Materials and methods for subjects at risk for viral reactivation
11913962 ยท 2024-02-27
Assignee
Inventors
- Krishna Komanduri (Miami, FL, US)
- Eric Wieder (Miami, FL, US)
- Jose Camargo (Miami, FL, US)
- Erik Kimble (Miami, FL, US)
Cpc classification
G01N2800/245
PHYSICS
G01N33/6863
PHYSICS
G01N2333/523
PHYSICS
International classification
Abstract
Described herein are materials and methods for stratifying risk for reactivation of a latent viral infection, such as CMV infection. The methods are particularly useful for immune compromised subjects. Also described herein are interventions, including therapeutic, prophylactic, and monitoring interventions, for subjects determined to be at elevated risk.
Claims
1. A method comprising: (a) identifying or quantifying a risk for reactivation of a latent herpesviridae virus in an immune-compromised mammalian subject from measurement of a T cell subset from a blood sample isolated from the subject, wherein the measurement of the T cell subset is obtained by (i) exposing the T cells to one or more antigens from the latent herpesviridae virus, under conditions to stimulate a T cell immune response; (ii) evaluating individual T cells to detect or measure expression of cytokines IL-2, IFN, TNF, and MIP-1 in the individual T cells; (iii) evaluating the individual T cells to detect or measure CD8 expression; and quantifying T cells having a CD8-positive (CD8+), IL-2-positive (IL-2+), IFN-positive (IFN+), TNF-positive (TNF+), MIP-1-positive (MIP-1+) phenotype (PHENOTYPE-P) from the blood sample; and/or quantifying T cells having a CD8-positive (CD8+), IL-2-negative (IL-2), IFN-positive (IFN+), TNF-negative (TNF), MIP-1-positive (MIP-1+) phenotype (PHENOTYPE-N) from the blood sample, wherein the quantifying comprises: quantifying the T cells with the phenotype relative to total T cells analyzed, to generate a relative measure of the quantity of the T cells with the phenotype; and/or calculating a relative percentage or ratio of PHENOTYPE-P T cells to PHENOTYPE-N T cells; (b) identifying an elevated or high risk for reactivation of the virus in the subject from the measurement; and (c) administering, to the subject identified as having the elevated or high risk of viral reactivation, a prophylaxis that comprises an antiviral chemotherapeutic agent, wherein said agent comprises Ganciclovir, Valganciclovir, Foscarnet, Cidofovir, Maribavir, Brincidofovir, or Letermovir.
2. The method according to claim 1, wherein the mammalian subject is human.
3. The method according to claim 1, wherein the subject is a transplant recipient, and wherein the identifying or quantifying risk is performed on a blood sample comprising the T cells obtained from the subject 14 or more days after the transplant.
4. The method according to claim 3, wherein the transplant recipient is an allogeneic organ transplant recipient, an allogeneic tissue transplant recipient, or an allogeneic cell transplant recipient.
5. The method according to claim 4, wherein the subject is a hematopoietic cell transplant recipient.
6. The method according to claim 1, wherein the subject is immune-compromised from cancer chemotherapy or immunosuppressant therapy.
7. The method according to claim 1, wherein the blood sample is a never-frozen blood sample comprising T cells.
8. The method according to claim 1 wherein the method comprises said measuring of the expression of the cytokines.
9. The method according to claim 8, wherein the one or more antigens comprises a latent herpesviridae virus viral envelope protein antigen, or comprises one or more antigenic fragments thereof.
10. The method according to claim 8, wherein the latent virus is CMV, and the one or more antigens comprises CMV tegument phosphoprotein 65 (pp65), or CMV immediate early 1 (lE1) protein, or comprises one or more antigenic fragments thereof, or comprises mixtures of said proteins or antigenic fragments.
11. The method according to claim 8, wherein the exposing step further comprises exposing the T cells to anti-CD49d and/or anti-CD28 antibodies.
12. The method according to claim 8 that comprises identifying an elevated or high risk of viral inactivation from one or more of the following: increased percentages of Phenotype-N T cells in the blood sample; decreased percentages of Phenotype-P T cells in the blood sample; and a combination of a high percentage of Phenotype-N T cells and a low percentage of Phenotype-P T cells in the blood sample.
Description
BRIEF DESCRIPTION OF THE DRAWING
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
DETAILED DESCRIPTION
(21) Described herein are materials and methods for stratifying risk for reactivation of a latent viral infection, such as a CMV infection. The methods are particularly useful for immune compromised subjects because such subjects are already at greater risk for viral reactivation (and its complications) than the general population. Despite higher relative risk than the general population, the immune compromised population will not uniformly suffer from viral reactivation and its complications. The materials and methods described herein can be used to stratify risk within the immune compromised population that has its own elevated baseline risk. Also described herein are interventions, including therapeutic, prophylactic, and monitoring interventions, for subjects determined to be at elevated risk.
(22) Definitions
(23) In the absence of specific definitions herein, terms should be construed as they would be understood by clinicians and scientists in the field of the invention.
(24) Unless the context clearly requires otherwise, throughout the description and the claims, the words comprise, comprising, and the like are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense; that is to say, in the sense of including, but not limited to.
(25) Aspects of the invention pertain to identifying or quantifying risk. In some variations, the risk can be quantified numerically as an absolute risk. For instance, based on comparison to patient data sets obtained according to techniques described herein, it is possible to assign a numerical risk score, such as a probability of experiencing an event (e.g., virus reactivation or progressive viremia) within a certain period of time.
(26) In some variations, risk assessment is a relative risk assessment. For instance, a subject has a baseline risk for an event (e.g., virus reactivation or progressive viremia) by virtue of belonging to a recognized class (e.g., a patient that has received a hematopoietic cell transplant within the past month). The materials and methods described herein are useful for stratifying individuals within such a class as having elevated or increased risk, compared to the baseline risk of the hematopoietic cell transplant group of patients as a whole; or a reduced or decreased risk, compared to the baseline risk. Relative risk can be expressed quantitatively also (e.g., percent greater risk than the baseline or an odds ratio). Generally speaking, increased susceptibility or increased risk is descriptive of a relative risk or odds ratio greater than 1, compared to the baseline population. Thus, in particular embodiments of the invention, the increased susceptibility or increased risk is characterized by a relative risk of at least 1.5, including a relative risk of at least 2.0, a relative risk of at least 2.5, a relative risk of at least 3.0, a relative risk of at least 3.5, and a relative risk of at least 4.0, 4.5, 5, 5.5, 6, 7, 8, 9, 10 or more. Other embodiments are characterized by relative risk of at least 1.25, 1.75, 2.25, 2.75, 3.25, 3.75, and so on. Conversely, decreased susceptibility or decrease risk is descriptive of a relative risk or odds ratio less than 1.0. Decreased susceptibility in particular embodiments is characterized by a relative risk of less than 0.8, a relative risk of less than 0.7, a relative risk of less than 0.6, a relative risk of less than 0.5, a relative risk of less than 0.4, a relative risk of less than 0.35, a relative risk of less than 0.3, and a relative risk of less than 0.25, a relative risk of less than 0.1, and so on. These numbers are exemplary only, and will vary depending on the population chosen. The techniques described herein permit stratification of subjects to reveal and calculate a relative risk. Standard statistical techniques can be used to verify the statistical significance of the risk assessment.
(27) In the context of methods of the invention, prescribing refers to providing an order or authorization for the therapy for a particular subject, wherein the therapy is then administered to that subject by person(s) and/or device(s) pursuant to the prescribing order/authorization. The physical act of administering may be by the hand of the prescribing authority; by one or more medical professionals different from the prescribing professional; self-administration by the subject or subject's caregiver (e.g., following dispensing to the subject by a pharmacy); or some combination thereof.
(28) Aspects of the invention relate to T cell subsets that are identifiable from a cytokine expression profile of cytokines interleukin-2 (IL-2), interferon gamma (IFN), tumor necrosis factor alpha (TNF), and macrophage inflammatory protein 1 (MIP-1). In some variations, the identifying is by direct measuring of these cytokines. In some variations, the same T cell subset is identified by one or more surrogate markers that are useful for identifying the same (or practically the same) T cell subset. Having described informative T cell subsets herein, it is possible to screen such subsets for surrogate markers that are effective for identifying the subset and identifying/stratifying risk as described herein.
(29) The term T cell subset refers to a portion of a subject's T cells that can be uniquely identified by a marker or set of markers expressed by those cells. For instance, as described below in greater detail, in the context of expression of a set for N markers, a population of T cells can be assigned to 2.sup.N subsets. In one of the subsets, none of the markers are expressed. In the other (2.sup.N-1) subsets, at least one marker is actively expressed. In some variations, the calculation of the percentage of T cells falling within a T cell subset, relative to total T cells in the 2.sup.N subsets, or total T cells in the active (2.sup.N-1) subsets, is contemplated.
(30) Mammalian Subjects
(31) The methods described herein can be practiced with any mammalian subject susceptible to viral infection, including laboratory animals (e.g., mice, rats, rabbits); livestock animals (e.g., porcine, bovine); and zoo and pet/domesticated animals (e.g., elephants, canines, felines, giraffes, equines).
(32) In some embodiments, the subject is a primate.
(33) In preferred embodiments, the subject is a human subject.
(34) The analytical methods described herein are particularly useful for human subjects who harbor a latent viral infection, because the methods can stratify risk for reactivation of the latent virus. In some variations, a subject can be pre-screened for evidence of the latent virus. However, the prevalence of some latent viruses is so high in many populations that, in some variations, the presence of the virus simply can be presumed. Such viruses include Epstein-Barr virus (implicated in mononucleosis and some cancers), cytomegalovirus, and varicella zoster virus (chick pox, shingles).
(35) Immune-Compromised Subjects
(36) The analytical methods described herein are particularly useful for assessment for subjects that are immune-compromised. In some variations, the subject is immune compromised as a result of medications. For instance, a subject may be immune compromised from a cancer chemotherapy with cytotoxic side-effects on the subject's immune cells. (Exemplary agents with reported increased risk of CMV include Ruxolitinib and Dasatinib.) A subject may be immune compromised from immunosuppressant therapies prescribed to treat an autoimmune disease or its symptoms. A subject may be immune compromised from immunosuppressant therapies prescribed to prevent graft versus host disease (GVHD) in a transplant recipient, especially an allogeneic transplant recipient. The transplant recipient can be an organ transplant recipient, a tissue transplant recipient, or a cell transplant recipient.
(37) In some variations, the subject has received a blood stem cell/hematopoietic progenitor cell transplant and is immune compromised at least for the reason that the transplanted cells have not fully grafted and reconstituted a fully functioning immune system. In some variations, the progenitor cell transplant is a cord blood/progenitor cell transplant.
(38) The analytical approach described herein is particularly useful for screening subjects during the period that they are most immune compromised. For example, testing a hematopoietic progenitor transplant patient as soon as the transplant has engrafted and a testable level of T cells exists is contemplated. For example, testing 7, 8, 9, 10, 11, 12,13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 days after the transplant is contemplated. Testing during later time periods, e.g., 51-60, 61-70, 71-80, 81-90, or more days post-transplantation if the subject remains immune compromised is possible.
(39) For cancer chemotherapy patients or patients receiving antibody therapy, testing any integer number of days from 0-50 after receipt of a cytotoxic chemotherapeutic dose is contemplated. In some variations, the testing is performed periodically any integer number of days from 0-50 after a final dose of a cytotoxic chemotherapeutic agent is administered.
(40) The method described herein also is suitable for testing subjects that receive autoimmune immunosuppressant therapies. Exemplary therapies include Humira, Etanercept, Infliximab, other anti-TNF therapies, and other anti-inflammatory cytokine therapies. Testing according to the invention can be performed at least once, or periodically, after such therapies have initiated. Testing any integer number of days from 0-50 after a first dose is especially contemplated.
(41) Viral Infections
(42) The analytical techniques described herein can, in principle, be used to predict risk for reactivation of any latent virus.
(43) In some embodiments, the virus is from the family herpes viridae (herpes viruses), a large family of DNA viruses that infect multiple species and cause diseases of varying severity. Herpes viruses that infect humans include: herpes simplex viruses 1 and 2 (HSV-1/HHV-1 and HSV-2/HHV2), varicella-zoster virus (VZV/HHV-3), Epstein-Barr virus (EBV/HHV-4), human cytomegalovirus (CMV or HCMV/HHV-5), human herpesvirus 6A and 6B (HHV-6A and HHV-6B), human herpesvirus 7 (HHV-7), and Kaposi's sarcoma-associated herpesvirus (KSHV/HHV-8).
(44) In other variations, the virus is an immunodeficiency virus (e.g., HIV) or a hepatitis virus (e.g., HBV, HCV).
(45) Biological Samples
(46) The analytical methods described herein are performed with T cells.
(47) In some variations, a tissue or fluid sample (most typically a blood sample) from the subject is used as a source for the T cells. For instance, assessments are performed from fresh blood samples of 0.5 cc to 60 cc, depending on the expected frequency of the virus-specific T cells being assessed. (Larger samples may be necessary from subjects with lymphocytopenia.)
(48) In some variations, the sample is a fresh sample that has never been frozen. In some variations, the sample is cryopreserved under conditions that preserve the integrity of the immune cells therein. This may include preservation using dimethylsulfoxide-containing media (e.g., 5-10% solutions) or other solutions designed to maximize the viability of healthy human mononuclear cells during cryopreservation, to enable their subsequent thawing for functional analyses.
(49) Biological Sample Preparation and Stimulation
(50) Red blood cells are unnecessary for the analysis described herein.
(51) In some variations, white cells are separated from red cells, e.g., by ficoll gradient centrifugation, prior to antigen stimulation.
(52) In some variations, red cells are lysed prior to antigen stimulation.
(53) Between sample collection and biological marker / phenotype analysis, the T cells are stimulated with antigen from at least one virus of interest.
(54) In some variations, inactive virus is used to stimulate the T cells. In some variations, whole viral protein is used as antigen to stimulate the T cells. In some variations, peptides from viral proteins are used as antigens to stimulate the T cells. In some variations, the antigen is an isolated antigen preparation (e.g., isolated peptides or proteins). In some variations, a virus like particle (VLP) or other expedient known in the art for antigen stimulation is used to present the antigen to the immune cells in the sample.
(55) In some variations, PBMC from the sample are incubated with the antigen. Antigen processing and antigen presenting immune cells present in the PBMC facilitate presentation of the antigen to T cells and T cell stimulation. In some variations, antigens are pre-processed into peptides and optionally formulated with MHC molecules, in which case stimulation of isolated T cells from the sample is possible.
(56) Any protein or peptide recognized by immune cells can be used in the stimulation protocol. Many of the viruses of interest herein are well known and characterized, and peptides suitable for antigens are commercially available. (See, e.g., https://www.jpt.com/products/pepmix-peptide-pools/)
(57) By way of example, if the latent virus of interest is CMV, suitable antigens for T cell stimulation include CMV tegument phosphoprotein 65 (pp65), or CMV immediate early 1 (1E1) protein, or one or more antigenic fragments of either of these proteins, or mixtures of these proteins or antigenic fragments.
(58) If the latent virus of interest is EBV, exemplary antigens suitable for practice of the invention include EBNA1, EBNA2, LMP1, and LMP2, as well as antigenic fragments thereof and mixtures thereof. If the latent virus of interest is HHV6, exemplary antigens include U54, U90, antigenic fragments thereof, and mixtures thereof. If the latent virus of interest is VZV, exemplary antigens include 1E62, fragments thereof, and mixtures thereof.
(59) The antigen stimulation is performed for, e.g., a period of about 4-16 hours. Exemplary antigen stimulation periods of 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16 hours, or integer ranges defined by any of these numbers, is contemplated.
(60) In some variations, a co-stimulatory molecule is used to stimulate the T cells contemporaneously or simultaneously with the viral antigen. Co-stimulation with anti-CD49d and/or anti-CD28 antibodies is specifically contemplated.
(61) In some variations, a super-antigen, such as a bacterial super-antigen is used to stimulate an aliquot of the sample, to serve as a positive control.
(62) Biological Markers
(63) The evaluation of risk for viral reactivation comprises identification and quantification of subclasses of T cells from the antigen-stimulated sample. The subclasses are identifiable by biological markers expressed by the cells.
(64) In some variations, the biological markers to be evaluated are protein markers. In some variations, the markers are mRNA's expressed in the cells that encode the protein markers.
(65) Generally speaking, a marker-specific detection agent is used to detect each marker of interest. For mRNA's, oligonucleotide probes can be used for detection. For proteins, antibodies are exemplary marker-specific agents. For antibody detection, both polyclonal and monoclonal antibodies are suitable, with monoclonal providing a more consistent or reproducible result. Antigen binding fragments of antibodies are equivalent to whole antibodies for the purposes described herein. Marker-specific agents that comprise a detectable label are specifically contemplated.
(66) Cytokine Markers
(67) As described herein the four cytokines interleukin-2 (IL-2), interferon gamma (IFN), tumor necrosis factor alpha (TNF), and macrophage inflammatory protein 1 (MIP-1) can be used to identify and quantify T cell populations that are informative of a subject's risk for viral reactivation.
(68) An exemplary sequence for human IL-2 (also known as T cell growth factor or TCGF) is set forth in the public UniProt database as entry UniProtKBP60568 (IL2_HUMAN) (SEQ ID NO: 1):
(69) TABLE-US-00001 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLD LQMILNCINNYKNPKLTRMLTFKFYMPKKATELKHLQCLE EELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT
(70) An exemplary seqeunce for human IFN is set forth in the public UniProt database as entry UniProtKBP01579 (IFNG_HUMAN) (SEQ ID NO: 2):
(71) TABLE-US-00002 MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNA GHSDVADNGTLFLCILKNWKEESDRKIMQSQIVSFYFKLF KNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFR GRRASQ
(72) An exemplary sequence for human TNF (also known as TNF or cachectin) is set forth in the public UniProt database as entry UniProtKBP01375 (TNFA_HUMAN) (SEQ ID NO:3):
(73) TABLE-US-00003 MSTESMIRDVELAEEALPKKIGGPQGSRRCLFLSLFSFLI VAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSS SRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIA VSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVF QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
(74) An exemplary sequence for human MIP-1 (also known as CCL4) is set forth in the public UniProt database as entry UniProtKBP13236 (CCL4_HUMAN) (SEQ ID NO: 4):
(75) TABLE-US-00004 MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTA RKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSES WVQEYVYDLEIN
(76) Antibodies for detecting each of these cytokine markers are commercially available. To facilitate detection, labeled antibodies are contemplated. To facilitate multiplex detection, antibodies with different detectable labels for each cytokine are contemplated.
(77) The specific markers described herein are not contemplated as the exclusive or only markers suitable for identifying the informative T cell populations of interest. The use of a single surrogate marker, or different combinations of markers that behave as a surrogate, are contemplated as alternative tools for identifying the T cell populations described herein. The power of a surrogate marker or marker set can be evaluated by the statistical correlation between the surrogate's expression and the expression of the marker phenotypes described herein. The power of the surrogate(s) to predict viral reactivation risk is confirmable by a population study as described herein using IL-2, IFN, TNF, and MIP-1.
(78) Surrogates can be identified by comparing expression patterns between the markers described herein and the candidate surrogate marker(s). Alternatively, surrogates are identified by studying the expression pattern of markers in the informative T cell subpopulations identified herein, to identify other marker signatures that serve to identify the T cell subpopulations.
(79) In some variations of the invention, identification of T cells that express cytokine markers is achieved by intracellular detection of the markers. For example, in some variations, after antigen stimulation, the T cells are fixed using standard techniques and permeabilized to antibodies, to facilitate intracellular detection of the cytokine markers of interest.
(80) In other variations, other multiplex technologies (e.g., mass cytometry or visual imaging-based detection technologies are used to identify individual cells that co-express combinations of cytokines following stimulation with target viral antigens leading to functional activation). Single Cell RNA-sequencing to identify these expression signatures also is contemplated.
(81) T Cell Markers and Controls
(82) Additional markers can be utilized to identify or select or distinguish T cells (e.g., to exclude from analysis other cells). In some variations, these markers include, but are not limited to, CD4, CD8, CD14, CD16, CD19, and CD56.
(83) The marker CD3 (T-cell surface glycoprotein CD3 epsilon, UniProtKBP07766 (CD3E_HUMAN)) is useful to identify T cells.
(84) The marker CD4 (T-cell surface glycoprotein CD4, UniProtKBP01730 (CD4_HUMAN)) is useful to identify CD4+ T cell subset of CD3+ T cells.
(85) The marker CD8 (T-cell surface glycoprotein CD8 alpha chain, UniProtKBP01732 (CD8A_HUMAN); or T-cell surface glycoprotein CD8 beta chain, UniProtKBP10966 (CD8B_HUMAN)) is useful to identify CD8+ T cell subset of CD3+ T cells.
(86) The marker CD14 (Monocyte differentiation antigen CD14; UniProtKBP08571 (CD14_HUMAN)) is useful to exclude monoctyes from the T cell analysis.
(87) The marker CD16 (Low affinity immunoglobulin gamma Fc region receptor III-A, UniProtKBP08637 (FCG3A_HUMAN)) is useful to exclude natural killer cells from analysis.
(88) The marker CD19 (B-lymphocyte antigen CD19, UniProtKBP15391 (CD19_HUMAN)) is useful to exclude B cells from analysis of the T cells of interest.
(89) The marker CD20 (B-lymphocyte antigen CD20, UniProtKBP11836 (CD20_HUMAN)) is useful to exclude B cells from analysis of the T cells of interest.
(90) The marker CD56 (Neural cell adhesion molecule 1, UniProtKBP13591 (NCAM1_HUMAN)) is useful to exclude natural killer cells from the T cell analysis.
(91) Staining for free amino or other markers of dead cells is useful (indicated, for example, by positive staining for free amine labeling dye (LIVE/DEAD Aqua) to exclude such cells from analysis.
(92) Cell SortingPhenotype DifferentiationQuantitative Detection
(93) After antigen stimulation, T cells of informative phenotype(s) are quantified. In some variations, an absolute quantity is determined. In some variations, a relative quantity is determined. Relative quantity is expressed relative to a suitable denominator. For instance, T cells of a phenotype of interest can be expressed as a total percentage of CD8+ T cells, or a total percentage of T cells.
(94) In some variations, cells are sorted by phenotype and quantified using automated or semi-automated techniques. Suitable techniques include flow cytometry, mass cytometry, imaging cytometry, or slide scanning cytometry. Singe cell RNA sequencing or PCR also are contemplated.
(95) A preferred technique for T cell analysis is multiparameter flow cytometry, a technique that permits rapid measurement of multiple characteristics of individual cells as they flow past laser/light in a focused fluid stream. See, e.g., O'Donnell et al., Multiparameter Flow Cytometry: Advance in High Resolution Analysis, Immune Network, 13(2): 43-54 (2013), incorporated herein by reference in its entirety.
(96) Using flow cytometry, it is possible to distinguish CD8+ T cells of interest from other T cells or non-T cells; and to measure cytokine markers of interest (e.g., IL-2, IFN, TNF, and MIP-1). By measuring each parameter, it is possible to sort and quantify the CD8+ T cells by each cytokine phenotype represented by the measured cytokines. For example, with cytokines IL-2, IFN, TNF, and MIP-1, it is possible to sort the T cells into the sixteen phenotypes based on whether the cell is scored as expressing, or not expressing, a particular cytokine (2.sup.4=16 phenotypes).
(97) As described below in greater detail, T cells that are CD8-positive (CD8+), IL-2-positive (IL-2+), IFN-positive (IFN+), TNF-positive (INF+), and MIP-1-positive (MIP-1+) are an informative phenotype insofar as increased quantities of these cells correlates with decreased CMV viral reactivation in hematopoietic cell transplant patients. Thus, greater numbers of these cells correlate with a subpopulation of subjects that appear to be more resistant (protected, PHENOTYPE-P) from viral reactivation. Quantifying PHENOTYPE-P T cells is specifically contemplated. When assessed alone, an increased percentage of Phenotype-P T cells in the sample from the subject is correlated with a decreased risk of viral reactivation in the subject, and decreased percentage of Phenotype-P T cells in the sample is correlated with an increased risk of viral reactivation in the subject.
(98) T cells that are CD8-positive (CD8+), IL-2-negative (IL-2), IFN-positive (IFN+), TNF-negative (TNF), MIP-1-positive (MIP-1+) are an informative phenotype insofar as increased quantities of these cells correlated with increased frequency of CMV viral reactivation in hematopoietic cell transplant patients. Thus, greater numbers of these cells correlate with a subpopulation of subjects that appear to be more susceptible (non-protected, PHENOTYPE-N) from viral reactivation. Quantifying PHENOTYPE-N T cells is specifically contemplated. When assessed alone, an increased percentage of Phenotype-N T cells in the sample from the subject is correlated with an increased risk of viral reactivation in the subject, and a decreased percentage of Phenotype-N T cells in the sample are correlated with a decreased risk of viral reactivation in the subject.
(99) Phenotypes N and T can be evaluated together to give a still more powerful risk assessment. The combination of a high percentage of Phenotype-P T cells and a low percentage of Phenotype-N T cells in the sample is correlated with a low risk of viral reactivation in the subject. The combination of a high percentage of Phenotype-N T cells and a low percentage of Phenotype-P T cells in the sample is correlated with high risk of viral reactivation in the subject.
(100) Suitable flow cytometer detector settings are established using standard beads to optimize the instrument (cytometer setup and tracking beads, BD catalog #642412). Single-stained samples for each reagent are acquired, and if necessary, voltages on each detector are lowered to ensure that the brightest stained cells are still on scale (not in the highest channel on the histogram). Once these settings are established they are not adjusted again. Single-stained controls for each reagent are then acquired and saved during each run to establish spillover coefficients, which are calculated automatically by BD FACS DIVA software, for example. (Software determination by other FACS analysis, such as FLOWJO software, could also be used.)
(101) For intracellular markers such as the cytokines/chemokine assessed here, antibody capture compensation beads (instead of cells, BD catalog #552843) are used for single-stained controls. Because the beads are small and fixed, and permeablized cells are also smaller than unpermeablized cells, it is important that the detection threshold is set low enough to include all cells in the well.
(102) Interpretation of T Cell Phenotype Data
(103) Exemplary flow cytometry data acquisition and gating selection is as follows: doublets are excluded using pulse-processing technique (ssc-width vs ssc area, fsc-width vs fsc arealarger width signal than cluster of majority of cells indicates aggregation of cells which are excluded). Dead cells (indicated by positive staining for free amine labeling dye (live-dead aqua) are excluded, followed by exclusion of non-T cells (dump channel-CD14/CD16/CD19/CD56+ cells). These exclusion settings are followed by positive gating of CD3+ cells. The CD3+ cells are selected/gated as single+ CD4 and CD8 gates. Exemplary gating is depicted in
(104) The cytokine/chemokine gate is set by taking an un-stimulated control sample and looking at CD4+ or CD8+ histograms. (Exemplary data for CMV-stimulated cells is depicted in
(105) In some variations, raw numbers of cells of phenotype(s) of interest are used for risk assessment/stratification (e.g., an un-normalized percentage of CD8+ cells with a phenotype of interest). In some variations, an absolute number of cells having phenotype(s) of interest are used for risk assessment/stratification. Absolute numbers for a subject in the peripheral blood are calculated by multiplying the percentage of CD8+ cells possessing each chemokine phenotype of interest by the absolute number of CD8 cells (e.g., cells per microliter) in the subject.
(106) In some variations, percentages of phenotypes of interest are calculated as a fraction/percentage of the number of responsive cells in the assay. For example, with the four-cytokine assay, there are sixteen possible phenotypes based on whether cells are scored as positive for each cytokine (2.sup.4=16 phenotypes). Of these sixteen phenotypes, fifteen are scored as responsive (and the /// quadruple negative cells are ignored). An exemplary histogram for CMV pp65 peptide-stimulated CD8+ T cells is depicted in
(107) Standard statistical modeling can be used to adjust the sensitivity and specificity with which the phenotypes described herein will predict risk of viral reactivation. For instance, receiver operating characteristic curves can be established for particular decision thresholds. Classification And Regression Tree (CART) analysis, mathematical modeling, and machine learning to optimize weighting of each informative phenotype is specifically contemplated.
(108) In an initial dataset described below, simple defined cutoffs (e.g., >10% PHENOTYPE-N cells within the parent CD8+ gate and <2% of the PHENOTYPE-P cells within the parent CD8+ gate, using the percentage of responsive cells approach described above) can be used to get significant discrimination of patients that suffered viral reactivation and patients that did not, as discussed below in greater detail. These are only exemplary cutoffs and can be further optimized with larger datasets and standard statistical modeling.
(109) Differences in the expression of cytokine profiling across groups were determined by using the Fisher Exact Test and Wilcoxon MannWhitney U-Test where appropriate. Log-rank test was used to assess differences in time-to-event. Statistical analyses were performed using prism (Graphpad Software, Inc).
(110) Adjusted Monitoring of Subjects Identified as Having Stratified Risk
(111) It is possible to screen blood or plasma samples from immune-compromised subjects for viral load, to provide a diagnosis of developing infection. See, e.g., Kraft et al., Interpreting Quantitative Cytomegalovirus DNA Testing: Understanding the Laboratory Perspective. Clinical Infections Diseases, 54(12) 1793-97 (2012). Indeed, such screening for CMV is standard of care for transplant patients, including hematopoietic cell transplant patients, but it is not without inconvenience and cost. The frequency of monitoring currently varies significantly between medical centers/practices.
(112) The analytical techniques described herein permit modulation of the frequency of viral load testing. For example, a subject determined to have lower risk of viral reactivation can be tested less frequently for viral load; a subject determined to have greater risk for viral reactivation according to the methods described here can be tested more frequently for viral load, to permit earlier detection of viral load increases or trends in increasing. For example, standards of practice at some facilities typically involve periodic monitoring of CMV viral load one to three times weekly in the first 60-100 days following HCT. In one potential application of this invention, patients determined to have higher-risk (based on the assessment of Phenotype-P and/or Phenotype-N cells, preferably together in a combined algorithm) continue to be monitored frequently; those at low risk might safely be monitored less frequently (e.g. once per 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 days) decreasing costs and inconvenience of testing.
(113) The combination of viral load testing and risk assessment can together be used to modulate therapeutic intervention. For example, antiviral therapy is initiated more quickly in a subject determined to be at higher risk for viral reactivation according to the T cell analysis methods described herein. For instance, therapy might be initiated at a lower absolute viral load measurement or more quickly upon detection of an upward trend in viral load measurements for subject stratified in a high risk group based on Phenotype P and/or Phenotype N measurements.
(114) Prophylaxis of Subject Identified as Having Elevated Risk
(115) Anti-viral therapeutic agents exist, but use of these agents for prophylaxis is not currently standard-of-care for all immune-compromised subjects. The drugs are expensive and prophylaxis exposes patients who are potentially in a low risk group to serious side effects, including nephrotoxicity (e.g., for agents such as Foscarnet) or myelosuppression (e.g., for agents such as ganciclovir or valganciclovir). However, when sufficiently high risk patients can be identified, as the data herein indicates, the rational basis for pre-emptive therapy becomes more compelling.
(116) In some variations, the invention further comprises administering, to a subject identified as having high risk of viral reactivation according to the techniques described herein, a prophylaxis that comprises an antiviral chemotherapeutic agent or an antiviral cellular therapy. In some embodiments, a healthcare provider performs or controls the risk assessment and the therapeutic/prohylaxis decision. In some variations, a healthcare provider controls only the therapy/prophylaxis, based on receipt of the results of a risk assessment as described herein.
(117) Exemplary antiviral chemotherapeutic agents are listed in the following table. In some variations, the prophylactic course of treatment is the same dose and duration as the therapeutic course of treatment. In some variations, prophylaxis is continued until the immune-compromised condition is alleviated. For example, for a subject that has received a hematopoietic cell transplant or cytotoxic chemotherapy, prophylaxis is continued until white blood cell counts improve.
(118) TABLE-US-00005 Brand name (Generic Chemical Mechanism of name) Manufacturer Chemical name structure action Comments Ganciclovir Roche 9-[[2-hydroxy-1-(hydroxymethyl)- C.sub.9H.sub.13N.sub.5O.sub.4 Inhibition of DNA Activity dependent on (Cytovene-IV) ethoxy]methyl]guanine. polymerase phosphorylation by (pUL54) pUL97 kinase Valganciclovir Genentech L-Valine, 2-[(2-amino-1,6- C.sub.14H.sub.22N.sub.6O.sub.5 Inhibition of DNA Currently the drug of (Valcyte) (Roche) dihydro-6-oxo-9Hpurin-9- polymerase choice to treat CMV yl)methoxy]-3-hydroxypropyl (pUL54) infections ester, monohydrochloride. Foscarnet Pfizer Trisodium phosphonoformate CH.sub.3O.sub.5P Inhibition of DNA (Foscavir) polymerase (pUL54) Cidofovir Gilead 1-[(S)-3-hydroxy-2- C.sub.8H.sub.14N.sub.3O.sub.6P Inhibition of DNA (Vistide) (phosphonomethoxy)propyl] polymerase cytosine dihydrate (HPMPC) (pUL54) Maribavir Shire 5,6,-dichloro-2-isopropylamino-1- C.sub.15H.sub.19Cl.sub.2N.sub.3O.sub.4 Competes with After successful phase -l-ribofuranosyl-1H- ATP for binding to I and II trials, benzimidazole pUL97. maribavir, at a potentially suboptimal selected dosage, failed to show efficacy in the prevention of CMV disease in a phase III trial Brincidofovir Chimerix Phosphoric acid, [[(S)-2-(4- C.sub.27H.sub.52N.sub.3O.sub.7P Inhibition of DNA Oral lipid conjugate of (CMX001) amino-2-oxo-1(2H)-pyrimidinyl)- polymerase cidofovir with braod 1-(hydroxymethyl) (pUL54) antiviral activity ethoxy]methyl]mono[3- against dsDNA viruses (hexadecyloxy)propyl] ester In the phase III trial, brincidofovir failed to prevent clinically significant CMV infection through week 24 after HCT Letermovir Merck 3-(2-methoxy-5- C.sub.29H.sub.28F.sub.4N.sub.4O.sub.4 Inhibits CMV DNA Most (trifluoromethyl)phenyl)-4H- synthesis at a late potent in vitro anti- guinazolin-4-yl)acetic acid step by CMV agent to date targeting the pUL56 subunit of the terminase enzyme complex
(119) Suitable cellular therapies for prophylaxis include antiviral chimeric antigen receptor T cells (CART) cellular therapy; transgenic tcr-transduced t cells (TCR transgenic cells); polyclonal T cell lines (made by culturing cells in the presence of the target antigen with co-stimulation to enrich and expand the pathogen-specific T cell population to high numbers). Companies with CAR-T, polyclonal T cell line, and transgenic T cells in the pipeline include Kite Pharmaceutical, Juno Therapeutics, Novartis, Ziopharm, Atara, Maxcyte, Autolus, Celgene, Bluebird, Pfizer, CRISPR Therapeutics, Cell Medica, and others.
(120) For example, for subjects determined to be at elevated risk for CMV, prophylaxis with CMV-specific cytotoxic T lymphocytes is contemplated. See, e.g., Bao et al., Adoptive immunotherapy with CMV-specific cytotoxic T lymphocytes for stem cell transplant patients with refractory CMV infections, J. Immunother. (2012) 35(3): 293-98, incorporated herein by reference. Such cells are being developed by Atara Biotherapeutics. See also international patent application no. PCT/US2014/062698 (published as WO2015066057), directed to expansion of cmv-specific t cells from cmv-seronegative donors, incorporated herein by reference. Zostavax vaccine (Merck) is contemplated as prophylaxis for zoster.
(121) The materials and methods described herein also are useful for identifying the most suitable candidates for receipt of investigative or approved antiviral vaccine compositions. For example vaccines are being developed to reduce CMV reactivation. (See, e.g., The Lancet Haematology, Vol. 3, No. 2, e87-e98 (Dec. 23, 2015); and Chiuppesi et al., Identification of a Continuous Neutralizing Epitope within UL128 of Human Cytomegalovirus, J.Virology, Accepted manuscript posted online 11 Jan. 2017, doi: 10.1128/JVI.01857-16, incorporated herein by reference.
(122) Other risk factors that can be weighed for the decision to implement prophylaxis or pre-emptive antiviral therapy include evidence of T-cell depletion, use of unrelated donors for transplant, CMV seronegative versus seropositive status of donors, existence of active graft-vs-host disease, timing post-transplant (with risk being higher in first 100 days), lymphoid malignancy, lymphopenia (absolute lymphocyte count below 300), and CMV viral load.
(123) The invention will be further understood from the examples which follow, which form part of the description of the invention.
EXAMPLE 1
(124) The following exemplary protocol is suitable for T cell analysis described herein. The assay is described with respect to assessment for risk for CMV reactivation, but similar procedures can be used for other viruses. Variations and equivalents will be apparent to scientists in the field.
(125) Specimens: PBMC (either thawed from cryopreserved specimen or freshly prepared by ficoll centrifugation)
(126) Plasticware: 15 ml conical tube (Falcon cat #352097) 96 well v-bottom plate (Nunc cat #249570)
(127) Chemicals/Solutions: RPMI media (Gibco cat #22400-089) PBS (Corning cat #21-031-CV) Fetal Bovine Serum (FBS) (Seradigm cat #1400-500) Sodium Azide (Sigma cat # S8032) Brefeldin A (Sigma cat # B7651) in stock solution 10 mg/ml in DMSO stored at 80 C. in aliquots EDTA (Sigma cat # E7889) DMSO (Sigma cat # D2650) Staining buffer (SB) (PBS+10% FBS+0.1% (w/v) Sodium Azide) RPMI+10% FBS (RPMI/10) Caltag Fix/Perm Medium A (Invitrogen cat # GAS001S100) Caltag Fix/Perm Medium B (Invitrogen cat # GAS002S100) EDTA solution (PBS+0.02% (w/v) EDTA)
(128) Stimulation Reagents: CMV pp65 peptide pool (JPT cat # PM-PP65-2) (25 pg/peptide, re-suspended in 40 l DMSO+210 l PBS, and aliquoted in 10 l aliquots and stored at 80 C.). JPT product data sheet, incorporated herein by reference, explains that this peptide mix has 138 peptides from human CMV, strain AD169, pp65 antigen (Swiss Prot ID No. P06725), supplied as trifluoroacetate salts with instructions to dissolve in pure DMSO and dilute with PBS buffer. CMV IE1 peptide pool (JPT cat # PM-IE1) (25 g/peptide, re-suspended and aliquoted as described for pp65 peptide). JPT product data sheet, incorporated here by reference, explains that this peptide mix has 120 peptides from human CMV, strain AD169, IE1 antigen (Swiss Prot ID No. P13202), supplied as trifluoroacetate salts with instructions to dissolve in pure DMSO and dilute with PBS buffer. SEB (Toxin Tech cat # BT202) (re-suspended at 100 g/ml in distilled H2O and aliquoted at 80 C.).
(129) Co-Stimulation Reagents: Anti-CD28 antibody pure (Becton Dickinson (BD) cat #348040) 0.5 mg/mL Anti CD49d antibody pure (BD cat #340976) 1.0 mg/ml Staining Reagents (monoclonal antibodies and live/dead discrimination):
(130) TABLE-US-00006 Live/Dead Aqua Life Technologies cat # L34957 CD3 AF700 BD cat # 557943 CD4 BV786 Biolegend cat # 317442 CD8 BV711 Biolegend cat # 301044 CD14 PE-CY5 eBioscience cat # 15-0149-42 CD16 PE-CY5 BD cat # 555408 CD19 PE-CY5 BD cat # 555414 CD56 PE-CY5 BD cat # 555517 IFN BV650 BD cat # 563416 IL-2 APC BD cat # 341116 MIP1 APC-Cy7 BD cat # 561280 TNF PE-Cy7 BD cat # 557647
(131) Protocol
(132) 1. Determine a minimum number of wells needed, based on the number of samples and controls to be analyzed. (Use at least 1 Million (106) cells per well). SAMPLE WELLS
(133) a) Unstimulated
(134) b) SEB-stimulated
(135) c) CMV pp65 peptide-stimulated SINGLE STAINED CONTROL WELLS (ADD THESE CELLS AT STEP 29)
(136) *Reserve PBMCs for unstained and surface markers (or use healthy donor)
(137) Blood Sample Preparation:
(138) 2. Obtain a blood sample from subjects to be tested. Isolate PBMC via Ficoll gradient centrifugation.
(139) 3. Wash PBMC with 10 ml PBS in a 15 mL conical tube.
(140) 4. Centrifuge for 5 minutes at 1400 rpm (450g) at room temp and decant.
(141) 5. Re-suspend cell pellet in 10 ml PBS and count cells.
(142) 6. Centrifuge for 5 minutes at 1400 rpm (450g) at room temp and decant.
(143) 7. Re-suspend cells in needed amount of RPMI/10 media at concentration of 110{circumflex over (6)}PBMCs/200 l RPMI media per well in a 96 well v-bottom plate.
(144) 8. Recover the cells in 37 C. 5% CO.sub.2 incubator for a minimum of 12-18 hours (e.g., overnight).
(145) 9. Centrifuge for 5 minutes at 1600 rpm (600g) at room temperature and decant.
(146) Blood Sample Stimulation
(147) 10. Re-suspend cells in 190 l (per well) RPMI media containing 2 l anti-CD28 antibody (0.5 ug/ml) and 0.5 l anti-CD49d antibody (1.0 ug/ml) (per well)
(148) 11. Add one stimulation per well selected from (a)-(d). (For the viral antigen stimulation, co-stimulation with pp65 and 1E1 antigens also is possible): (a) Unstimulated well (gets no stimulants) (b) staphylococcal enterotoxin B (SEB)=10 l of 100 g/ml (SEB bacterial superantigen serves as positive control) (c) CMV pp65 peptide pool JPT=2 l in sample (reconstituted at 100 ng/ul) (d) CMV IE1 peptide pool JPT=2 l in sample (reconstituted at 100 ng/ul)
(149) 12. Incubate at 37 degrees in 5% CO.sub.2 incubator for 30 minutes.
(150) 13. Add 5 ul of diluted Brefeldin A to each well (dilute stock with RPMI/10 at 1:25=10 l Bref A+ 240 l RPMI/10).
(151) 14. Incubate for 6 hours at 37 C. in 5% CO.sub.2 incubator.
(152) Post-Stimulation Preparation and Antigen Staining
(153) 15. Centrifuge cells for 5 min at 1600 rpm (600g) room temperature and decant.
(154) 16. Re-suspend/Wash with 200 ul PBS.
(155) 17. Centrifuge for 5 min at 1600 rpm (600g) room temp) and decant.
(156) 18. Re-suspend cells in 180 l of 0.02% EDTA in PBS (from 4 degree, keep on ice until just before use) and incubate in 37 C. for 10 min.
(157) 19. Re-suspend in 50 l Staining Buffer (SB), then add the following reagents to each well: CD4: 2 l CD8: 3 l CD14: 0.5 l CD16: 1 l CD19: 2 l CD56: 4 l LIVE/Aqua: 0.2 l
Mix and incubate for 30 minutes in dark at 4 C.
(158) These markers are useful as follows: CD3 to identify T cells; CD4 to identify CD4+ T cell subset of CD3+ T cells; CD8 to identify CD8+ T cell subset of CD3+ T cells; CD14 to exclude monoctyes from analysis; CD16 to exclude natural killer cells from analysis; CD19 to exclude B cells from analysis; CD56 to exclude natural killer cells from analysis.
(159) 20. Add 150 l SB, spin (5 min, 1600 rpm (600g), room temp) and decant.
(160) 21. Re-suspend in 200 l SB, spin (5 min, 1600 rpm (600g), room temp) and decant.
(161) 22. Re-suspend in 100 l of Caltag Fix/Perm Medium A in ALL wells for 20 minutes in dark at room temperature.
(162) 23. Spin down (5 min, 2000 rpm (930g), room temp) and decant.
(163) 24. Wash with 200 l SB, spin down (5 min, 2000 rpm (930g), room temp) and decant.
(164) 25. Re-suspend with 100 l Caltag Fix/Perm Medium B in ALL wells.
(165) 26. Add each of the following antibodies to each test sample well for 20 min in dark at room temp: IL-2: 3 l IFN: 3 l TNF: 3 l MIP1: 3 l CD3: 2 l
(166) 27. Spin down (5 min, 2000 rpm (930g), room temp) and decant.
(167) 28. Wash with 200 l SB.
(168) 29. Add single-stained control wells to the plate, using healthy donor cells or cells reserved from the day before, or compensation beads for individual cytokines (1 drop each of compensation antibody capture beads BD #552843)stain in 50 l SB.
(169) 30. Add 150 l SB spin down (5 min, 2000 rpm (930g), room temp) and decant.
(170) 31. Wash samples with 200 l SB.
(171) 32. Re-suspend ALL WELLS in 200 l of PBS for flow cytometer analysis.
(172) Flow Cytometry
(173) Flow cytometry was performed with cell selection and gating substantially as described above.
EXAMPLE 2
(174) Overview/Synopsis
(175) The inventors have applied higher-order functional cytokine flow cytometry (CFC) to the assessment of clinical risk in immune-compromised (hematopoietic cell transplant, HCT) patients using a protocol essentially as outlined above in Example 1.
(176) Peripheral blood mononuclear cells (PBMC) were isolated from blood samples drawn from thirty HCT recipients at day +30 after HCT. Based on monitoring for CMV reaction for period of thirty months, the HCT recipients were divided into three groups: Group 1: Elite Controllerssubjects with no observed CMV reactivation for 30 months following HCT; Group 2 Spontaneous Controllerssubject who experienced low level CMV reactivation, but the reactivation resolved without anti-viral therapy; and Group 3: Non-controllerssubjects who experienced higher level, uncontrolled CMV reactivation viremia requiring anti-viral therapy. The CMV serostatus of the hematopoietic cells did not appear to strongly correlate with CMV viremia in the subject sample studied.
(177) Cryopreserved PBMC from the +30 day sample were thawed, stimulated with peptide pools spanning CMV tegument protein pp65, and then analyzed for lineage, cell surface phenotype, and the production of four cytokines/chemokines: TNF, IFN, IL-2 and MIP-1.
(178) Interferon gamma has been investigated as a predictive marker for CMV viremia, but IFN measurements gave poor discrimination in the subjects studied.
(179) Cytokine signatures of the pp65-stimulated CD8+ T cells drawn at day +30 were examined. Two cytokine/chemokine signatures were identified that positively or negatively correlated with failure to control CMV after HCT. The signature of polyfunctional cells (e.g., CD8+ T cells producing all four effector proteins: TNF+/IFN+/IL-2+/MIP-1+) was associated with CMV control (the protective signature or PS or PHENOTYPE P). Conversely, TNF-negative/IFN+/IL-2-negative/MIP-1+ cells were positively correlated with risk of viremia (nonprotective signature or NPS or PHENOTYPE N). Each of these phenotypes alone was useful to discriminate subjects more or less likely to experience CMV reactivation in the first 100 days post-transplant. High versus Low cutoff used was 10% of responsive T cells, as described above. High versus Low cutoff used with 2% of responsive T cells, as described above.
(180) By combining these two positive and negative signatures, into one predictive algorithm, they accurately predicted risk of CMV. (See
EXAMPLE 3CMV RISK STRATIFICATION
(181) Example 3 extends the initial results from Example 2 by incorporation of a larger sample of patients.
(182) Overview/Synopsis
(183) The inventors have applied higher-order functional cytokine flow cytometry (CFC) to the assessment of clinical risk in immune-compromised (hematopoietic cell transplant, HCT) patients using a protocol essentially as outlined above in Example 1.
(184) Peripheral blood mononuclear cells (PBMC) were isolated from blood samples drawn from fifty-six HCT recipients at day +30 after HCT. Based on monitoring for CMV reaction for period of thirty months, the HCT recipients were divided into three groups: Group 1: Elite Controllerssubjects with no observed CMV reactivation for 30 months following HCT; Group 2 Spontaneous Controllerssubject who experienced low level CMV reactivation, but the reactivation resolved without anti-viral therapy; and Group 3: Non-controllerssubjects who experienced higher level, uncontrolled CMV reactivation viremia requiring anti-viral therapy. (See
(185) Cryopreserved PBMC from the +30 day sample were thawed, stimulated with peptide pools spanning CMV tegument protein pp65, and then analyzed for lineage, cell surface phenotype, and the production of four cytokines/chemokines: TNF, IFN, IL-2 and MIP-1.
(186) Interferon gamma has been investigated as a predictive marker for CMV viremia, but IFN measurements gave poor discrimination in the subjects studied. (See
(187) Cytokine signatures of the pp65-stimulated CD8+ T cells drawn at day +30 were examined. Two cytokine/chemokine signatures were identified that positively or negatively correlated with failure to control CMV after HCT. The signature of polyfunctional cells (e.g., CD8+ T cells producing all four effector proteins: TNF+/IFN+/IL-2+/MIP-1) was associated with CMV control (the protective signature or PS or PHENOTYPE P). Conversely, TNF-negative/IFN+/IL-2-negative/MIP-1+ cells were positively correlated with risk of viremia (nonprotective signature or NPS or PHENOTYPE N). Each of these phenotypes alone was useful to discriminate subjects more or less likely to experience CMV reactivation in the first 100 days post-transplant. Data analysis for the NPS T cell phenotype is set forth in