B7-H3 TARGETING ANTIBODY-DRUG CONJUGATE, AND PREPARATION METHOD THEREFOR AND USE THEREOF
20240058463 ยท 2024-02-22
Inventors
- Qingsong GUO (Shanghai, CN)
- Yijun SHEN (Shanghai, CN)
- Tong YANG (Shanghai, CN)
- Bin BAO (Shanghai, CN)
- Bei Gao (Shanghai, CN)
- Fang WU (Shanghai, CN)
- Jun Xu (Shanghai, CN)
Cpc classification
A61K47/6889
HUMAN NECESSITIES
A61K47/6803
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
A61K47/68037
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
A B7-H3 targeting antibody-drug conjugate, and a preparation method therefor and use thereof. Provided is the antibody-drug conjugate as shown in formula I. The compound has a good targeting property, good inhibitory effect on tumor cells positively expressing B7-H3, and good druggability and safety. The present antibody-drug conjugate has an inhibitory effect against B7-H3, and also a good inhibitory effect against at least one of NCI-N87, A375, LN-229, PA-1, MDA-MB-468, Calu-6 and HS-700T cells.
Claims
1. An antibody-drug conjugate, a pharmaceutically acceptable salt thereof, a solvate thereof, or a solvate of the pharmaceutically acceptable salt thereof, and the antibody-drug conjugate has a structure shown in formula I; ##STR00074## wherein Ab is a B7-H3 antibody or a variant of the B7-H3 antibody; m is 2 to 8; the amino acid sequence of the light chain in the B7-H3 antibody is shown in SEQ ID NO: 1, and the amino acid sequence of the heavy chain is shown in SEQ ID NO: 2; the variant of the B7-H3 antibody is at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% identical to the B7-H3 antibody; D is a cytotoxic drug topoisomerase inhibitor; R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, C.sub.1-C.sub.6 alkyl, C.sub.3-C.sub.10 cycloalkyl, C.sub.6-C.sub.14 aryl, or 5- to 14-membered heteroaryl; the heteroatom in the 5- to 14-membered heteroaryl is selected from one or more than one of N, O, and S, and the number of heteroatoms is 1, 2, 3, or 4; the R.sup.1-1, R.sup.1-2 and R.sup.1-3 are each independently C.sub.1-C.sub.6 alkyl; L.sub.1 is independently one or more than one of a phenylalanine residue, alanine residue, glycine residue, glutamic acid residue, aspartic acid residue, cysteine residue, histidine residue, isoleucine residue, leucine residue, lysine residue, methionine residue, proline residue, serine residue, threonine residue, tryptophan residue, tyrosine residue, and valine residue; p is 2 to 4; L.sub.2 is ##STR00075## wherein n is independently 1 to 12, the c-terminal is connected to L.sub.1 through a carbonyl group, and the f-terminal is connected to the d-terminal of L.sub.3; L.sub.3 is ##STR00076## wherein the b-terminal is connected to the Ab, and the d-terminal is connected to the f-terminal of L.sub.2.
2. The antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 1, wherein when D is the cytotoxic drug topoisomerase inhibitor, the cytotoxic drug topoisomerase inhibitor is ##STR00077## R.sup.2 and R.sup.5 are each independently H, C.sub.1-C.sub.6 alkyl, or halogen; R.sup.3 and R.sup.6 are each independently H, C.sub.1-C.sub.6 alkyl, or halogen; R.sup.4 and R.sup.7 are each independently C.sub.1-C.sub.6 alkyl; or, the b-terminal of L.sub.3 is connected to the sulfhydryl group on the antibody in the form of a thioether; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by more than one NR.sup.1-1R.sup.1-2, the more than one is two or three; or, when R.sup.1-1 and R.sup.1-2 are each independently C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by more than one R.sup.1-3S(O).sub.2, the more than one is two or three; or, when R.sup.1-3 is C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, m is an integer or non-integer of 4 to 8; or, p is 2; or, n is 8 to 12; or, when R.sup.1-1, R.sup.1-2, and R.sup.1-3 are independently C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is C.sub.1-C.sub.4 alkyl.
3. The antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 2, wherein when R.sup.2 and R.sup.5 are each independently C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.2 and R.sup.5 are each independently halogen, the halogen is fluorine, chlorine, bromine, or iodine; or, when R.sup.3 and R.sup.6 are each independently C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.3 and R.sup.6 are each independently halogen, the halogen is fluorine, chlorine, bromine, or iodine; or, when R.sup.4 and R.sup.7 are each independently C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, the NR.sup.1-1R.sup.1-2 is N(CH.sub.3).sub.2; or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one NR.sup.1-1R.sup.1-2, the C.sub.1-C.sub.6 alkyl substituted by one NR.sup.1-1R.sup.1-2 is ##STR00078## or, when R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one R.sup.1-3S(O).sub.2, the C.sub.1-C.sub.6 alkyl substituted by one R.sup.1-3S(O).sub.2 is ##STR00079## or, m is 7.4 to 7.85; or, (L.sub.1).sub.p is ##STR00080## wherein the g-terminal is connected to the c-terminal of L.sub.2 through a carbonyl group; or, n is 8, 9, 10, 11, or 12; or, when R.sup.1-1, R.sup.1-2, and R.sup.1-3 are independently C.sub.1-C.sub.6 alkyl, the C.sub.1-C.sub.6 alkyl is methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, or tert-butyl.
4. The antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 2, wherein R.sup.2 and R.sup.5 are each independently C.sub.1-C.sub.6 alkyl; or, R.sup.3 and R.sup.6 are each independently halogen; or, R.sup.4 and R.sup.7 are ethyl; or, L.sub.1 is one or more than one of the phenylalanine residue, alanine residue, glycine residue, isoleucine residue, leucine residue, proline residue, and valine residue; or, R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, C.sub.1-C.sub.6 alkyl, or C.sub.3-C.sub.10 cycloalkyl, D is ##STR00081##
5. The antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 2, wherein the antibody-drug conjugate is any one of the following schemes: scheme I: Ab is the B7-H3 antibody or the variant of the B7-H3 antibody; D is ##STR00082## R.sup.2 and R.sup.5 are each independently H, C.sub.1-C.sub.6 alkyl, or halogen; R.sup.3 and R.sup.6 are each independently H, C.sub.1-C.sub.6 alkyl, or halogen; R.sup.4 and R.sup.7 are each independently C.sub.1-C.sub.6 alkyl; R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, C.sub.1-C.sub.6 alkyl, or C.sub.3-C.sub.10 cycloalkyl; L.sub.1 is independently one or more than one of the phenylalanine residue, alanine residue, glycine residue, isoleucine residue, leucine residue, proline residue, and valine residue; scheme II: Ab is the B7-H3 antibody or the variant of the B7-H3 antibody; D is ##STR00083## R.sup.2 and R.sup.5 are each independently C.sub.1-C.sub.6 alkyl; R.sup.3 and R.sup.6 are each independently halogen; R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, or C.sub.1-C.sub.6 alkyl; L.sub.1 is independently one or more than one of the phenylalanine residue, alanine residue, glycine residue, isoleucine residue, leucine residue, proline residue, and valine residue; scheme III: Ab is the B7-H3 antibody or the variant of the B7-H3 antibody; D is ##STR00084## R.sup.2 and R.sup.5 are each independently C.sub.1-C.sub.6 alkyl; R.sup.3 and R.sup.6 are each independently halogen; m is 7 to 8; R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, or C.sub.1-C.sub.6 alkyl; L.sub.1 is independently selected from the valine residue and the alanine residue; scheme IV: Ab is the B7-H3 antibody or the variant of the B7-H3 antibody; D is ##STR00085## R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, or C.sub.1-C.sub.6 alkyl; scheme V: Ab is the B7-H3 antibody or the variant of the B7-H3 antibody; D is ##STR00086## m is 7 to 8; R.sup.1 is C.sub.1-C.sub.6 alkyl substituted by one or more than one NR.sup.1-1R.sup.1-2, C.sub.1-C.sub.6 alkyl substituted by one or more than one R.sup.1-3S(O).sub.2, or C.sub.1-C.sub.6 alkyl; L.sub.1 is independently selected from the valine residue and the alanine residue.
6. The antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 1, wherein the antibody-drug conjugate is any one of the following compounds: ##STR00087## ##STR00088## ##STR00089## wherein, Ab is the B7-H3 antibody or the variant of the B7-H3 antibody, and m is 7.47, 7.48, 7.52, 7.62, 7.64, 7.65, 7.67, 7.72, 7.78, 7.83, or 7.85.
7. The antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 1, wherein the antibody-drug conjugate is any one of the following compounds: ##STR00090## Ab is the B7-H3 antibody, and m is 7.64; ##STR00091## Ab is the B7-H3 antibody, and m is 7.67 ##STR00092## Ab is the B7-H3 antibody, and m is 7.83; ##STR00093## Ab is the B7-H3 antibody, and m is 7.65; ##STR00094## Ab is the B7-H3 antibody, and m is 7.78; ##STR00095## Ab is the B7-H3 antibody, and is 7.62; ##STR00096## Ab is the B7-H3 antibody, and m is 7.48; ##STR00097## Ab is the B7-H3 antibody, and m is 7.52; ##STR00098## Ab is the B7-H3 antibody and m is 7.47; ##STR00099## Ab is the B7-H3 antibody, and m is 7.85; or ##STR00100## Ab is the B7-H3 antibody, and m is 7.72.
8. A method for preparing the antibody-drug conjugate according to claim 1, comprising the following steps: carrying out a coupling reaction between a compound of formula II and Ab-hydrogen as shown below; ##STR00101##
9. A pharmaceutical composition, comprising substance X and a pharmaceutically acceptable excipient; the substance X is the antibody-drug conjugate, the pharmaceutically acceptable salt thereof, the solvate thereof, or the solvate of the pharmaceutically acceptable salt thereof according to claim 1.
10-12. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0122]
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENT
[0123] The present disclosure will be further described below with reference to examples, but the present disclosure is not therefore limited to the scope of the examples. Experimental methods without specific conditions in the following examples are selected according to conventional methods and conditions, or according to the commercial specification.
DESCRIPTION OF ABBREVIATIONS
[0124] PCR polymerase chain reaction [0125] CHO Chinese hamster ovary cells [0126] HTRF homogeneous time-resolved fluorescence [0127] PB phosphate buffer [0128] EDTA ethylenediaminetetraacetic acid [0129] TECP tris(2-carboxyethyl)phosphine [0130] DMSO dimethyl sulfoxide [0131] DMF N,N-dimethylformamide [0132] HATU 2-(7-azabenzotriazol-1-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate [0133] /v V/V, volume ratio [0134] UV ultraviolet visible light [0135] ELISA enzyme-linked immunosorbent assay [0136] BSA bovine serum albumin [0137] rpm revolutions per minute [0138] FBS fetal bovine serum
Example 1: Preparation of B7-H3 Antibody
[0139] In the present disclosure, the monoclonal antibody FDA016 with high affinity and specific targeting B7-H3 was selected, the amino acid sequence of its light chain was shown in SEQ ID NO: 1, and the amino acid sequence of its heavy chain was shown in SEQ ID NO: 2. The light and heavy chain nucleotide sequences of FDA016 were obtained by whole gene synthesis (Suzhou Genewiz). They were separately constructed into the pV81 vector (as shown in
[0140] The amino acid sequence of the FDA016 light chain is shown below:
TABLE-US-00001 SEQIDNO:1: 1 DIQMTQSPSSLSASVGDRVTITCRASESIYSYLAWYQQKPGKAPKLLVYN 51 TKTLPEGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQHHYGTPPWTFG 101 QGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWK 151 VDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQ 201 GLSSPVTKSFNRGEC
[0141] The amino acid sequence of FDA016 heavy chain is shown below:
TABLE-US-00002 SEQIDNO:2: 1 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYGMSWVRQAPGKGLEWVAT 51 INSGGSNTYYPDSLKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHD 101 GGAMDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF 151 PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYIC 201 NVNHKPSNTKVDKRVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT 251 LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY 301 RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYT 351 LPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS 401 DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Example 2: Synthesis of Linker-Drug Conjugates
Example 2-1: Synthesis of LE12
[0142] ##STR00044## ##STR00045##
[0143] Synthesis of Intermediate 2:
[0144] (S)-2-Azidopropionic acid (10 g, 86.9 mmol) and 4-aminobenzyl alcohol (21.50 g, 173.8 mmol) were dissolved in a mixed solvent of 300 mL of dichloromethane and methanol (in a volume ratio of 2:1), and then 2-ethoxy-1-ethoxycarbonyl-1,2-dihydroquinoline (21.49 g, 86.9 mmol) was added thereto. The reaction was carried out at room temperature for 5 hours. The solvent was then evaporated under reduced pressure and the obtained crude product was purified by silica gel column chromatography [dichloromethane:ethyl acetate=1:1 (v/v)] to obtain intermediate 2 (16.3 g, yield of 85%), ESI-MS m/z: 221 (M+H).
Synthesis of Intermediate 3
[0145] Intermediate 2 (15 g, 68.2 mmol) was mixed with bis(p-nitrophenyl)carbonate (22.82 g, 75.02 mmol) and dissolved in 200 mL of anhydrous N,N-dimethylformamide, and then 25 mL of triethylamine was added thereto, and the reaction was carried out at room temperature for 2 hours. After the complete reaction of the raw materials was monitored by liquid chromatography-mass spectrometry, methylamine hydrochloride (6.91 g, 102.3 mmol) was added thereto, and the reaction was continued at room temperature for 1 hour. After the reaction was completed, most of the solvent was removed by distillation under reduced pressure, then 200 mL of water and 200 mL of ethyl acetate were added thereto. The organic phase was collected after the phases were separated, and the organic phase was dried and concentrated, and then the obtained crude product was purified by silica gel column chromatography [dichloromethane:ethyl acetate=10:1 (v/v)] to obtain intermediate 3 (18.9 g, yield of 100%), ESI-MS m/z: 278 (M+H).
Synthesis of Intermediate 5
[0146] Intermediate 3 (10 g, 36.1 mmol) was mixed with polyformaldehyde (1.63 g, 54.2 mmol) and dissolved in 150 mL of anhydrous dichloromethane. Trimethylchlorosilane (6.28 g, 57.76 mmol) was slowly added thereto and the reaction was carried out at room temperature for 2 hours to obtain a crude solution of intermediate 4. The reaction was monitored by liquid chromatography-mass spectrometry after sampling and quenching with methanol. After the reaction was completed, the reaction mixture was filtered and then tert-butyl hydroxyacetate (9.54 g, 72.2 mmol) and triethylamine (10 mL, 72.2 mmol) were added to the filtrate and the reaction was continued at room temperature for 2 hours. After the reaction was completed, most of the solvent was removed by distillation under reduced pressure, and then the obtained crude product was purified by silica gel column chromatography [petroleum ether: ethyl acetate=3:1 (v/v)] to obtain intermediate 5 (11.2 g, yield of 74%), ESI-MS m/z: 422 (M+H).
Synthesis of Intermediate 6
[0147] Intermediate 5 (10 g, 23.8 mmol) was dissolved in 80 mL of anhydrous tetrahydrofuran, and 80 mL of water was added thereto, and then tris(2-carboxyethylphosphine) hydrochloride (13.6 g, 47.6 mmol) was added thereto and the reaction was carried out for 4 hours at room temperature. After the reaction was completed, the tetrahydrofuran was removed by distillation under reduced pressure, and then the mixture was extracted with ethyl acetate. The obtained organic phase was dried and evaporated to remove the solvent under reduced pressure, and purified by silica gel column chromatography [dichloromethane: methanol=10:1 (v/v)] to obtain intermediate 6 (8.1 g, yield of 86%), ESI-MS m/z: 396 (M+H).
Synthesis of Intermediate 8
[0148] Intermediate 6 (5 g, 12.7 mmol) was dissolved in 60 mL of a mixed solvent of dichloromethane and methanol (v/v=2:1), and 3 mL of trifluoroacetic acid was slowly added thereto, and the reaction was carried out at room temperature for 30 min. After the reaction was completed, an equal volume of water and ethyl acetate were added thereto, and the organic phase was dried and concentrated, and the obtained crude product was directly used in the next step.
[0149] The crude product obtained from the previous step was dissolved in 50 mL of anhydrous N,N-dimethylformamide, and then Fmoc-L-valine hydroxysuccinimide ester (8.3 g, 19.1 mmol) and triethylamine (5 mL) were added thereto, and the reaction was carried out at room temperature for 2 hours. After the reaction was completed, most of the solvent was removed by distillation under reduced pressure, and then the obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=10:1 (v/v)] to obtain intermediate 8 (5.4 g, yield of 64%), ESI-MS m/z: 661 (M+H).
Synthesis of Intermediate 9
[0150] Intermediate 8 (1 g, 1.5 mmol) was mixed with Exatecan methanesulfonate (0.568 g, 1 mmol) in 30 mL of anhydrous N,N-dimethylformamide, and then 2-(7-azabenzotriazol-1-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate (1.14 g, 3.0 mmol) and 2 mL of triethylamine were added thereto, and the reaction was carried out at room temperature for 2 hours. After the reaction was completed, the solvent was removed by distillation under reduced pressure, and then the obtained crude product was purified by silica gel column chromatography [chloroform: methanol=10:1 (v/v)] to obtain intermediate 9 (0.94 g, yield of 87%), ESI-MS m/z: 1078 (M+H).
Synthesis of Compound LE12
[0151] Intermediate 9 (1 g, 0.929 mmol) was dissolved in 20 mL of anhydrous DMF, then 0.5 mL of 1,8-diazabicyclo[5.4.0]undec-7-ene was added thereto, and the reaction was carried out at room temperature for 1 hour. After the reaction of the raw materials was completed, N-succinimidyl 6-maleimidohexanoate (428.5 mg, 1.39 mmol) was added directly, and the reaction mixture was stirred at room temperature for 1 hour. The solvent was removed by distillation under reduced pressure, and then the obtained crude product was purified by silica gel column chromatography [chloroform: methanol=8:1 (v/v)] to obtain the title compound (0.7 g, yield of 73%), ESI-MS m/z: 1035 (M+H).
Example 2-2: Synthesis of Compound LE13
[0152] ##STR00046## ##STR00047##
Synthesis of Intermediate 14
[0153] Commercially available intermediate 12 (267 mg, 0.8 mmol) was mixed with paraformaldehyde (50 mg, 1.6 mmol) and dissolved in 20 mL of anhydrous dichloromethane. Then, trimethylchlorosilane (0.3 mL, 3.4 mmol) was added slowly. After the addition was completed, the reaction was carried out at room temperature for 2 hours. Then, the reaction was monitored by liquid chromatography-mass spectrometry after sampling and quenching with methanol. After the reaction was completed, the reaction mixture was filtered, and then tert-butyl 2-hydroxyacetate (211 mg, 1.6 mmol) and pempidine (0.5 mL) were added to the filtrate, and the reaction was continued at room temperature for about 2 hours. After the reaction was completed, most of the solvent was removed by distillation under reduced pressure, and the obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=20:1 (v/v)] to obtain intermediate 14 (260 mg, yield of 68%), ESI-MS m/z: 479 (M+H).
Synthesis of Intermediate 15
[0154] Intermediate 14 (238 mg, 0.50 mmol) was dissolved in 6 mL of a mixed solvent of dichloromethane and methanol (v/v=2:1), and 0.3 mL of trifluoroacetic acid was slowly added thereto, and the reaction was carried out at room temperature for 30 min. After the reaction was completed, an equal volume of water and ethyl acetate were added thereto, and the organic phase was dried and concentrated, and the obtained crude product was directly used in the next step.
Synthesis of Intermediate 16
[0155] The crude product obtained from the previous step was mixed with Exatecan methanesulfonate (170 mg, 0.30 mmol) in 5 mL of anhydrous N,N-dimethylformamide, and then 2-(7-azabenzotriazol-1-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate (341 mg, 0.90 mmol) and 0.60 mL of triethylamine were added thereto, and the reaction was carried out at room temperature for 2 hours. After the reaction was completed, the solvent was removed by distillation under reduced pressure, and then the obtained crude product was purified by silica gel column chromatography [chloroform: methanol=10:1 (v/v)] to obtain intermediate 16 (210 mg, 83%), ESI-MS m/z: 840 (M+H).
Synthesis of Intermediate 17
[0156] Intermediate 16 (100 mg, 0.12 mmol) was dissolved in 15 mL of anhydrous tetrahydrofuran, and 3 mL of water was added thereto, then 0.3 mL of 1 mol/L triethylphosphine aqueous solution was added thereto, and the reaction was carried out at room temperature for 4 hours. After the reaction was monitored to be completed, the reaction mixture was distilled under reduced pressure to remove tetrahydrofuran. Sodium bicarbonate was added to the remaining aqueous solution to adjust the pH to neutral, and then dichloromethane was added for extraction. The obtained organic phase was dried and evaporated under reduced pressure to remove the solvent. The obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=10:1 (v/v)] to obtain intermediate 17 (69 mg, yield of 71%), ESI-MS m/z: 814 (M+H).
Synthesis of Compound LE13
[0157] Intermediate 17 (120 mg, 0.15 mmol) obtained according to the previous synthesis method was mixed with the commercially available raw material MC-V(102 mg, 0.33 mmol) in 40 mL of dichloromethane, and the condensation agent 2-ethoxy-1-ethoxycarbonyl-1,2-dihydroquinoline (82 mg, 0.33 mmol) was added to react overnight at room temperature. After the reaction was completed, the solvent was evaporated under reduced pressure and the obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=10:1 (v/v)] to obtain compound LE13 (116 mg, yield of 70%), ESI-MS m/z: 1106.5 (M+H).
Example 2-3: Synthesis of Compound LE14
[0158] ##STR00048##
Synthesis of Intermediate 19
[0159] Commercially available intermediate 18 (300 mg, 0.8 mmol) was mixed with polyformaldehyde (50 mg, 1.6 mmol) and dissolved in 20 mL anhydrous dichloromethane. Then, trimethylchlorosilane (0.3 mL, 3.4 mmol) was slowly added thereto, and the reaction was carried out at room temperature for 2 hours. The reaction was monitored by liquid chromatography-mass spectrometry after sampling and quenching with methanol. After the reaction was completed, the reaction mixture was filtered and then tert-butyl 2-hydroxyacetate (211 mg, 1.6 mmol) and triethylamine (0.22 m, 1.6 mmol) were added to the filtrate. The reaction was continued at room temperature for about 2 hours. After the reaction was completed, most of the solvent was removed by distillation under reduced pressure and the obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=20:1 (v/v)] to obtain intermediate 19 (349 mg, yield of 85%), ESI-MS m/z: 514 (M+H), .sup.1H NMR (400 MHz, CDCl.sub.3) ? 8.13 (s, 1H), 7.56 (d, J=7.5 Hz, 2H), 7.35 (s, 2H), 5.14 (s, 2H), 4.91 (s, 2H), 4.25 (q, J=7.1 Hz, 1H), 3.99 (d, J=42.5 Hz, 2H), 3.85 (t, J=6.2 Hz, 2H), 3.40 (dd, J=18.5, 7.6 Hz, 2H), 2.89 (d, J=48.6 Hz, 3H), 1.65 (d, J=6.8 Hz, 3H), 1.46 (s, 9H).
Synthesis of Intermediate 20
[0160] Intermediate 19 (257 mg, 0.50 mmol) was dissolved in 6 mL of a mixed solvent of dichloromethane and methanol (v/v=2:1), and 0.3 mL of trifluoroacetic acid was slowly added thereto, and the reaction was carried out at room temperature for 30 min. After the reaction was completed, an equal volume of water and ethyl acetate were added thereto, and the organic phase was dried and concentrated, and the obtained crude product was directly used in the next step.
[0161] The obtained crude product was mixed with Exatecan methanesulfonate (170 mg, 0.30 mmol) in 5 mL of anhydrous N,N-dimethylformamide, and then 2-(7-azabenzotriazol-1-yl)-N,N,N,N-tetramethyluronium hexafluorophosphate (341 mg, 0.90 mmol) and 0.60 mL of triethylamine were added thereto, and the reaction was carried out at room temperature for 2 hours. After the reaction was completed, the solvent was removed by distillation under reduced pressure, and then the obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=20:1 (v/v)] to obtain intermediate 20 (212 mg, yield of 81%), ESI-MS m/z: 875 (M+H). .sup.1H NMR (400 MHz, CDCl.sub.3) ? 8.27 (d, J=34.7 Hz, 1H), 7.63-7.35 (m, 5H), 7.21-7.10 (m, 1H), 5.71-5.48 (m, 2H), 5.24-4.95 (m, 3H), 4.95-4.72 (m, 4H), 4.45 (s, 1H), 4.33-3.97 (m, 3H), 3.75 (s, 2H), 3.39-2.99 (m, 4H), 2.76 (d, J=15.3 Hz, 3H), 2.43-2.15 (m, 5H), 2.04 (s, 1H), 1.94-1.75 (m, 2H), 1.62 (d, J=6.6 Hz, 3H), 1.11-0.89 (m, 3H).
Synthesis of Intermediate 21
[0162] Intermediate 20 (77 mg, 0.09 mmol) was dissolved in 12 mL of anhydrous tetrahydrofuran, and 3 mL of water was added thereto, then 0.3 mL of 1 mol/L triethylphosphine aqueous solution was added thereto, and the reaction was carried out at room temperature for 4 hours. After the reaction was completed, the reaction mixture was distilled under reduced pressure to remove tetrahydrofuran. Sodium bicarbonate was added to the remaining aqueous solution to adjust the pH to neutral, and then dichloromethane was added for extraction. The obtained organic phase was dried and evaporated under reduced pressure to remove the solvent. The obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=10:1 (v/v)] to obtain intermediate 21 (53 mg, yield of 69%), ESI-MS m/z: 849 (M+H). .sup.1H NMR (400 MHz, DMSO) ? 8.52 (s, 1H), 7.79 (d, J=10.8 Hz, 1H), 7.67-7.55 (m, 2H), 7.47-7.21 (m, 3H), 6.51 (s, 1H), 5.60 (s, 1H), 5.52-5.32 (m, 2H), 5.30-5.11 (m, 2H), 5.11-4.94 (m, 2H), 4.94-4.74 (m, 2H), 4.02 (s, 2H), 3.81-3.66 (m, 2H), 3.60-3.35 (m, 4H), 3.24-3.08 (m, 2H), 2.94 (d, J=30.8 Hz, 3H), 2.39 (s, 3H), 2.28-2.04 (m, 2H), 2.00-1.73 (m, 2H), 1.22 (d, J=6.6 Hz, 3H), 0.96-0.70 (m, 3H).
Synthesis of Compound LE14
[0163] Intermediate 21 (134 mg, 0.16 mmol) was mixed with the commercially available raw material MC-V(102 mg, 0.33 mmol) in 40 mL of dichloromethane, and the condensation agent 2-ethoxy-1-ethoxycarbonyl-1,2-dihydroquinoline (82 mg, 0.33 mmol) was added to react overnight at room temperature. After the reaction was completed, the solvent was evaporated under reduced pressure and the obtained crude product was purified by silica gel column chromatography [dichloromethane: methanol=10:1 (v/v)] to obtain compound LE14 (137 mg, yield of 75%), ESI-MS m/z: 1141.4 (M+H). .sup.1H NMR (400 MHz, DMSO) ? 9.97 (s, 1H), 8.52 (s, 1H), 8.27-8.09 (m, 1H), 7.88-7.70 (m, 2H), 7.63-7.51 (m, 2H), 7.28 (s, 3H), 6.99 (s, 2H), 6.51 (s, 1H), 5.59 (s, 1H), 5.50-5.32 (m, 2H), 5.17 (s, 2H), 4.98 (s, 2H), 4.85 (d, J=17.3 Hz, 2H), 4.43-4.33 (m, 1H), 4.21-4.12 (m, 1H), 4.03 (s, 2H), 3.74-3.64 (m, 2H), 3.20-3.03 (m, 3H), 3.02-2.84 (m, 4H), 2.36 (s, 3H), 2.23-2.09 (m, 4H), 2.01-1.90 (m, 1H), 1.90 -1.78 (m, 2H), 1.55-1.39 (m, 4H), 1.30 (d, J=6.7 Hz, 3H), 1.23-1.11 (m, 2H), 0.93-0.77 (m, 9H).
Example 2-4: Synthesis of Compound LE15-LE20
[0164] ##STR00049##
[0165] Intermediate VI could be prepared by replacing the methylamine hydrochloride in step b with the corresponding commercially available amino compound, using Fmoc-L-valyl-L-alanine as the starting material and referring to steps a and b in the synthesis method of intermediate 3 in Example 2-1. The subsequent steps were carried out starting from intermediate VI, and with the same methods as those in steps c, d, f, and h of Example 2-1, and intermediate IX similar to intermediate 9 was obtained. Then, following the same steps i and j as Example 6, the amino protecting group was removed, and condensed with different commercially available maleimide compounds to obtain the final product. The structures of the amino compounds and maleimides used are shown in Table 1. Compound LE15: gray-white solid, ESI-MS m/z: 1121.2 (M+H); compound LE16: light yellow solid, ESI-MS m/z: 1167.1 (M+H); compound LE17: yellow solid, ESI-MS m/z: 1132.3 (M+H); compound LE18: light yellow solid, ESI-MS m/z: 1305.4 (M+H); compound LE19: light yellow solid, ESI-MS m/z: 1307.4 (M+H); compound LE20: light yellow solid, ESI-MS m/z: 1337.6 (M+H).
TABLE-US-00003 TABLE 1 Intermediates used for the synthesis of LE15 to LE20 Maleimide Structure Product R.sup.A Amino Compound
Example 2-5: Synthesis of Compounds LE21 and LE22
[0166] ##STR00069## ##STR00070##
Synthesis of Compound DXD-1
[0167] Commercially available Exatecan methanesulfonate (0.568 g, 1 mmol) was mixed with commercially available 2-(tert-butyldimethylsilyloxy)acetic acid (CAS: 105459-05-0, 0.38 g, 2 mmol) in 20 mL anhydrous dichloromethane. The condensation agent HATU (0.76 g, 2 mmol) and 1 mL of pyridine were added thereto and stirred at room temperature for 2 hours. After the reaction was completed, the solvent was evaporated to dryness under reduced pressure, and the obtained crude product was purified by column chromatography [dichloromethane: methanol=50:1 (v/v)] to obtain title compound DXD-1 (0.55 g, yield of 90%), ESI-MS m/z: 608.1 (M+H). .sup.1H NMR (400 MHz, CDCl.sub.3) ? 7.73 (d, J=10.5 Hz, 1H), 7.64 (s, 1H), 7.05 (d, J=9.2 Hz, 1H), 5.80-5.62 (m, 2H), 5.41-5.14 (m, 4H), 4.29-4.15 (m, 2H), 4.08-4.03 (m, 1H), 3.27-3.07 (m, 2H), 2.45 (s, 3H), 2.38-2.28 (m, 2H), 1.96-1.81 (m, 2H), 1.04 (t, J=7.4 Hz, 3H), 0.80 (s, 9H), 0.11 (s, 3H), 0.03 (s, 3H).
Preparation of Intermediate V
[0168] Intermediate V could be prepared by replacing the methylamine hydrochloride in step b with the corresponding commercially available amino compound, referring to the preparation method of compound 4 in Example 2-1.
Synthesis of LE21 to LE22
[0169] Intermediate V was reacted with DXD-1, and then treated with 10% trifluoroacetic acid/dichloromethane solution to obtain intermediate X. Then, intermediate X was reacted according to the subsequent steps e, g, i, and j of compound 5 in Example 2-1: Intermediate X was reduced to obtain an amino compound, and the amino compound was then condensed with Fmoc-L-valine hydroxysuccinimide ester. Then the Fmoc protecting group of the amino group was removed from the obtained product, and the obtained amino product was then reacted with N-succinimidyl 6-maleimidohexanoate to obtain the final product. Compound LE21: yellow solid, ESI-MS m/z: 1141.2 (M+H); compound LE22: yellow solid, ESI-MS m/z: 1106.6 (M+H).
##STR00071##
Example 2-6: Synthesis of Compound LS13
[0170] Referring to the synthesis method of LE15 in Examples 2 to 4, SN-38 (7-ethyl-10-hydroxycamptothecin) was reacted with intermediate VII (R.sup.1 is methylsulfonyl ethyl) to obtain compound LS13 after deprotection, condensation and other steps: .sup.1H NMR (400 MHz, DMSO) ? 9.92 (d, J=22.4 Hz, 1H), 8.14 (s, 1H), 8.08 (d, J=9.1 Hz, 1H), 7.81 (d, J=8.0 Hz, 1H), 7.70-7.50 (m, 3H), 7.47 (d, J=7.2 Hz, 1H), 7.34 (d, J=7.2 Hz, 1H), 7.27 (s, 1H), 7.20 (s, 1H), 6.98 (s, 2H), 6.51 (s, 1H), 5.61 (s, 2H), 5.48-5.35 (m, 2H), 5.27 (s, 2H), 5.10 (d, J=20.6 Hz, 2H), 4.36 (s, 1H), 4.21-4.07 (m, 1H), 3.84 (s, 2H), 3.48 (s, 2H), 3.21-2.92 (m, 6H), 2.25-2.04 (m, 2H), 2.04-1.78 (m, 3H), 1.55-1.36 (m, 4H), 1.36-1.10 (m, 9H), 0.95-0.71 (m, 10H).
##STR00072##
Example 2-7: Synthesis of Compound GGFG-Dxd
[0171] Compound GGFG-Dxd was prepared according to the known synthesis method reported in WO2015146132A1. ESI-MS m/z: 1034.5 (M+H), .sup.1H-NMR (400 MHz, DMSO-d.sub.6) ?8.61 (t, J=6.4 Hz, 1H), 8.50 (d, J=8.5 Hz, 1H), 8.28 (t, J=5.1 Hz, 1H), 8.11 (d, J=7.5 Hz, 1H), 8.05 (t, J=5.7 Hz, 1H), 7.99 (t, J=5.9 Hz, 1H), 7.77 (d, J=11.0 Hz, 1H), 7.31 (s, 1H), 7.25-7.16 (m, 5H), 6.98 (s, 2H), 6.51 (s, 1H), 5.59 (dt, J=7.4, 4.1 Hz, 1H), 5.41 (s, 2H), 5.20 (s, 2H), 4.64 (d, J=6.1 Hz, 2H), 4.53-4.40 (m, 1H), 4.02 (s, 2H), 3.74-3.37 (m, 8H), 3.18-3.00 (m, 2H), 3.04-2.97 (m, 1H), 2.77 (dd, J=13.5, 9.4 Hz, 1H), 2.38 (s, 3H), 2.19 (dd, J=14.9, 8.5 Hz, 2H), 2.11-2.05 (m, 2H), 1.86 (dd, J=14.0, 6.7 Hz, 2H), 1.45 (s, 4H), 1.20-1.14 (m, 2H), 0.87 (t, J=7.1 Hz, 3H).
##STR00073##
Example 3: Preparation of Antibody-Drug Conjugates
[0172] The antibody FDA016 against B7-H3 was prepared according to the method of Example 1 and was replaced into 50 mM PB/1.0 mM EDTA buffer (pH 7.0) using a G25 desalting column. 12 equivalents of TECP were added thereto and the mixture was stirred at 37? C. for 2 hours to fully open the disulfide bonds between the antibody chains. Then, phosphoric acid was used to adjust the pH of the reduced antibody solution to 6.0 and the temperature of the water bath was lowered to 25? C. for coupling reaction. The linker-drug conjugates LE12 to LE22, LS13, and GGFG-Dxd prepared according to the above Example 2 were dissolved in DMSO respectively and 12 equivalents of linker-drug conjugate were added dropwise to the reduced antibody solution. Additional DMSO was added to a final concentration of 10% (v/v) and the reaction was stirred at 25? C. for 0.5 hours. After the reaction was completed, the sample was filtered through a 0.22 ?m membrane. The tangential flow filtration system was used to purify and remove unconjugated small molecules. The buffer was a 50 mM PB/1.0 mM EDTA solution (pH 6.0). After purification, a final concentration of 6% sucrose was added and stored in a ?20? C. refrigerator. The absorbance values were measured at 280 nm and 370 nm by UV method, respectively, and the DAR value was calculated. The results are shown in Table 2 below.
[0173] The coupling reaction was carried out in the same manner as in this example and all samples were prepared according to the highest DAR (i.e., excessive coupling). The occurrence of precipitation during each coupling reaction was observed and the polymer ratio and recovery rate after each coupling reaction were calculated. The results are also shown in Table 2.
TABLE-US-00004 TABLE 2 Coupling conditions for preparing different antibody-drug conjugates (ADCs) Linker- Whether Aggre- Re- Drug DAR Precipi- gation covery ADC Number Antibody Conjugate Value tation Ratio Rate FDA016-LE12 FDA016 LE12 7.64 No 0.5% 89% FDA016-LE13 FDA016 LE13 7.67 No 0.2% 98% FDA016-LE14 FDA016 LE14 7.83 No 0.1% 94% FDA016-LE15 FDA016 LE15 7.65 No 0.3% 90% FDA016-LE16 FDA016 LE16 7.78 No 0.2% 85% FDA016-LE17 FDA016 LE17 7.62 No 0.2% 86% FDA016-LE18 FDA016 LE18 7.48 No 0.3% 90% FDA016-LE19 FDA016 LE19 7.52 No 0.2% 89% FDA016-LE20 FDA016 LE20 7.47 No 0.2% 88% FDA016-LE21 FDA016 LE21 7.85 No 0.3% 90% FDA016-LE22 FDA016 LE22 7.72 No 0.2% 89% FDA016-LS13 FDA016 LS13 7.68 No 0.5% 92% FDA016-8201 FDA016 GGFG- 7.81 No 0.3% 90% Dxd / indicates that the recovery rate is not calculated
[0174] In practical research, it was found that the linker-drug conjugate GGFG-Dxd also produced precipitation when coupled with other antibodies and had a high aggregation ratio, which lacked universality. However, when most of the linker-drug conjugates of the present technical solution were attempted to be coupled with different antibodies including F016, no precipitation was produced and the aggregation ratio was within the normal range, indicating that the antibody-drug conjugates provided by the present disclosure have good solubility and druggability, and that no precipitation during the coupling process is also very conducive to the preparation of antibody-drug conjugates.
Effect Example 1: In Vitro Killing Activity Evaluation of Antibody-Drug Conjugates
[0175] Calu-6 (ATCC) cells were selected as the cell line for in vitro activity detection. 2000 cells per well were seeded in a 96-well cell culture plate and cultured for 20 to 24 hours. The antibody-drug conjugates prepared according to the method of Example 3 were formulated into test solutions with 11 concentration gradients of 1000, 166.7, 55.6, 18.6, 6.17, 2.06, 0.69, 0.23, 0.08, 0.008, and 0 nM using L15 cell culture medium containing 10% FBS. The diluted test solutions were added to the culture plate containing the seeded cells at 100 ?L/well and incubated for 144 hours at 37? C. in a 5% CO.sub.2 incubator. CellTiter-Glo? Luminescent Cell Viability Assay Reagent (promega, G9243) (50 ?L/well) was added and the plate was shaken at 500 rpm at room temperature for 10 minutes to mix well. The data were read using a SpectraMaxL microplate reader (OD 570 nm, reading at 2 s intervals) and the IC50 results were calculated as shown in Table 3.
[0176] Using the same method as above, the cytotoxic activity of each antibody-drug conjugate against multiple tumor cells of NCI-N87, A375, Hs-700T, LN-229, MDA-MB-468, PA-1, and Raji purchased from ATCC was tested. The results are shown in Table 3. From the results in Table 3, it can be seen that the antibody-drug conjugates provided by the present disclosure have excellent in vitro killing activity against cells such as Calu-6, NCI-N87, A375, Hs-700T, LN-229, MDA-MB-468, and PA-1. However, the antibody-drug conjugate has no killing activity on Raji-negative cells, indicating that the prepared ADC has specific targeted killing activity.
TABLE-US-00005 TABLE 3 In vitro killing activity of antibody-drug conjugates IC50 (nM) ADC Calu-6 NCI- A375 Hs-700T LN-229 MDA-MB- PA-1 Raji Number Cell N87 Cell Cell Cell Cell 468 Cell Cell Cell FDA016- 1.2 7.8 0.98 3.1 Not Not Not Not LE12 Tested Tested Tested Tested FDA016- 2.0 10.38 1.23 2.78 Not 15.64 20.32 Not LE13 Tested Tested FDA016- 0.8 5.2 0.62 2.5 3.5 9.87 8.93 >500 LE14 FDA016- 0.93 4.98 1.12 3.23 5.28 12.38 10.23 >500 LE15 FDA016- 1.34 7.89 Not Not 6.79 17.38 Not >500 LE16 Tested Tested Tested FDA016- 0.82 Not Not 3.52 3.78 16.54 Not >500 LE17 Tested Tested Tested FDA016- 0.96 Not Not Not 3.28 Not Not >500 LE18 Tested Tested Tested Tested Tested FDA016- 1.13 Not 0.96 Not 3.62 Not Not Not LE19 Tested Tested Tested Tested Tested FDA016- Not 6.78 Not Not 4.23 Not Not Not LE20 Tested Tested Tested Tested Tested Tested FDA016- Not 7.53 3.23 Not 10.32 22.32 Not Not LE21 Tested Tested Tested Tested FDA016- Not 10.62 2.32 Not Not 13.58 7.68 Not LE22 Tested Tested Tested Tested FDA016- 53.23 69.32 >100 >100 Not Not Not Not LS13 Tested Tested Tested Tested FDA016- 1.2 6.7 0.76 3.8 5.6 10.56 Not >500 GGFG- Tested Dxd
Effect Example 2: In Vitro Plasma Stability Assay
[0177] This example evaluates the stability of the antibody-drug conjugate prepared according to the method of Example 3 in human plasma. Specifically, in this example, the antibody-drug conjugate of Example 3 was added to human plasma and placed in a 37? C. water bath for 1, 3, 7, 14, 21, and 28 days. An internal standard (Exatecan as an internal standard substance) was added and extracted and then detected by high-performance liquid chromatography to detect the release of free drugs. The results are shown in Table 4.
TABLE-US-00006 TABLE 4 Stability evaluation of different ADCs in human plasma Free Drug Ratio Sample Name Day 1 Day 3 Day 7 Day 14 Day 21 Day 28 FDA016-GGFG-Dxd 0.1% 0.6% 0.7% 1.2% 1.6% 2.1% FDA016-LE12 0.2% 0.5% 0.9% 1.4% 1.7% 2.2% FDA016-LE13 0.1% 0.2% 0.7% 1.2% 1.2% 2.1% FDA016-LE14 0.1% 0.3% 0.5% 0.8% 1.3% 2.0% FDA016-LS13 0.5% 0.8% 2.4% 3.3% 4.6% 5.2%
[0178] The plasma stability results show that the antibody-drug conjugate provided by the present disclosure has good plasma stability.
Effect Example 3: In Vitro Enzyme Digestion Experiment of Linker-Drug Conjugates
[0179] The linker-drug conjugate (LE14 and GGFG-Dxd) was co-incubated with cathepsin B in three different pH (5.0, 6.0, 7.0) buffers. Samples were taken at different time points and entered into a high-performance liquid chromatography-mass spectrometry instrument. The external standard method (with DXD as the external standard) was used to determine the release percentage of the drug. The experimental results (as shown in Table 5) show that GGFG-Dxd has a slow speed of enzyme digestion within the pH range used, while the Linker-drug conjugate LE14 employed by the present disclosure can be quickly enzymatically digested within the pH range of 5.0 to 7.0.
TABLE-US-00007 TABLE 5 In vitro enzyme digestion of LE14 and GGFG-Dxd at different pH Percentage of drug release in the sample % Time GGFG-Dxd LE14 (h) pH 5.0 pH 6.0 pH 7.0 pH 5.0 pH 6.0 pH 7.0 0 22.0 22.35 22.16 13.82 14.32 16.59 1 24.82 24.8 25.76 96.0 96.12 98.32 2 25.85 27.32 29.45 98.35 96.75 98.45 3 27.46 29.32 32.00 99.12 98.52 99.12 4 29.68 32.0 34.72 99.21 98.45 99.12 5 31.72 33.15 37.17 99.45 98.92 99.87 6 34.17 36.38 38.43 98.23 99.15 99.47
Effect Example 4: In Vitro Enzyme Digestion Experiment of FDA016-LS13
[0180] NCI-N87 cell line was selected as the experimental cell lines. After the sample was incubated in cathepsin B system (100 mM sodium acetate-acetic acid buffer, 4 mM dithiothreitol, pH 5.0) at 37? C. for 4 hours, the obtained sample was diluted with culture medium to different concentrations. 8 concentrations (1.5 to 10-fold dilution) were set from 70 nM to 0.003 nM of SN-38 concentration. The killing (inhibitory) ability of the cell line was observed for 144 hours. The IC50 value was calculated by reading the fluorescence data after chemical luminescent staining with CellTiter-Glo? Luminescent Cell Viability Assay.
[0181] The above enzyme digestion samples obtained by incubating in a cathepsin B system at 37? C. for 4 hours were precipitated with an appropriate amount of ethanol to remove protein and detected by high-performance liquid chromatography to release small molecule compounds. The 4-hour release rate was measured with an equal amount of SN-38 as a reference, and the results showed that the release rate reached 99%.
[0182] The experimental results (as shown in Table 6) show that after enzyme digestion treatment, the cytotoxic activity of FDA016-LS13 is almost the same as that of SN-38 at an equivalent dose, which also indicates that FDA016-LS13 has almost completely released SN-38 under the action of cathepsin B and played a role. However, FDA016-LS13 may have undergone unpredictable changes when it is endocytosed into lysosomes, resulting in SN-38 not being able to function effectively.
TABLE-US-00008 TABLE 6 Changes in killing activity of FDA016-LS13 on NCI-N87 cell line before and after enzyme digestion by cathepsin B system IC50 (based on SN-38 equivalent, nM) Before Enzyme Sample Digestion After Enzyme Digestion FDA016-LS13 >100 nM 6.32 nM SN-38 7.13 nM 7.45 nM
Effect Example 5: Testing Antitumor Activity of FDA016-LE14 in Calu-6 Human Lung Cancer Model
[0183] 6- to 8-week-old female Balb/c nude mice were subcutaneously injected with 5?10.sup.6 human lung cancer cells (Calu-6) dissolved in 100 ?L of PBS solution on the right side of the neck and back. When the tumor grew to an average volume of 150 to 200 mm.sup.3, mice were randomly divided into 5 groups according to tumor size and mouse weight, with 6 animals in each group. The groups were blank control group, 5 mg/kg FDA016-GGFG-Dxd group, 10 mg/kg FDA016-GGFG-Dxd group, 5 mg/kg FDA016-LE14 group, and 10 mg/kg FDA016-LE14 group, respectively, administered intraperitoneally once a week. The animal weight and tumor volume were measured twice a week, and the survival status of the experimental animals was observed during the experiment process. As shown in Table 7, the average tumor volume of the mice in the blank control group was 2107.51 mm.sup.3 at the end of treatment. The average tumor volume of the FDA016-GGFG-Dxd treatment group at 5.0 mg/kg was 72.35 mm.sup.3 on the 14th day after the end of treatment, and the average tumor volume of the FDA016-GGFG-Dxd treatment group at 10 mg/kg was 3.28 mm.sup.3 on the 14th day after the end of treatment. The average tumor volume of the FDA016-LE14 treatment group at 5.0 mg/kg was 50.48 mm.sup.3 on the 14th day after the end of treatment, and the average tumor volume of the FDA016-LE14 treatment group at 10 mg/kg was 0.00 mm.sup.3 on the 14th day after the end of treatment. The experimental results show that FDA016-LE14 has good in vivo antitumor activity, and all experimental mice have no death or weight loss, indicating that FDA016-LE14 has good safety.
TABLE-US-00009 TABLE 7 Antitumor activity of FDA016-LE14 in Calu-6 human lung cancer model Observation Days Grouping 13 16 20 23 27 30 34 37 41 44 48 Average Tumor Volume/mm.sup.3 01 150.65 205.67 538.37 783.23 946.54 1238.48 1472.54 1753.15 2107.51 / / 02 150.45 185.32 117.78 113.26 79.88 46.40 44.56 42.81 49.38 62.53 72.35 03 150.83 182.35 93.56 39.61 10.68 7.75 5.83 4.28 3.91 3.83 3.28 04 150.52 174.27 114.94 108.40 74.98 42.34 37.45 39.12 42.53 47.85 50.48 05 150.46 168.08 89.23 32.13 4.15 2.12 1.35 1.12 0.00 0.00 0.00 Standard Deviation 01 10.37 31.73 32.42 77.06 85.50 81.66 92.36 / / / / 02 10.81 30.80 21.55 17.67 11.96 14.21 12.45 10.13 8.38 6.23 6.27 03 11.13 23.15 23.03 19.12 13.67 2.19 1.83 0.28 1.83 1.35 0.56 04 10.74 27.49 22.75 13.43 15.76 12.31 15.57 20.69 13.81 9.14 6.58 05 10.93 18.63 20.43 11.58 3.27 1.83 1.56 0.70 0.00 0.00 0.00
[0184] Note: Group 01 is the blank control group; group 02 is the 5 mg/kg FDA016-GGFG-Dxd group; group 03 is the 10 mg/kg FDA016-GGFG-Dxd group; group 04 is the 5 mg/kg FDA016-LE14 group; group 05 is the 10 mg/kg FDA016-LE14 group.