Method for producing recombinant alkaline phosphatase
11913039 ยท 2024-02-27
Assignee
Inventors
- Rahul Godawat (Woodbridge, CT, US)
- Meghan DEWITT (Madison, CT, US)
- Siguang SUI (South Glastonbury, CT, US)
- Saravanamoorthy RAJENDRAN (Long Valley, NJ, US)
Cpc classification
C07K1/22
CHEMISTRY; METALLURGY
C12N5/0682
CHEMISTRY; METALLURGY
C12Y204/99
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
International classification
C07K1/22
CHEMISTRY; METALLURGY
Abstract
A method of producing recombinant alkaline phosphatase comprising control of production parameters, particularly harvest clarified culture fluid (HCCF) and filtration pool (UFDF), to provide a defined total sialic acid content.
Claims
1. A method of producing recombinant alkaline phosphatase comprising: (I) (a) inoculating Chinese Hamster Ovary (CHO) cells expressing recombinant alkaline phosphatase; (b) culturing the CHO cells in culture medium; (c) isolating the recombinant alkaline phosphatase from the culture medium by at least one purification step to form harvest clarified culture fluid (HCCF) with a total sialic acid content (TSAC) of about 2.1 mol/mol to about 4.3 mol/mol; (d) performing at least one additional protein purification step to form a filtration pool (UFDF), wherein the UFDF is held at a temperature of about 13 C. to about 27 C. for about 14 hours to about 42 hours, and at a protein concentration of about 2.0 g/L to about 4.3 g/L to reduce TSAC loss; and (e) subjecting the UFDF to at least one chromatography step to obtain partially purified recombinant alkaline phosphatase; and (f) recovering the recombinant alkaline phosphatase from the UFDF, wherein the recombinant alkaline phosphatase has a TSAC of about 1.2 mol/mol to about 3.0 mol/mol; or (II) (a) inoculating CHO cells expressing recombinant alkaline phosphatase; (b) culturing the CHO cells in culture medium to produce a cell culture; (c) adding a nutrient supplement to the culture medium; (d) isolating the recombinant alkaline phosphatase from the culture medium by at least one purification step to form a filtration pool (Ultrafiltration/Diafiltration UFDF), wherein the UFDF is held at a temperature of about 13 C. to about 27 C. for about 14 hours to about 42 hours, and at a protein concentration of about 2.0 g/L to about 4.3 g/L to reduce TSAC loss; and (e) recovering the recombinant alkaline phosphatase from the UFDF, wherein the recombinant alkaline phosphatase in the UFDF has a TSAC of about 1.2 mol/mol to about 3.0 mol/mol.
2. The method of claim 1, wherein the culture medium comprises sialidase and the sialidase is selectively removed from the culture medium, the HCCF, and/or the UFDF and/or an exogenous sialyltransferase is added to the culture medium, the HCCF, and/or the UFDF.
3. The method of claim 1, wherein: (i) the culturing of the CHO cells in the culture medium is at a temperature of about 36 C. to about 38 C.; (ii) the nutrient supplement is added to the culture medium at least one day after inoculation of CHO cells into the culture medium; (iii) the nutrient supplement is added at more than 2 different times; (iv) the culture medium is selected from the group consisting of serum-free medium; CD DG44 Medium; SFM4CHO Medium; and combinations thereof; (v) the culturing of the CHO cells is in a 0.25 L to a 25,000 L bioreactor; (vi) the temperature of the culture medium is decreased about 80 hours to about 120 hours after the inoculation; (vii) step (d) of (I) or (II) occurs about 10 to about 14 days after inoculation; (viii) the TSAC of the HCCF is about 2.2 mol/mol to about 3.6 mol/mol; and/or (ix) the at least one additional purification step comprises at least one of harvest clarification, filtration, ultrafiltration, diafiltration, viral inactivation, affinity capture, and combinations thereof.
4. The method of claim 3, wherein: (a) the culturing of the CHO cells in the culture medium is at a temperature of about 37 C.; (b) the culturing of the CHO cells is in a 100 L to 25,000 L bioreactor; (c) the TSAC of the HCCF is about 2.2 mol/mol to about 3.4 mol/mol; and/or (d) the at least one additional purification step comprises ultrafiltration and/or diafiltration.
5. The method of claim 4, wherein the culturing of the CHO cells is in a 2000 L to 20,000 L bioreactor.
6. The method of claim 1, wherein: (i) the UFDF is held at a temperature of about 14 C. to about 26 C.; and/or (ii) the UFDF has an alkaline phosphatase concentration of about 3.3 g/L to about 4.1 g/L.
7. The method of claim 6, wherein: (a) the UFDF is held at a temperature of about 15 C. to about 26 C.; and/or (b) the UFDF has a protein concentration of about 3.1 g/L.
8. The method of claim 7, wherein one or more of: (i) the UFDF is held at a temperature of about 15 C. to about 25 C.; and (ii) the at least one additional chromatography step and/or the at least one additional protein purification step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 1.4 mol/mol to about 2.6 mol/mol.
9. The method of claim 8, wherein one or more of: (a) the UFDF is held at a temperature of about 19 C. to about 25 C.; and (b) the UFDF is held for about 17 hours to about 34 hours.
10. The method of claim 9, wherein the UFDF is held for about 19 hours to about 33 hours.
11. The method of claim 10, wherein the UFDF is held for about 25 hours to about 38 hours.
12. The method of claim 11, wherein the UFDF is held for about 29 hours to about 35 hours.
13. The method of claim 1, wherein: (i) the at least one chromatography step is protein affinity chromatography; (ii) the at least one chromatography step is Protein A chromatography; (iii) the at least one chromatography step comprises column chromatography; (iv) the at least one chromatography step comprises hydrophobic interaction chromatography; (v) the at least one additional protein purification step of (I) comprises an additional diafiltration; (vi) the at least one chromatography step and/or the at least one additional protein purification step comprises hydrophobic interaction chromatography and/or at least one additional diafiltration step; (vii) step (d) of (I) further comprises a viral inactivation step; and/or (viii) step (e) of (I) or (II) further comprises at least one additional chromatography and/or purification step.
14. The method of claim 1, wherein the recombinant alkaline phosphatase comprises the structure of W-sALP-X-Fc-Y-Dn-Z, wherein W is absent or is an amino acid sequence of at least one amino acid; X is absent or is an amino acid sequence of at least one amino acid; Y is absent or is an amino acid sequence of at least one amino acid; Z is absent or is an amino acid sequence of at least one amino acid; F c is a fragment crystallizable region; Dn is a poly-aspartate, poly-glutamate, or combination thereof, wherein n=10 or 16; and sALP is a soluble alkaline phosphatase.
15. The method of claim 14, wherein the recombinant alkaline phosphatase comprises asfotase alfa (SEQ ID NO: 1).
16. The method of claim 13, wherein the recombinant alkaline phosphatase obtained from the protein affinity chromatography is stored at about 2 C. to about 8 C.
17. The method of claim 1, wherein (I) further comprises: (i) adding a nutrient supplement to the culture medium of (b) after inoculation; and/or (ii) measuring recombinant alkaline phosphatase activity.
18. A recombinant alkaline phosphatase produced by the method of claim 1.
19. A filtration pool (UFDF) comprising recombinant alkaline phosphatase produced by the method of claim 1.
20. A composition comprising the recombinant alkaline phosphatase of claim 19, wherein the composition further comprises at least one pharmaceutically acceptable carrier, diluent, or excipient or a combination thereof.
21. The method of claim 1, wherein in step (d) of (I), the UFDF is held at a temperature of 13 C. to 27 C. for 14 hours to 42 hours, and at a protein concentration of 2.0 g/L to 4.3 g/L to reduce the TSAC loss.
22. The method of claim 1, wherein in step (d) of (II), the UFDF is held at a temperature of 13 C. to 27 C. for 14 hours to 42 hours, and at a protein concentration of 2.0 g/L to 4.3 g/L to reduce the TSAC loss.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) In the appended drawings:
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
DETAILED DESCRIPTION
Definitions
(14) About, Approximately: As used herein, the terms about and approximately, as applied to one or more particular cell culture conditions or numerical values, refer to a range of values that are similar to the stated reference value for that culture condition, conditions, or numerical values. In certain embodiments, the term about refers to a range of values that fall within 25, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 percent or less of the stated reference value for that culture condition, conditions, or numerical values.
(15) Amino acid: The term amino acid, as used herein, refers to any of the twenty naturally occurring amino acids that are normally used in the formation of polypeptides, or analogs or derivatives of those amino acids Amino acids of the present disclosure can be provided in medium to cell cultures. The amino acids provided in the medium may be provided as salts or in hydrate form.
(16) Batch culture: The term batch culture, as used herein, refers to a method of culturing cells in which all of the components that will ultimately be used in culturing the cells, including the medium (see definition of medium below) as well as the cells themselves, are provided at the beginning of the culturing process. A batch culture is typically stopped at some point and the cells and/or components in the medium are harvested and optionally purified. In some embodiments, the methods described here are used in a batch culture.
(17) Bioreactor: The term bioreactor as used herein refers to any vessel used for the growth of a cell culture (e.g., a mammalian cell culture). The bioreactor can be of any size so long as it is useful for the culturing of cells. Typically, the bioreactor will be at least 1 liter and may be 10, 100, 250, 500, 1000, 2500, 5000, 8000, 10,000, 12,0000, 20,000 liters or more, or any volume in between. In some embodiments, the bioreactor is 100 liters to 25,000 liters, 500 liters to 20,000 liters, 1,000 liters to 20,000 liters, 2,000 liters to 20,000 liters, 5,000 liters to 20,000 liters, or 10,000 liters to 20,000 liters. The internal conditions of the bioreactor, including, but not limited to pH and temperature, are typically controlled during the culturing period. The bioreactor can be composed of any material that is suitable for holding mammalian or other cell cultures suspended in media under the culture conditions of the present disclosure, including glass, plastic or metal. The term production bioreactor as used herein refers to the final bioreactor used in the production of the polypeptide or protein of interest. The volume of the large-scale cell culture production bioreactor is typically at least 500 liters and may be 1000, 2500, 5000, 8000, 10,000, 12,0000, 20,000 liters or more, or any volume in between. One of ordinary skill in the art will be aware of and will be able to choose suitable bioreactors for use in practicing the present disclosure.
(18) Cell density: The term cell density, as used herein, refers to the number of cells present in a given volume of medium.
(19) Cell viability: The term cell viability, as used herein, refers to the ability of cells in culture to survive under a given set of culture conditions or experimental variations. The term as used herein also refers to that portion of cells which are alive at a particular time in relation to the total number of cells, living and dead, in the culture at that time.
(20) Culture and cell culture: These terms, as used herein, refer to a cell population that is suspended in a medium (see definition of medium below) under conditions suitable for survival and/or growth of the cell population. As will be clear to those of ordinary skill in the art, these terms as used herein may refer to the combination comprising the cell population and the medium in which the population is suspended.
(21) Fed-batch culture: The term fed-batch culture, as used herein, refers to a method of culturing cells in which additional components are provided to the culture at some time subsequent to the beginning of the culture process. The provided components typically comprise nutritional supplements for the cells, which have been depleted during the culturing process. A fed-batch culture is typically stopped at some point and the cells and/or components in the medium are harvested and optionally purified. Fed-batch culture may be performed in the corresponding fed-batch bioreactor. In some embodiments, the method comprises a fed-batch culture.
(22) Fragment: The term fragment, as used herein, refers to a polypeptide and is defined as any discrete portion of a given polypeptide that is unique to or characteristic of that polypeptide. The term as used herein also refers to any discrete portion of a given polypeptide that retains at least a fraction of the activity of the full-length polypeptide. In some embodiments the fraction of activity retained is at least 10% of the activity of the full-length polypeptide. In various embodiments the fraction of activity retained is at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the activity of the full-length polypeptide. In other embodiments the fraction of activity retained is at least 95%, 96%, 97%, 98%, or 99% of the activity of the full-length polypeptide. In one embodiment, the fraction of activity retained is 100% of the activity of the full-length polypeptide. The term as used herein also refers to any portion of a given polypeptide that includes at least an established sequence element found in the full-length polypeptide. In some embodiments, the sequence element spans at least 4-5 amino acids of the full-length polypeptide. In some embodiments, the sequence element spans at least about 10, 15, 20, 25, 30, 35, 40, 45, 50 or more amino acids of the full-length polypeptide.
(23) Glycoprotein or glycoproteins: These terms, as used herein, refer to a protein or polypeptide with carbohydrate groups (such as sialic acid) attached to the polypeptide chain.
(24) Medium, media, cell culture medium, and culture medium: These terms, as used herein, refer to a solution containing nutrients which nourish growing mammalian cells. Typically, these solutions provide essential and non-essential amino acids, vitamins, energy sources, lipids, and trace elements required by the cell for minimal growth and/or survival. The solution may also contain components that enhance growth and/or survival above the minimal rate, including hormones and growth factors. The solution is, e.g., formulated to a pH and salt concentration optimal for cell survival and proliferation. In some embodiments, a culture medium may be a defined mediaa serum-free media that contains no proteins, hydrolysates or components of unknown composition. Defined media are free of animal-derived components and all components have a known chemical structure. In some embodiments, the culture medium is a basal medium, i.e., an undefined medium containing a carbon source, water, salts, a source of amino acids and nitrogen (e.g., animal, e.g., beef, or yeast extracts). Various mediums are commercially available and are known to those in the art. In some embodiments, the culture medium is selected from EX-CELL 302 Serum-Free Medium (Signam Aldrich, St. Louis, MO), CD DG44 Medium (ThermoFisher Scientific, Waltham, MA), BD Select Medium (BD Biosciences, San Jose, CA), or a mixture thereof. a mixture of BD Select Medium with SFM4CHO Medium (Hyclone, Logan UT). In some embodiments, the culture medium comprises a combination of SFM4CHO Medium and BD Select Medium. In some embodiments, the culture medium comprises a combination of SFM4CHO Medium and BD Select Medium at a ratio selected from 90/10, 80/20, 75/25, 70/30, 60/40, or 50/50. In some embodiments, the culture medium comprises a combination of SFM4CHO Medium and BD Select Medium at a ratio of 70/30 to 90/10. In some embodiments, the culture medium comprises a combination of SFM4CHO Medium and BD Select Medium at a ratio 75/25.
(25) Osmolality and osmolarity: Osmolality is a measure of the osmotic pressure of dissolved solute particles in an aqueous solution. The solute particles include both ions and non-ionized molecules. Osmolality is expressed as the concentration of osmotically active particles (i.e., osmoles) dissolved in 1 kg of solution (1 mOsm/kg H.sub.2O at 38 C. is equivalent to an osmotic pressure of 19 mm Hg). Osmolarity, by contrast, refers to the number of solute particles dissolved in 1 liter of solution. When used herein the abbreviation mOsm means milliosmoles/kg solution.
(26) Perfusion culture: The term perfusion culture, as used herein, refers to a method of culturing cells in which additional components are provided continuously or semi-continuously to the culture subsequent to the beginning of the culture process. The provided components typically comprise nutritional supplements for the cells, which have been depleted during the culturing process. A portion of the cells and/or components in the medium are typically harvested on a continuous or semi-continuous basis and are optionally purified. In some embodiments, the nutritional supplements as described herein are added in a perfusion culture, i.e., they are provided continuously over a defined period of time.
(27) Polypeptide: The term polypeptide, as used herein, refers a sequential chain of amino acids linked together via peptide bonds. The term is used to refer to an amino acid chain of any length, but one of ordinary skill in the art will understand that the term is not limited to lengthy chains and can refer to a minimal length chain comprising two amino acids linked together via a peptide bond.
(28) Protein: The term protein, as used herein, refers to one or more polypeptides that function as a discrete unit. If a single polypeptide is the discrete functioning unit and does not require permanent physical association with other polypeptides in order to form the discrete functioning unit, the terms polypeptide and protein as used herein are used interchangeably.
(29) Recombinantly-expressed polypeptide and recombinant polypeptide: These terms, as used herein, refer to a polypeptide expressed from a host cell that has been genetically engineered to express that polypeptide. The recombinantly-expressed polypeptide can be identical or similar to a polypeptide that is normally expressed in the mammalian host cell. The recombinantly-expressed polypeptide can also be foreign to the host cell, i.e., heterologous to peptides normally expressed in the host cell. Alternatively, the recombinantly-expressed polypeptide can be chimeric in that portions of the polypeptide contain amino acid sequences that are identical or similar to polypeptides normally expressed in the mammalian host cell, while other portions are foreign to the host cell.
(30) Seeding: The term seeding, as used herein, refers to the process of providing a cell culture to a bioreactor or another vessel. The cells may have been propagated previously in another bioreactor or vessel. Alternatively, the cells may have been frozen and thawed immediately prior to providing them to the bioreactor or vessel. The term refers to any number of cells, including a single cell. In various embodiments, alkaline phosphatase (e.g., asfotase alfa) is produced by a process in which cells are seeded in a density of about 1.010.sup.5 cells/mL, 1.510.sup.5 cells/mL, 2.010.sup.5 cells/mL, 2.510.sup.5 cells/mL, 3.010.sup.5 cells/mL, 3.510.sup.5 cells/mL, 4.010.sup.5 cells/mL, 4.510.sup.5 cells/mL, 5.010.sup.5 cells/mL, 5.510.sup.5 cells/mL, 6.010.sup.5 cells/mL, 6.510.sup.5 cells/mL, 7.010.sup.5 cells/mL, 7.510.sup.5 cells/mL, 8.010.sup.5 cells/mL, 8.510.sup.5 cells/mL, 9.010.sup.5 cells/mL, 9.510.sup.5 cells/mL, 1.010.sup.6 cells/mL, 1.510.sup.6 cells/mL, 2.010.sup.6 cells/mL, or a higher density. In one particular embodiment, in such process cells are seeded in a density of about 4.010.sup.5 cells/mL, 5.510.sup.5 cells/mL or 8.010.sup.5 cells/mL.
(31) Total Sialic Acid Content or TSAC: The term as used herein refers to the amount of sialic acid (a carbohydrate) on a particular protein molecule. It is expressed as moles TSAC per mole of protein, or, mol/mol. TSAC concentration is measured during the purification process. For example, one method of TSAC quantitiation is where TSAC is released from asfotase alfa using acid hydrolysis, and the released TSAC is subsequently detected via electrochemical detection using high-performance anion-exchange chromatography with pulsed amperometric detection technique (HPAE-PAD).
(32) Titer: The term titer, as used herein, refers to the total amount of recombinantly-expressed polypeptide or protein produced by a cell culture divided by a given amount of medium volume. Titer is typically expressed in units of milligrams of polypeptide or protein per milliliter of medium.
(33) Acronyms used herein include, e.g., HCCF: Harvest Clarified Culture Fluid; UF: ultrafiltration, DF: diafiltration; VCD: Viable Cell Density; IVCC: Integral of Viable Cell Concentration; TSAC: Total Sialic Acid Content; HPAE-PAD: High-Performance Anion Exchange Chromatography with Pulsed Amperometric Detection; SEC: Size Exclusion Chromatography; AEX: Anion Exchange Chromatography; LoC: Lab-on-Chip; and MALDI-TOF: Matrix Assisted Laser Desorption/IonizationTime of Flight.
(34) As used herein, the term hydrophobic interaction chromatography (HIC) column refers to a column containing a stationary phase or resin and a mobile or solution phase in which the hydrophobic interaction between a protein and hydrophobic groups on the stationary phase or resin separates a protein from impurities including fragments and aggregates of the subject protein, other proteins or protein fragments and other contaminants such as cell debris, or residual impurities from other purification steps. The stationary phase or resin comprises a base matrix or support such as a cross-linked agarose, silica or synthetic copolymer material to which hydrophobic ligands are attached. Examples of such stationary phase or resins include phenyl-, butyl-, octyl-, hexyl- and other alkyl substituted agarose, silica, or other synthetic polymers. Columns may be of any size containing the stationary phase, or may be open and batch processed. In some embodiments, the recombinant alkaline phosphatase is isolated from the cell culture using HIC.
(35) As used herein, the term preparation refers to a solution comprising a protein of interest (e.g., a recombinant alkaline phosphatase described herein) and at least one impurity from a cell culture producing such protein of interest and/or a solution used to extract, concentrate, and/or purify such protein of interest from the cell culture. For example, a preparation of a protein of interest (e.g., a recombinant alkaline phosphatase described herein) may be prepared by homogenizing cells, which grow in a cell culture and produce such protein of interest, in a homogenizing solution. In some embodiments, the preparation is then subjected to one or more purification/isolation process, e.g., a chromatography step.
(36) As used herein, the term solution refers to a homogeneous, molecular mixture of two or more substances in a liquid form. Specifically, in some embodiments, the proteins to be purified, such as the recombinant alkaline phosphatases or their fusion proteins (e.g., asfotase alfa) in the present disclosure represent one substance in a solution. The term buffer or buffered solution refers to solutions which resist changes in pH by the action of its conjugate acid-base range. Examples of buffers that control pH at ranges of about pH 5 to about pH 7 include HEPES, citrate, phosphate, and acetate, and other mineral acid or organic acid buffers, and combinations of these. Salt cations include sodium, ammonium, and potassium. As used herein the term loading buffer/solution or equilibrium buffer/solution refers to the buffer/solution containing the salt or salts which is mixed with the protein preparation for loading the protein preparation onto a chromatography column, e.g., HIC column. This buffer/solution is also used to equilibrate the column before loading, and to wash to column after loading the protein. The elution buffer/solution refers to the buffer/solution used to elute the protein from the column. As used herein, the term solution refers to either a buffered or a non-buffered solution, including water.
(37) The term sialic acid refers generally to N- or O-substituted derivatives of neuraminic acid, a monosaccharide with a nine-carbon backbone. Sialic acid may also refer specifically to the compound N-acetylneuraminic acid and is sometimes abbreviated as NeuSAc or NANA. Presence of sialic acid may affect absorption, serum half-life, and clearance of glycoproteins from the serum, as well as physical, chemical, and immunogenic properties of the glycoprotein. In some embodiments of the present disclosure, sialic acid associated with alkaline phosphatases, e.g., asfotase alfa, impacts the half-life of the molecule in physiological conditions. In some embodiments, precise and predictable control of total sialic acid content (TSAC) of asfotase alfa serves as a critical quality attribute for recombinant asoftase alfa. In some embodiments, the TSAC is 1.2 to 3.0 mol/mol asfotase alfa monomer. In some embodiments, TSAC is generated in the recombinant protein production process in the bioreactor. In some embodiments, the disclosure provides a method of controlling total sialic acid content (TSAC) in a TSAC-containing recombinant protein through mammalian cell culture, comprising at least one purification step and at least one chromatography step. In some embodiments, the purification and chromatography steps lead to decreased glycosidase activity, and thus increased total sialic acid content of the recombinant protein.
(38) The term sialylation refers to a specific type of glycosylation, i.e., the addition of one or more sialic acid molecules to biomolecules, particularly, the addition of one or more sialic acid molecules to proteins. In some embodiments of the present disclosure, sialylation is performed by a sialyltransferase enzyme. In some embodiments, sialyltransferases add sialic acid to nascent oligosaccharides and/or to N- or O-linked sugar chains of glycoproteins. In some embodiments, sialyltransferases are present natively in the cells producing recombinant alkaline phosphatase. In some embodiments, sialyltransferases are present in the cell culture medium and/or nutrient supplement used in culturing the cells producing recombinant alkaline phosphatase. In some embodiments, sialyltransferases are produced recombinantly, using recombinant protein expression methods known in the art. In some embodiments, recombinant sialyltransferases produced separately from the recombinant alkaline phosphatases are added exogenously to the cell culture, the harvest clarified culture fluid (HCCF), and/or the filtration pool.
(39) In some embodiments of the present disclosure, sialic acid groups are removed from glycoproteins (i.e., desialylation) by hydrolysis. In some embodiments, desialylation is performed by a glycosidase enzyme. As used herein, glycosidase, also called glycoside hydrolase, is an enzyme that catalyzes the hydrolysis of a bond joining a sugar of a glycoside to an alcohol or another sugar unit. Examples of glycosidases include amylase, xylanase, cellulase, and sialidase. In some embodiments, desialylation is performed by a sialidase enzyme. In some embodiments, sialidases hydrolyze glycosidic linkages of terminal sialic acid residues in glycoproteins, glycolipids, oligosaccharides, colominic acid, and/or synthetic substrates. In some embodiments, sialidases are present in the cell culture medium producing recombinant alkaline phosphatase. In some embodiments, sialidase activity is dependent on and/or correlates with total protein concentration. In some embodiments, sialidases are essentially inactive until a critically high protein concentration, at which point the sialidase is activated. In some embodiments, sialidases are present in the HCCF or the filtration pool of the cell culture producing recombinant alkaline phosphatase. In some embodiments, sialidases remove sialic acid moieties from glycosylation sites on recombinant alkaline phosphatase, e.g., asfotase alfa, effectively reducing the TSAC of the recombinant alkaline phosphatase. In some embodiments, sialidases are selectively removed from the cell culture, the HCCF, and/or the filtration pool. Sialidases can be selectively removed by, e.g., one or a combination of sialidase-specific inhibitors, antibodies, ion exchange and/or affinity chromatography, immunoprecipitation, and the like. For an overview of how bioprocess conditions affect the sialic acid content of proteins, see Gramer et al., Biotechnol. Prog. 9(4):366-373 (1993), the disclosure of which is hereby incorporated by reference in its entirety. In some embodiments, the present disclosure provides a method of controlling glycosidase activity in mammalian cell culture producing recombinant protein, comprising at least one purification and at least one chromatography step. In some embodiments, the purification and chromatography steps lead to decreased glycosidase activity, and thus increased total sialic acid content of the recombinant protein.
(40) The term harvest clarified culture fluid, abbreviated as HCCF, refers to a clarified, filtered fluid harvested from a cell culture, e.g., a cell culture in a bioreactor. The HCCF is typically free of cells and cellular debris (such as, e.g., insoluble biomolecules) which may be present in the cell culture. In some embodiments of the present disclosure, HCCF is generated through centrifugation, depth filtration, sterile filtration, and/or chromatography. In some embodiments, a cell culture fluid from the bioreactor is first centrifuged and/or filtered, then subjected to at least one chromatography step in order to generate the HCCF. In some embodiments, the HCCF is concentrated prior to and/or after the at least one chromatography step. In some embodiments, the HCCF is diluted after the at least one chromatography step. In some embodiments, the HCCF from the cell culture producing recombinant alkaline phosphatase contains the recombinant alkaline phosphatase and contaminant proteins. In some embodiments, the contaminant proteins in the HCCF include sialidase enzymes.
(41) The terms filtration and flow filtration refer to a pressure driven process that uses membranes to separate components in a liquid solution or suspension based on their size and charge differences. Flow filtration may be normal flow filtration or tangential flow filtration, also known as TFF or cross-flow filtration. TFF is typically used for clarifying, concentrating, and purifying proteins. During a TFF process, fluid is pumped tangentially along the surface of at least one membrane. An applied pressure serves to force a portion of the fluid through the membrane to the downstream side as filtrate. Particulates and macromolecules that are too large to pass through the membrane pores are retained on the upstream side as retentate. TFF may be used in various forms, including, for example, microfiltration, ultrafiltrationwhich includes virus filtration and high performance TFF, reverse osmosis, nanofiltration, and diafiltration. In some embodiments of the present disclosure, one or more of the TFF forms are used in combination for protein processing and/or purification. In some embodiments, ultrafiltration and diafiltration are used in combination for purifying a recombinant alkaline phosphatase. Ultrafiltration and diafiltration are described herein.
(42) Ultrafiltration, or UF, is a purification process used to separate proteins from buffer components for buffer exchange, desalting, or concentration. Depending on the protein to be retained, membrane molecular weight limits in the range of about 1 kD to about 1000 kD are used. In some embodiments, UF is a TFF process.
(43) Diafiltration, or DF, is a purification process that washes smaller molecules through a membrane and leaves larger molecules in the retentate without ultimately changing concentration. Typically, DF is used in combination with another purification processes to enhance product yield and/or purity. During DF, solution (e.g., water or buffer) is introduced into the sample reservoir while filtrate is removed from the unit operation. In processes where the desired product is in the retentate, diafiltration washes components out of the product pool into the filtrate, thereby exchanging buffers and reducing the concentration of undesirable species. When the product is in the filtrate, diafiltration washes it through the membrane into a collection vessel. In some embodiments, DF is a TFF process.
(44) The term filtration pool, sometimes also referred to as the UFDF pool or the UFDF, refers to a total volume of fluid from a filtration process, typically from a combined ultrafiltration/diafiltration (UF/DF) process. In the context of protein purification, the UFDF refers to the retentate from an ultrafiltration/diafiltration process.
(45) The present disclosure provides a method of improving the yield, enzymatic function and consistency of a recombinant protein which is expressed by cell culture (e.g., mammalian cells including but not limited to Chinese Hamster Ovary (CHO) cells). Specifically, a recombinant protein may be produced by a certain type of cells (e.g., mammalian cells including but not limited to Chinese Hamster Ovary (CHO) cells) through, for example, a fermentation process. The total processes of inoculation and growth of the cells, induction of protein expression, and various parameter optimizations for protein expression are referred as upstream processing steps. Correspondingly, the downstream processing steps may include, e.g., the recovery and purification of the produced proteins (i.e., separation of the produced proteins from other impurities and/or contaminants originated from the cells and the culture medium). Exemplary downstream process steps include, for example, protein capturing from harvest, removing host cell debris, host cell proteins (HCPs), and host cell DNAs, endotoxins, viruses and other containments, buffer-exchanging, and formulation adjustment, etc.
(46) The present disclosure provides a method of improving the yield, enzymatic function and consistency of an alkaline phosphatase (e.g., asfotase alfa) which is produced by cell culture.
(47) The present disclosure provides a method of culturing cells (e.g., mammalian cells including but not limited to Chinese Hamster Ovary (CHO) cells) expressing a recombinant protein. The present disclosure provides manufacturing systems for the production of an alkaline phosphatase (e.g., asfotase alfa) by cell culture. In certain embodiments, systems are provided that minimize production of one or more metabolic products that are detrimental to cell growth, viability, and/or protein production or quality. In particular embodiments, the cell culture is a batch culture, a fed-batch culture, a culture or a continuous culture.
(48) Alkaline Phosphtases (ALPS)
(49) The present disclosure relates to the manufacturing of an alkaline phosphatase protein (e.g., asfotase alfa) in recombinant cell culture. The alkaline phosphatase protein includes any polypeptides or molecules comprising polypeptides that comprise at least some alkaline phosphatase activity. In various embodiments, the alkaline phosphatase disclosed herein includes any polypeptide having alkaline phosphatase functions, which may include any functions of alkaline phosphatase known in the art, such as enzymatic activity toward natural substrates including phosphoethanolamine (PEA), inorganic pyrophosphate (PPi) and pyridoxal 5-phosphate (PLP).
(50) In certain embodiments, such alkaline phosphatase protein, after being produced and then purified by the methods disclosed herein, can be used to treat or prevent alkaline phosphatase-related diseases or disorders. For example, such alkaline phosphatase protein may be administered to a subject having decreased and/or malfunctioned endogenous alkaline phosphatase, or having overexpressed (e.g., above normal level) alkaline phosphatase substrates. In some embodiments, the alkaline phosphatase protein in this disclosure is a recombinant protein. In some embodiments, the alkaline phosphatase protein is a fusion protein. In some embodiments, the alkaline phosphatase protein in this disclosure specifically targets a cell type, tissue (e.g., connective, muscle, nervous, or epithelial tissues), or organ (e.g., liver, heart, kidney, muscles, bones, cartilage, ligaments, tendons, etc.). For example, such alkaline phosphatase protein may comprise a full-length alkaline phosphatase (ALP) or fragment of at least one alkaline phosphatase (ALP). In some embodiments, the alkaline phosphatase protein comprises a soluble ALP (sALP) linked to a bone-targeting moiety (e.g., a negatively-charged peptide as described below). In some embodiments, the alkaline phosphatase protein comprises a soluble ALP (sALP) linked to an immunoglobulin moiety (full-length or fragment). For example, such immunoglobulin moiety may comprise a fragment crystallizable region (Fc). In some embodiments, the alkaline phosphatase protein comprises a soluble ALP (sALP) linked to both a bone-targeting moiety and an immunoglobulin moiety (full-length or fragment). For more detailed description of the alkaline phosphatase protein disclosed herein, see PCT Publication Nos. WO 2005/103263 and WO 2008/138131, the teachings of both of which are incorporated by reference herein in their entirety.
(51) In some embodiments, the alkaline phosphatase protein described herein comprises any one of the structures selected from the group consisting of: sALP-X, X-sALP, sALP-Y, Y-sALP, sALP-X-Y, sALP-Y-X, X-sALP-Y, X-Y-sALP, Y-sALP-X, and Y-X-sALP, wherein X comprises a bone-targeting moiety, as described herein, and Y comprises an immunoglobulin moiety, as described herein. In one embodiment, the alkaline phosphatase protein comprises the structure of W-sALP-X-Fc-Y-D.sub.n/E.sub.n-Z, wherein W is absent or is an amino acid sequence of at least one amino acid; X is absent or is an amino acid sequence of at least one amino acid; Y is absent or is an amino acid sequence of at least one amino acid; Z is absent or is an amino acid sequence of at least one amino acid; Fc is a fragment crystallizable region; D.sub.n/E.sub.n is a polyaspartate, polyglutamate, or combination thereof wherein n=8-20; and sALP is a soluble alkaline phosphatase (ALP). In some embodiments, D.sub.n/E.sub.n is a polyaspartate sequence. For example, D.sub.n may be a polyaspartate sequence wherein n is any number between 8 and 20 (both included) (e.g., n may be 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20). In one embodiment, D.sub.n is D.sub.10 or D.sub.16. In some embodiments, D.sub.n/E.sub.n is a polyglutamate sequence. For example, E.sub.n may be a polyglutamate sequence wherein n is any number between 8 and 20 (both included) (e.g., n may be 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20). In one embodiment, E.sub.n is E.sub.10 or E.sub.16.
(52) For example, such sALPs may be fused to the full-length or fragment (e.g., the fragment crystallizable region (Fc)) of an immunoglobulin molecule. In some embodiments, the recombinant polypeptide comprises a structure of W-sALP-X-Fc-Y-D.sub.n-Z, wherein W is absent or is an amino acid sequence of at least one amino acid; X is absent or is an amino acid sequence of at least one amino acid; Y is absent or is an amino acid sequence of at least one amino acid; Z is absent or is an amino acid sequence of at least one amino acid; Fc is a fragment crystallizable region; D.sub.n is a poly-aspartate, poly-glutamate, or combination thereof, wherein n=10 or 16; and said sALP is a soluble alkaline phosphatase. In one embodiment, n=10. In another embodiment, W and Z are absent from said polypeptide. In some embodiments, said Fc comprises a CH2 domain, a CH3 domain and a hinge region. In some embodiments, said Fc is a constant domain of an immunoglobulin selected from the group consisting of IgG-1, IgG-2, IgG-3, IgG-3 and IgG-4. In one embodiment, said Fc is a constant domain of an immunoglobulin IgG-1. In one particular embodiment, said Fc comprises the sequence as set forth in D488-K714 of SEQ ID NO: 1.
(53) In some embodiments, the alkaline phosphatase disclosed herein comprises the structure of W-sALP-X-Fc-Y-D.sub.n-Z, wherein W is absent or is an amino acid sequence of at least one amino acid; X is absent or is an amino acid sequence of at least one amino acid; Y is absent or is an amino acid sequence of at least one amino acid; Z is absent or is an amino acid sequence of at least one amino acid; Fc is a fragment crystallizable region; D.sub.n is a poly-aspartate, poly-glutamate, or combination thereof, wherein n=10 or 16; and said sALP is a soluble alkaline phosphatase. Such sALP is capable of catalyzing the cleavage of at least one of phosphoethanolamine (PEA), inorganic pyrophosphate (PPi) and pyridoxal 5-phosphate (PLP). In various embodiments, the sALP disclosed herein is capable of catalyzing the cleavage of inorganic pyrophosphate (PPi). Such sALP may comprise all amino acids of the active anchored form of alkaline phosphatase (ALP) without C-terminal glycolipid anchor (GPI). Such ALP may be at least one of tissue-non-specific alkaline phosphatase (TNALP), placental alkaline phosphatase (PALP), germ cell alkaline phosphatase (GCALP), and intestinal alkaline phosphatase (IAP), or their chimeric or fusion forms or variants disclosed herein. In one particular embodiment, the ALP comprises tissue-non-specific alkaline phosphatase (TNALP). In another embodiment, the sALP disclosed herein is encoded by a polynucleotide encoding a polypeptide comprising the sequence as set forth in L1-S485 of SEQ ID NO: 1. In yet another embodiment, the sALP disclosed herein comprises the sequence as set forth in L1-S485 of SEQ ID NO: 1.
(54) In one embodiment, the alkaline phosphatase protein comprises the structure of TNALP-Fc-D.sub.10 (SEQ ID NO: 1, as listed below). Underlined asparagine (N) residues correspond to potential glycosylation sites (i.e., N 123, 213, 254, 286, 413 & 564). Bold underlined amino acid residues (L.sub.486-K.sub.487 & D.sub.715-I.sub.716) correspond to linkers between sALP and Fc, and Fc and D.sub.10 domains, respectively.
(55) TABLE-US-00001 (SEQIDNO:1) 10203040 LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMF 50607080 LGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVAL 90100110120 SKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERS 130140150160 RCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAA 170180190200 YAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDV 210220230240 IMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWK 250260270280 SFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQY 290300310320 ELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRID 330340350360 HGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTA 370380390400 DHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGN 410420430440 GPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGE 450460470480 DVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHC 490500510520 APASSLKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI 530540550560 SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE 570580590600 EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE 610620630640 KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFY 650660670680 PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD 690700710720 KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDIDDDD DDDDDD
(56) In this embodiment, the polypeptide is composed of five portions. The first portion (sALP) containing amino acids L1-S485 is the soluble part of the human tissue non-specific alkaline phosphatase enzyme, which contains the catalytic function. The second portion contains amino acids L486-K487 as a linker. The third portion (Fc) containing amino acids D.sub.488-K714 is the Fc part of the human immunoglobulin gamma 1 (IgG1) containing hinge, CH.sub.2 and CH.sub.3 domains. The fourth portion contains D715-1716 as a linker. The fifth portion contains amino acids D717-D726 (D.sub.10), which is a bone targeting moiety that allows asfotase alfa to bind to the mineral phase of bone. In addition, each polypeptide chain contains six potential glycosylation sites and eleven cysteine (Cys) residues. Cys102 exists as free cysteine. Each polypeptide chain contains four intra-chain disulfide bonds between Cys122 and Cys184, Cys472 and Cys480, Cys528 and Cys588, and Cys634 and Cys692. The two polypeptide chains are connected by two inter-chain disulfide bonds between Cys493 on both chains and between Cys496 on both chains. In addition to these covalent structural features, mammalian alkaline phosphatases are thought to have four metal-binding sites on each polypeptide chain, including two sites for zinc, one site for magnesium and one site for calcium.
(57) There are four known isozymes of ALP, namely tissue non-specific alkaline phosphatase (TNALP) further described below, placental alkaline phosphatase (PALP) (as described e.g., in GenBank Accession Nos. NP_112603 and NP_001623), germ cell alkaline phosphatase (GCALP) (as described, e.g., in GenBank Accession No. P10696) and intestinal alkaline phosphatase (IAP) (as described, e.g., in GenBank Accession No. NP_001622). These enzymes possess very similar three-dimensional structures. Each of their catalytic sites contains four metal-binding domains, for metal ions that are necessary for enzymatic activity, including two Zn and one Mg. These enzymes catalyze the hydrolysis of monoesters of phosphoric acid and also catalyze a transphosphorylation reaction in the presence of high concentrations of phosphate acceptors. Three known natural substrates for ALP (e.g., TNALP) include phosphoethanolamine (PEA), inorganic pyrophosphate (PPi) and pyridoxal 5-phosphate (PLP) (Whyte et al., 1995 J Clin Invest 95:1440-1445). An alignment between these isozymes is shown in FIG. 30 of WO 2008/138131, the teachings of which are incorporated by reference herein in their entirety.
(58) The alkaline phosphatase protein in this disclosure may comprise a dimer or multimers of any ALP protein, alone or in combination. Chimeric ALP proteins or fusion proteins may also be produced, such as the chimeric ALP protein that is described in Kiffer-Moreira et al. 2014 PLoS One 9:e89374, the entire teachings of which are incorporated by reference herein in its entirety.
(59) In one particular embodiment, the alkaline phosphatase disclosed herein is encoded by a polynucleotide encoding a polypeptide comprising the sequence as set forth in SEQ ID NO: 1. In some embodiments, the alkaline phosphatase disclosed herein is encoded by a polynucleotide encoding a polypeptide comprising a sequence having 80%, 85%, 88%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NO: 1. In some embodiments, the alkaline phosphatase disclosed herein is encoded by a polynucleotide encoding a polypeptide comprising a sequence having 95% or 99% identity to SEQ ID NO: 1. In another embodiment, the alkaline phosphatase disclosed herein comprises the sequence as set forth in SEQ ID NO: 1.
(60) TNALP
(61) As indicated above, TNALP is a membrane-bound protein anchored through a glycolipid to its C-terminus (for human TNALP, see UniProtKB/Swiss-Prot Accession No. P05186). This glycolipid anchor (GPI) is added post translationally after removal of a hydrophobic C-terminal end which serves both as a temporary membrane anchor and as a signal for the addition of the GPI. Hence, in one embodiment a soluble human TNALP comprises a TNALP wherein the first amino acid of the hydrophobic C-terminal sequence, namely alanine, is replaced by a stop codon. The soluble TNALP (herein called sTNALP) so formed contains all amino acids of the native anchored form of TNALP that are necessary for the formation of the catalytic site but lacks the GPI membrane anchor. Known TNALPs include, e.g., human TNALP [GenBank Accession Nos. NP-000469, AAI10910, AAH90861, AAH66116, AAH21289, and AAI26166]; rhesus TNALP [GenBank Accession No. XP-001109717]; rat TNALP [GenBank Accession No. NP_037191]; dog TNALP [GenBank Accession No. AAF64516]; pig TNALP [GenBank Accession No. AAN64273], mouse TNALP [GenBank Accession No. NP_031457], bovine TNALP [GenBank Accession Nos. NP_789828, NP_776412, AAM 8209, and AAC33858], and cat TNALP [GenBank Accession No. NP_001036028].
(62) As used herein, the terminology extracellular domain is meant to refer to any functional extracellular portion of the native protein (e.g., without the peptide signal). Recombinant sTNALP polypeptide retaining original amino acids 1 to 501 (18 to 501 when secreted), amino acids 1 to 502 (18 to 502 when secreted), amino acids 1 to 504 (18 to 504 when secreted), or amino acids 1 to 505 (18-505 when secreted) are enzymatically active (see Oda et al., 1999 J. Biochem 126:694-699). This indicates that amino acid residues can be removed from the C-terminal end of the native protein without affecting its enzymatic activity. Furthermore, the soluble human TNALP may comprise one or more amino acid substitutions, wherein such substitution(s) does not reduce or at least does not completely inhibit the enzymatic activity of the sTNALP. For example, certain mutations that are known to cause hypophosphatasia (HPP) are listed in PCT Publication No. WO 2008/138131 and should be avoided to maintain a functional sTNALP.
(63) Negatively-Charged Peptide
(64) The alkaline phosphatase protein of the present disclosure may comprise a target moiety which may specifically target the alkaline phosphatase protein to a pre-determined cell type, tissue, or organ. In some embodiments, such pre-determined cell type, tissue, or organ is bone tissues. Such bone-targeting moiety may include any known polypeptide, polynucleotide, or small molecule compounds known in the art. For example, negatively-charged peptides may be used as a bone-targeting moiety. In some embodiments, such negatively-charged peptides may be a poly-aspartate, poly-glutamate, or combination thereof (e.g., a polypeptide comprising at least one aspartate and at least one glutamate, such as a negatively-charged peptide comprising a combination of aspartate and glutamate residues). In some embodiments, such negatively-charged peptides may be D.sub.6, D.sub.7, Ds, D.sub.9, D.sub.10, D.sub.11, D.sub.12, D.sub.13, D.sub.14, D.sub.15, D.sub.16, D.sub.17, D.sub.18, D.sub.19, D.sub.20, or a polyaspartate having more than 20 aspartates. In some embodiments, such negatively-charged peptides may be E.sub.6, E.sub.7, E.sub.8, E.sub.9, E.sub.10, E.sub.11, E.sub.12, E.sub.13, E.sub.14, E.sub.15, E.sub.16, E.sub.17, E.sub.18, E.sub.19, E.sub.20, or a polyglutamate having more than 20 glutamates. In one embodiment, such negatively-charged peptides may comprise at least one selected from the group consisting of D.sub.10 to D.sub.16 or E.sub.10 to E.sub.16.
(65) Spacer
(66) In some embodiments, the alkaline phosphatase protein of the present disclosure comprises a spacer sequence between the ALP portion and the targeting moiety portion. In one embodiment, such alkaline phosphatase protein comprises a spacer sequence between the ALP (e.g., TNALP) portion and the negatively-charged peptide targeting moiety. Such spacer may be any polypeptide, polynucleotide, or small molecule compound. In some embodiments, such spacer may comprise fragment crystallizable region (Fc) fragments. Useful Fc fragments include Fc fragments of IgG that comprise the hinge, and the CH2 and CH.sub.3 domains. Such IgG may be any of lgG-1, lgG-2, lgG-3, lgG-3 and lgG-4, or any combination thereof.
(67) Without being limited to this theory, it is believed that the Fc fragment used in bone-targeted sALP fusion proteins (e.g., asfotase alfa) acts as a spacer, which allows the protein to be more efficiently folded given that the expression of sTNALP-Fc-D.sub.10 was higher than that of sTNALP-D.sub.10. One possible explanation is that the introduction of the Fc fragment alleviates the repulsive forces caused by the presence of the highly negatively-charged D.sub.10 sequence added at the C-terminus of the sALP sequence exemplified herein. In some embodiments, the alkaline phosphatase protein described herein comprises a structure selected from the group consisting of: sALP-Fc-D.sub.10, sALP-D.sub.10-Fc, D.sub.10-sALP-Fc, D.sub.10-Fc-sALP, Fc-sALP-D.sub.10, and Fc-D.sub.10-sALP. In other embodiments, the D.sub.10 in the above structures is substituted by other negatively-charged polypeptides (e.g., D.sub.8, D.sub.16, E.sub.10, E.sub.8, E.sub.16, etc.).
(68) Useful spacers for the present disclosure include, e.g., polypeptides comprising a Fc, and hydrophilic and flexible polypeptides able to alleviate the repulsive forces caused by the presence of the highly negatively-charged bone-targeting sequence (e.g., D.sub.10) added at the C-terminus of the sALP sequence.
(69) Dimers/Tetramers
(70) In specific embodiments, the bone-targeted sALP fusion proteins of the present disclosure are associated so as to form dimers or tetramers.
(71) In the dimeric configuration, the steric hindrance imposed by the formation of the interchain disulfide bonds is presumably preventing the association of sALP domains to associate into the dimeric minimal catalytically-active protein that is present in normal cells.
(72) The bone-targeted sALP may further optionally comprise one or more additional amino acids 1) downstream from the negatively-charged peptide (e.g., the bone tag); and/or 2) between the negatively-charged peptide (e.g., the bone tag) and the Fc fragment; and/or 3) between the spacer (e.g., an Fc fragment) and the sALP fragment. This could occur, for example, when the cloning strategy used to produce the bone-targeting conjugate introduces exogenous amino acids in these locations. However the exogenous amino acids should be selected so as not to provide an additional GPI anchoring signal. The likelihood of a designed sequence being cleaved by the transamidase of the host cell can be predicted as described by Ikezawa, 2002 Glycosylphosphatidylinositol (GPI)-anchored proteins. Biol Pharm Bull. 25:409-17.
(73) The present disclosure also encompasses a fusion protein that is post-translationally modified, such as by glycosylation including those expressly mentioned herein, acetylation, amidation, blockage, formylation, gamma-carboxyglutamic acid hydroxylation, methylation, phosphorylation, pyrrolidone carboxylic acid, and sulfation.
(74) Asfotase Alfa
(75) Asfotase alfa is a soluble Fc fusion protein consisting of two TNALP-Fc-D.sub.10 polypeptides each with 726 amino acids as shown in SEQ ID NO: 1. Each polypeptide or monomer is composed of five portions. The first portion (sALP) containing amino acids L1-S485 is the soluble part of the human tissue non-specific alkaline phosphatase enzyme, which contains the catalytic function. The second portion contains amino acids L486-K487 as a linker. The third portion (Fc) containing amino acids D488-K714 is the Fc part of the human Immunoglobulin gamma 1 (IgG1) containing hinge, CH.sub.2 and CH.sub.3 domains. The fourth portion contains D715-1716 as a linker. The fifth portion contains amino acids D717-D726 (D.sub.10), which is a bone targeting moiety that allows asfotase alfa to bind to the mineral phase of bone. In addition, each polypeptide chain contains six potential glycosylation sites and eleven cysteine (Cys) residues. Cys102 exists as free cysteine. Each polypeptide chain contains four intra-chain disulfide bonds between Cys122 and Cys184, Cys472 and Cys480, Cys528 and Cys588, and Cys634 and Cys692. The two polypeptide chains are connected by two inter-chain disulfide bonds between Cys493 on both chains and between Cys496 on both chains. In addition to these covalent structural features, mammalian alkaline phosphatases are thought to have four metal-binding sites on each polypeptide chain, including two sites for zinc, one site for magnesium and one site for calcium.
(76) Asfotase alfa can also be characterized as follows. From the N-terminus to the C terminus, asfotase alfa comprises: (1) the soluble catalytic domain of human tissue non-specific alkaline phosphatase (TNSALP) (UniProtKB/Swiss-Prot Accession No. P05186), (2) the human immunoglobulin G1 Fc domain (UniProtKB/Swiss-Prot Accession No. P01857) and (3) a deca-aspartate peptide (D.sub.10) used as a bone-targeting domain (Nishioka et al. 2006 Mol Genet Metab 88:244-255). The protein associates into a homo-dimer from two primary protein sequences. This fusion protein contains 6 confirmed complex N-glycosylation sites. Five of these N-glycosylation sites are located on the sALP domain and one on the Fc domain. Another important post-translational modification present on asfotase alfa is the presence of disulfide bridges stabilizing the enzyme and the Fc-domain structure. A total of 4 intra-molecular disulfide bridges are present per monomer and 2 inter-molecular disulfide bridges are present in the dimer. One cysteine of the alkaline phosphatase domain is free.
(77) Asfotase alfa has been used as an enzyme-replacement therapy for the treatment of hypophosphatasia (HPP). In patients with HPP, loss-of-function mutation(s) in the gene encoding TNSALP causes a deficiency in TNSALP enzymatic activity, which leads to elevated circulating levels of substrates, such as inorganic pyrophosphate (PPi) and pyridoxal-5-phosphate (PLP). Administration of asfotase alfa to patients with HPP cleaves PPi, releasing inorganic phosphate for combination with calcium, thereby promoting hydroxyapatite crystal formation and bone mineralization, and restoring a normal skeletal phenotype. For more details on asfotase alfa and its uses in treatment, see PCT Publication Nos. WO 2005/103263 and WO 2008/138131
(78) In some embodiments, the method provides an alkaline phosphatase (asfotase alfa) having improved enzymatic activity of the produced alkaline phosphatase (e.g., asfotase alfa) relative to an alkaline phosphatase produced by conventional means, by minimizing the concentration of metal ions having potential negative impact on activity or increasing the concentration of metal ions having potential positive impact on activity or both as described herein. Activity may be measured by any known method. Such methods include, e.g., those in vitro and in vivo assays measuring the enzymatic activity of the produced alkaline phosphatase (e.g., asfotase alfa) to substrates of an alkaline phosphatase, such as phosphoethanolamine (PEA), inorganic pyrophosphate (PPi) and pyridoxal 5-phosphate (PLP).
(79) In some embodiments, the alkaline phosphatase disclosed herein is encoded by a first polynucleotide which hybridizes under high stringency conditions to a second polynucleotide comparing the sequence completely complementary to a third polynucleotide encoding a polypeptide comprising the sequence as set forth in SEQ ID NO: 1. Such high stringency conditions may comprise: pre-hybridization and hybridization in 6SSC, 5Denhardt's reagent, 0.5% SDS and 100 mg/ml of denatured fragmented salmon sperm DNA at 68 C.; and washes in 2SSC and 0.5% SDS at room temperature for 10 minutes; in 2SSC and 0.1% SDS at room temperature for 10 minutes; and in 0.1SSC and 0.5% SDS at 65 C. three times for 5 minutes.
(80) Manufacturing Process
(81) The alkaline phosphatase protein described herein (e.g., asfotase alfa) may be produced by mammalian or other cells, particularly CHO cells, using methods known in the art. Such cells may be grown in culture dishes, flask glasses, or bioreactors. Specific processes for cell culture and producing recombinant proteins are known in the art, such as described in Nelson and Geyer, 1991 Bioprocess Technol. 13:112-143 and Rea et al., Supplement to BioPharm International March 2008, 20-25. Exemplary bioreactors include batch, fed-batch, and continuous reactors. In some embodiments, the alkaline phosphatase protein is produced in a fed-batch bioreactor.
(82) Cell culture processes have variability caused by, for example, variable physicochemical environment, including but not limited to, changes in pH, temperature, temperature changes, timing of temperature changes, cell culture media composition, cell culture nutrient supplements, raw material lot-to-lot variation, medium filtration material, bioreactor scale difference, gassing strategy (air, oxygen, and carbon dioxide), etc. As disclosed herein, the yield, relative activity profile, and glycosylation profile of manufactured alkaline phosphatase protein may be affected and may be controlled within particular values by alterations in one or more of these parameters.
(83) For recombinant protein production in cell culture, the recombinant gene with the necessary transcriptional regulatory elements is first transferred to a host cell by methods known in the biotechnological arts. Optionally, a second gene is transferred that confers to recipient cells a selective advantage. In the presence of the selection agent, which may be applied a few days after gene transfer, only those cells that express the selector gene survive. Two exemplary genes for such selection are dihydrofolate reductase (DHFR), an enzyme involved in nucleotide metabolism, and glutamine synthetase (GS). In both cases, selection occurs in the absence of the appropriate metabolite (hypoxanthine and thymidine, in the case of DHFR, and glutamine in the case of GS), preventing growth of any nontransformed cells. In general, for efficient expression of the recombinant protein, it is not important whether the biopharmaceutical-encoding gene and selector genes are on the same plasmid or not.
(84) Following selection, surviving cells may be transferred as single cells to a second cultivation vessel, and the cultures are expanded to produce clonal populations. Eventually, individual clones are evaluated for recombinant protein expression, with the highest producers being retained for further cultivation and analysis. From these candidates, one cell line with the appropriate growth and productivity characteristics is chosen for production of the recombinant protein. A cultivation process is then developed that is determined by the production needs and the requirements of the final product.
(85) Cells
(86) Any mammalian cell or non-mammalian cell type, which can be cultured to produce a polypeptide, may be utilized in accordance with the present disclosure. Non-limiting examples of mammalian cells that may be used include, e.g., Chinese hamster ovary cells+/DHFR (CHO, Urlaub and Chasin, 1980 Proc. Natl. Acad. Sci. USA, 77:4216); BALB/c mouse myeloma line (NSO/1, ECACC Accession No: 85110503); human retinoblasts (PER.C6 (CruCell, Leiden, The Netherlands)); monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., 1977 J. Gen Virol., 36:59); baby hamster kidney cells (BHK, ATCC CCL 10); mouse Sertoli cells (TM4, Mather, Biol. Reprod., 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-I 587); human cervical carcinoma cells (HeLa, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., 1982, Annals N.Y. Acad. Sci. 383:44-68); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2). In a particular embodiment, culturing and expression of polypeptides and proteins occurs from a Chinese Hamster Ovary (CHO) cell line.
(87) Additionally, any number of commercially and non-commercially available hybridoma cell lines that express polypeptides or proteins may be utilized in accordance with the present disclosure. One skilled in the art will appreciate that hybridoma cell lines might have different nutrition requirements and/or might require different culture conditions for optimal growth and polypeptide or protein expression, and will be able to modify conditions as needed.
(88) As noted above, in many instances the cells will be selected or engineered to produce high levels of protein or polypeptide. Often, cells are genetically engineered to produce high levels of protein, for example by introduction of a gene encoding the protein or polypeptide of interest and/or by introduction of control elements that regulate expression of the gene (whether endogenous or introduced) encoding the polypeptide of interest.
(89) Seeding Density
(90) In the present disclosure, Chinese Hamster Ovary (CHO) cells are inoculated, i.e., seeded, into the culture medium. Various seeding densities can be used. In some embodiments, a seeding density of 1.010.sup.4 cells/mL to 1.010.sup.7 cells/mL can be used. In some embodiments, a seeding density of 1.010.sup.5 cells/mL to 1.010.sup.6 cells/mL can be used. In some embodiments, a seeding density of 4.010.sup.5 cells/mL to 8.010.sup.5 cells/mL can be used. In some embodiments, increased seeding density can impact fragmentation of asfotase alfa quality, as measured by SEC. In some embodiments, the seeding density is controlled when inoculating in order to reduce the risk of fragment generation.
(91) Temperature
(92) Prior results indicated that temperature may have an impact on several parameters including growth rate, aggregation, fragmentation, and TSAC. In some embodiments, the temperature remains constant when culturing the CHO cells in the culture medium. In some embodiments, the temperature is about 30 C. to about 40 C., or about 35 C. to about 40 C., or about 37 C. to about 39 C. when culturing the CHO cells in the culture medium. In some embodiments, the temperature is about 30 C., about 30.5 C., about 31 C., about 31.5 C., about 32 C., about 32.5 C., about 33 C., about 33.5 C., about 34 C., about 34.5 C., about 35 C., about 35.5 C., about 36 C., about 36.5 C., about 37 C., about 37.5 C., about 38 C., about 38.5 C., about 39 C., about 39.5 C., or about 40 C. when culturing the CHO cells in the culture medium. In some embodiments, the temperature is constant for 40 to 200 hours after inoculation. In some embodiments, the temperature is constant for 50 to 150 hours, or 60 to 140 hours, or 70 to 130 hours, or 80 to 120 hours, or 90 to 110 hours after inoculation. In some embodiments, the temperature is constant for 80 to 120 hours after inoculation. In some embodiments, the temperature is constant for 90 hours, 92 hours, 94 hours, 96 hours, 98 hours, 100 hours, 102 hours, 104 hours, 106 hours, 108 hours or 110 hours after inoculation.
(93) Temperature Shifting
(94) Run times of cell culture processes, especially non-continuous processes (e.g., fed-batch processes in bioreactors), are usually limited by the remaining viability of the cells, which typically declines over the course of the run. Therefore, extending the length of time for cell viability is desired for improving recombination protein production. Product quality concerns also offer a motivation for minimizing decreases in viable cell density and maintaining high cell viability, as cell death can release sialidases to the culture supernatant, which may reduce the sialic acid content of the protein expressed. Protein purification concerns offer yet another motivation for minimizing decreases in viable cell density and maintaining high cell viability. Cell debris and the contents of dead cells in the culture can negatively impact one's ability to isolate and/or purify the protein product at the end of the culturing run. Thus, by keeping cells viable for a longer period of time in culture, there is a reduction in the contamination of the culture medium by cellular proteins and enzymes (e.g., cellular proteases and sialidases) that may cause degradation and ultimate reduction in the quality of the desired glycoprotein produced by the cells.
(95) Many methods may be applied to achieve high cell viability in cell cultures. One involves lowering culture temperature following initial culturing at a normal temperature. For example, see Ressler et al., 1996, Enzyme and Microbial Technology 18:423-427). Generally, the mammalian or other types of cells capable of expressing a protein of interest are first grown under a normal temperature to increase cell numbers. Such normal temperatures for each cell type are generally around 37 C. (e.g., from about 35 C. to about 39 C., including, for example, 35.0 C., 35.5 C., 36.0 C., 36.5 C., 37.0 C., 37.5 C., 38.0 C., 38.5 C., and/or 39.0 C.). In one particular embodiment, the temperature for producing asfotase alfa is first set at about 37 C. When a reasonably high cell density is reached, the culturing temperature for the whole cell culture can then be shifted (e.g., decreased) to promote protein production. In most cases lowering temperature shifts the cells towards the non-growth G1 portion of the cell cycle, which may increase cell density and viability, as compared to the previous higher-temperature environment. In addition, a lower temperature may also promote recombinant protein production by increasing the cellular protein production rate, facilitating protein post-translational modification (e.g., glycosylation), decreasing fragmentation or aggregation of newly-produced proteins, facilitating protein folding and formation of 3D structure (thus maintaining activity), and/or decreasing degradation of newly produced proteins. In some embodiments, the temperature is decreased 3 C., 4 C., 5 C., 6 C., 7 C., 8 C., 9 C., or 10 C. In some embodiments, the temperature is decreased to about 27 C., 28 C., 29 C., 30 C., 31 C., 32 C., 33 C., 34 C., or 35 C. In some embodiments, the lower temperature is from about 30 C. to about 35 C. (e.g., 30.0 C., 30.5 C., 31.0 C., 31.5 C., 32.0 C., 32.5 C., 33.0 C., 33.5 C., 34.0 C., 34.5 C., and/or 35.0 C.). In other embodiments, the temperature for producing asfotase alfa is first set to from about 35.0 C. to about 39.0 C. and then shifted to from about 30.0 C. to about 35.0 C. In one embodiment, the temperature for producing asfotase alfa is first set at about 37.0 C. and then shifted to about 30 C. In another embodiment, the temperature for producing asfotase alfa is first set at about 36.5 C. and then shifted to about 33 C. In yet another embodiment, the temperature for producing asfotase alfa is first set at about 37.0 C. and then shifted to about 33 C. In yet a further embodiment, the temperature for producing asfotase alfa is first set at about 36.5 C. and then shifted to about 30 C. In other embodiments, multiple (e.g., more than one) steps of temperature shifting may be applied.
(96) The time for maintaining the culture at a particular temperature prior to shifting to a different temperature may be determined to achieve a sufficient (or desired) cell density while maintaining cell viability and an ability to produce the protein of interest. In some embodiments, the cell culture is grown under the first temperature until the viable cell density reaches about 10.sup.5 cells/mL to about 10.sup.7 cells/mL (e.g., 110.sup.5, 1.510.sup.5, 2.010.sup.5, 2.510.sup.5, 3.010.sup.5, 3.510.sup.5, 4.010.sup.5, 4.510.sup.5, 5.010.sup.5, 5.510.sup.5, 6.010.sup.5, 6.510.sup.5, 7.010.sup.5, 7.510.sup.5, 8.010.sup.5, 8.510.sup.5, 9.010.sup.5, 9.510.sup.5, 1.010.sup.6, 1.510.sup.6, 2.010.sup.6, 2.510.sup.6, 3.010.sup.6, 3.510.sup.6, 4.010.sup.6, 4.510.sup.6, 5.010.sup.6, 5.510.sup.6, 6.010.sup.6, 6.510.sup.6, 7.010.sup.6, 7.510.sup.6, 8.010.sup.6, 8.510.sup.6, 9.010.sup.6, 9.510.sup.6, 110.sup.7 cell/mL, or more) before shifting to a different temperature. In one embodiment, the cell culture is grown under the first temperature until the viable cell density reaches about 2.5 to about 3.410.sup.6 cells/mL before shifting to a different temperature. In another embodiment, the cell culture is grown under the first temperature until the viable cell density reaches about 2.5 to about 3.210.sup.6 cells/mL before shifting to a different temperature. In yet another embodiment, the cell culture is grown under the first temperature until the viable cell density reaches about 2.5 to about 2.810.sup.6 cells/mL before shifting to a different temperature.
(97) In some embodiments, the method of the present disclosure provides the temperature shift occurs 50 to 150 hours, or 60 to 140 hours, or 70 to 130 hours, or 80 to 120 hours, or 90 to 110 hours after inoculation. In some embodiments, the method of the present disclosure provides the temperature decreased about 80 hours to 150 hours after inoculation, about 90 hours to 100 hours after inoculation or about 96 hours after inoculation. In some embodiments, the temperature shift occurs 80 to 120 hours after inoculation. In some embodiments, the temperature shift occurs 90 hours, 92 hours, 94 hours, 96 hours, 98 hours, 100 hours, 102 hours, 104 hours, 106 hours, 108 hours or 110 hours after inoculation. In some embodiments, the temperature after the temperature shift is maintained until the CHO cells are harvested.
(98) pH
(99) Alteration of the pH of the growth medium in cell culture may affect cellular proteolytic activity, secretion, and protein production levels. Most of the cell lines grow well at about pH 7-8. Although optimum pH for cell growth varies relatively little among different cell strains, some normal fibroblast cell lines perform best at a pH 7.0-7.7 and transformed cells typically perform best at a pH of 7.0-7.4 (Eagle, 1973 The effect of environmental pH on the growth of normal and malignant cells. J Cell Physiol 82:1-8). In some embodiments, the pH of the culture medium for producing asfotase alfa is about pH 6.5-7.7 (e.g., 6.50, 6.55, 6.60, 6.65, 6.70, 6.75, 6.80, 6.85, 6.90, 6.95, 7.00, 7.05, 7.10, 7.15, 7.20, 7.25, 7.30, 7.35, 7.39, 7.40, 7.45, 7.50, 7.55, 7.60, 7.65, or 7.70).
(100) Culture Medium
(101) In some embodiments, batch culture is used, wherein no additional culture medium is added after inoculation. In some embodiments, fed batch is used, wherein one or more boluses of culture medium are added after inoculation. In some embodiments, two, three, four, five or six boluses of culture medium are added after inoculation.
(102) In various embodiments, alkaline phosphatase (e.g., asfotase alfa) is produced by a process in which extra boluses of culture medium are added to the production bioreactor. For example, one, two, three, four, five, six, or more boluses of culture medium may be added. In one particular embodiment, three boluses of culture medium are added. In various embodiments, such extra boluses of culture medium may be added in various amounts. For example, such boluses of culture medium may be added in an amount of about 20%, 25%, 30%, 33%, 40%, 45%, 50%, 60%, 67%, 70%, 75%, 80%, 90%, 100%, 110%, 120%, 125%, 130%, 133%, 140%, 150%, 160%, 167%, 170%, 175%, 180%, 190%, 200%, or more, of the original volume of culture medium in the production bioreactor. In one particular embodiment, such boluses of culture medium may be added in an amount of about 33%, 67%, 100%, or 133% of the original volume. In various embodiments, such addition of extra boluses may occur at various times during the cell growth or protein production period. For example, boluses may be added at day 1, day 2, day 3, day 4, day 5, day 6, day 7, day 8, day 9, day 10, day 11, day 12, or later in the process. In one particular embodiment, such boluses of culture medium may be added in every other day (e.g., at (1) day 3, day 5, and day 7; (2) day 4, day 6, and day 8; or (3) day 5, day 7, and day 9. In practice, the frequency, amount, time point, and other parameters of bolus supplements of culture medium may be combined freely according to the above limitation and determined by experimental practice.
(103) Various culture mediums are available commercially. In some embodiments, the culture medium is selected from the group consisting of EX-CELL 302 Serum-Free Medium; CD DG44 Medium; BD Select Medium; SFM4CHO Medium, or a combination thereof. In some embodiments, the culture medium comprises a combination of commercially available mediums, e.g., SFM4CHO Medium and BD Select Medium. In some embodiments, the culture medium comprises a combination of commercially available mediums, e.g., SFM4CHO Medium and BD Select Medium, at a ratio selected from 90/10, 80/20, 75/25, 70/30, 60/40, or 50/50.
(104) Nutrient Supplement
(105) Various nutrient supplements, also referred to as feed media, are commercially available and are known to those of skill in the art. Nutrient supplements include a media (distinct from the culture media) added to a cell culture after innocuation has occurred. In some instances, the nutrient supplement can be used to replace nutrients consumed by the growing cells in the culture. In some embodiments, the nutrient supplement is added to optimize production of a desired protein, or to optimize activity of a desired protein. Numerous nutrient supplements have been developed and are available commercially. While the expressed purpose of the nutrient supplements is to increase an aspect of process development, no universal nutrient supplement exists that works for all cells and/or all proteins produced. The selection of a scalable and appropriate cell culture nutrient supplement that can work in combination with the desired cell line, protein produced and a given base medium to achieve the desired titer and growth characteristics is not routine. The typical approach of screening multiple commercially available nutrient supplements and identifying the most appropriate supplement with a specific cell line, specific protein produced and base medium combination may not be successful due to the myriad of variables present in the cell culture process. In some embodiments, the nutrient supplement is selected from the group consisting of Efficient Feed C+ AGT Supplement (Thermo Fisher Scientific, Waltham, MA), a combination of Cell Boost 2+Cell Boost 4 (GE Healthcare, Sweden), a combination of Cell Boost 2+Cell Boost 5 (GE Healthcare, Sweden), Cell Boost 6 (GE Healthcare, Sweden), and Cell Boost 7a+Cell Boost 7b (GE Healthcare, Sweden), or combinations thereof.
(106) Cell Boost 7a can be described as a first animal-derived component-free (ADCF) nutrient supplement comprising one or more amino acids, vitamins, salts, trace elements, poloxamer and glucose, wherein the first ADCF nutrient supplement does not comprise hypoxanthine, thymidine, insulin, L-glutamine, growth factors, peptides, proteins, hydrolysates, phenol red and 2-mercaptoethanol. Cell Boost 7a is a chemically defined supplement. The phrase animal-derived component-free or ADCF refers to a supplement in which no ingredients are derived directly from an animal source, e.g., are not derived from a bovine source. In some embodiments, the nutrient supplement is Cell Boost 7a.
(107) Cell Boost 7b can be described as a second ADCF nutrient supplement comprising one or more amino acids, wherein the second ADCF nutrient supplement lacks hypoxanthine, thymidine, insulin, L-glutamine, growth factors, peptides, proteins, hydrolysates, phenol red, 2-mercaptoethanol and poloxamer. Cell Boost 7b is a chemically defined supplement. In some embodiments, the nutrient supplement is Cell Boost 7b.
(108) In some embodiments, combinations of commercially available nutrient supplements are used. The term nutrient supplement refers to both a single nutrient supplement, as well as combinations of nutrient supplements. For example, in some embodiments a combination of nutrient supplements includes a combination of Cell Boost 7a and Cell Boost 7b.
(109) In various embodiments, alkaline phosphatase (e.g., asfotase alfa) is produced by a process in which extra additions of nutrient supplement are added to the production bioreactor. In some embodiments, the nutrient supplement is added over a period of time, e.g., over a period of time ranging from 1 minute to 2 hours. In some embodiments, the nutrient supplement is added in a bolus. For example, one, two, three, four, five, six, or more boluses of nutrient supplement may be added. In some embodiments, the nutrient supplement is added at more than 2 different times, e.g., 2 to 6 different times. In various embodiments, such extra boluses of nutrient supplement may be added in various amounts. For example, such boluses of nutrient supplement may be added in an amount of about 1% to 20%, 1% to 10% or 1% to 5% (w/v) of the original volume of culture medium in the production bioreactor. In one particular embodiment, such boluses of nutrient supplement may be added in an amount of 1% to 20%, 1% to 10% or 1% to 5% (w/v) of the original volume.
(110) In some embodiments, a combination of nutrient supplements is used, and the first nutrient supplement, e.g., Cell Boost 7a, is added at a concentriaton of 0.5% to 4% (w/v) of the culture medium. In some embodiments, a combination of nutrient supplements is used, and the second nutrient supplement, e.g., Cell Boost 7b, is added at a concentriaton of 0.05% to 0.8% (w/v) of the culture medium. In specific embodiments wherein a combination of nutrient supplements include Cell Boost 7a and Cell Boost 7b, a boluses of nutrient supplement may be added in an amount of 1% to 20%, 1% to 10% or 1% to 5% (w/v) of the original volume.
(111) In various embodiments, such addition of extra boluses may occur at various times after inoculation. For example, boluses may be added at day 1, day 2, day 3, day 4, day 5, day 6, day 7, day 8, day 9, day 10, day 11, day 12, or later after inoculation. In practice, the frequency, amount, time point, and other parameters of bolus supplements of nutrient supplement may be combined freely according to the above limitation and determined by experimental practice.
(112) In some embodiments, the method disclosed herein further comprises adding zinc into said culture medium during production of the recombinant polypeptide. In some embodiments, zinc may be added to provide a zinc concentration of from about 1 to about 300 M in said culture medium. In one embodiment, zinc may be added to provide a zinc concentration of from about 10 to about 200 M (e.g., 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, or 150 M) in the culture medium. In some embodiments, zinc is added to provide a zinc concentration in the culture medium of from about 25 M to about 150 M, or about 60 M to about 150 M. In one embodiment, zinc is added to provide a zinc concentration in the culture medium of from about about 30, 60, or 90 M of zinc. In some embodiments, the zinc is added into said culture medium in a bolus, continuously, semi-continuously, or combinations thereof. In some embodiments, zinc is added one day, two days, three days, four days, five days, six days, seven days, eight days, nine days, ten days, eleven days, twelve days, and/or thirteen days after inoculation.
(113) Harvest
(114) Prior studies suggested that delaying harvest timing was associated with a viability and TSAC decline, so harvest timing can have a potential impact on other CQAs. In various embodiments, alkaline phosphatase (e.g., asfotase alfa) is harvested at a time point of about 200 hr, 210 hr, 220 hr, 230 hr, 240 hr, 250 hr, 260 hr, 264 hr, 270 hr, 280 hr, 288 hr (i.e., 12 days), or more than 12 days.
(115) Downstream Processes
(116) The term downstream process(es) used herein is generally referred to the whole or part(s) of the processes for recovery and purification of the alkaline phosphatases (e.g., asfotase alfa) produced from sources such as culture cells or fermentation broth.
(117) Generally, downstream processing brings a product from its natural state as a component of a tissue, cell or fermentation broth through progressive improvements in purity and concentration. For example, the removal of insolubles may be the first step, which involves the capture of the product as a solute in a particulate-free liquid (e.g., separating cells, cell debris or other particulate matter from fermentation broth). Exemplary operations to achieve this include, e.g., filtration, centrifugation, sedimentation, precipitation, flocculation, electro-precipitation, gravity settling, etc. Additional operations may include, e.g., grinding, homogenization, or leaching, for recovering products from solid sources, such as plant and animal tissues. The second step may be a product-isolation step, which removes components whose properties vary markedly from that of the desired product. For most products, water is the chief impurity and isolation steps are designed to remove most of it, reducing the volume of material to be handled and concentrating the product. Solvent extraction, adsorption, ultrafiltration, and precipitation may be used alone or in combinations for this step. The next step is about product purification, which separates contaminants that resemble the product very closely in physical and chemical properties. Possible purification methods include, e.g., affinity, ion-exchange chromatography, hydrophobic interaction chromatography, mixed-mode chromatography, size exclusion, reversed phase chromatography, ultrafiltration-diafiltration, crystallization and fractional precipitation. In some embodiments, the downstream processes comprise at least one of harvest clarification, ultrafiltration, diafiltration, viral inactivation, affinity capture, and combinations thereof. Downstream processes are described herein.
(118) Determination of Total Sialic Acid Content
(119) Commercial methods of carbohydrate quantification are available, e.g., from ThermoFisher. Generally, TSAC is released from a glycoprotein, e.g., asfotase alfa, using acid hydrolysis, and released sugars/TSAC are detected via electrochemical detection using column chromatography such as High-Performance Anion-Exchange Chromatography with Pulsed Amperometric Detection technique (HPAE-PAD). The resulting levels are quantified per mole against an internal standard and expressed as a function of the total mole protein.
(120) In some embodiments, the methods described herein further comprise measuring the total sialic acid content (TSAC) of the recombinant alkaline phosphatase. As described herein, TSAC impacts the half-life of the recombinant alkaline phosphatase in physiological conditions, and thus serves as a critical quality attribute for recombinantly-produced alkaline phosphatases such as, e.g., asfotase alfa. Tight control of the TSAC range is important for reproducibility and cGMP. In some embodiments, the TSAC is about 0.8 mol/mol to about 4.0 mol/mol recombinant alkaline phosphatase. In some embodiments, the TSAC is about 0.9 mol/mol to about 3.0 mol/mol recombinant alkaline phosphatase. In some embodiments, the TSAC is about 1.0 mol/mol to about 2.8 mol/mol recombinant alkaline phosphatase. In some embodiments, the TSAC is about 1.2 mol/mol to about 3.0 mol/mol recombinant alkaline phosphatase. In some embodiments, the TSAC is about 1.2 mol/mol to about 2.4 mol/mol recombinant alkaline phosphatase. In some embodiments, the TSAC is about 0.9 mol/mol, about 1.0 mol/mol, about 1.1 mol/mol, about 1.2 mol/mol, about 1.3 mol/mol, about 1.4 mol/mol, about 1.5 mol/mol, about 1.6 mol/mol, about 1.7 mol/mol, about 1.8 mol/mol, about 1.9 mol/mol, about 2.0 mol/mol, about 2.1 mol/mol, about 2.2 mol/mol, about 2.3 mol/mol, about 2.4 mol/mol, about 2.5 mol/mol, about 2.6 mol/mol, about 2.7 mol/mol, about 2.8 mol/mol, about 2.9 mol/mol, or about 3.0 mol/mol recombinant alkaline phosphatase.
(121) In some embodiments, the TSAC of recombinant alkaline phosphatase decreases during downstream processing. In some embodiments, the TSAC of recombinant alkaline phosphatases decreases as a result of sialidase enzymes present in the solution containing recombinant alkaline phosphatase, e.g., the cell culture, the HCCF, and/or the UFDF filtration pool. In some embodiments, sialidases are selectively removed from the cell culture, the HCCF, and/or the UFDF filtration pool to achieve a TSAC of about 0.9 mol/mol to about 3.0 mol/mol recombinant alkaline phosphatase. Sialidases can be selectively removed by, e.g., one or a combination of sialidase-specific inhibitors, antibodies, ion exchange and/or affinity chromatography, immunoprecipitation, and the like.
(122) In some embodiments, sialic acid moieties are added to recombinant alkaline phosphatase by sialyltransferase enzymes present in the solution containing recombinant alkaline phosphatase, e.g., the cell culture, the HCCF, and/or the UFDF filtration pool. In some embodiments, recombinant sialyltransferases are added exogenously to the cell culture, the HCCF, and/or the UFDF filtration pool to achieve a TSAC of about 0.9 to about 3.0 mol/mol recombinant alkaline phosphatase.
(123) Determination of Recombinant Alkaline Phosphatase Activity
(124) In some embodiments, the methods described herein further comprise measuring recombinant alkaline phosphatase activity. In some embodiments, the activity is selected from a method selected from at least one of a pNPP-based alkaline phosphatase enzymatic assay and an inorganic pyrophosphate (PPi) hydrolysis assay. In some embodiments, at least one of the recombinant alkaline phosphatase Kcat and Km values increases in an inorganic pyrophosphate (PPi) hydrolysis assay. In some embodiments, the method comprises determining an integral of viable cell concentration (IVCC).
(125) The last step may be used for product polishing, the processes which culminate with packaging of the product in a form that is stable, easily transportable and convenient. Storage at 2-8 C., freezing at 20 C. to 80 C., crystallization, desiccation, lyophilization, freeze-drying and spray drying are exemplary methods in this final step. Depending on the product and its intended use, product polishing may also sterilize the product and remove or deactivate trace contaminants (e.g., viruses, endotoxins, metabolic waste products, and pyrogens), which may compromise product safety.
(126) Product recovery methods may combine two or more steps discussed herein. For example, expanded bed adsorption (EBA) accomplishes removal of insolubles and product isolation in a single step. For a review of EBA, see Kennedy, Curr Protoc Protein Sci. 2005 June; Chapter 8: Unit 8.8. In addition, affinity chromatography often isolates and purifies in a single step.
(127) For a review of downstream processes for purifying a recombinant protein produced in culture cells, see Rea, 2008 Solutions for Purification of Fc-fusion Proteins. BioPharm Int. Supplements March 2:20-25. The downstream processes for alkaline phosphatases disclosed herein may include at least one, or any combination, of exemplary step described herein.
(128) Harvest Clarification Process
(129) In some embodiments of the method, the recombinant alkaline phosphatase is isolated from the cell culture by at least one purification step to form harvest clarified culture fluid (HCCF), i.e., a harvesting step or harvest clarification step. Harvesting the cell culture typically refers to the process of collecting the cell culture from the culture container, e.g., a bioreactor. In some embodiments, the at least one purification step comprises at least one of filtration, centrifugation, and combinations thereof. In some embodiments, the harvest clarification step comprises centrifuging and/or filtering the harvested cell culture in order to remove cells and cellular debris (e.g., insoluble biomaterials) to recover the product, i.e., the recombinant alkaline phosphatase. In some embodiments, the cells and cellular debris are removed in order to yield a clarified, filtered fluid suitable for chromatography. In some embodiments, the clarified, filtered fluid is known as harvest clarified culture fluid, or HCCF. In some embodiments, the cell culture is subjected to a combination of centrifugation and depth filtration to generate the HCCF. Possible used solutions in this step may include a recovery buffer (e.g., 50 mM Sodium Phosphate, 100 mM NaCl, pH 7.50). The composition of suitable recovery buffers may be selected by the skilled artisan.
(130) In some embodiments, the HCCF has a total sialic acid content (TSAC) of from about 2.1 mol/mol to about 4.3 mol/mol. In some embodiments, the HCCF has a TSAC of from about 2.2 mol/mol to about 3.6 mol/mol. In some embodiments, the HCCF has a TSAC of from about 2.2 mol/mol to about 3.4 mol/mol. In some embodiments, the HCCF has a TSAC of about 2.0, about 2.1, about 2.2, about 2.3, about 2.4, about 2.5, about 2.6, about 2.7, about 2.8, about 2.9, about 3.0, about 3.1, about 3.2, about 3.3, about 3.4, about 3.5, about 3.6, about 3.7, about 3.8, about 3.9, about 4.0, about 4.1, about 4.2, about 4.3, about 4.4, or about 4.5 mol/mol.
(131) Post-Harvest Ultrafiltration and/or Diafiltration
(132) In some embodiments of the method, an additional purification step is performed after the at least one purification step to form a filtration pool, also known as an UFDF pool or UFDF. In some embodiments, the at least one purification step is for concentration and buffer dilution. In some embodiments, the at least one purification step comprises at least one of harvest clarification, filtration, ultrafiltration, diafiltration, viral inactivation, affinity capture, and combinations thereof. In some embodiments, the at least one purification step comprises ultrafiltration (UF) and/or diafiltration (DF). Exemplary steps for the UF process include, e.g., pre-use cleaning/storage of the filter membrane, post-clean/post-storage flush, equilibration (e.g., with a buffer containing 50 mM sodium phosphate, 100 mM NaCl, pH 7.50), loading, concentration, dilution/flush/recovery (e.g., with a buffer containing 50 mM sodium phosphate, 100 mM NaCl, pH 7.50), and post-use flush/clean/storage of the filter membrane.
(133) In some embodiments, after UF/DF, the UFDF is diluted to a protein concentration of about 1.7 g/L to about 5.3 g/L, then maintained at about 13 C. to about 27 C. for about 1 to about 60 hours, prior to storage and/or further purification. Holding or maintaining the UFDF, as used herein, refers to the UFDF being kept at the same temperature (within about 1 C.) for a target length of time, i.e., the hold time (within about 2 hours). In some embodiments, the UFDF is held in order to serve as a control point in the recombinant alkaline phosphatase production process. In some embodiments, the UFDF is held in order to ensure uniform product quality. In some embodiments, the UFDF is held in order to facilitate downstream processing.
(134) In some embodiments, the TSAC of the recombinant alkaline phosphatase decreases during the UFDF hold time. In some embodiments, the TSAC decline is correlated with the protein concentration, length of time, and/or temperature during the UFDF hold time.
(135) In some embodiments, the start of the UFDF hold time is immediately after the end of the chromatography step. In some embodiments, the start of the UFDF hold time is immediately after the end of the UF/DF. In some embodiments, the start of the UFDF hold time is immediately after the completion of a recirculation at the end of the UF/DF step. In some embodiments, the start of the UFDF hold time is immediately after the UF/DF product filtration and transfer is completed.
(136) In some embodiments, the UFDF is diluted to achieve a desired protein concentration. In some embodiments, the UFDF has a protein concentration of about 1.0 g/L to about 6.0 g/L. In some embodiments, the UFDF has a protein concentration of about 1.7 g/L to about 5.3 g/L. In some embodiments, the UFDF has a protein concentration of about 2.0 g/L to about 5.0 g/L. In some embodiments, the UFDF has a protein concentration of about 2.3 g/L to about 4.3 g/L. In some embodiments, the UFDF has a protein concentration of about 3.0 g/L to about 4.5 g/L. In some embodiments, the UFDF has a protein concentration of about 3.3 g/L to about 4.1 g/L. In some embodiments, the UFDF has a protein concentration of about 2.0 g/L, about 2.1 g/L, about 2.2 g/L, about 2.3 g/L, about 2.4 g/L, about 2.5 g/L, about 2.6 g/l, about 2.7 g/L, about 2.8 g/L, about 2.9 g/L, about 3.0 g/L, about 3.1 g/L, about 3.2 g/L, about 3.3 g/L, about 3.4 g/L, about 3.5 g/L, about 3.6 g/L, about 3.7 g/L, about 3.8 g/L, about 3.9 g/L, about 4.0 g/L, about 4.1 g/L, about 4.2 g/L, about 4.3 g/L, about 4.4 g/L, or about 4.5 g/L.
(137) In some embodiments, the UFDF comprises a combination of recombinant alkaline phosphatase and other proteins. In some embodiments, the UFDF has an alkaline phosphatase concentration of about 2.0 g/L to about 6.0 g/L. In some embodiments, the UFDF has an alkaline phosphatase concentration of about 2.5 g/L to about 5.0 g/L. In some embodiments, the UFDF has an alkaline phosphatase concentration of about 3.0 g/L to about 4.5 g/L. In some embodiments, the UFDF has an alkaline phosphatase concentration of about 3.3 g/L to about 4.1 g/L. In some embodiments, the UFDF has an alkaline phosphatase concentration of about 3.0 g/L, about 3.1 g/L, about 3.2 g/L, about 3.3 g/L, about 3.4 g/L, about 3.5 g/L, about 3.6 g/L, about 3.7 g/L, about 3.8 g/L, about 3.9 g/L, about 4.0 g/L, about 4.1 g/L, about 4.2 g/L, about 4.3 g/L, about 4.4 g/L, or about 4.5 g/L.
(138) In some embodiments, the UFDF is held for about 1 hour to about 60 hours. In some embodiments, the UFDF is held for about 10 hours to about 50 hours. In some embodiments, the UFDF is held for about 12 hours to about 48 hours. In some embodiments, the UFDF is held for about 14 hours to about 42 hours. In some embodiments, the UFDF is held for about 17 hours to about 34 hours. In some embodiments, the UFDF is held for about 19 hours to about 33 hours. In some embodiments, the UFDF is held for about 25 to about 38 hours. In some embodiments, the UFDF is held for about 29 to about 35 hours. In some embodiments, the UFDF is held for about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, or about 20 hours. In some embodiments, the UFDF is held for about 29 hours, about 30 hours, about 31 hours, about 32 hours, about 33 hours, about 34 hours, or about 35 hours. In some embodiments, the UFDF is held for about 42 hours, about 43 hours, about 44 hours, about 45 hours, about 46 hours, about 47 hours, or about 48 hours.
(139) In some embodiments, the UFDF is held at a temperature of about 10 C. to about 30 C. In some embodiments, the UFDF is held at a temperature of about 13 C. to about 27 C. In some embodiments, the UFDF is held at a temperature of about 14 C. to about 26 C. In some embodiments, the UFDF is held at a temperature of about 15 C. to about 26 C. In some embodiments, the UFDF is held at a temperature of about 15 C. to about 25 C. In some embodiments, the UFDF is held at a temperature of about 19 C. to about 25 C. In some embodiments, the UFDF is stored at the end of the hold time until further downstream processing steps are performed. In some embodiments, the UFDF is stored at 80 C. after flash freezing.
(140) In some embodiments, the at least one additional purification step further comprises a viral inactivation step. In some embodiments, the viral inactivation step comprises a solvent/detergent viral inactivation process to chemically inactivate viral particles. Exemplary solvent/detergent may comprise 10% Polysorbate 80, 3% TNBP, 50 mM Sodium Phosphate, and 100 mM NaCl.
(141) Chromatography
(142) In some embodiments of the method, the UFDF is subjected to at least one chromatography step to obtain partially purified recombinant alkaline phosphatase. In some embodiments, the UFDF is subjected to at least one chromatography step to obtain partially purified recombinant alkaline phosphatase, wherein the recombinant alkaline phosphatase has a total sialic acid content (TSAC) of about 0.9 mol/mol to about 3.0 mol/mol. In some embodiments, the at least one chromatography step is performed to further purify the product and/or separate the impurities/contaminants. In some embodiments, the at least one chromatography step is protein chromatography. In some embodiments, the protein chromatography is gel filtration chromatography, ion exchange chromatography, reversed-phase chromatography (RP), affinity chromatography, expanded bed adsorption (EBA), mixed-mode chromatography, and/or hydrophobic interaction chromatography (HIC). In some embodiments, the protein chromatography is affinity chromatography. In some embodiments, the protein chromatography is Protein A chromatography. In some embodiments, the Protein A chromatography captures the product (i.e., the alkaline phosphatase, such as asfotase alfa). For example, a process of GE Healthcare Mab Select SuRe Protein A chromatography may be used. Exemplary buffers and solutions used in Protein A chromatography include, e.g., equilibration/wash buffer (e.g., 50 mM Sodium Phosphate, 100 mM NaCl, pH 7.50), elution buffer (e.g., 50 mM Tris, pH 11.0), strip buffer (e.g., 100 mM Sodium Citrate, 300 mM NaCl, pH 3.2), flushing buffer, cleaning solution (e.g., 0.1 M NaOH), etc.
(143) In some embodiments, the at least one chromatography step comprises an additional chromatography and/or purification step. In some embodiments, the at least one additional chromatography step comprises column chromatography. In some embodiments, the column chromatography is gel filtration chromatography, ion exchange chromatography, reversed-phase chromatography (RP), affinity chromatography, expanded bed adsorption (EBA), mixed-mode chromatography, and/or hydrophobic interaction chromatography (HIC). In some embodiments, the column chromatography comprises hydrophobic interaction chromatography (HIC). In some embodiments, the HIC uses Butyl Sepharose or CAPTO Butyl agarose columns. Exemplary buffers and solutions used in a CAPTO Butyl agarose HIC process include, e.g., loading dilution buffer/pre-equilibration buffer (e.g., 50 mM sodium phosphate, 1.4 M sodium sulfate, pH 7.50), equilibration buffer/wash buffer/elution buffer (e.g., all containing sodium phosphate and sodium sulfate), strip buffer (e.g., containing sodium phosphate), etc. Exemplary buffers and solutions used in a Butyl HIC process include, e.g., loading dilution buffer/pre-equilibration buffer (e.g., 10 mM HEPES, 2.0 M ammonium sulfate, pH 7.50), equilibration buffer/wash buffer(s)/elution buffer (e.g., all containing sodium phosphate or HEPES and ammonium sulfate), and strip buffer (e.g., containing sodium phosphate).
(144) In some embodiments, the at least one additional purification step comprises an additional diafiltration. In some embodiments, the at least one additional chromatography and/or purification step comprises hydrophobic interaction chromatography and/or at least an additional diafiltration step. In some embodiments, the additional diafiltration step is performed after a hydrophobic interaction chromatography step. In some embodiments, the additional diafiltration step is performed for product concentration and/or buffer exchange. Exemplary buffers and solutions used in this process include, e.g., equilibration buffer (e.g., 20 mM Sodium Phosphate, 100 mM NaCl, pH 6.75), diafiltration buffer (20 mM Sodium Phosphate, 100 mM NaCl, pH 6.75), etc.
(145) In some embodiments, the at least one additional chromatography and/or purification step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 0.5 mol/mol to about 4.0 mol/mol. In some embodiments, the at least one additional chromatography and/or purification step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 0.9 mol/mol to about 3.9 mol/mol. In some embodiments, the at least one additional chromatography and/or purification step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 1.1 mol/mol to about 3.2 mol/mol. In some embodiments, the at least one additional chromatography and/or purification step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 1.4 mol/mol to about 2.6 mol/mol. In some embodiments, the at least one additional chromatography and/or purification step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 1.2 mol/mol to about 3.0 mol/mol. In some embodiments, the at least one additional chromatography step is performed to obtain recombinant alkaline phosphatase with a TSAC of about 0.8 mol/mol, about 0.9 mol/mol, 1.0 mol/mol, about 1.1 mol/mol, about 1.2 mol/mol, about 1.3 mol/mol, about 1.4 mol/mol, about 1.5 mol/mol, about 1.6 mol/mol, about 1.7 mol/mol, about 1.8 mol/mol, about 1.9 mol/mol, about 2.0 mol/mol, about 2.1 mol/mol, about 2.2 mol/mol, about 2.3 mol/mol, about 2.4 mol/mol, about 2.5 mol/mol, about 2.6 mol/mol, about 2.7 mol/mol, about 2.8 mol/mol, about 2.9 mol/mol, about 3.0 mol/mol, about 3.1 mol/mol, about 3.2 mol/mol, about 3.3 mol/mol, about 3.4 mol/mol, about 3.5 mol/mol, about 3.6 mol/mol, about 3.7 mol/mol, about 3.8 mol/mol, about 3.9 mol/mol, or about 4.0 mol/mol.
(146) Additional Downstream Processes
(147) In some embodiments, additional downstream processes are performed in addition to the at least one purification step, the additional purification step, the at least one chromatography step, and/or the additional chromatography step. In some embodiments, the additional downstream processes further purify the product, i.e., the recombinant alkaline phosphatase.
(148) In some embodiments, the additional downstream processes include a viral reduction filtration process to further remove any viral particles. In some embodiments, the viral reduction filtration process is nanofiltration.
(149) In some embodiments, the additional downstream processes include at least one further chromatography step. In some embodiments, the at least one further chromatography step is protein chromatography. In some embodiments, the protein chromatography is gel filtration chromatography, ion exchange chromatography, reversed-phase chromatography (RP), affinity chromatography, expanded bed adsorption (EBA), mixed-mode chromatography, and/or hydrophobic interaction chromatography (HIC). In some embodiments, the third chromatography step is mixed-mode chromatography, such as CAPTO Adhere agarose chromatography. Commercially available mixed-mode materials include, e.g., resins containing hydrocarbyl amine ligands (e.g., PPA Hypercel and HEA Hypercel from Pall Corporation, Port Washington, NY), which allow binding at neutral or slightly basic pH, by a combination of hydrophobic and electrostatic forces, and elution by electrostatic charge repulsion at low pH (see Brenac et al., 2008 J Chromatogr A. 1177:226-233); resins containing 4-mercapto-ethyl-pyridine ligand (MEP Hypercel, Pall Corporation), which achieves hydrophobic interaction by an aromatic residue and the sulfur atom facilitates binding of the target protein by thiophilic interaction (Lees et al., 2009 Bioprocess Int. 7:42-48); resins such as CAPTO MMC mixed-mode chromatography and CAPTO adhere agarose chromatography (GE Healthcare, Amersham, UK) containing ligands with hydrogen bonding groups and aromatic residues in the proximity of ionic groups, which leads to the salt-tolerant adsorption of proteins at different conductivities (Chen et al., 2010 J Chromatogr A. 1217:216-224); and other known chromatography materials, such as affinity resins with dye ligands, hydroxyapatite, and some ion-exchange resins (including, but not limited to, Amberlite CG 50 (Rohm & Haas, Philadelphia, PA) or Lewatit CNP 105 (Lanxess, Cologne, DE). For an exemplary agarose HIC chromatography step, exemplary buffers and solutions used in this process include, e.g., pre-equilibration buffer (e.g., 0.5 M Sodium Phosphate, pH 6.00), equilibration/wash buffer (e.g., 20 mM Sodium Phosphate, 440 mM NaCl, pH 6.50), load titration buffer (e.g., 20 mM Sodium Phosphate, 3.2 M NaCl, pH 5.75), pool dilution buffer (e.g., 25 mM Sodium Phosphate, 150 mM NaCl, pH 7.40), and strip buffer (0.1 M Sodium Citrate, pH 3.20.
(150) In some embodiments, the additional downstream processes comprise a virus filtration step for viral clearance. In some embodiments, the viral filtration step is performed by size exclusion chromatography. Exemplary buffers and solutions used in this process include, e.g., pre-use and post-product flush buffer (e.g., 20 mM Sodium Phosphate, 100 mM NaCl, pH 6.75).
(151) In some embodiments, the additional downstream processes comprise a formulation process. In some embodiments, the formulation process comprises at least one further ultrafiltration and/or diafiltration for further concentration and/or buffer exchange. Exemplary buffers and solutions used in this process include, e.g., filter flush/equilibration/diafiltration/recovery buffer (e.g., 25 mM Sodium Phosphate, 150 mM NaCl, pH 7.40).
(152) In some embodiments, the additional downstream processes comprise a bulk fill process. In some embodiments, the bulk fill process comprises sterile filtration. Exemplary filters for sterile filtration are Millipak 60 or Equivalent sized PVDF filters (EMD Millipore, Billerica, MA.
(153) In some embodiments, the steps used for producing, purifying, and/or separating the alkaline phosphatase from the culture cells, as disclosed herein, further comprise at least one of steps selected from the group consisting of: a harvest clarification process (or a similar process to remove the intact cells and cell debris from the cell culture), an ultrafiltration (UF) process (or a similar process to concentrate the produced alkaline phosphatase), a diafiltration (DF) process (or a similar process to change or dilute the buffer comprising the produced alkaline phosphatase from previous processes), a viral inactivation process (or a similar process to inactivate or remove viral particles), an affinity capture process (or any one of chromatography methods to capture the produced alkaline phosphatase and separate it from the rest of the buffer/solution components), a formulation process and a bulk fill process. In one embodiment, the steps for producing, purifying, and/or separating the alkaline phosphatase from the culture cells, as disclosed herein, comprise at least a harvest clarification process (or a similar process to remove the intact cells and cell debris from the cell culture), a post-harvest ultrafiltration (UF) process (or a similar process to concentrate the produced alkaline phosphatase), a post-harvest diafiltration (DF) process (or a similar process to change or dilute the buffer comprising the produced alkaline phosphatase from previous processes), a solvent/detergent viral inactivation process (or a similar process to chemically inactivate viral particles an intermediate purification process (such as hydrophobic interaction chromatography (HIC) or any one of chromatography methods to capture the produced alkaline phosphatase and separate it from the rest of the buffer/solution components), a post-HIC UF/DF process (or a similar process to concentrate and/or buffer exchange for the produced alkaline phosphatase), a viral reduction filtration process (or a similar process to further remove any viral particles or other impurities or contaminants); a mixed-mode chromatography (such as CAPTO Adhere agarose chromatography, or a similar process to further purify and/or concentrate the produced alkaline phosphatase), a formulation process and a bulk fill process. In one embodiment, the separating step of the method provided herein further comprises at least one of harvest clarification, ultrafiltration, diafiltration, viral inactivation, affinity capture, HIC chromatography, mixed-mode chromatography and combinations thereof.
(154) In some embodiments, the disclosure provides a method for controlling total sialic acid content (TSAC) in a TSAC-containing recombinant protein through mammalian cell culture, comprising at least one purification step and at least one chromatography step. In some embodiments, the disclosure provides a method for controlling glycosidase activity in mammalian cell culture producing recombinant protein, comprising at least one purification step and at least one chromatography step. In some embodiments, the at least one purification step comprises at least one of filtration, centrifugation, harvest clarification, filtration, ultrafiltration, diafiltration, viral inactivation, affinity capture, and combinations thereof. In some embodiments, the at least one chromatography step comprises protein chromatography. In some embodiments, the protein chromatography is gel filtration chromatography, ion exchange chromatography, reversed-phase chromatography (RP), affinity chromatography, expanded bed adsorption (EBA), mixed-mode chromatography, and/or hydrophobic interaction chromatography (HIC). In some embodiments, the purification step and chromatography step are ultrafiltration/diafiltration and protein A chromatography.
(155) All references cited herein are incorporated by reference in their entirety. Although the foregoing disclosure has been described in some detail by way of illustration and example for purposes of clarity of understanding, it is apparent to those skilled in the art that certain minor changes and modifications will be practiced. Therefore, the description and examples should not be construed as limiting the scope of the disclosure.
EXAMPLES
Example 1: Production of Asfotase Alfa and TSAC Measurement
(156) Asfotase alfa (or other glycoprotein of interest) is manufactured by known methods. In particular, inoculum expansion is performed from the appropriate recombinant cell line (i.e., transfected CHO cells carrying GS resistance marker, selected in the presence of MSX), which is sample aliquoted into the appropriate growth media, then further grown in a bioreactor at controlled temperature, pH, DO.sub.2, and agitation. Typical production methods for asfotase alfa are fed-batch bioreactor methods with CHO cells, though other methods are also acceptable. When a desired cell density and/or cell viability has been reached, the primary recovery from the raw Cell Culture Fluid (CCF) is performed by centrifugation and depth filtration which results in the Harvest Cell Culture Fluid (HCCF).
(157) The HCCF is further purified by ultrafiltration and diafiltration to form the UFDF. Further chromatographic purification steps are performed, such as viral inactivation, protein A chromatography (resulting in a protein A pool), multimodal chromatography purification, and additional ultrafiltration and diafiltration steps. The final bulk drug substance, or purified recombinant asfotase alfa, is tested for release specifications. The bulk drug substance proceeds to final fill finish steps, which result in final packaging suitable for administration.
(158) During manufacturing, the TSAC content is an important value and is monitored closely. However, the specific impact of hold time and temperature on TSAC was not fully understood. Therefore, identification and quantitation of sialic acid in asfotase alfa samples at various stages of manufacture was performed by high performance anion exchange chromatography with pulsed amperometric detection (HPAE-PAD). (Commercial systems for carbohydrate detection and quantitation are available, i.e., ThermoScientific and others.) Samples were first spiked with internal standard and dried in a rotary evaporator and sialic acids were released via acid hydrolysis (0.1M HCl). Samples were dried again to remove residual acid then reconstituted in water to be injected into a capillary ion chromatography system (Dionex IC-5000). After injection, samples undergo anion exchange chromatography in an alkaline environment using an acetate gradient for separation of sialic acid species, from 5% acetate buffer to 30% acetate buffer over 30 minutes with a 5 minute equilibration at 5% acetate buffer at the end of each injection. Separation occurs in an HPLC column designed for carbohydrate separation (i.e., CarboPac PA100 column, where a stationary phase of nonporous beads coated with latex in conjunction with alkaline mobile phases separates based on charge). Post separation, samples were detected via pulsed amperometric detection. A repeating waveform oxidized samples at the surface of a gold electrode, where the difference of electrical potential between oxidized sample and the gold electrode is measured. Results are plotted as electrical potential (nC) vs time and peaks are integrated. Percent of internal standard (% ISTD) is calculated via NeuSAc or Neu5Gc peak area divided by the internal standard, 3-deoxy-D-glycero-D-galacto-2-nonulosonic acid (KDN, Sigma-Aldrich), area multiplied by 100, and quantitated by comparison to a standard curve of standard % ISTD vs standard concentration. Sample concentration is determined by interpolating sample % ISTD from the standard curve. A blend of Neu5Ac and Neu5Gc sialic acids was used as an assay standard, allowing the method to quantitate both species. Results are reported in nmol Neu5Ac per nmol monomer. Neu5Gc is not expected to be present in amounts above the LOQ of the assay; however samples exhibiting quantifiable Neu5Gc are noted in routine experimentation.
(159) The mole ratio of sialic acid to protein for each sample is calculated by dividing the nmol amount of sialic acid recovered by the nmol amount of protein (i.e., asfotase alfa) hydrolyzed by using the concentration (as determined by absorbance of the sample at 280 nm and adjusted by the molar extinction coefficient and the molecular weight).
(160) Additional details on the some embodiments of the methods of the production of asfotase alfa can be found in International Publications WO 2017/031114 and WO 2017/214130, the disclosures of which are hereby incorporated by reference in their entireties.
Example 2: Evaluation of UFDF Hold Time, Temperature, and Protein Concentration on TSAC
(161) During large-scale production of asfotase alfa (as described generally in Example 1), a drop in TSAC from harvested cell culture fluid (HCCF) to Protein A pool was observed. This difference was expected to be largely due to the post-harvest concentration/diafiltration (UF/DF1) hold step. The average decrease in TSAC observed from HCCF to protein A pool was approximately 1.1 mol/mol with a standard deviation of 0.2 mol/mol, with a range of 0.9 mol/mol to 1.3 mol/mol.
(162)
(163)
(164) A small-scale characterization study was executed to assess and characterize the impact of UF/DF1 hold time, temperature, and protein concentration on TSAC during the UF/DF1 hold.
Example 2.1: UF/DF1 Operation and Hold
(165)
(166) TABLE-US-00002 TABLE 1 UF/DF1 Process Conditions Process Parameter Target TFF membrane used Millipore Biomax C screen Membrane cutoff (Da) 50,000 TMP 15 PSI (10-20 PSI target range; 22 PSI maximum) Cross flow rate 6-8 L/m.sup.2/min Filter area (m.sup.2) 0.1 Filter load (L/m.sup.2) 250
(167) TABLE-US-00003 TABLE 2 Post Harvest Concentration/Diafiltration (UF/DF1) Cross Flow Step Buffer Volume Rate WFI Rinse WFI 5 L/m.sup.2 8 L/m.sup.2/min Pre-use Clean 0.5M NaOH 5 L/m.sup.2 8 L/m.sup.2/min WFI Rinse WFI 5 L/m.sup.2 8 L/m.sup.2/min NWP 0.1M NaOH N/A 5 L/m.sup.2/min Equilibration 50 mM Sodium 5 L/m.sup.2 8 L/m.sup.2/min Phosphate 100 mM Sodium Chloride pH 7.5 Concentration Harvest 25X maximum 6 L/m.sup.2/min Diafiltration 50 mM Sodium 7X 6 L/m.sup.2/min Phosphate 100 mM Sodium Chloride pH 7.5 Product 50 mM Sodium Chase/concentrate as 4 L/m.sup.2/min Recovery Phosphate 100 needed to target mM Sodium 4.9 mg/mL and Chloride pH 7.5 dilute aliquots immediately to target final concentrations..sup.1 WFI Rinse WFI 20 L/m.sup.2 5 L/m.sup.2/min Clean 0.5M NaOH, 5 L/m.sup.2 8 L/m.sup.2/min 400 ppm bleach WFI Rinse WFI 5 L/m.sup.2 8 L/m.sup.2/min Store 0.2M NaOH 5 L/m.sup.2 8 L/m.sup.2/min .sup.1Generating samples at high concentration required a final concentration factor above the transferred range (25X) and was governed by harvest titer. To achieve the higher concentration, a final concentration step (UF1') was performed prior to product recovery.
(168) In-process samples at the end of UF1 and end of DF were pulled for purification and TSAC analysis. Generating samples at high concentration required a final concentration step (UF1) that resulted in a concentration factor above the transferred range (25 X) and was governed by the estimated harvest titer of each individual lot. The lower concentrations were achieved by dilution with DF buffer Immediately following completion of the UF/DF1, the pool was diluted according to the study design (
(169) T=0 in this study was defined as the time at which a 10 minute recirculation was completed at the end of the diafiltration (DF) step. During manufacturing operations, the start of the hold time is currently defined as the end of bag fill following UF/DF1 product filtration and transfer. The transfer takes approximately 5 hours on average from the end of diafiltration, which is in addition to the hold time for the UF/DF1 pool.
Example 2.2: High Throughput MabSelect SuRe Protein a Chromatography
(170) UF/DF1 hold samples were processed through MabSelect SuRe pre packed RoboColumns without the solvent/detergent viral inactivation (S/D VI) step. Removal of the S/D VI step does not affect TSAC results and improves processing time for the high throughput RoboColumn method (DVL 16 0128). Table 3 presents the MabSelect SuRe RoboColumn affinity chromatography step. The operation was performed using pre-packed MabSelect SuRe RoboColumns and the Tecan Freedom Evo Liquid Handling system. Samples were purified in batches with up to 8 samples per batch. Prior to purification of each sample batch, samples were thawed in a water bath (18-25 C.) for 1 hour.
(171) The elution from each RoboColumn purification was collected across four 96-well plates (approximately 200 l per well) and the absorbance (A280) measured for each well. For each column, elution wells containing product were pooled via micropipetting on the basis of the collection criteria defined in Table 3 and pools were sterile filtered (0.22 m). The ProA pools were not pH adjusted or diluted.
(172) TABLE-US-00004 TABLE 3 MabSelect SuRe RoboColumn Chromatography Flow Rate Step Buffer CV (cm/hr) Clean 0.1M Sodium Hydroxide 5 150 Equilibration 50 mM Sodium 8 150 Phosphate 100 mM Sodium Chloride pH 7.5 Load UF/DF1 Retentate 100 Post Load 50 mM Sodium 3.5 150 Wash 1 Phosphate 100 mM Sodium Chloride pH 7.5 Elution 50 mM Tris pH 11.0 16 100 Strip 100 mM Sodium Citrate 5.5 150 300 mM Sodium Chloride pH 3.2 WFI Flush WFI 3 150 Clean 0.1M Sodium Hydroxide 5 150 Equilibration 50 mM Sodium 3 150 Phosphate 100 mM Sodium Chloride pH 7.5 Store 18% Ethanol 3 100
Example 2.3: ResultsTSAC at HCCF/in-Process Samples
(173) Table 4 lists the UF/DF1 in-process TSAC data generated across all three harvest lots. There is a drop in TSAC expected from HCCF to the start of the UF/DF1 hold (T=0) due to the higher concentrations of both product and sialidase that are achieved in the UF1 step and then maintained throughout the remainder of the UF/DF1 operation. However, this TSAC decrease is only expected to be a small fraction of the total TSAC drop from HCCF to Protein A given the processing time is minimal relative to the total UF/DF1 pool hold time. To assess this decrease, TSAC results from all T=0 samples for each harvest UF/DF1 batch were averaged and then subtracted from the starting TSAC at HCCF of the batch. Given the duration from end of UF/DF1 operation and T=0 sampling (diluted and frozen within 2 hours of hold start time), minimal variability (within 10% assay variability) is expected across the T=0 samples despite the varying protein concentrations. Therefore, averaging the results from the T=0 samples provides more confidence in the T=0 result and minimizes the impact of assay variability.
(174) As shown in Table 4, the reported TSAC at HCCF for harvest batch #B is 3.6 mol/mol and the average TSAC result for the T=0 samples is 2.5 mol/mol. A 0.9 mol/mol drop in TSAC is therefore calculated during the UF/DF1 operation for this lot. This extent of TSAC drop is more typically seen after the UF/DF1 hold (14-48 hrs) has been completed, suggesting one of the TSAC results for this lot may have been an outlier. The additional small scale in process results for batch #B provided evidence that the TSAC value for HCCF was the outlier assay result since the averaged TSAC at T=0 aligned well with the UF/DF1 in process results (End UF1, End DF) shown below. Additionally, the TSAC value measured for CCF of this manufacturing batch is 2.7 mol/mol and the difference between the TSAC results at CCF and HCCF for this batch was inconsistent with process expectations.
(175) TABLE-US-00005 TABLE 4 HCCF and UF/DF1 In-process sample TSAC Data summary Harvest Lot # A B C TSAC (mol/mol) HCCF 3.4 3.6 2.9 End UF1 3.3 2.4 2.7 End DF 3.1 2.2 2.7 End of UF1 (T = 0, average) 3.0 2.7.sup.1 2.4 Drop from HCCF to end 0.4 0.9 0.5 of UF/DF1 process.sup.2 .sup.1Average of only two TSAC values (excluded low concentration sample as it will not be included in final analysis) .sup.2Calculation: TSAC at HCCF TSAC at End of UF1' (T = 0)
(176) An accurate TSAC at HCCF result is required to analyze the TSAC drop from HCCF to the Protein A pool (TSAC drop=TSAC at HCCFTSAC at ProA Pool). To minimize the impact of a potentially aberrant result for TSAC at HCCF for harvest batch #B on subsequent analyses, an average TSAC value was calculated using in process results from HCCF through T=0. Included in the average is the original TSAC at HCCF result of 3.6 mol/mol, the TSAC at end of UF1 (2.4 mol/mol), the TSAC at end of DF (2.2 mol/mol), and the TSAC values at T=0. In this case, only two of the three T=0 values were used in this calculation, since the result from the lowest hold temperature and lowest UF/DF1 protein concentration was ultimately excluded from the data set (see
(177) TABLE-US-00006 TABLE 5 Revised HCCF and UF/DF1 In-process sample TSAC Data summary Harvest Lot # A B C TSAC HCCF 3.4 2.7.sup.1 2.9 (mol/mol) End UF1 3.3 2.4 2.7 End DF 3.1 2.2 2.7 End of UF1 (T = 0, average) 3.0 2.7.sup.2 2.4 Drop from HCCF at end of 0.4 0.0 0.5 UF/DF1 process.sup.3 .sup.1Harvest value = average of QC result, end UF, end DF, and both T = 0 samples .sup.2Average of only two TSAC values (excluded low concentration sample as it will not be included in final analysis) .sup.3Calculation: TSAC at HCCF TSAC at End of UF1' (T = 0)
Example 2.4: TSAC at Protein A
(178)
Example 3: TSAC Measurement after Protein A Chromatography and Bulk Fill
(179) Total sialic acid content (TSAC) was measured at two steps of the manufacturing process for asfotase alfa: after Protein A Chromatography (also referred to as the Protein A or ProA pool) and Bulk Fill (also referred to as the bulk drug substance or BDS release) (see
Example 4: TSAC Measurement Before and After Harvest
(180) Total sialic acid content (TSAC) was measured in the cell culture fluid (CCF) and harvest clarified culture fluid (HCCF) (see
(181) Additional multivariate analysis performed on cell culture fluid did not identify a statistically significant impact from cell generation number (32 to 51 generations) at the inoculation of production bioreactor on CCF TSAC (data not shown). A subsequent analysis confirmed no statistically significant correlation between generation number with the tested ranged and TSAC at CCF or HCCF.
Example 5: TSAC Measurement Before and after Harvest
(182) A review of TSAC measurement collected at various points in the manufacturing process shows that the decrease in TSAC between the HCCF and Protein A pool occurs over the hold after UF/DF1 (also known as the UF1 hold; see
(183) Previous analysis identified a correlation between UFDF1 hold time and TSAC variability at BDS. Since the impact of the UFDF1 hold time, temperature, and protein concentration on TSAC decrease were not fully understood, additional temperature and protein concentration dependent data were collected at small scale to understand the impact on TSAC decrease during the UF1 hold. A multivariate evaluation of the three factors during UFDF1 hold was accomplished using a full factorial experimental study design evaluating a range for each factor (Table 6). This small scale characterization study design was executed using harvest from three batches (A, B, and C). Following small scale UFDF 1 operations for each harvest, UFDF1 pools were held at various hold times, temperatures, and protein concentrations (Table 6). Samples were purified using small scale Protein A column for TSAC analysis. The TSAC at Protein A pool was compared to the TSAC value at HCCF for the respective harvest and the total decrease in TSAC from HCCF (TSAC drop) was calculated for each UF1 hold condition.
(184) TABLE-US-00007 TABLE 6 Parameter/Attribute Studied Characterization Range Hold Temperature ( C.) 15-25 Hold Time (hours) 0-60 Protein Concentration (g/L) 1.8-5.3
(185) A JMP model was created by performing fit model analysis on the TSAC drop during UFDF1 hold as per the experimental results. Each factor (hold time, temperature, and protein concentration) was included in a factorial analysis using the stepwise regression. Model outputs included the actual by predicted plot (
(186) To ensure that the small scale UFDF1 model as well as the JMP model created from these data are representative of large scale process, the predictive model was verified for its ability to predict BDS TSAC for 35 manufactured batches where HCCF TSAC and UFDF1 hold data (average hold time, protein concentration, and average hold temperature) are both available. For each manufactured batch, the predicted TSAC drop was subtracted from the measured HCCF TSAC to yield predicted ProA TSAC. Based on an average 0.2 mol/mol TSAC increase from ProA to BDS, the predicted BDS TSAC was calculated. The BDS TSAC was predictable within assay variability (20%) for all manufacturing batches with the exception of batch # B.
(187) Characterization studies demonstrated that UFDF 1 protein concentration has a statistically significant (p-value<0.0001) impact on TSAC decrease during UFDF1 hold. The TSAC decrease during UF1 hold is believed to occur due to presence of sialidase enzyme which is known to be present in mammalian cell culture harvest (Gramer and Goochee, Biotechnol. Prog. 9:366-373 (1993), incorporated specifically herein by reference). The protein concentration of asfotase alfa is considered a surrogate for concentration of sialidase enzyme during UFDF1 hold. However, this attribute was not defined for TSAC control in the drug substance manufacturing process.
(188) In conclusion, the data suggests reducing the range of the hold time of the UFDF from 14-48 hours to 14-42 hours. Additionally, the data suggested adding a new performance attribute for protein concentration at the UFDF hold step with the range 2.0-4.3 g/L.
(189) All publications, patents, and patent applications mentioned in the above specification are hereby incorporated by reference to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety. Various modifications and variations of the described methods, pharmaceutical compositions, and kits of the instant disclosure will be apparent to those skilled in the art without departing from the scope and spirit of the claimed invention. Although the disclosure has been described in connection with specific embodiments, it will be understood that it is capable of further modifications and that the invention as claimed should not be unduly limited to such specific embodiments.