM KCl, 26.2 mM NaHCO.sub.3, 2.5 mM CaCl.sub.2), 1.3 mM MgCl2, 1 mM NaH2PO4, and 20 mM glucose (pH 7.4, osmolarity 300 mOsm), bubbled with 5% CO2/95% O2 at room temperature for a minimum of 1 h before recording. Slices were constantly perfused with ACSF during recordings. Whole-cell recordings were made from the neurons migrating from the clusters, which tended to be more mature than cells in the center of the clusters. Patch electrodes (5-8 M) were filled with intracellular solution containing the following: 130 mM K-gluconate, 16 mM KCl, 2 mM MgCl2, 10 mM HEPES, 0.2 mM EGTA, 4 mM Na2-ATP, and 0.4 mM Na3-GTP (pH 7.25, osmolarity 290 mOsm). The membrane potential of each cell was identified shortly after rupturing the patch and periodically during the course of the experiment to ensure there was no significant deterioration of the health of the cell. Spontaneous miniature synaptic currents were recorded in voltage-clamp mode held at 60 mV. Depolarizing and hyperpolarizing current steps (0.2 Hz; duration 500 ms) were applied to the cells to help characterize their electrophysiological profile. All parameters were measured for a minimum of three trials for each cell, and the average value was calculated.
Example XXV
[0603] In vivo transplantation: All animal experiments were done in accordance with protocols approved by our institutional Animal Care and Use Committee and following NIH guidelines for animal welfare. Murine subcutaneous injections of hormone producing cells: For subcutaneous transplantations, 110.sup.6 hESC-derived pituitary cells (at day 16 and day 32 of differentiation) in 0.5 ml of matrigel or matrigel alone (as controls) were injected into adult 8-weeks-old male NOD-SCID IL2Rgc null strain mice and adult 8-weeks-old male nude rats (Taconic). The whole blood collections or retrorbital blood collection per RARC guidelines were performed a week, 4 weeks and 6 weeks after the transplantations for hormone measurements from the plasma. Animals were sacrificed at 2 days, 1 week, and 6 weeks after transplantation and processed for histology. Matrigel plugs from adult mice were fixed in 4% paraformaldehyde and cryosectioned for immunohistochemical analysis.
Example XXVI
[0604] Transplantation into chick trigeminal ganglion anlage: For in ovo transplantation, fertile eggs (Charles River) were incubated at 37 C. in a humidified incubator. The GFP hESC-placode derived neurons were transplanted into the prospective trigeminal ganglion of HH Stage 9-10 chick embryos. Eggs are incubated until HH Stage 20. The chick embryo was sectioned transverse at the level of the midbrain neural tube to visualize the trigeminal ganglia.
Example XXVII
[0605] Transplantation into mouse pons region: The GFP expressing hESC derived trigeminal neuron/progenitor cells at day 22 of differentiation were transplanted into the right pons of nine NOD-SCID IL2Rgc null strain mouse by using stereotactic surgery; the coordinates are Lambda: 0.77, Bregma: 4.16, D/V: 4.65 and M/L: +0.5(Right). For each animal 200,000 cells were transplanted in a 100K/l density. Tissues from chick embryos and adult mice were fixed in 4% paraformaldehyde and cryosectioned for immunohistochemical analysis.
Example XXVIII
[0606] In vitro and in vivo analysis of ACTH and GH release: Hormone producing hESC-derived cells were analyzed at day 36 of differentiation. The cells were rinsed with HBSS and subsequently exposed to fresh HBSS (500 l at 37 C. for 10 min). The supernatant was subsequently collected and subjected to ELISA using the ACTH LumELISA kit (Calbiotech). ACTH was also readily detected from conditioned medium subjected to ELISA. For in vivo studies, blood samples from mice and rats engrafted with hESCderived anterior pituitary cells and matrigel-only controls were collected into K2 EDTA-treated BD Microtainer MAP (BD) at 8 a.m. under conditions to minimize stress. Plasma was isolated by centrifugation for 20 min at 2,000 g using a refrigerated centrifuge. The supernatant was collected for ELISA to measure hormone levels. GH levels were measured similarly both in vitro and in vivo after transplantation using the Human Growth Hormone ELISA kit (Calbiotech).
Example XXIX
[0607] PIP protocol using E8/E6 cell culture media: E8/E6 cell culture media (Essential8/Essential6, Nat Methods. 2011 May; 8(5):424-9) comprises the ingredients DMEM/F12, ascorbic acid, selenum, insulin, NaHCO.sub.3, transferrin, FGF2 and TGF. The media differs from KSR media described herein in that E8/E6 does not include an active BMP or Wnt ingredient. The present example describes a modified PIP protocol that utilizes the BMP deficient E8/E6 media.
[0608] A Six1 knock in GFP reporter cell line (SIX1::H2B-GFP) was developed to monitor when cells have been transformed to a placode fate. (
Example XXX
[0609] Modified PIP-E6 to induce trigeminal placode as a default: Unlike KSR, E8/E6 does not include any Wnt active compounds. In order to make the trigeminal placode fate the default fate when culturing using the PIP-E6 protocol, PIP-E6 was modified by adding CHIR (Wnt activator) to the culture protocol. Including CHIR in the media during days 2-4 of the PIP-E6 protocol resulted in the induction of trigeminal placodes as the default placode. (
Example XXXI
[0610] Identification of trigeminal placode markers GD2 and CD57 (HNK1): Six1::GFP marker cells were cultured according to the PIP-E6 protocol, as described by
[0618] Surface markers that enrich for trigeminal placode are shown in
[0619] CD57 (HNK1) was also identified as a marker that may be useful for identifying and isolating trigeminal placode. (
[0620]
Example XXXII
[0621] High throughput screen for compounds that promote placode induction: SIX1::GFP cells were cultured according to the PIP-E6 protocol. 1280 test compounds were screened for their ability to enhance placode induction. Each test compound was added to the cell culture media at day 3, and cells were imaged to determine the level of placode induction at day 6. (
Example XXXIII
[0622] Induction of anterior pituitary gland cells: Pituitary placode cells were induced by culturing SIX1::GFP cells according to the PIP-E6 protocol, wherein pituitary factors SHH, FGF8, FGF10 and/or hypothalamus CM were supplemented in the culture media from days 6-15. (
[0623] The hormone expressing cells were responsive to external stimuli. In particular, in response to stimulation with somatocrinin, the cells released growth hormone (GH), and in response to nafarelin the cells released follicle stimulating hormone (FSH). (
Example XXXIV
[0624] Induction of anterior pituitary gland cells: SIX1::GFP hPSCs were cultured according to a modified PIP-E6 protocol, wherein pituitary factors such as FGF8, FGF10 or SHH, etc., were included in the culture media from days 6-14. Cells were sorted based on expression of SIX1::GFP, and were replated at a concentration of 10,000 cells/cm.sup.2 on PO/L/F, and were incubated with small molecule/growth factors for 2 weeks. (
Example XXXV
[0625] Grafting in vitro differentiated mixtures of pituitary hormone releasing cells into rat: Mixtures of pituitary hormone releasing cells derived in vitro from human PSCs using the modified PIP-E6 protocol described in the preceding two examples were grafted into unlesioned adult rat brain adjacent to the pituitary/hypothalamic site. The grafted cells survived and increased the level of detectable ACTH in the grafted animals compared to control. (
[0626] All publications and patents mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described method and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in cellular biology, neurobiology, cancer cell biology, molecular biology, biochemistry, chemistry, organic synthesis, or related fields are intended to be within the scope of the following claims.