GDNF fusion polypeptides and methods of use thereof

11912750 ยท 2024-02-27

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to compositions and methods of GDNF fusion polypeptides, wherein the GDNF fusion polypeptides include an Fc domain, an albumin-binding peptide, a fibronectin domain, or a human serum albumin, joined to a GDNF variant either directly or by the way of a linker. The GDNF fusion polypeptides may used to treat metabolic diseases, such as obesity and Type-1 and Type-2 diabetes, and neurological diseases, such as Amyotrophic lateral sclerosis (ALS) and Parkinson's disease.

Claims

1. A glial-derived neurotrophic factor (GDNF) fusion polypeptide consisting of the formula A-L-B, wherein A is an Fc domain; L is a linker; and B has at least 95% sequence identity to a GDNF variant, wherein the sequence of the GDNF variant is (a) the sequence of amino acids 92-211 of SEQ ID NO: 1 or (b) a fragment of the sequence of amino acids 92-211 of SEQ ID NO: 1 amino acids 118-211 of SEQ ID NO: 1.

2. The GDNF fusion polypeptide of claim 1, wherein the sequence of B is (a) the sequence of amino acids 92-211 of SEQ ID NO: 1 or (b) a fragment of the sequence of amino acids 92-211 of SEQ ID NO: 1 comprising amino acids 118-211 of SEQ ID NO: 1.

3. The GDNF fusion polypeptide of claim 1, wherein the sequence of said GDNF variant is the sequence of amino acids 110-211 of SEQ ID NO: 1.

4. The GDNF fusion polypeptide of claim 3, wherein the sequence of B is the sequence of amino acids 110-211 of SEQ ID NO: 1.

5. The GDNF fusion polypeptide of claim 1, wherein B has at least 97% sequence identity to said GDNF variant, wherein the sequence of the GDNF variant is (a) the sequence of amino acids 92-211 of SEQ ID NO: 1 or (b) a fragment of the sequence of amino acids 92-211 of SEQ ID NO: 1 comprising amino acids 118-211 of SEQ ID NO: 1.

6. The GDNF fusion polypeptide of claim 1, wherein said Fc domain does not form a dimer.

7. The GDNF fusion polypeptide of claim 1, wherein said Fc domain does not comprise a hinge domain.

8. The GDNF fusion polypeptide of claim 1, wherein said linker comprises the sequence of any one of SEQ ID NOs: 4-29.

9. A nucleic acid molecule encoding a GDNF fusion polypeptide of claim 1.

10. A vector comprising the nucleic acid molecule of claim 9.

11. An isolated host cell that expresses the GDNF fusion polypeptide of claim 1.

12. The isolated host cell of claim 11, wherein the host cell is a mammalian cell.

13. A pharmaceutical composition comprising a GDNF fusion polypeptide of claim 1 and one or more pharmaceutically acceptable carriers or excipients.

14. The GDNF fusion polypeptide of claim 1, wherein the sequence of said GDNF variant is the sequence of amino acids 117-211 of SEQ ID NO: 1.

15. The GDNF fusion polypeptide of claim 14, wherein the sequence of B is the sequence of amino acids of 117-211 of SEQ ID NO: 1.

16. The GDNF fusion polypeptide of claim 1, wherein the GDNF fusion polypeptide is produced by expression in a mammalian cell.

17. The GDNF fusion polypeptide of claim 1, wherein the linker is a 3-9 amino acid peptide spacer.

18. The GDNF fusion polypeptide of claim 1, wherein the sequence of said GDNF variant is the sequence of amino acids 118-211 of SEQ ID NO: 1.

19. The GDNF fusion polypeptide of claim 18, wherein the sequence of B is the sequence of amino acids 118-211of SEQ ID NO: 1.

Description

DESCRIPTION OF THE DRAWINGS

(1) FIG. 1A is a western blot that shows the expression of five GDNF fusion polypeptides (Fusion polypeptide 1: Fc-hGDNF.sub.78-211 (SEQ ID NO: 32), Fusion polypeptide 2: Fc-GGG-hGDNF.sub.92-211 (SEQ ID NO: 33), Fusion polypeptide 3: Fc-GGG-hGDNF.sub.110-211 (SEQ ID NO: 34), Fusion polypeptide 4: Fc-GGG-hGDNF.sub.117-211 (SEQ ID NO: 35), and Fusion polypeptide 5: Fc-GGGGAGGGG (SEQ ID NO: 22)-hGDNF.sub.117-211 (SEQ ID NO: 36)) of the invention.

(2) FIG. 1B is an illustration of three sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) gels showing the expressions of fusion polypeptide 2, 3, and 4, respectively, under either reducing or non-reducing condition.

(3) FIG. 2 is an illustration showing four graphs showing the serum concentrations of GDNF fusion polypeptides in mice.

(4) FIG. 3 is an illustration showing two graphs showing the effect of GDNF fusion polypeptide 6 on body weight.

(5) FIG. 4 is a bar graph showing the effect of GDNF fusion polypeptide 6 on food intake.

(6) FIG. 5 includes two graphs showing the effect of GDNF fusion polypeptide 6 on body composition.

(7) FIG. 6 is a graph showing the effect of GDNF fusion polypeptide 6 on the rate of glucose clearance.

DETAILED DESCRIPTION OF THE INVENTION

(8) The present invention features compositions and methods of preparing glial-derived neurotrophic factor (GDNF) fusion polypeptides as therapeutic proteins. The GDNF fusion polypeptides of the invention bind to human GDNF family receptor alpha-1 (GFR1) and have long serum half-life. The invention also features pharmaceutical compositions and methods of using these GDNF fusion polypeptides to treat and/or prevent metabolic diseases such as obesity and Type-1 and Type-2 diabetes, and neurological diseases such as schizophrenia, epilepsy, Amyotrophic lateral sclerosis (ALS), Parkinson's disease, Alzheimer's disease, Huntington's disease, anxiety, stroke, a brain tumor, and a brain metastasis.

(9) I. GDNF Fusion Polypeptides

(10) In general, the invention features GDNF fusion polypeptides having the formula A-L-B, where A includes an Fc domain, an albumin-binding peptide, a fibronectin domain, or a human serum albumin, joined to the N-terminus of a GDNF variant directly or by way of a linker. In preferred embodiments, the GDNF fusion polypeptide is encoded by a single open reading frame. In some embodiments, when A includes an Fc domain, the GDNF fusion polypeptide of the invention further includes an albumin-binding peptide, a fibronectin domain, or a human serum albumin, joined to the N-terminus of the Fc domain directly or by way of a linker.

(11) In certain embodiments, the GDNF fusion polypeptides of the invention have a serum half-life of 3 to 60 days. In other embodiments, the GDNF fusion polypeptides bind to human GDNF family receptor alpha-1 (GFR1) with a K.sub.D of 20 to 20,000 pM.

(12) II. GDNF Variants

(13) A GDNF variant is a polypeptide containing a mutant or fragment of wild-type human GDNF (SEQ ID NO: 1). In some embodiments, a GDNF variant has at least 80% sequence identity (e.g., at least 85%, 90%, 95%, 97%, or 100% sequence identity) to a reference GDNF sequence that includes amino acids 118-211, 117-211, 110-211, 92-211, or 78-211 of SEQ ID NO: 1. The amino acid sequences of wild-type human GDNF is shown below.

(14) TABLE-US-00001 SEQIDNO:1:wild-typehumanGDNF 1 MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ 61 FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL 121 TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR 181 PIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

(15) Amino acids 78-211 of human GDNF form the GDNF functional domain. In certain embodiments, the GDNF variant consists of amino acids 92-211 of SEQ ID NO: 1 or a fragment thereof. In some embodiments, the GDNF variant consists of amino acids 118-211, amino acids 117-211, amino acids 110-211, amino acids 92-211, or amino acids 78-211 of SEQ ID NO: 1.

(16) Wild-type human GDNF contains a potential proteolytic cleavage site that is approximately between amino acids 85 and 120 of SEQ ID NO: 1. This site of GDNF makes the protein prone to proteolysis and degradation. Thus, wild-type human GDNF often exhibits a short serum half-life of, e.g., less than 10 minutes (see, e.g., FIG. 4 of Boado et al., Drug Metab Dispos. 37:2299-304, 2009).

(17) To improve the serum half-life of the protein, a GDNF variant can have the proteolytic cleavage site deleted. In other embodiments, a GDNF variant contains amino acid substitutions relative to wild-type human GDNF that reduce proteolysis within the potential proteolytic site (i.e., between amino acid residues 85 and 120 of SEQ ID NO: 1). Such amino acid substitutions include substituting charged amino acids, e.g., arginine and lysine, in the proteolytic cleavage site for a non-basic amino acid. Charged amino acids, e.g., arginine and lysine, between amino acids 85 and 120 that can be substituted for a non-basic amino acid include R88, R89, R91, R93, R104, K106, R108, R109, R112, K114, and R116. These amino acid residues can be substituted for non-basic amino acids such as glycine, alanine, valine, isoleucine, leucine, phenylalanine, tryptophan, methionine, cysteine, asparagine, glutamine, serine, threonine, tyrosine, proline, aspartic acid, and glutamic acid.

(18) The GDNF fusion polypeptides including GDNF variants described above display long serum half-life, e.g., from 3 to 60 days, and maintain the desired binding affinity to GFR1, e.g., with a K.sub.D of 20 to 20,000 pM.

(19) III. Fc Domain

(20) In the present invention, Fc domain refers to a protein having at least 80% sequence identity (e.g., at least 85%, 90%, 95%, 97%, or 100% sequence identity) to a human Fc domain that includes at least a C.sub.H2 domain and a C.sub.H3 domain. Optionally, the Fc domain contains one or more amino acid substitutions that reduce or inhibit Fc domain dimerization. Optionally, the Fc domain contains a hinge domain. The Fc domain can be of immunoglobulin antibody isotype IgG, IgE, IgM, IgA, or IgD. Additionally, the Fc domain can be an IgG subtype (e.g., IgG1, IgG2a, IgG2b, IgG3, or IgG4). The Fc domain can also be a non-naturally occurring Fc domain, e.g., a recombinant Fc domain.

(21) Methods of engineering Fc domain that have reduced dimerization are known in the art. In some embodiments, one or more amino acids with large side-chains (e.g., tyrosine or tryptophan) may be introduced to the C.sub.H3-C.sub.H3 dimer interface to hinder dimer formation due to steric clash. In other embodiments, one or more amino acids with small side-chains (e.g., alanine, valine, or threonine) may be introduced to the C.sub.H3-C.sub.H3 dimer interface to remove favorable interactions. Methods of introducing amino acids with large or small side-chains in the C.sub.H3 domain are described in, e.g., Ying et al. (J Biol Chem. 287:19399-19408, 2012), U.S. Patent Publication No. 2006/0074225, U.S. Pat. Nos. 8,216,805 and 5,731,168, Ridgway et al. (Protein Eng. 9:617-612, 1996), Atwell et al. (J Mol Biol. 270:26-35, 1997), and Merchant et al. (Nat Biotechnol. 16:677-681, 1998), all of which are incorporated herein by reference in their entireties.

(22) In yet other embodiments, one or more amino acid residues in the C.sub.H3 domain that make up the C.sub.H3-C.sub.H3 interface between two Fc domains are replaced with positively-charged amino acid residues (e.g., lysine, arginine, or histidine) or negatively-charged amino acid residues (e.g., aspartic acid or glutamic acid) such that the interaction becomes electrostatically unfavorable depending on the specific charged amino acids introduced. Methods of introducing charged amino acids in the C.sub.H3 domain to disfavor or prevent dimer formation are described in, e.g., Ying et al. (J Biol Chem. 287:19399-19408, 2012), U.S. Patent Publication Nos. 2006/0074225, 2012/0244578, and 2014/0024111, all of which are incorporated herein by reference in their entireties.

(23) In some embodiments of the invention, an Fc domain includes one or more of the following amino acid substitutions: T366W, T366Y, T394W, F405W, Y349T, Y349E, Y349V, L351T, L351H, L351N, L352K, P353S, S354D, D356K, D356R, D356S, E357K, E357R, E357Q, S364A, T366E, L368T, L368Y, L368E, K370E, K370D, K370Q, K392E, K392D, T394N, P395N, P396T, V397T, V397Q, L398T, D399K, D399R, D399N, F405T, F405H, F405R, Y407T, Y407H, Y407I, K409E, K409D, K409T, and K409I, relative to the sequence of human IgG1. In one particular embodiment, an Fc domain includes the amino acid substitution T366W, relative to the sequence of human IgG1. The sequence of wild-type Fc domain is shown in SEQ ID NO: 3.

(24) IV. Albumin-Binding Peptide

(25) Binding to serum protein peptides can improve the pharmacokinetics of protein pharmaceuticals, and in particular the GDNF fusion polypeptides described here may be joined with serum protein-binding peptides.

(26) As one example, albumin-binding peptides that can be used in the methods and compositions described here are generally known in the art. In one embodiment, the albumin binding peptide includes the sequence DICLPRWGCLW (SEQ ID NO: 2).

(27) In the present invention, albumin-binding peptides may be joined to the N-terminus of the Fc domain in a GDNF fusion polypeptide of the invention to increase the serum half-life of the GDNF fusion polypeptide. An albumin-binding peptide can be joined, either directly or through a linker, to the N-terminus of the Fc domain. In other embodiments, an albumin-binding peptide is joined, either directly or through a linker, to the N-terminus of a GDNF variant.

(28) Albumin-binding peptides can be fused genetically to GDNF fusion polypeptides or joined to GDNF fusion polypeptides through chemical means, e.g., chemical conjugation. If desired, a spacer can be inserted between the GDNF fusion polypeptide and the albumin-binding peptide. Without being bound to a theory, it is expected that inclusion of an albumin-binding peptide in a GDNF fusion polypeptide of the invention may lead to prolonged retention of the therapeutic protein through its binding to serum albumin.

(29) V. Fibronectin Domain

(30) Binding to fibronectin domains can improve the pharmacokinetics of protein pharmaceuticals, and in particular the GDNF fusion polypeptides described here may be joined with fibronectin domains.

(31) Fibronectin domain is a high molecular weight glycoprotein of the extracellular matrix, or a fragment thereof, that binds to, e.g., membrane-spanning receptor proteins such as integrins and extracellular matrix components such as collagens and fibrins. In some embodiments of the present invention, a fibronectin domain is joined to the N-terminus of the Fc domain in a GDNF fusion polypeptide of the invention to increase the serum half-life of the GDNF fusion polypeptide. A fibronectin domain can be joined, either directly or through a linker, to the N-terminus of the Fc domain. In other embodiments, a fibronectin domain is joined, either directly or through a linker, to the N-terminus of a GDNF variant.

(32) As one example, fibronectin domains that can be used in the methods and compositions described here are generally known in the art. In one embodiment, the fibronectin domain is a fibronectin type III domain (SEQ ID NO: 30) having amino acids 610-702 of the sequence of UniProt ID NO: P02751. In another embodiment, the fibronectin domain is an adnectin protein.

(33) Fibronectin domains can be fused genetically to GDNF fusion polypeptides or joined to GDNF fusion polypeptides through chemical means, e.g., chemical conjugation. If desired, a spacer can be inserted between the GDNF fusion polypeptide and the fibronectin domain. Without being bound to a theory, it is expected that inclusion of a fibronectin domain in a GDNF fusion polypeptide of the invention may lead to prolonged retention of the therapeutic protein through its binding to integrins and extracellular matrix components such as collagens and fibrins.

(34) VI. Serum Albumin

(35) Binding to serum albumins can improve the pharmacokinetics of protein pharmaceuticals, and in particular the GDNF fusion polypeptides described here may be joined with serum albumins.

(36) Serum albumin is a globular protein that is the most abundant blood protein in mammals. Serum albumin is produced in the liver and constitutes about half of the blood serum proteins. It is monomeric and soluble in the blood. Some of the most crucial functions of serum albumin include transporting hormones, fatty acids, and other proteins in the body, buffering pH, and maintaining osmotic pressure needed for proper distribution of bodily fluids between blood vessels and body tissues. In preferred embodiments, serum albumin is human serum albumin. In some embodiments of the present invention, a human serum albumin is joined to the N-terminus of the Fc domain in a GDNF fusion polypeptide of the invention to increase the serum half-life of the GDNF fusion polypeptide. A human serum albumin can be joined, either directly or through a linker, to the N-terminus of the Fc domain. In other embodiments, a human serum albumin is joined, either directly or through a linker, to the N-terminus of a GDNF variant.

(37) As one example, serum albumins that can be used in the methods and compositions described here are generally known in the art. In one embodiment, the serum albumin includes the sequence of UniProt ID NO: P02768 (SEQ ID NO: 31).

(38) Serum albumins can be fused genetically to GDNF fusion polypeptides or joined to GDNF fusion polypeptides through chemical means, e.g., chemical conjugation. If desired, a spacer can be inserted between the GDNF fusion polypeptide and the human serum albumin. Without being bound to a theory, it is expected that inclusion of a human serum albumin in a GDNF fusion polypeptide of the invention may lead to prolonged retention of the therapeutic protein.

(39) VII. Linkers

(40) In the present invention, a linker is used to describe a linkage or connection between polypeptides or protein domains and/or associated non-protein moieties. In some embodiments, a linker is a linkage or connection between an Fc domain, an albumin-binding peptide, a fibronectin domain, or a human serum albumin, and a GDNF variant, for which the linker connects the C-terminus of the Fc domain, the albumin-binding peptide, the fibronectin domain, or the human serum albumin to the N-terminus of the GDNF variant, such that the two polypeptides are joined to each other in tandem series.

(41) A linker can be a simple covalent bond, e.g., a peptide bond, a synthetic polymer, e.g., a polyethylene glycol (PEG) polymer, or any kind of bond created from a chemical reaction, e.g. chemical conjugation. In the case that a linker is a peptide bond, the carboxylic acid group at the C-terminus of one protein domain can react with the amino group at the N-terminus of another protein domain in a condensation reaction to form a peptide bond. Specifically, the peptide bond can be formed from synthetic means through a conventional organic chemistry reaction well-known in the art, or by natural production from a host cell, wherein a nucleic acid molecule encoding the DNA sequences of both proteins, e.g., an Fc domain and a GDNF variant, in tandem series can be directly transcribed and translated into a contiguous polypeptide encoding both proteins by the necessary molecular machineries, e.g., DNA polymerase and ribosome, in the host cell.

(42) In the case that a linker is a synthetic polymer, e.g., a PEG polymer, the polymer can be functionalized with reactive chemical functional groups at each end to react with the terminal amino acids at the connecting ends of two proteins.

(43) In the case that a linker (except peptide bond mentioned above) is made from a chemical reaction, chemical functional groups, e.g., amine, carboxylic acid, ester, azide, or other functional groups commonly used in the art, can be attached synthetically to the C-terminus of one protein and the N-terminus of another protein, respectively. The two functional groups can then react to through synthetic chemistry means to form a chemical bond, thus connecting the two proteins together. Such chemical conjugation procedures are routine for those skilled in the art.

(44) Spacer

(45) In the present invention, a linker between an Fc domain, an albumin-binding peptide, a fibronectin domain, or a human serum albumin, and a GDNF variant, can be an amino acid spacer including 3-200 amino acids. Suitable peptide spacers are known in the art, and include, for example, peptide linkers containing flexible amino acid residues such as glycine and serine. In certain embodiments, a spacer can contain motifs, e.g., multiple or repeating motifs, of GS, GGS, GGG (SEQ ID NO: 4), GGGGS (SEQ ID NO: 5), GGSG (SEQ ID NO: 6), or SGGG (SEQ ID NO: 7). In certain embodiments, a spacer can contain 2 to 12 amino acids including motifs of GS, e.g., GS, GSGS (SEQ ID NO: 8), GSGSGS (SEQ ID NO: 9), GSGSGSGS (SEQ ID NO: 10), GSGSGSGSGS (SEQ ID NO: 11), or GSGSGSGSGSGS (SEQ ID NO: 12). In certain other embodiments, a spacer can contain 3 to 12 amino acids including motifs of GGS, e.g., GGS, GGSGGS (SEQ ID NO: 13), GGSGGSGGS (SEQ ID NO: 14), and GGSGGSGGSGGS (SEQ ID NO: 15). In yet other embodiments, a spacer can contain 4 to 12 amino acids including motifs of GGSG (SEQ ID NO: 16), e.g., GGSG (SEQ ID NO: 17), GGSGGGSG (SEQ ID NO: 18), or GGSGGGSGGGSG (SEQ ID NO: 19). In other embodiments, a spacer can contain motifs of GGGGS (SEQ ID NO: 20), e.g., GGGGSGGGGSGGGGS (SEQ ID NO: 21). In other embodiments, a spacer can also contain amino acids other than glycine and serine, e.g., GGGGAGGGG (SEQ ID NO: 22), GENLYFQSGG (SEQ ID NO: 23), SACYCELS (SEQ ID NO: 24), RSIAT (SEQ ID NO: 25), RPACKIPNDLKQKVMNH (SEQ ID NO: 26), GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 27), AAANSSIDLISVPVDSR (SEQ ID NO: 28), or GGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGS (SEQ ID NO: 29). In certain embodiments in the present invention, a 3- or 9-amino acid peptide spacer is used to connect an Fc domain, an albumin-binding peptide, a fibronectin domain, or a human serum albumin, and a GDNF variant in tandem series. The 3- and 9-amino acid peptide spacers consisting of sequences GGG (SEQ ID NO: 4) and GGGGAGGGG (SEQ ID NO: 22), respectively. The length of the peptide spacer and the amino acids used can be adjusted depending on the two protein domains involved and the degree of flexibility desired in the final protein fusion polypeptide. The length of the spacer can be adjusted to ensure proper protein folding and avoid aggregate formation. For example, a small GDNF variant (e.g., a GDNF variant having amino acids 117-211 or 118-211 of SEQ ID NO: 1) can be joined to a longer spacer (e.g., a spacer of the sequence GGGGAGGGG (SEQ ID NO: 22)) rather than a shorter spacer (e.g., GGG (SEQ ID NO: 4)).

(46) VIII. Vectors, Host Cells, and Protein Production

(47) The GDNF fusion polypeptides of the invention can be produced from a host cell. A host cell refers to a vehicle that includes the necessary cellular components, e.g., organelles, needed to express the polypeptides and fusion polypeptides described herein from their corresponding nucleic acids. The nucleic acids may be included in nucleic acid vectors that can be introduced into the host cell by conventional techniques known in the art (e.g., transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc). The choice of nucleic acid vectors depends in part on the host cells to be used. Generally, preferred host cells are of either prokaryotic (e.g., bacterial) or eukaryotic (e.g., mammalian) origin.

(48) Nucleic Acid Vector Construction and Host Cells

(49) A nucleic acid sequence encoding the amino acid sequence of a GDNF fusion polypeptide of the invention may be prepared by a variety of methods known in the art. These methods include, but are not limited to, oligonucleotide-mediated (or site-directed) mutagenesis and PCR mutagenesis. A nucleic acid molecule encoding a GDNF fusion polypeptide of the invention may be obtained using standard techniques, e.g., gene synthesis. Alternatively, a nucleic acid molecule encoding a wild-type human GDNF may be truncated and/or mutated to contain specific amino acid substitutions using standard techniques in the art, e.g., QuikChange mutagenesis. Nucleic acid molecules can be synthesized using a nucleotide synthesizer or PCR techniques.

(50) A nucleic acid sequence encoding a GDNF fusion polypeptide of the invention may be inserted into a vector capable of replicating and expressing the nucleic acid molecule in prokaryotic or eukaryotic host cells. Many vectors are available in the art and can be used for the purpose of the invention. Each vector may contain various components that may be adjusted and optimized for compatibility with the particular host cell. For example, the vector components may include, but are not limited to, an origin of replication, a selection marker gene, a promoter, a ribosome binding site, a signal sequence, the nucleic acid sequence encoding protein of interest, and a transcription termination sequence.

(51) In some embodiments, mammalian cells are used as host cells for the invention. Examples of mammalian cell types include, but are not limited to, human embryonic kidney (HEK) (e.g., HEK293, HEK 293F), Chinese hamster ovary (CHO), HeLa, COS, PC3, Vero, MC3T3, NS0, Sp2/0, VERY, BHK, MDCK, W138, BT483, Hs578T, HTB2, BT20, T47D, NS0 (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7O3O, and HsS78Bst cells. In other embodiments, E. coli cells are used as host cells for the invention. Examples of E. coli strains include, but are not limited to, E. coli 294 (ATCC 31,446), E. coli 1776 (ATCC 31,537, E. coli BL21 (DE3) (ATCC BAA-1025), and E. coli RV308 (ATCC 31,608). Different host cells have characteristic and specific mechanisms for the posttranslational processing and modification of protein products. Appropriate cell lines or host systems may be chosen to ensure the correct modification and processing of the GDNF fusion polypeptide expressed. The above-described expression vectors may be introduced into appropriate host cells using conventional techniques in the art, e.g., transformation, transfection, electroporation, calcium phosphate precipitation, and direct microinjection. Once the vectors are introduced into host cells for protein production, host cells are cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences. Methods for expression of therapeutic proteins are known in the art, see, for example, Paulina Balbas, Argelia Lorence (eds.) Recombinant Gene Expression: Reviews and Protocols (Methods in Molecular Biology), Humana Press; 2nd ed. 2004 and Vladimir Voynov and Justin A. Caravella (eds.) Therapeutic Proteins: Methods and Protocols (Methods in Molecular Biology) Humana Press; 2nd ed. 2012.

(52) Protein Production, Recovery, and Purification

(53) Host cells used to produce the GDNF fusion polypeptides of the invention may be grown in media known in the art and suitable for culturing of the selected host cells. Examples of suitable media for mammalian host cells include Minimal Essential Medium (MEM), Dulbecco's Modified Eagle's Medium (DMEM), Expi293 Expression Medium, DMEM with supplemented fetal bovine serum (FBS), and RPMI-1640. Examples of suitable media for bacterial host cells include Luria broth (LB) plus necessary supplements, such as a selection agent, e.g., ampicillin. Host cells are cultured at suitable temperatures, such as from about 20 C. to about 39 C., e.g., from 25 C. to about 37 C., preferably 37 C., and CO.sub.2 levels, such as 5 to 10% (preferably 8%). The pH of the medium is generally from about 6.8 to 7.4, e.g., 7.0, depending mainly on the host organism. If an inducible promoter is used in the expression vector of the invention, protein expression is induced under conditions suitable for the activation of the promoter.

(54) Protein recovery typically involves disrupting the host cell, generally by such means as osmotic shock, sonication, or lysis. Once the cells are disrupted, cell debris may be removed by centrifugation or filtration. The proteins may be further purified. A GDNF fusion polypeptide may be purified by any method known in the art of protein purification, for example, by chromatography (e.g., ion exchange, affinity, and size-exclusion column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. For example, the protein can be isolated and purified by appropriately selecting and combining affinity columns such as Protein A column (e.g., POROS Protein A chromatography) with chromatography columns (e.g., POROS HS-50 cation exchange chromatography), filtration, ultra filtration, salting-out and dialysis procedures. In some instances, a GDNF fusion polypeptide can be conjugated to marker sequences, such as a peptide to facilitate purification. An example of a marker amino acid sequence is a hexa-histidine peptide (His-tag), which binds to nickel-functionalized agarose affinity column with micromolar affinity. Other peptide tags useful for purification include, but are not limited to, the hemagglutinin HA tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., Cell 37:767, 1984).

(55) Alternatively, GDNF fusion polypeptides can be produced by the cells of a subject (e.g., a human), e.g., in the context of gene therapy, by administrating a vector (such as a viral vector (e.g., a retroviral vector, adenoviral vector, poxviral vector (e.g., vaccinia viral vector, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vector, and alphaviral vector)) containing a nucleic acid molecule encoding the GDNF fusion polypeptide of the invention. The vector, once inside a cell of the subject (e.g., by transformation, transfection, electroporation, calcium phosphate precipitation, direct microinjection, infection, etc) will promote expression of the GDNF fusion polypeptide, which is then secreted from the cell. If treatment of a disease or disorder is the desired outcome, no further action may be required. If collection of the protein is desired, blood may be collected from the subject and the protein purified from the blood by methods known in the art.

(56) IX. Pharmaceutical Compositions and Preparations

(57) The invention features pharmaceutical compositions that include one or more GDNF fusion polypeptides described herein. In some embodiments, pharmaceutical compositions of the invention contain one or more GDNF fusion polypeptides of the invention as the therapeutic proteins. In other embodiments, pharmaceutical compositions of the invention containing one or more GDNF fusion polypeptides may be used in combination with other agents (e.g., therapeutic biologics and/or small molecules) or compositions in a therapy. In addition to a therapeutically effective amount of the GDNF fusion polypeptide, the pharmaceutical compositions may contain one or more pharmaceutically acceptable carriers or excipients, which can be formulated by methods known to those skilled in the art. In other embodiments, pharmaceutical compositions of the invention contain nucleic acid molecules (DNA or RNA, e.g., mRNA) encoding one or more GDNF fusion polypeptides of the invention, or vectors containing such nucleic acid molecules.

(58) Acceptable carriers and excipients in the pharmaceutical compositions are nontoxic to recipients at the dosages and concentrations employed. Acceptable carriers and excipients may include buffers such as phosphate, citrate, HEPES, and TAE, antioxidants such as ascorbic acid and methionine, preservatives such as hexamethonium chloride, octadecyldimethylbenzyl ammonium chloride, resorcinol, and benzalkonium chloride, proteins such as human serum albumin, gelatin, dextran, and immunoglobulins, hydrophilic polymers such as polyvinylpyrrolidone, amino acids such as glycine, glutamine, histidine, and lysine, and carbohydrates such as glucose, mannose, sucrose, and sorbitol. Pharmaceutical compositions of the invention can be administered parenterally in the form of an injectable formulation. Pharmaceutical compositions for injection can be formulated using a sterile solution or any pharmaceutically acceptable liquid as a vehicle. Pharmaceutically acceptable vehicles include, but are not limited to, sterile water, physiological saline, and cell culture media (e.g., Dulbecco's Modified Eagle Medium (DMEM), -Modified Eagles Medium (-MEM), F-12 medium). Formulation methods are known in the art, see e.g., Banga (ed.) Therapeutic Peptides and Proteins: Formulation, Processing and Delivery Systems (2nd ed.) Taylor & Francis Group, CRC Press (2006).

(59) The pharmaceutical compositions of the invention may be prepared in microcapsules, such as hydroxylmethylcellulose or gelatin-microcapsule and poly-(methylmethacrylate) microcapsule. The pharmaceutical compositions of the invention may also be prepared in other drug delivery systems such as liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules. Such techniques are described in Remington: The Science and Practice of Pharmacy 22.sup.th edition (2012). The pharmaceutical compositions to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.

(60) The pharmaceutical compositions of the invention may also be prepared as a sustained-release formulation. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the GDNF fusion polypeptides of the invention. Examples of sustained release matrices include polyesters, hydrogels, polyactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as LUPRON DEPOT, and poly-D-()-3-hydroxybutyric acid. Some sustained-release formulations enable release of molecules over a few months, e.g., one to six months, while other formulations release pharmaceutical compositions of the invention for shorter time periods, e.g., days to weeks.

(61) The pharmaceutical composition may be formed in a unit dose form as needed. The amount of active component, e.g., one or more GDNF fusion polypeptides of the invention, included in the pharmaceutical preparations is such that a suitable dose within the designated range is provided (e.g., a dose within the range of 0.01-30 mg/kg of body weight).

(62) The pharmaceutical composition for gene therapy can be in an acceptable diluent, or can include a slow release matrix in which the gene delivery vehicle is imbedded. If hydrodynamic injection is used as the delivery method, the pharmaceutical composition containing a nucleic acid molecule encoding a GDNF fusion polypeptide or a vector (e.g., a viral vector) containing the nucleic acid molecule is delivered rapidly in a large fluid volume intravenously. Vectors that may be used as in vivo gene delivery vehicle include, but are not limited to, retroviral vectors, adenoviral vectors, poxviral vectors (e.g., vaccinia viral vectors, such as Modified Vaccinia Ankara), adeno-associated viral vectors, and alphaviral vectors.

(63) X. Routes, Dosage, and Administration

(64) Pharmaceutical compositions that contain one or more GDNF fusion polypeptides of the invention as the therapeutic proteins may be formulated for intravenous administration, parenteral administration, subcutaneous administration, intramuscular administration, intra-arterial administration, intrathecal administration, or intraperitoneal administration. The pharmaceutical composition may also be formulated for, or administered via, oral, nasal, spray, aerosol, rectal, or vaginal administration. For injectable formulations, various effective pharmaceutical carriers are known in the art. See, e.g., Pharmaceutics and Pharmacy Practice, J. B. Lippincott Company, Philadelphia, Pa., Banker and Chalmers, eds., pages 238-250 (1982), and ASHP Handbook on Injectable Drugs, Toissel, 4th ed., pages 622-630 (1986).

(65) In some embodiments, pharmaceutical compositions that contain nucleic acid molecules encoding one or more GDNF fusion polypeptides of the invention or vectors containing such nucleic acid molecules may be administered by way of gene delivery. Methods of gene delivery are well-known to one of skill in the art. Vectors that may be used for in vivo gene delivery and expression include, but are not limited to, retroviral vectors, adenoviral vectors, poxviral vectors (e.g., vaccinia viral vectors, such as Modified Vaccinia Ankara (MVA)), adeno-associated viral vectors, and alphaviral vectors. In some embodiments, a vector can include an internal ribosome entry site (IRES) that allows the expression of multiple GDNF fusion polypeptides. In certain embodiments, mRNA molecules encoding one or more GDNF fusion polypeptides may be administered directly to a subject.

(66) In some embodiments of the present invention, nucleic acid molecules encoding one or more GDNF fusion polypeptides or vectors containing such nucleic acid molecules may be administered using a hydrodynamic injection platform. In the hydrodynamic injection method, a nucleic acid molecule encoding a GDNF fusion polypeptide is put under the control of a strong promoter in an engineered plasmid (e.g., a viral plasmid). The plasmid is often delivered rapidly in a large fluid volume intravenously. Hydrodynamic injection uses controlled hydrodynamic pressure in veins to enhance cell permeability such that the elevated pressure from the rapid injection of the large fluid volume results in fluid and plasmid extravasation from the vein. The expression of the nucleic acid molecule is driven primarily by the liver. In mice, hydrodynamic injection is often performed by injection of the plasmid into the tail vein. In certain embodiments, mRNA molecules encoding one or more GDNF fusion polypeptides may be administered using hydrodynamic injection.

(67) The dosage of the pharmaceutical compositions of the invention depends on factors including the route of administration, the disease to be treated, and physical characteristics, e.g., age, weight, general health, of the subject. Typically, the amount of a GDNF fusion polypeptide of the invention contained within a single dose may be an amount that effectively prevents, delays, or treats the disease without inducing significant toxicity. A pharmaceutical composition of the invention may include a dosage of a GDNF fusion polypeptide of the invention ranging from 0.01 to 500 mg/kg (e.g., 0.01, 0.1, 0.2, 0.3, 0.4, 0.5, 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 100, 150, 200, 250, 300, 350, 400, 450, or 500 mg/kg) and, in a more specific embodiment, about 0.1 to about 30 mg/kg and, in a more specific embodiment, about 1 to about 30 mg/kg. The dosage may be adapted by the physician in accordance with conventional factors such as the extent of the disease and different parameters of the subject.

(68) The pharmaceutical compositions are administered in a manner compatible with the dosage formulation and in such amount as is therapeutically effective to result in an improvement or remediation of the symptoms. The pharmaceutical compositions are administered in a variety of dosage forms, e.g., intravenous dosage forms, subcutaneous dosage forms, and oral dosage forms (e.g., ingestible solutions, drug release capsules). Generally, therapeutic proteins are dosed at 0.1-100 mg/kg, e.g., 1-50 mg/kg. Pharmaceutical compositions that contain a GDNF fusion polypeptide of the invention may be administered to a subject in need thereof, for example, one or more times (e.g., 1-10 times or more) daily, weekly, monthly, biannually, annually, or as medically necessary. Dosages may be provided in either a single or multiple dosage regimens. The timing between administrations may decrease as the medical condition improves or increase as the health of the patient declines.

(69) XI. Indications

(70) The pharmaceutical compositions and methods of the invention are useful to treat and/or prevent medical conditions, such as metabolic diseases, e.g., obesity and diabetes (Type-1 and Type-2 diabetes), and neurological diseases.

(71) In some embodiments, pharmaceutical compositions containing the GDNF fusion polypeptides of the invention may be used to prevent the development of obesity and/or to treat patients already diagnosed with obesity. For example, administration of the GDNF fusion polypeptides of the invention to a subject may help to reduce the body weight of the subject by decreasing the amount of fat, while maintaining the amount of lean mass (see, e.g., Examples 5 and 7).

(72) In some embodiments, pharmaceutical compositions containing the GDNF fusion polypeptides of the invention may be used to prevent the development of diabetes (e.g., Type-1 and Type-2 diabetes) and/or to treat patients already diagnosed with diabetes. Patients who are likely to develop diabetes, e.g., individuals with genetic disposition, family history of diabetes, association with other autoimmune diseases, or other metabolic diseases, may be administered the GDNF fusion polypeptides of the invention prophylactically, such that the GDNF fusion polypeptides may maintain the normal function and health of -cells and prevent or delay the autoimmune inflammatory damage to -cells. In other embodiments, pharmaceutical compositions containing the GDNF fusion polypeptides of the invention may be administered to individuals before they would be diagnosed with diabetes (e.g., Type-1 and Type-2 diabetes) or develop clinical symptoms of diabetes, e.g., high blood glucose level, high fasting insulin level, insulin resistance, polyuria, polydipsia, and polyphagia. In some embodiments, the GDNF fusion polypeptides may be administered to patients prior to the patients needing insulin. In yet other embodiments, the administration of GDNF fusion polypeptides may delay or postpone the need for insulin treatment in diabetic patients. For example, administration of the GDNF fusion polypeptides of the invention to a subject may help to increase the rate of glucose clearance from the blood (see, e.g., Example 8).

(73) The pharmaceutical compositions and methods of the invention are also useful to treat neurological diseases including, but are not limited to, schizophrenia, epilepsy, Amyotrophic lateral sclerosis (ALS), Parkinson's disease, Alzheimer's disease, Huntington's disease, anxiety, stroke, a brain tumor, and a brain metastasis.

EXAMPLES

Example 1

Expression of GDNF Fusion Polypeptides

(74) For expression of the GDNF fusion polypeptides, vectors containing nucleic acid molecules encoding GDNF fusion polypeptides were transfected into Chinese hamster ovary (CHO) cells through electroporation. After protein expression, the expressed fusion polypeptides were purified from the cell culture supernatant by Protein A-based affinity column chromatography. Purified GDNF fusion polypeptides were analyzed by western blot using anti-GDNF antibody. FIG. 1A shows the expression of five GDNF fusion polypeptides:

(75) TABLE-US-00002 Fusionpolypeptide1: (SEQIDNO:32) Fc-hGDNF.sub.78-211 Fusionpolypeptide2: (SEQIDNO:33) Fc-GGG-hGDNF.sub.92-211 Fusionpolypeptide3: (SEQIDNO:34) Fc-GGG-hGDNF.sub.110-211 Fusion polypeptide4: (SEQIDNO:35) Fc-GGG-hGDNF.sub.117-211 Fusionpolypeptide5: (SEQIDNO:36) Fc-GGGGAGGGG-hGDNF.sub.117-211

(76) Each fusion polypeptide described above is encoded by a single open reading frame. Each of the five fusion polypeptides was analyzed on day 2 and day 6. As shown in FIG. 1A, fusion polypeptide 1, which includes the potential proteolytic cleavage site (i.e., amino acids 85-120 of SEQ ID NO: 1), appeared to generate degradation products by day 6.

(77) Each of fusion polypeptides 2, 3, and 4 was also analyzed under either reducing or non-reducing condition (FIG. 1B).

Example 2

Binding Affinities

(78) Surface Plasmon Resonance (SPR) was used to determine the binding affinities of the GDNF fusion polypeptides to GFR1. The GDNF fusion polypeptides in this example include fusion polypeptides 2-4 as described in Example 1, as well as Fc (T366W)-GGG-hGDNF.sub.117-211 (SEQ ID NO: 37) (fusion polypeptide 6) which has an Fc domain having the amino acid substitution T366W (relative to the sequence of human IgG1) joined to the N-terminus of the GDNF variant having amino acids 117-211 of SEQ ID NO: 1 through a GGG linker. The SPR assay was configured to capture human GFR1, GFR2, and GFR3 Fc chimeras (R&D Systems) onto a CM5 chip surface using His-tag capture kit (GE Healthcare) to appropriate levels for kinetic analysis. GDNF fusion polypeptides were flowed over the immobilized GFRs to measure the kinetics of GDNF fusion polypeptide and GFR association and dissociation. The binding of various concentrations of GDNF fusion polypeptides was measured in HBS-EP buffer (GE Healthcare) at a flow rate of 30 L/min. Binding curves were fitted using Scrubber2 software to obtain apparent binding affinities and kinetic constants.

(79) Table 1 shows that the equilibrium dissociation constant, K.sub.D, of the GDNF fusion polypeptides of the invention ranged from 870 pM (fusion polypeptide 2) to 3.8 nM (fusion polypeptide 4) for binding to human GDNF family receptor alpha-1 (GFR1) joined to an Fc domain at its C-terminus.

(80) TABLE-US-00003 TABLE 1 Binding affinities of GDNF fusion polypeptides to GFR1 GFRa1-hFc K.sub.D, app R&D hGDNF ~900 pM Fusion polypeptide 2 (Fc-GGG-hGDNF.sub.92-211) 160 pM Fusion polypeptide 3 (Fc-GGG-hGDNF.sub.110-211) 870 pM Fusion polypeptide 4 (Fc-GGG-hGDNF.sub.117-211) 3.8 nM Fusion polypeptide 6 (Fc (T366W)-GGG-hGDNF.sub.117-211) 4.9 nM

Example 3

GFR1 Reporter Assay

(81) HEK293T cells were seeded in a 96-well collagen-coated plate at a density of 20,000 cells/well in DMEM containing 10% FBS and antibiotics. Six hours later, cells were transfected with pFR-Luc (62.5 ng), pFA-ELK1 (7.5 ng), hRet (10.5 ng) and GFR1 (4.5 ng) plasmids using Fugene 6 according to manufacturer's instructions. The next day, cells were washed once with PBS and placed in fresh DMEM containing 1% FBS for 6-8 hours. Cells were then treated with GDNF fusion polypeptides at the indicated concentration for 16 hours. Luciferase activity was determined using luciferin as substrate (Bright-Glo, Promega).

Example 4

In Vivo Serum Concentration

(82) To measure the in vivo serum concentrations of GDNF fusion polypeptides 2-4 (described in Example 1) and 6 (described in Example 2) of the invention, mice of transgenic mouse strain C57BL/6NTa were injected with 10 g of nucleic acid molecule encoding the GDNF fusion polypeptide by way of hydrodynamic injection. Serum concentrations of the GDNF fusion polypeptide were measured using enzyme-linked immunosorbent assay (ELISA) at different time points post injection using blood samples taken from the mice. The results, shown in FIG. 2, indicate that the half-life is greater than 48 hours in mice.

Example 5

Effect of Fusion Polypeptide 6 on Body Weight

(83) To measure the effect of fusion polypeptide 6 (described in Example 2) on body weight, three mice of transgenic mouse strain C57BL/6NTa were injected intraperitoneally with 0.3, 3.0, or 10.0 mg/kg fusion polypeptide 6 or with phosphate buffered saline (PBS) on day 0. The average body weight of three mice was recorded every two or three days. The percent body weight change was also calculated and recorded. FIG. 3 shows that treatment with fusion polypeptide 6 reduced body weight in a dose-dependent manner.

Example 6

Effect of Fusion Polypeptide 6 on Food Intake

(84) Using the same protocol as describe in Example 5, mice injected with different dosages of fusion polypeptide 6 or PBS were monitored for the amount of food intake (i.e., a high-fat diet (HFD)). The average daily amount of food intake was measured and recorded every two or three days starting on day 0. FIG. 4 shows that treatment with fusion polypeptide 6 had no significant effect on the mice's appetite for food intake.

Example 7

Effect of Fusion Polypeptide 6 on Body Composition

(85) Using the same protocol as describe in Example 5, the change in the amount of fat, lean mass, and fluid of the mice injected with different dosages of fusion polypeptide 6 or PBS were measured on day 18 post injection.
Change from baseline=(final weight of fat, lean mass, or fluid)(initial weight of fat, lean mass, or fluid)
Percent change from baseline=100[(final weightinitial weight)/(initial weight)]

(86) As shown in FIG. 5, treatment with fusion polypeptide 6 significantly decreased the amount of fat without affecting lean mass in the body, indicating that the weight loss of the mice is fully attributable to a reduction in adiposity.

Example 8

Effect of Fusion Polypeptide 6 on Rate of Glucose Clearance

(87) Using the same protocol as describe in Example 5, mice injected with different dosages of fusion polypeptide 6 or PBS were subjected to a glucose tolerance test (GTT). Following a 5-hour fast, fasting blood glucose levels of mice were measured and recorded. Mice were the injected intraperitoneally with D-glucose at a dose of 2 g/kg body weight. Blood glucose measurements were taken at 15, 30, 60, 90 and 120 minutes post glucose injection. All samples were taken from tail vein bleeds and measured with a glucometer.

(88) As shown in FIG. 6, treatment with fusion polypeptide 6 significantly improved the rate of glucose clearance. The level of serum glucose in mice injected with 10 mg/kg fusion polypeptide 6 was back to the initial level of serum glucose before GTT after 2 hours.

Other Embodiments

(89) While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure come within known or customary practice within the art to which the invention pertains and may be applied to the essential features hereinbefore set forth.

(90) All publications, patents, and patent applications are herein incorporated by reference in their entirety to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety.

(91) Other embodiments are within the following claims.