FULLY HUMAN SINGLE-DOMAIN TANDEM CHIMERIC ANTIGEN RECEPTOR (CAR) TARGETING CD5, AND USE THEREOF
20240050568 · 2024-02-15
Assignee
Inventors
- Taochao Tan (Nanjing, CN)
- Zhenyu Dai (Nanjing, CN)
- Jianfeng Zhou (Nanjing, CN)
- Ya Zhao (Nanjing, CN)
- Qiaoe Wei (Nanjing, CN)
- Xiangyin Jia (Nanjing, CN)
- Jianwei Liu (Nanjing, CN)
Cpc classification
A61K35/17
HUMAN NECESSITIES
C07K2317/569
CHEMISTRY; METALLURGY
C12N15/63
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K39/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
Provided is a fully human single-domain tandem chimeric antigen receptor (CAR) capable of specifically binding to a CD5 protein, which comprises a CD5 binding domain, a transmembrane domain, a co-stimulatory domain and an intracellular signaling domain. Also provided are engineered immune effector cells, such as T cells, comprising the chimeric antigen receptor, and use of the CAR and the engineered immune effector cells in the treatment of diseases or conditions associated with the expression of CD5.
Claims
1. A chimeric antigen receptor (CAR), comprising a CD5 binding domain, a transmembrane domain, a co-stimulatory domain and an intracellular signaling domain, wherein the CD5 binding domain comprises one or more antibodies or fragments thereof specifically binding to CD5, wherein the antibody comprises a heavy chain complementarity determining region 1 (HCDR1), a heavy chain complementarity determining region 2 (HCDR2) and a heavy chain complementarity determining region 3 (HCDR3), and the amino acid sequences of the HCDR1, HCDR2, and HCDR3 are selected from any one of the following combinations: (1) HCDR1 with an amino acid sequence as set forth in SEQ ID NO:38, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:39, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:40; (2) HCDR 1 with an amino acid sequence as set forth in SEQ ID NO:41, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:42, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:43; (3) HCDR1 with an amino acid sequence as set forth in SEQ ID NO:64, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:65, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:66; (4) HCDR1 with an amino acid sequence as set forth in SEQ ID NO:67, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:68, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:69.
2. The CAR according to claim 1, wherein the CD5 binding domain comprises at least two antibodies or fragments thereof that specifically bind to CD5, and the HCDR1, HCDR2, and HCDR3 comprised in the antibodies or fragments thereof are independently selected from any of the following combinations: (1) HCDR1 with an amino acid sequence as set forth in SEQ ID NO:38, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:39, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:40; (2) HCDR1 with an amino acid sequence as set forth in SEQ ID NO:41, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:42, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:43; (3) HCDR 1 with an amino acid sequence as set forth in SEQ ID NO:64, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:65, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:66; (4) HCDR1 with an amino acid sequence as set forth in SEQ ID NO:67, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:68, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:69.
3. The CAR according to claim 2, wherein the CD5 binding domain comprises a first antibody or a fragment thereof and a second antibody or a fragment thereof that specifically bind to CD5, and the HCDR1, HCDR2, and HCDR3 comprised in the first antibody or fragment thereof and the second antibody or fragment thereof are selected from any of the following combinations: (1) the first antibody or fragment thereof comprises HCDR1 with an amino acid sequence as set forth in SEQ ID NO:38, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:39, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:40; the second antibody or fragment thereof comprises HCDR1 with an amino acid sequence as set forth in SEQ ID NO:41, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:42, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:43; (2) the first antibody or fragment thereof comprises HCDR1 with an amino acid sequence as set forth in SEQ ID NO:38, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:39, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:40; the second antibody or fragment thereof comprises HCDR1 with an amino acid sequence as set forth in SEQ ID NO:64, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:65, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:66; (3) the first antibody or fragment thereof comprises HCDR1 with an amino acid sequence as set forth in SEQ ID NO:38, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:39, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:40; the second antibody or fragment thereof comprises HCDR1 with an amino acid sequence as set forth in SEQ ID NO:67, HCDR2 with an amino acid sequence as set forth in SEQ ID NO:68, and HCDR3 with an amino acid sequence as set forth in SEQ ID NO:69.
4-5. (canceled)
6. The CAR according to claim 1, wherein the antibody is a single-domain antibody.
7. The CAR according to claim 6, wherein the CD5 binding domain comprises a plurality of single-domain antibodies, and the plurality of single-domain antibodies are linked by linker fragments.
8-9. (canceled)
10. The CAR according to claim 1, wherein the transmembrane domain comprises a polypeptide from a protein selected from: ?, ? or ? chains of T cell receptors, CD28, CD3e, CD45, CD4, CD5, CD8?, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, and CD154; the co-stimulatory domain comprises a polypeptide selected from the following proteins: CD28, 4-1BB, OX-40 and ICOS; and/or the intracellular signaling domain comprises a signaling domain derived from CD3?.
11-15.(canceled)
16. The CAR according to claim 1, wherein the CAR further comprises a hinge region linking the CD5 binding domain and the transmembrane domain, and/or the CAR is further linked to a CD8? signal peptide.
17-22. (canceled)
23. The CAR according to claim 1, wherein the CAR is further linked to a truncated EGFR molecule (tEGFR) through the cleaving peptide and a CSF2RA signal peptide.
24-25. (canceled)
26. An isolated nucleic acid molecule encoding the CAR according to claim 1.
27. (canceled)
28. A vector comprising the nucleic acid molecule claim 26.
29. (canceled)
30. An immune effector cell comprising the CAR according to claim 1.
31. The cell according to claim 30, wherein CD5 is not expressed on the immune effector cell.
32. The cell according to claim 30, wherein the immune effector cell is selected from T lymphocyte and natural killer (NK) cell.
33. (canceled) 34 A pharmaceutical composition comprising the immune effector cell of claim 30 and a pharmaceutically acceptable adjuvant.
35. (canceled)
36. A method for treating a disease or a condition associated with the expression of CD5, comprising administering a therapeutically effective amount of the immune effector cells according to claim 30 to a patient in need thereof.
37. The method according to claim 36, further comprising further administering an anti-EGFR antibody to the patient in need thereof to inhibit the effect of the immune effector cells or the pharmaceutical composition.
38. The method according to claim 36, wherein the disease or condition associated with the expression of CD5 is cancer or malignant tumor.
39. The method according to claim 36, wherein the disease or condition associated with the expression of CD5 is T lymphoblastic lymphoma or mantle cell lymphoma.
40. An immune effector cell comprising the CAR according to claim 3.
41. A method for treating a disease or a condition associated with the expression of CD5, comprising administering a therapeutically effective amount of the immune effector cells according to claim 40 to a patient in need thereof.
Description
DESCRIPTION OF DRAWINGS
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
DETAILED DESCRIPTION OF THE INVENTION
[0059] The implementation of the invention of the present application will be described in the following specific examples, and those skilled in the art can easily understand other advantages and effects of the invention of the present application from the content disclosed in the specification. The CAR of the present application can specifically bind to CD5, the CAR-T cells made by using the CAR can stably express the CAR, and the CAR-T cells made by using the CAR have a higher
[0060] CAR-positive rate. In addition, the CAR can promote the release of cytokines and can be used to treat diseases or conditions associated with the expression of CD5.
[0061] The implementation of the present application will employ, unless expressly indicated to the contrary, conventional methods of chemistry, biochemistry, organic chemistry, molecular biology, microbiology, recombinant DNA techniques, genetics, immunology and cell biology in the art.
[0062] Descriptions of these methods can be found, for example, in Sambrook et al., Molecular Cloning: A Laboratory Manual (3rd Edition, 2001); Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Edition, 1989); Maniatis et al., Molecular Cloning: A Laboratory Manual (1982); Ausubel et al., Current Protocols in Molecular Biology (John Wiley and Sons, updated in July 2008); Short Protocols in Molecular Biology: A Compendium of Methods from Current Protocols in Molecular Biology, Greene Pub. Associates and Wiley-Interscience; Glover, DNA Cloning: A Practical Approach, vol. I&II (IRL Press, Oxford, 1985); Anand, Techniques for the Analysis of Complex Genomes, (Academic Press, New York, 1992); Transcription and Translation (B. Hames & S. Higgins, Eds., 1984); Perbal, A Practical Guide to Molecular Cloning (1984); Harlow and Lane, Antibodies, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1998) Current Protocols in Immunology QEColigan, A. M. Kruisbeek, D. H. Marg?Lies, E. M. Shevach and W. Strober, eds., 1991); Annual Review of Immunology; and journal monographs such as Advances in Immunology.
[0063] Unless otherwise defined, all technical and scientific terms used herein have the meaning as commonly understood by one of ordinary skill in the art. For the purposes of the present application, the following terms are defined below.
[0064] In the present application, the term chimeric antigen receptor (CAR) is a fusion protein of the variable region of a single-chain antibody and a T cell signaling molecule. It allows T-cells to recognize specific antigens in a non-MHC-restricted manner and exert cytotoxicity. CAR is the core component of chimeric antigen receptor T cells (CAR-T), which can comprise a tumor-associated antigen (TAA) binding region, a transmembrane domain, a co-stimulatory domain and an intracellular signaling domain, and a hinge region may be further included between the tumor-associated antigen binding region and the transmembrane domain. In the present application, the CAR can be a genetically engineered chimeric protein capable of redirecting the cytotoxicity of immune effector cells to T-cells, which combines antibody-based antigen (such as CD5) specificity with T-cell receptor activation intracellular domains together. T-cells genetically modified to express CAR can specifically recognize and eliminate malignant cells expressing target antigens. For descriptions of CAR and CAR T-cells, see, for example, Sadelain M, Brentjens R, Rivi'ere I. The basicprinciples of chimeric antigen receptor design. Cancer Discov. 2013;3(4):388-398; Turtle C J, Hudecek M, Jensen M C, Riddell S R. Engineered T cells for anti-cancer therapy. Curr Opin Immunol. 2012;24(5):633-639; Dotti G, Gottschalk S, Savoldo B, Brenner M K. Design and development of therapies using chimeric antigen receptor-expressing T cells. Immunol Rev. 2014;257(1): 107-126; and WO2013154760, WO2016014789.
[0065] In the present application, the term CD5 is a type I transmembrane glycosylated protein that plays an important role in the negative regulation of T cell receptor signaling and promotes the survival of normal and malignant lymphocytes. CD5 is one of the characteristic surface markers of malignant T-cell tumors, and 80% of T-cell acute lymphoblastic leukemia (T-ALL) and peripheral T-cell lymphomas express CD5. In the present application, the CD5 may be human CD5 with GenBank accession number being NM_014207.4. CD5 proteins may also include fragments of CD5, such as the extracellular domain and fragments thereof.
[0066] In the present application, the term CD5 binding domain generally refers to the extracellular domain of CD5 CAR, which can specifically bind to an antigen. For example, the CD5 extracellular binding domain may comprise a chimeric antigen receptor capable of specifically binding to a CD5 polypeptide expressed on a human cell, an anti-CD5 antibody or an antigen-binding fragment thereof. The terms binding domain, extracellular domain, extracellular binding domain, antigen-specific binding domain and extracellular antigen-specific binding domain are used interchangeably in the present application, and a CAR with the ability to specifically bind to a target antigen of interest (such asCD5) is provided. The CD5 binding domain may be of natural, synthetic, semi-synthetic or recombinant origin.
[0067] In the present application, the term antibody generally refers to a polypeptide molecule capable of specifically recognizing and/ or neutralizing a specific antigen. For example, an antibody may comprise an immunoglobulin composed of at least two heavy (H) chains and two light (L) chains inter-linked by disulfide bonds, and includes any molecule comprising an antigen-binding portion thereof. The term antibody includes monoclonal antibodies, antibody fragments or antibody derivatives, including but not limited to human antibodies, humanized antibodies, chimeric antibodies, single-domain antibodies (e.g., sdAb), single-chain antibodies (e.g., scFv). In the present application, the fragment of an antibody may refer to an antigen-binding fragment of an antibody, for example, Fab, Fab and (Fab).sub.2 fragments and the like. The term antibody also includes all recombinant forms of antibodies, such as antibodies expressed in prokaryotic cells, nonglycosylated antibodies, and any antigen-binding antibody fragments and derivatives thereof. Each heavy chain can be composed of a heavy chain variable region (VH) and a heavy chain constant region. The VH regions can be further distinguished into hypervariable regions called complementarity determining regions (CDRs), which are interspersed in more conserved regions called framework regions (FRs). Each VH can be composed of three CDRs and four FR regions, which can be arranged in the following order from the amino terminus to the carboxyl terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. The variable region of the heavy chain comprises a binding domain that interacts with the antigen. The constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells (e.g., effector cells) of the immune system and the first component (Clq) of the classical complement system.
[0068] In the present application, the term single-domain antibody may also be called sdAb, which refers to an antibody consisting of a single chain of heavy chain variable regions or heavy chain variable regions linked by a linker peptide.
[0069] In the present application, the term transmembrane domain generally refers to a domain in CAR that passes through the cell membrane, which is linked to the intracellular signaling domain and plays a role in transmitting signals. In the present invention, the transmembrane domain may be a CD8? transmembrane domain.
[0070] In the present application, the term co-stimulatory domain generally refers to an intracellular domain that can provide immune co-stimulatory molecules, which are cell surface molecules required for an effective response of lymphocytes to antigens. The co-stimulatory domain may include the co-stimulatory domain of CD28, and may also include the co-stimulatory domain of the TNF receptor family, such as the co-stimulatory domain of OX40 and 4-1BB.
[0071] In the present application, the term hinge region generally refers to the linking region between the antigen binding region and the immune cell Fc receptor (FcR) binding region. In the present invention, the hinge region may be a CD8? hinge region.
[0072] In the present application, the term intracellular signaling domain generally refers to the component of CAR located inside the cell for signal transduction, which comprises a signaling domain and a domain that specifically binds to the receptor component. For example, it may be selected from CD3? intracellular domain, CD28 intracellular domain, CD28 intracellular domain, 4-1BB intracellular domain and OX40 intracellular domain.
[0073] In the present application, the term CD8? signal peptide generally refers to a short (5-30 amino acids in length) peptide chain that guides the transfer of newly synthesized proteins to the secretory pathway.
[0074] In the present application, the term cleaving peptide refers to self-cleaving 2Apeptides, which can realize the function of cleaving proteins through ribosome jumping instead of proteolytic hydrolysis, and may include T2A, F2A and P2A, etc.
[0075] In the present application, the term marker detection signal generally refers to a gene, protein or other molecule with known function or sequence that can function as a specific marker and emit a detectable signal. The marker detection signal can be a fluorescent protein, such as: GFP, RFP, YFP. The marker detection signal can be EGFRt. The terms EGFRt and tEGFR are used interchangeably in the present invention and refer to a gene encoding a truncated human epidermal growth factor receptor polypeptide, which lacks the distal membrane EGF binding domain and cytoplasmic signaling tail, but retains extracellular epitopes recognized by anti-EGFR antibodies. EGFRt can be used as a non-immunogenic selection tool as well as a tracking marker capable of genetically modifying cells. In the present application, it can be used as a marker molecule for CAR-T cells to clear the ADCC pathway mediated by anti-EGFR antibodies (such as cetuximab) (cetuximab mediated ADCC pathway) of CAR-T cells in vivo when necessary (see U.S. Pat. No. 8802374B2), that is, it can be used as a safety switch in clinical transformation.
[0076] In the present invention, the term CSF2RA signal peptide, that is, the colony stimulating factor 2 receptor subunit alpha signal peptide, is a peptide chain that can guide the expression of newly synthesized proteins on the surface of CAR-T cells.
[0077] In the present application, anti-EGFR antibody refers to antibodies that can trigger antibody-dependent cell-mediated cytotoxicity to allow immune cells to attack CAR-T cells with truncated epidermal growth factor receptor (EGFRt), to assist in the removal of CAR-T cells. The anti-EGFR antibody can be used when patients have severe adverse reactions after infusion of CAR-T or other situations that require removal of CAR-T cells. It can assist in the removal of CAR-T cells and alleviate symptoms related to CAR-T treatment. The anti-EGFR antibodies include, but are not limited to, cetuximab, panitumumab, necituzumab and nimotuzumab.
[0078] In the present application, sequence identity generally refers to the degree to which sequences are identical on a nucleotide-by-nucleotide or amino-acid-by-amino acid basis over a comparison window. Percent sequence identity can be calculated as follows: two optimally aligned sequences are compared over a comparison window to determine the number of positions with the same nucleic acid bases (e.g., A, T, C, G, I) or the same amino acid residues (e.g., Ala, Pro, Ser, Thr, Gly, Val, Leu, Ile, Phe, Tyr, Trp, Lys, Arg, His, Asp, Glu, Asn, Gln, Cys and Met) to obtain the number of matching positions, the number of matching positions is divided by the total number of positions in the comparison window (i.e., window size), and the result is multiplied by 100 to yield the percent sequence identity. Optimal alignment for purposes of determining percent sequence identity can be achieved in various ways known in the art, for example, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared or over a region of sequence of interest.
[0079] The term functional variant of a protein or polypeptide sequence in the present application refers to a sequence having amino acid changes compared to the parent sequence by one or more, such as 1-30, or 1-20 or 1-10, such as 1 or 2 or 3 or 4 or 5 amino acid substitutions, deletions and/or insertions. Functional variants substantially retain the biological properties of the protein or polypeptide sequence before the change. In one aspect, the present application encompasses variants of any protein or polypeptide sequence of the present application. In some embodiments, a functional variant of a protein or polypeptide sequence retains at least 60%, 70%, 80%, 90%, or 100% of the biological activity of the pre-altered parent. The functional variants described in the present invention may be functional variants of signal peptide, antibody, hinge region, transmembrane domain, co-stimulatory domain, intracellular signaling domain, cleaving peptide, CSF2RA signal peptide, and EGFRt. When referring to a functional variant of an antibody, it also includes functional variants of antibody variable regions (such as VH or VL), antibody constant regions (such as CH or CL), heavy chain CDR regions (HCDR1, HCDR2 or HCDR3), light chain CDR regions (LCDRI, LCDR2 or LCDR3) etc. Amino acid substitutions, deletions and/or insertions may occur in either the heavy chain CDR region or the light chain CDR region, or the heavy chain FR region or the light chain FR region, or the heavy chain constant region or the light chain constant region, wherein the variant substantially retains the biological properties of the antibody molecule before change. For antibodies, biological activities include, for example, antigen binding ability. In some embodiments, functional variants of antibodies comprise amino acid changes that do not result in the antibody variant losing binding to the antigen, but optionally confer properties such as increased affinity for the antigen and different effector functions. It is understood that the heavy chain variable region or light chain variable region, or each CDR region of the antibody can be altered individually or in combination. In some embodiments, there are no more than 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid changes in one or more or all three heavy chain CDRs. In some embodiments, the amino acid changes may be amino acid substitutions, such as conservative substitutions. In some embodiments, the functional variant has at least 80%, 85%, 90% or 95% or 99% or higher amino acid identity to the parent. Similarly, a functional variant of a nucleic acid molecule in the present application refers to a nucleic acid molecule that encodes the same amino acid sequence as the parent nucleic acid molecule.
[0080] In the present application, the term isolated generally refers to an antibody that has been separated from components in its natural environment. In some embodiments, antibodies are purified to have a purity of greater than 95% or 99% as determined by, for example, electrophoresis (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatography (e.g., ion exchange or reversed-phase HPLC). For a review of methods for assessing antibody purity, see Flatman, S. et al., J.Chrom.B 848 (2007) 79-87.
[0081] In the present application, the term nucleic acid molecule generally refers to an isolated form of nucleotides, deoxyribonucleotides or ribonucleotides or analogs thereof of any length isolated from their natural environment or artificially synthesized. The nucleic acid molecules described in the present application can be isolated. For example, it may be produced or synthesized by the following methods: (i) it is amplified in vitro, such as by polymerase chain reaction (PCR) amplification, (ii) it is recombinantly produced by cloning, (iii) it is purified, for example, by enzymatic digestion and fractionation by gel electrophoresis, or (iv) it is synthesized, for example, by chemical synthesis. In some embodiments, the isolated nucleic acid is a nucleic acid molecule prepared by recombinant DNA techniques. In the present application, nucleic acids encoding the antibodies or antigen-binding fragments thereof can be prepared by various methods known in the art, including, but not limited to, overlap extension PCR operated using restriction fragments or using synthetic oligonucleotides, the specific operations of which can be found in Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989; and Ausube et al., Current Protocols in Molecular Biology, Greene Publishing and Wiley-Interscience, New York N.Y., 1993.
[0082] In the present application, the term vector generally refers to a nucleic acid molecule capable of self-replicating in a suitable host for transferring the inserted nucleic acid molecule into and/or between host cells. The vectors may include vectors mainly used for inserting DNA or RNA into cells, vectors mainly used for replicating DNA or RNA, and vectors mainly used for expression of transcription and/or translation of DNA or RNA. The vector also includes a vector having various functions as described above. The vector may be a polynucleotide capable of being transcribed and translated into a polypeptide when introduced into a suitable host cell. Generally, the vector can produce the desired expression product by culturing an appropriate host cell comprising the vector. In the present application, one or more nucleic acid molecules may be included in the vector. In addition, other genes may be included in the vector, such as marker genes that allow selection of the vector in appropriate host cells and under appropriate conditions. In addition, the vector may also comprise expression control elements that permit proper expression of the coding region in an appropriate host. Such control elements are well known to those skilled in the art, and may include, for example, promoters, ribosome binding sites, enhancers, and other control elements that regulate gene transcription or mRNA translation. In some embodiments, the expression control sequences are regulatable elements. The specific structure of the expression control sequence may vary depending on the species or the function of cell type, but generally includes 5 non-transcribed sequences and 5 and 3 non-translated sequences involved in the initiation of transcription and translation, respectively, such as TATA box, capping sequence, and CAAT sequence. For example, the 5 non-transcribed expression control sequence may comprise a promoter region which may comprise a promoter sequence for transcriptional control of the functionally linked nucleic acid. The vectors described herein may be selected from plasmids, retroviral vectors and lentiviral vectors. The plasmids, retroviral vectors and lentiviral vectors described in the present application may comprise CAR.
[0083] In the present application, the term plasmid generally refers to DNA molecules other than chromosomes or nucleoids in organisms such as bacteria and yeast, which exists in the cytoplasm and has the ability to replicate autonomously, enabling it to remain a constant number of copies in daughter cells and express the genetic information carried. Plasmids are used as vectors of genes in genetic engineering research.
[0084] In the present application, the term retroviral vector generally refers to a type of RNA virus whose genetic information is stored on ribonucleic acid, and most of these viruses have reverse transcriptase. Retroviruses comprises at least three genes: gag, a gene for the proteins that make up the center and structure of the virus; pol, a gene for reverse transcriptases; and env, a gene for the virus coat. Through retroviral transfection, the retroviral vector can randomly and stably integrate its own genome and the foreign genes it carries into the host cell genome, for example, it can integrate CAR molecules into the host cell.
[0085] In the present application, the term lentiviral vector generally refers to a type of diploid RNA viral vector belonging to retroviruses. The lentiviral vector is based on the genome of the lentivirus, and it is a vector prepared by removing a plurality of sequence structures related to viral activity to make it biologically safe, and then introducing the sequence and expression structure of a target gene required for the experiment into the genome backbone. Compared to other retroviruses, lentiviral vectors have a wider range of hosts, and have the ability to infect both dividing and non-dividing cells. For some cells that are difficult to transfect, such as primary cells, stem cells, and undifferentiated cells, it can greatly improve the transduction efficiency of the target gene (see Chen Chen and Wan Haisu, Lentiviral vectors and their research progress, Chinese Journal of Lung Cancer 17.12 (2014): 870-876. PMC). Through lentiviral vector transfection, the retroviral vector can randomly and stably integrate its own genome and the foreign genes it carries into the host cell genome, for example, it can integrate CAR molecules into the host cell.
[0086] In the present application, the term transposon generally refers to a discrete segment of DNA comprising a transposase gene, flanked by terminal inverted repeats (TIRs) comprising transposase binding sites. Transposases can bind to TIRs and transfer the transposon to a new site. The transposon of the present application is a two-component system consisting of a plasmid carrying CAR (transposon) and another plasmid carrying a transposase. The transposon can be introduced into target cells by means of electrotransduction and the like. For example, first, the two components are electroporated into peripheral blood mononuclear cells (PBMCs), and the expressed transposase acts on the terminal inverted repeats (TIRs) on both sides of CAR to cleave the CAR (transposon), which then integrated into the TA dinucleotide sequence in the genome of the target cell (e.g., T-cell). After transposition and stable genome integration are completed, the CAR protein can be expressed on the surface of the target cell (see Cheng Zhang, Jun Liu, Jiang F Zhong, et al. Engineering CAR-T cells. Biomarker Research. 2017, 5:22).
[0087] In the present application, the term gene editing generally refers to the technology of site-directed modification of the genome, which may include technologies based on zinc finger nucleases (ZFNs), transcription activator like effector nucleases (TALENs), clustered regularly interspaced short palindromic repeats/CRISPR-associated protein (Cas9) (CRISPR/Cas9) and other technologies. It enables highly efficient targeted modification of the genome by adding, removing or changing genetic material at specific locations in the genome. The gene editing described in the present application may include introducing CAR molecules into the genome of recipient cells through gene editing techniques (such as CRISPR-Cas9).
[0088] In the present application, the term immune effector cell generally refers to immune cells involved in clearing foreign antigens and performing effector functions in an immune response. It includes, for example, plasma cells, cytotoxic T-cells, NK cells, APSC pluripotent cells, mast cells, etc.
[0089] In the present application, the term pharmaceutically acceptable adjuvant generally refers to a pharmaceutically acceptable formulation carrier, solution or additive that enhances the properties of the formulation. Such additives are well known to those skilled in the art.
[0090] In the present application, the term cancer generally refers to or describes a physiological condition in mammals that is typically characterized by dysregulation of cell proliferation or survival. In the present application, hyperproliferative diseases referred to as cancer include, but are not limited to, solid tumors such as cancers occurring in the breast, respiratory tract, brain, reproductive organs, digestive tract, urinary tract, eye, liver, skin, head and neck, thyroid, parathyroid, and their distant metastases. Such diseases also include lymphomas, sarcomas, and leukemias. Examples of breast cancer include, but are not limited to, invasive ductal carcinoma, invasive lobular carcinoma, ductal carcinoma in situ, and lobular carcinoma in situ. Examples of cancers of the respiratory tract include, but are not limited to, small cell lung cancer and non-small cell lung cancer, as well as bronchial adenoma and pleuropulmonary blastoma. Examples of brain cancers include, but are not limited to, brainstem and hypothalamus keratomas, cerebellar and cerebral astrocytomas, medulloblastomas, ependymomas, and neuroectodermal and pineal tumors. Tumors of the male genitalia include, but are not limited to, prostate and testicular cancers. Tumors of the female genitalia include, but are not limited to, cancers of the endometrium, cervix, ovary, vagina, and vulva, and uterine tumors. Tumors of the respiratory tract include, but are not limited to, cancers of the anus, colon, colorectum, esophagus, gallbladder, stomach, pancreas, rectum, small intestine, and salivary glands. Tumors of the urethra include, but are not limited to, cancers of the bladder, penis, kidney, renal pelvis, ureter, and urethra. Eye cancers include, but are not limited to, intraocular melanoma and retinoblastoma. Examples of liver cancer include, but are not limited to, hepatocellular carcinoma (hepatocellular carcinoma with or without the fibrolamellar variation), cholangiocarcinoma (intrahepatic cholangiocarcinoma), and mixed hepatocellular cholangiocarcinoma. Skin cancers include, but are not limited to, squamous cell carcinoma, Kaposi's sarcoma, malignant melanoma, Merkel cell skin cancer, and non-melanoma skin cancer. Head and neck cancers include, but are not limited to, cancers of the larynx/hypopharynx/nasopharynx/oropharynx, and cancers of the lips and mouth. Lymphatic cancers include, but are not limited to, AIDS-related lymphoma, non-Hodgkin's lymphoma, cutaneous T-cell lymphoma, Hodgkin's disease, and central nervous system lymphoma. Sarcomas include, but are not limited to, soft tissue sarcomas, osteosarcomas, malignant fibrous histiocytomas, lymphosarcomas, and rhabdomyosarcomas. Leukemias include, but are not limited to, acute myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, chronic myeloid leukemia, and hairy cell leukemia.
[0091] The term and/or should be understood as meaning any one of the alternatives or both of the alternatives.
[0092] As used in the present application, the term comprising or including means including stated elements, integers or steps, but not excluding any other elements, integers or steps. In the present application, when the term comprising or including is used, unless otherwise specified, situations consisting of the mentioned elements, integers or steps are also covered. For example, when referring to comprising the antibody variable region of a particular sequence, it is also intended to encompass an antibody variable region that consists of that particular sequence.
[0093] In the present application, the term about usually refers to a change in the range of 0.5%-10% above or below the specified value, such as a change in the range of 0.5%, 1%, 1.5%, 2%, 2.5%, 3%, 3.5%, 4%, 4.5%, 5%, 5.5%, 6%, 6.5%, 7%, 7.5%, 8%, 8.5%, 9%, 9.5%, or 10% above or below the specified value.
Chimeric Antigen Receptor
[0094] In the present application, the CAR may comprise an extracellular domain specifically binding to CD5, a transmembrane domain, an intracellular co-stimulatory signaling domain, and an intracellular signaling domain. In the present application, the extracellular domain of the CAR may comprise a single-domain antibody (VHH), two or more single-domain antibodies in tandem (2xVHH) of the present invention. For example, the single-domain antibody can be linked to the transmembrane domain via a hinge region, such as the CD8? hinge. In the present application, the CAR can be used to transduce immune effector cells (such as T-cells) and expressed on the cell surface. Therefore, the present application can also provide T-cells expressing the chimeric antigen receptor, and the use of the T-cells and/or the CAR in the preparation of drugs for treating CD5-related diseases.
[0095] In the present application, the chimeric antigen receptor (CAR) may comprise a CD5 binding domain, a transmembrane domain, a co-stimulatory domain and an intracellular signaling domain. In the present application, the CD5 binding domain may comprise an antibody or fragment thereof specifically binding to CD5, and the antibody may comprise a heavy chain complementarity determining region 1 (HCDR1), a heavy chain complementarity determining region 2 (HCDR2) and a heavy chain complementarity determining region 3 (HCDR3), the amino acid sequences of HCDR1-3 are as set forth in SEQ ID NOs: 38-43, 64-69. In the present application, the antibody comprises a heavy chain variable region, and the amino acid sequence of the heavy chain variable region is as set forth in SEQ ID No: 33, 35, 37, 47, 57, 59, 61 or 63.
[0096] In the present application, the antibody may be a single-domain antibody. In some embodiments, the antibody may comprise an amino acid sequence as set forth in SEQ ID No: 33, 35, 37, 47, 57, 59, 61 or 63 or a functional variant thereof. For example, the single-domain antibody may include FHVH1 sdAb, the sequence of which is as set forth in SEQ ID No: 33; the single-domain antibody may include FHVH3 sdAb, the sequence of which is as set forth in SEQ ID No: 35; the single-domain antibody may include FHVH3VH1 sdAb, the sequence of which is as set forth in SEQ ID No: 37; the single-domain antibody may include FHVHIVH3 sdAb, the sequence of which is as set forth in SEQ ID No: 47; the single-domain antibody may include FHVH2 sdAb, the sequence of which is as set forth in SEQ ID No: 57; the single-domain antibody may include FHVH4 sdAb, the sequence of which is as set forth in SEQ ID No: 59; the single-domain antibody may include FHVH2VH1 sdAb, the sequence of which is as set forth in SEQ ID No: 61; the single-domain antibody may include FHVH4VH1 sdAb, the sequence of which is as set forth in SEQ ID No: 63.
[0097] For example, the single-domain antibody described in the present application can be FHVHI sdAb, the sequence of which is as set forth in SEQ ID No: 33, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH1 are respectively as set forth in SEQ ID No: 38, SEQ ID No: 39 and SEQ ID No: 40; the single-domain antibody may include FHVH3 sdAb, the sequence of which is as set forth in SEQ ID No: 35, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH3 are respectively as set forth in SEQ ID No: 41, SEQ ID No: 42 and SEQ ID No: 43; the single-domain antibody may include FHVHIVH3 sdAb, the sequence of which is as set forth in SEQ ID No: 37, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVHIVH3 are respectively as set forth in SEQ ID No: 38, SEQ ID No: 39, SEQ ID No: 40, SEQ ID No: 41, SEQ ID No: 42 and SEQ ID No: 43. The single-domain antibody may include FHVH3VH1 sdAb, the sequence of which is as set forth in SEQ ID No: 37, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH3VH1 are respectively as set forth in SEQ ID No: 38, SEQ ID No: 39, SEQ ID No: 40, SEQ ID No: 41, SEQ ID No: 42 and SEQ ID No: 43.
[0098] For example, the single-domain antibody described in the present application can be FHVH2 sdAb, the sequence of which is as set forth in SEQ ID No: 57, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH2 are respectively as set forth in SEQ ID No: 64, SEQ ID No: 65 and SEQ ID No: 66; the single-domain antibody may include FHVH4 sdAb, the sequence of which is as set forth in SEQ ID No: 59, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH4 are as respectively set forth in SEQ ID No: 67, SEQ ID No: 68 and SEQ ID No: 69; the single-domain antibody may include FHVH2VH1 sdAb, the sequence of which is as set forth in SEQ ID No: 61, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH2VH1 are respectively as set forth in SEQ ID No: 64, SEQ ID No: 65, SEQ ID No: 66, SEQ ID No: 38, SEQ ID No: 39 and SEQ ID No: 40. The single-domain antibody may include FHVH4VH1 sdAb, the sequence of which is as set forth in SEQ ID No: 63, and the amino acid sequences of HCDR1-3 of the single-domain antibody FHVH4VH1 are respectively as set forth in SEQ ID No: 67, SEQ ID No: 68, SEQ ID No: 69, SEQ ID No: 38, SEQ ID No: 39 and SEQ ID No: 40.
[0099] The CAR described in the present application may comprise a transmembrane domain, and the transmembrane domain may comprise a polypeptide from a protein selected from the group consisting of: a, B or (chains of T cell receptors, CD28, CD3e, CD45, CD4, CD5, CD8?, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, and CD154. In the present application, the transmembrane domain may comprise an amino acid sequence as set forth in SEQ ID No: 6 or a functional variant thereof. For example, the transmembrane domain of the present application may include CD8?, the sequence of which is as set forth in SEQ ID No: 6.
[0100] In the present application, the co-stimulatory domain may comprise a polypeptide from a protein selected from the group consisting of: CD28, 4-1BB, OX40 and ICOS. In the present application, the co-stimulatory domain may comprise an amino acid sequence as set forth in SEQ ID No: 8 or a functional variant thereof.
[0101] The CAR described in the present application can include an intracellular signaling domain, which can comprise a signaling domain derived from CD3?. In the present application, the intracellular signaling domain may comprise an amino acid sequence as set forth in SEQ ID No: or a functional variant thereof.
[0102] The CAR of the present application may include a hinge region, and the hinge region may link the antibody and the transmembrane domain. In the present application, the hinge region may comprise an amino acid sequence as set forth in SEQ ID No: 4 or a functional variant thereof.
[0103] The CAR of the present application may include a signal peptide, for example, the signal peptide may be located at the N-terminus of the extracellular domain that specifically binds to CD5. The signal peptide may comprise an amino acid sequence as set forth in SEQ ID No: 2 or a functional variant thereof. For example, the signal peptide can be a CD8? signal peptide, the sequence of which is as set forth in SEQ ID No: 2.
[0104] In the present application, the CAR can also be linked to a cleaving peptide. In the present application, the cleaving peptide may comprise an amino acid sequence derived from a T2A peptide. In the present application, the cleaving peptide may comprise an amino acid sequence as set forth in SEQ ID No: 12 or a functional variant thereof. For example, the cleaving peptide can be T2A, the sequence of which is as set forth in SEQ ID No: 12.
[0105] In the present application, the CAR can also be linked to an EGFRt fragment, and the EGFRt fragment can be used for signal detection, or used as a molecular switch for CAR-T cells. In the present application, the CAR may comprise an amino acid sequence as set forth in SEQ ID No: 27, 29, 31, 45, 49, 51, 53 or 55, or a functional variant thereof. For example, the CAR can be selected from FHVH1 CAR, the sequence of which is as set forth in SEQ ID No: 27. For another example, the CAR can be selected from FHVH3 CAR, the sequence of which is as set forth in SEQ ID No: 29; the CAR can be selected fromFHVH3VH1 CAR, the sequence of which is as set forth in SEQ ID No: 31. The CAR can be selected from FHVHIVH3 CAR, the sequence of which is as set forth in SEQ ID No: 45. The CAR can be selected from FHVH2 CAR, the sequence of which is as set forth in SEQ ID No: 49; the CAR can be selected from FHVH4 CAR , the sequence of which is as set forth in SEQ ID No: 51; the CAR can be selected from FHVH2VH1 CAR, the sequence of which is as set forth in SEQ ID No: 53; and the CAR can be selected from FHVH4VH1 CAR, the sequence of which is as set forth in SEQ ID No: 55.
[0106] In some embodiments, the CAR of the present application may sequentially comprise a CD5 binding domain, a transmembrane domain, a co-stimulatory domain, and an intracellular signaling domain from the N-terminus. Among others, the CAR may include a CD5 binding domain, and the sequence of the CD5 binding domain is as set forth in SEQ ID No: 33, 35. Among others, the CD5 binding domain may include HCDR1-3, the sequences of which are sequentially as set forth in SEQ ID No: 38-40; and the CD5 binding domain may include another group of HCDR1-3, the sequences of which are sequentially as set forth in SEQ ID No: 41-43. The CAR may include FHVH3VH1 CAR or the CAR of the present application having the same two sets of HCDR1-3. The CD5 binding domain includes a tandem heavy chain variable region, the sequence of which is as set forth in SEQ ID No: 37 or 47, wherein the heavy chain variable region may include HCDR1-3, the sequences of which are sequentially set forth in SEQ ID No: 38-40, and the CD5 binding domain may include another group of HCDR1-3, the sequence of which are sequentially as set forth in SEQ ID No: 41-43.
[0107] In some embodiments, the CAR of the present application may sequentially comprise a CD5 binding domain, a transmembrane domain, a co-stimulatory domain, and an intracellular signaling domain from the N-terminus. Among others, the CAR may include a CD5 binding domain, and the sequence of the CD5 binding domain is as set forth in SEQ ID No: 57, 59. Among others, the CD5 binding domain may include HCDR1-3, the sequences of which are sequentially as set forth in SEQ ID No: 64-66; and the CD5 binding domain may include another group of HCDR1-3, the sequences of which are sequentially as set forth in SEQ ID No: 67-69. The CD5 binding domain includes a tandem heavy chain variable region, the sequence of which is as set forth in SEQ ID No: 61 or 63, wherein the heavy chain variable region may include HCDR1-3, the sequences of which are sequentially as set forth in SEQ ID No: 64-66, 38-40, and the CD5 binding domain may include another group of HCDR1-3, the sequence of which are sequentially as set forth in SEQ ID No: 67-69, 38-40.
[0108] A linker peptide may also be included between the heavy chain variable regions, the sequence of which is as set forth in SEQ ID No: 25. For example, the CAR may include FHVH3VH1 CAR, FHVH1VH3 CAR, FHVH2VH1 CAR, FHVH4VH1 CAR or the CAR of the present application having the same linker peptide. The transmembrane domain may include a transmembrane domain derived from CD8?, and its sequence may be as set forth in SEQ ID No: 6. For example, the CAR may include FHVH3VH1 CAR, FHVHIVH3 CAR, FHVH2VH1 CAR, FHVH4VH1 CAR or the CAR of the present application having the same transmembrane domain. The co-stimulatory domain may comprise a co-stimulatory structure from 4-1BB, and its sequence may be as set forth in SEQ ID No: 8. For example, the CAR may include FHVH3VH1 CAR, FHVHIVH3 CAR, FHVH2VH1 CAR, FHVH4VH1 CAR or the CAR of the present application having the same co-stimulatory domain. The intracellular signaling domain may comprise a signaling domain derived from CD35, the sequence of which is as set forth in SEQ ID No: 10. For example, the CAR may include FHVH3VH1 CAR, FHVHIVH3 CAR, FHVH2VH1 CAR, FHVH4VH1 CAR or the CAR of the present application having the same intracellular signaling domain. The CAR may also comprise a hinge region, which may be located at the C-terminus of the CD5 binding domain and at the N-terminus of the transmembrane domain, and its sequence may be as set forth in SEQ ID No: 4, for example. For example, the CAR may include FHVH3VH1 CAR, FHVHIVH3 CAR, FHVH2VH1 CAR, FHVH4VH1 CAR or the CAR of the present application having the same hinge region. The CAR can also be linked to a signal peptide, which can be located at the N-terminal of the CAR, and its sequence can be as set forth in SEQ ID No: 2.
[0109] The CAR can also be linked to a cleaving peptide, for example: T2A. The cleaving peptide may be located at the C- terminus of the intracellular signaling domain, and its sequence may be as set forth in SEQ ID No: 12. The CAR can also be linked to the CSF2RA signal peptide, which can be located before EGFRt, and its sequence can be as set forth in SEQ ID No: 14, for example. The CAR can also be linked to a marker detection signal, which can be located at the C-terminus of the CAR (or, the cleaving peptide). The marker detection signal can be selected from the group consisting of: GFP, RFP, YFP or EGFRt, and the sequence of EGFRt can be as set forth in SEQ ID No:16, for example.
[0110] For example, the CAR of the present application can be FHVH3VH1 CAR, the amino acid sequences of its VHH (FHVH1) HCDR1-3 are respectively as set forth in SEQ ID No: 38, SEQ ID No: 39 and SEQ ID No: 40: the amino acid sequence of VHH (FHVH1) is as set forth in SEQ ID No:33: the amino acid sequences of VHH(FHVH3)HCDR1-3 are as set forth in SEQ ID No: 41, SEQ ID No: 42 and SEQ ID No: 43 respectively: the amino acid of VHH(FHVH3) is as set forth in SEQ ID No:35. The sequence of the linker peptide between VHH(FHVH3) and VHH (FHVH1) is as set forth in SEQ ID No: 25: its hinge region is as set forth in SEQ ID No: 4; its transmembrane domain is as set forth in SEQ ID No: 6; its co-stimulatory domain is 4-1BB co-stimulatory domain, as set forth in SEQ ID No: 8; its CD3? intracellular signaling domain is as set forth in SEQ ID No:10. The FHVH3VH1 CAR also comprises a cleaving peptide as set forth in SEQ ID No: 12, a CSF2RA signal peptide as set forth in SEQ ID No: 14, and EGFRt as set forth in SEQ ID No: 16: a CD8? signal peptide as set forth in SEQ ID No:2.
[0111] CD8? For example, the CAR of the present application can be FHVH1 CAR, the amino acid sequences of its VHH(FHVH1)HCDR1-3 are respectively as set forth in SEQ ID No: 38, SEQ ID No: 39 and SEQ ID No: 40: the amino acid sequence of VHH(FHVH1) is as set forth in SEQ ID No:33: its hinge region is as set forth in SEQ ID No: 4; its transmembrane domain is as set forth in SEQ ID No: 6; its co-stimulatory domain is 4-1BB co-stimulatory domain, as set forth in SEQ ID No: 8; its CD3? intracellular signaling domain is as set forth in SEQ ID No:10; the FHVHI CAR also comprises a cleaving peptide as set forth in SEQ ID No: 12, a CSF2RA signal peptide as set forth in SEQ ID No: 14, and EGFRt as set forth in SEQ ID No: 16; and a CD8? signal peptide as set forth in SEQ ID No: 2.
[0112] For example, the CAR of the present application can be FHVH3 CAR, the amino acid sequences of its VHH(FHVH3)HCDR1-3 are respectively as set forth in SEQ ID No: 41, SEQ ID No: 42 and SEQ ID No: 43: the amino acid sequence of VHH(FHVH3) is as set forth in SEQ ID No:35; its hinge region is as set forth in SEQ ID No: 4; its transmembrane domain is as set forth in SEQ ID No: 6; its co-stimulatory domain is 4-1BB co-stimulatory domain, as set forth in SEQ ID No: 8; its CD3? intracellular signaling domain is as set forth in SEQ ID No:10; the FHVH1 CAR also comprises a cleaving peptide as set forth in SEQ ID No: 12, a CSF2RA signal peptide as set forth in SEQ ID No: 14, and EGFRt as set forth in SEQ ID No: 16; and a CD8? signal peptide as set forth in SEQ ID No: 2.
Nucleic Acid, Vector, Cell, Preparation Method and Composition
[0113] In another aspect, the present application provides an isolated nucleic acid molecule which can encode the CAR of the present application. The isolated nucleic acid molecule encoding CAR described in the present application may comprise a nucleic acid sequence selected from the group consisting of SEQ ID No: 1, 3, 5, 7, 9, 11, 13, 15, 17-24, 26, 28, 30, 32, 34, 36, 44, 46, 48, 50, 52, 54, 56, 58, 60, or 62 or a functional variant thereof. The nucleic acid molecules described in the present application can be isolated. For example, it may be produced or synthesized by the following methods: (i) it is amplified in vitro, such as by polymerase chain reaction (PCR) amplification, (ii) it is recombinantly produced by cloning, (iii) it is purified, for example, by enzymatic digestion and fractionation by gel electrophoresis, or (iv) it is synthesized, for example, by chemical synthesis. In some embodiments, the isolated nucleic acid is a nucleic acid molecule prepared by recombinant DNA techniques.
[0114] In another aspect, the present application provides a vector which may comprise the nucleic acid molecule. In the present application, the vector may be selected from one or more of plasmids, retroviral vectors and lentiviral vectors. The lentiviral vector of the present application may comprise CAR. For example, the lentiviral vector described in the present application may comprise a nucleic acid sequence selected from the group consisting of SEQ ID No: 1, 3, 5, 7, 9, 11, 13, 15, 17-24, 26, 28, 30, 32, 34, 36, 44, 46, 48, 50, 52, 54, 56, 58, 60, or 62 or a functional variant thereof. In addition, other genes may be included in the vector, such as marker genes that allow selection of the vector in appropriate host cells and under appropriate conditions. In addition, the vector may also comprise expression control elements that permit proper expression of the coding region in an appropriate host. Such control elements are well known to those skilled in the art, and may include, for example, promoters, ribosome binding sites, enhancers, and other control elements that regulate gene transcription or mRNA translation. In some embodiments, the expression control sequences are regulatable elements. The specific structure of the expression control sequence may vary depending on the species or the function of cell type, but generally includes 5 non-transcribed sequences and 5 and 3 non-translated sequences involved in the initiation of transcription and translation, respectively, such as TATA box, capping sequence, and CAAT sequence. For example, the 5 non-transcribed expression control sequence may comprise a promoter region which may comprise a promoter sequence for transcriptional control of the functionally linked nucleic acid. One or more nucleic acid molecules described in the present application can be operably linked to the expression control element. Such vectors may include, for example, plasmids, cosmids, viruses, phages, or other vectors commonly used in, for example, genetic engineering. For example, the vector is an expression vector, including vector sdAb plasmid and/or CAR plasmid.
[0115] In another aspect, the present application provides an immune effector cell which may comprise the CAR, the nucleic acid molecule, or the vector of the present application. In the present application, the immune effector cells may be mammalian cells. In the present application, the immune effector cells may be selected from T lymphocytes and natural killer (NK) cells. In another aspect, the present application provides a method for preparing immune effector cells, which comprises knocking out the CD5 gene of the immune effector cells, and introducing the vectors of the present application into the immune effector cells. For example, the vectors described herein can be introduced into the immune effector cells, such as T lymphocytes or natural killer (NK) cells. In some embodiments, each type of cell or each cell may comprise one or more of the vectors described in the present application. In some embodiments, each type of cell or each cell may comprise a plurality of (e.g., 2 or more) or a plurality of types of (e.g., 2 types or more) vectors of the present application. In the present application, for introducing the vector into immune effector cells, the vector of the present application can be introduced into the cells by methods known in the art. For example, retroviral vectors can be used to transfect immune effector cells to integrate the viral genome with CAR molecules into the host genome to ensure long-term and stable expression of the target gene. For another example, transposons are introduced into target cells through plasmids carrying CAR (transposon) and plasmids carrying transposase. As another example, CAR molecules can be added to the genome through gene editing (such as CRISPR/Cas9). In the present application, the vector carrying the CAR molecule of the present application can be introduced into the cells by methods known in the art, such as electroporation, liposome transfection (lipofectamine 3000, Invitrogen).
[0116] In another aspect, the present application provides a pharmaceutical composition, which may comprise the immune effector cells and a pharmaceutically acceptable adjuvant. The pharmaceutically acceptable adjuvants may include buffers, antioxidants, preservatives, low molecular weight polypeptides, proteins, hydrophilic polymers, amino acids, sugars, chelating agents, counterions, metal complexes and/or non-ionic surfactants, etc. In the present application, the pharmaceutical composition can be formulated for administration orally, intravenously (for example, intravenous injection, I.V.), intramuscularly (e.g., intramuscular injection, I.M.), in situ at the tumor site, by inhalation, rectally, vaginally, transdermally or via a subcutaneous depot.
Pharmaceutical Use
[0117] In another aspect, the present application provides the use of the CAR, the nucleic acid molecule, the vector, or the immune effector cells in the preparation of a drug, wherein the drug is used to treat a disease or condition associated with the expression of CD5. In the present application, the disease or condition associated with the expression of CD5 is a cancer or malignant tumor. In some embodiments, the cancer or malignancy may be selected from a malignant T-cell tumor or a malignant B-cell tumor. Among them, the malignant T-cell tumor can be selected from T-cell acute lymphoblastic leukemia (T-ALL), T-cell lymphoma (TCL) (such as peripheral T-cell lymphoma, cutaneous T-cell lymphoma (CTCL), T-cell non-Hodgkin's lymphoma (T-NHL)); the malignant B-cell neoplasm may be selected from chronic lymphocytic leukemia (B-CLL) (e.g., hairy cell leukemia (HCL)), mantle cell lymphoma (B-MCL), diffuse large B lymphoma (DLBCL).
[0118] In another aspect, the present application provides the use of the CAR, the nucleic acid molecule, the vector, or the immune effector cells in the treatment of a disease or condition associated with the expression of CD5.
[0119] In another aspect, the present application provides a method for treating a disease or condition associated with the expression of CD5, comprising administering to a patient the CAR, the nucleic acid molecule, the vector, or the immune effector cells.
[0120] Without being limited by any theory, the following examples are only to illustrate the working mode of the chimeric antigen receptor, vector, cell, and composition of the present application, and are not intended to limit the scope of the present invention.
Study Overview
[0121] The researchers use fully human phages for antibody screening to directly obtain fully human monoclonal antibodies. Compared to traditional hybridoma technology, it omits the difficult step of humanizing murine antibody. Moreover, the fully human antibody has lower immunogenicity than humanized murine antibody, and has better potential in the development of CAR-T. After obtaining antibody clones that specifically bind to the cell surface CD5 antigen and CD5 recombinant protein, the applicant conducted in-depth research, constructed these clones and the control clone H65 onto the second-generation CAR structure, and then packaged them with lentivirus and transfected into T cells. At the level of CAR-T cells, fully human CD5 antibody clones and candidate CAR-T molecules with stronger functions than the control clone H65 were screened from the perspectives of target cell activation and cytotoxicity, and target cell stimulation and proliferation.
[0122] In addition, literature reports that in most constructed tumor animal models, re-emerging tumor cells retain CD5 expression, which suggests that tumor recurrence is not due to the loss of antigen, and that failure to eradicate all xenografts is due to the poor persistence of CD5 CAR-T cells in mice14. The experimental results show that CD5 knockout CAR-T cells can expand normally, and maintain cytotoxicity to CD5-positive target cells, while minimizing the self-activation and suicide of CD5 CAR-T, ensuring its persistence and effectiveness in clinical validation.
EXAMPLES
Example 1. CAR-T Cell Antigen Binding Assay and Epitope Competition Experiment
Experimental Purpose and Principle:
[0123] As shown in
Brief Experimental Steps of Cell Antigen Binding Assay
[0124] 1) Take CD5 KO CAR-T transfected with clones H65, FHVH1, and FHVH3 and MOCK T, each 1?10{circumflex over ()}6, centrifuge at 600 g for 5 min at room temperature. After washing twice with PBS, mix with 0.2 ?g of biotinylated CD5 antigen, and incubate at 4? C. in the dark for 30 min. [0125] 2) Wash twice with PBS, add 0.2 ?L/test APC-streptavidin and 5 ?L of PE-EGFR antibody, wash twice with PBS, resuspend with 100 ?L of PBS, and detect by flow cytometry.
Brief Experimental Steps of Epitope Competition Experiment
[0126] 1) Take CD5 KO CAR-T transfected with clones H65, FHVH1, and FHVH3 and MOCK T, each 1?10{circumflex over ()}6, centrifuge at 600 g for 5 min at room temperature. Wash twice with PBS for later use; [0127] 2) Pre-mix 0.5 ?g each of H65 antibody, FHVH3 antibody or FHVH1 antibody with human Fc tag and 0.2 ?g of CD5 antigen, then add to CD5 KO T cells expressing the CAR to be tested respectively, and incubate at 4? C. in the dark for 30 min. [0128] 3) Wash twice with PBS. [0129] 4) Add 2 ?L of APC-human Fc and 5 ?L of PE-EGFR antibody to each well, and incubate at 4? C. in the dark for 30 min. After washing with PBS, resuspend in 100 ?L of PBS, and detect by flow cytometry.
Main Materials and Reagents
[0130] APC anti-human IgG, Fc? fragment specific, Jackson ImmunoResearch, Cat. 109-136-170; [0131] PE anti-human EGFR Antibody, Clone AY13, BioLegend, Cat. No.352904;
Experimental Results
[0132] As shown in the schematic diagram of
Example 2. Preparation and Detection of CD5 KO CAR-T Cells
Experimental Purpose and Principle
[0133] The present application uses lentiviral transfection to make the knockout T cells express CAR. For the CAR-T preparation process, please refer to the patent (Zhou J, Liu J, Hu G, et al. Chimeric antigen receptor (car) binding to bema, and uses thereof: U.S. patent application Ser. No. 16/650,580[P]. 2020-8-6.). The lentiviral vector is based on the genome of the lentivirus, and it is a vector prepared by removing a plurality of sequence structures related to viral activity to make it biologically safe, and then introducing the sequence and expression structure of a target gene required for the experiment into the genome backbone. Compared to other retroviruses, lentiviral vectors have a wider range of hosts, and have the ability to infect both dividing and non-dividing cells. For some cells that are difficult to transfect, such as primary cells, stem cells, and undifferentiated cells, it can greatly improve the transduction efficiency of the target gene (see Chen Chen and Wan Haisu, Lentiviral vectors and their research progress, Chinese Journal of Lung Cancer 17.12 (2014): 870-876. PMC). Through lentiviral vector transfection, CAR molecules can be integrated into host cells.
[0134] T cells were knocked out of CD5 and transfected with a single single-domain clone CAR lentivirus, tandem fully human single-domain clone CAR lentivirus (the structure as shown in
[0135] The sequences of exemplary CAR molecules and antigen recognition portions thereof mentioned herein are shown in Table 1 below.
TABLE-US-00001 TABLE1 ExemplaryCARmoleculesandantigenrecognitionportionsthereof FHVH1CAR: CD8?signalpeptide-FHVH1sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR CDRsofFHVH1sdAb: SEQIDNO:38 HCDR1 GFTFSHSA SEQIDNO:39 HCDR2 IYARGGYT SEQIDNO:40 HCDR3 ARGYHLEYMVSQDV FHVH3CAR: CD8?signalpeptide-FHVH3sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR CDRsofFHVH3sdAb: SEQIDNO:41 HCDR1 GGTFSNYA SEQIDNO:42 HCDR2 ISAYNGDT SEQIDNO:43 HCDR3 ARYESMSGQDI FHVH3VH1CAR: CD8?signalpeptide-FHVH3VH1sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR CDRsofFHVH3VH1sdAb: SEQIDNO:41 HCDR1 GGTFSNYA SEQID HCDR1 GFTFSHSA NO:38 SEQIDNO:42 HCDR2 ISAYNGDT SEQID HCDR2 IYARGGYT NO:39 SEQIDNO:43 HCDR3 ARYESMSGQDI SEQID HCDR3 ARGYHLEYMVSQD NO:40 V CD8?signalpeptide-FHVH1VH3sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR CDRsofFHVH1VH3sdAb: SEQIDNO:38 HCDR1 GFTFSHSA SEQID HCDR1 GGTFSNYA NO:41 SEQIDNO:39 HCDR2 IYARGGYT SEQID HCDR2 ISAYNGDT NO:42 SEQIDNO:40 HCDR3 ARGYHLEYMVS SEQID HCDR3 ARYESMSGQDI QDV NO:43 FHVH2CAR: CD8?signalpeptide-FHVH2sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR CDRsofFHVH2sdAb: SEQIDNO:64 HCDR1 GFTFSSYE SEQIDNO:65 HCDR2 ISSSGSTI SEQIDNO:66 HCDR3 ARVAQREGDV FHVH4CAR: CD8?signalpeptide-FHVH4sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD32--T2A--CSF2RAsignal-tEGFR CDRsofFHVH4sdAb: SEQIDNO:67 HCDR1 GYSFSNHW SEQIDNO:68 HCDR2 VYPGDSDT SEQIDNO:69 HCDR3 ARGGTIDGDYGGRQDF FHVH2VH1CAR: CD8?signalpeptide-FHVH2VH1sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR SEQIDNO:64 HCDR1 GFTFSSYE SEQID HCDR1 GFTFSHSA NO:38 SEQIDNO:65 HCDR2 ISSSGSTI SEQID HCDR2 IYARGGYT NO:39 SEQIDNO:66 HCDR3 ARVAQREGDV SEQID HCDR3 ARGYHLEYMVSQ NO:40 DV FHVH4VH1CAR: CD8?signalpeptide-FHVH4VH1sdAb--CD8?hinge/TM--4-1BBco-stimulatorymolecule-- CD3?--T2A--CSF2RAsignal-tEGFR CDRsofFHVH4VH1sdAb: SEQIDNO:67 HCDR1 GYSFSNHW SEQID HCDR1 GFTFSHSA NO:38 SEQIDNO:68 HCDR2 VYPGDSDT SEQID HCDR2 IYARGGYT NO:39 SEQIDNO:69 HCDR3 ARGGTIDGDYG SEQID HCDR3 ARGYHLEYMVSQ GRQDF NO:40 DV
Experimental Purpose and Principle
[0136] All mature T cells express the CD5 antigen on the surface, while the CD5 CAR-T developed by Mamonkin M and other researchers without CD5 knockout has been reported to have a certain degree of suicide.sup.14 and has a limited duration in the patient's body, which greatly limits the potential of the patient disease remission time and application of the CAR-T product. In order to solve this problem, the present application uses CRISPR/Cas9 technology to knock out the CD5 antigen on the surface of T cells to minimize the self-activation and suicide of CD5 CAR-T, and ensure its persistence and effectiveness.
[0137] The brief experimental steps of CD5 KO T cell preparation process are as follows: [0138] 1) Prepare the sgRNA/Cas9 RNP mixture: calculate the required amount of sgRNA and Cas9 protein according to the amount of cells 1?10{circumflex over ()}6 T cells need to use 30 ?g of Cas9 protein and 20 ug of sgRNA), mix the sgRNA and Cas9 protein gently, and co-incubate at room temperature for 15 min. [0139] 2) Gently mix the incubated sgRNA/Cas9 RNP mixture with T cells and co-incubate at room temperature for 10 min. [0140] 3) Knock off the CD5 antigen of T cells using the voltage and shock time recommended for the electroporator. [0141] 4) Place CD5 KO T cells in fresh rewarmed T cell culture medium, put them back in a 5% carbon dioxide incubator at 37? C., perform lentiviral transfection after 24 h, and detect knockout efficiency and CAR transfection efficiency from the 5th day to the 7th day after the cell state recovers.
[0142] The brief experimental steps of CD5 antigen expression detection and EGFRt expression detection of CAR-T/T cells are as follows: [0143] 1) Take 1?10.sup.6 CAR-T/T cells per well, add PBS to wash the cells once, centrifuge at 300 g for 5 min, and discard the supernatant. [0144] 2) Resuspend the cell pellet in 100 ?L of PBS, add 5 ?L of APC-CD5 antibody and 5 ?L of PE-5 EGFR antibody respectively, and incubate at 4?C for 15 min in the dark. [0145] 3) Wash twice with PBS and centrifuge at 300 g for 5 min. [0146] 4) Resuspend with 200 ?L of PBS, and detect by flow cytometry.
Main Materials and Reagents:
[0147] Chemically synthesized EasyEdit sgRNA, Nanjing GenScript Biotech Co., Ltd .; [0148] sgRNA: gctgtagaactccaccacgc (SEQ ID NO: 70); [0149] TrueCut?M Cas9 Protein v2, thermo, Cat. No.A36498; [0150] APC Mouse Anti-Human CD5 antibody, Clone UCHT2, BD Pharmingen, Cat. No.555355; [0151] PE anti-human EGFR Antibody, Clone AY13, BioLegend, Cat. No.352904; [0152] Fetal bovine serum (FBS), Gibco, Cat. No.10099141.
Experimental Results:
[0153] The CAR-T studied in the present application targets the CD5 target. If the CAR-T cells function well, the CAR-T cells transfected with lentivirus can kill CAR-T/T cells that still express the CD5 antigen. In this experiment, CAR-T cells could clear the cells without CD5 knockout. In order to reduce the suicide of CD5 CAR-T cells in subsequent experiments, CD5 was knocked out by CRISPR/Cas9 technology.
[0154] As shown in
Example 3. In Vitro Function Verification of CAR-T Cells
Experimental Purpose and Principle:
[0155] Since fully human single-domain clones and tandem clones that bind to CD5 antigen may not have good activation function after being constructed into the CAR structure, its function on CAR-T cells needs to be further confirmed, and the most active CAR molecules are to be screened. To this end, we prepared lentiviral vectors of these CAR molecular clones, and transduced T cells to prepare CAR-T cells. Then, the in vitro biological efficacy of the CAR-T cells was evaluated by
[0156] CD107a degranulation assay and in vitro cytotoxicity assay. Through the functional verification of these CAR-T levels, CAR molecules with ideal efficacy and safety were finally screened for the development of downstream CAR-T product.
CD107a Degranulation Assay
[0157] CD107a is a marker for intracellular microvesicles, and CD107a on the cell membrane increases after granzyme-loaded microvesicles fuse with the cell membrane, and when its recovery is blocked by monesin (purchased from BioLegend), it can quantitatively reflect the intensity of microvesicle release. When CAR-T is stimulated by the target antigen on the target cell, it will cause the release of granzymes, and the activation of T cells can be judged by the increase of CD107a by flow cytometry.
Brief Experimental Steps of CD107a Degranulation:
[0158] 1) Verification of the CD5 expression of target cells: take 1?10.sup.6 target cells JURKAT, CCRF-CEM, CCRF-CD5 KO, MOLT-4, SUP-T1, K562, RAJI per well, add PBS to wash once, and centrifuge at 300 g for 5 min, and discard the supernatant. Resuspend the cell pellet in 100 ?L of PBS, add 5 ?L of APC-CD5 antibody, and incubate at 4? C. for 15 min in the dark. Wash twice with PBS and centrifuge at 300 g for 5 min. Resuspend in 100 ?L of PBS, and detect with flow cytometry. [0159] 2) Centrifuge the CAR-T cells to be tested and the target cells at 300 g for 5 min at room temperature, respectively, discard the supernatant, resuspend in 1640 medium +10% FBS to 4?10.sup.6 cells/mL; [0160] 3) In a 96-well plate, add 100 ?L of CAR-T cells to be tested and 100 ?L of the target cells, and mix well; [0161] 4) Add 5 ?L of PE/Cy7 mouse anti-human CD107a antibody and 0.2 ?l of monensin to each well of cells, and then put them in a cell incubator (37? C., 5% CO.sub.2) to incubate for 4 h; [0162] 5) After completion of incubation, centrifuge at 4? C. and 600 g for 5 min, discard the supernatant, and wash the cells twice with 200 ?L of PBS;
[0163] 16) Resuspend the cells with 100 ?L of PBS, and add 5 ?L of APC anti-human EGFR and 5 ?L of BV421 anti-human CD8? antibody respectively, mix well and incubate on ice in the dark for 20 min; [0164] 7) After completion of incubation, wash the cells 3 times with 200 ?L of PBS; re-suspend with 100 ?L of PBS and then detect by flow cytometry.
Main Samples and Reagents:
[0165] Target cells JURKAT, CCRF-CEM, CCRF-CD5 KO, MOLT-4, SUP-T1, K562, RAJI; [0166] APC Mouse Anti-Human CD5 antibody, Clone UCHT2, BD Pharmingen, Cat. No.555355; [0167] Fetal bovine serum, Gibco, Cat. No.10099141; [0168] Monensin, BioLegend, Cat. No. 420701; [0169] PE/Cy7 mouse anti-human CD107a, BD Pharmingen, Cat. No. 561348; [0170] BV421 anti-human CD8?, Biolegend, Cat. No. 301036; [0171] APC anti-human EGFR, BioLegend, Cat. No. 352906.
Experimental Results:
[0172] As shown in
[0173] The CAR-T cells were obtained by lentiviral transduction, and CD107a degranulation assay was performed after the CAR-T cells were cultured in vitro for 9 days. The CAR-T cells to be detected were incubated with target cells, monensin and CD107a antibody for 4 h, and the cell density of both the CAR-T cells and target cells was 4?10.sup.5 cells/mL. Then, after the samples were labeled with CD8 antibody and EGFR antibody, flow cytometric detection was performed. The cells were analyzed in Flowjo software, living cell gate (P1) was selected in the scatter plot, and cell debris was removed. For the cells in the Pl gate, a single scattered cell gate (P2) was selected after analysis. Then, CD8 positive cells were further selected in the P2 gate (P3). Finally, in the P3 gate, the CD107a positive proportion in the cells that were positive in EGFR antibody staining (i.e., CAR positive cells) was analyzed.
[0174] The analysis results are shown in
In Vitro Cytotoxicity Assay
[0175] The purpose and principle of the experiment: In vitro cytotoxicity assay uses CCRF-CEM, JURKAT, MOLT4 andSUP-T1 as CD5 positive target cells, CCRF-CD5 KO, K562 and RAJI cells as CD5 negative target cells to evaluate the antigen-specific cytotoxicity of CD5 CAR-T cells. Among them, the above cells are respectively transduced by lentivirus to obtain target cells stably expressing firefly luciferase, so the activity of luciferase in the sample can reflect the number of target cells. The CAR-T cells and target cells are co-incubated and cultured. When target cells are killed by CAR-T cells, luciferase is released and quickly inactivated (firefly luciferase has a half-life of about 0.5 h). If the target cells are not killed or inhibited by CAR-T cells, more luciferases will be produced as the target cells proliferate and continue to express luciferase. Therefore, the cytotoxicity of CAR-T on target cells can be detected by the activity of luciferase.
Brief Experimental Steps of in Vitro Cytotoxicity Assay
[0176] 1) Centrifuge the above cells at room temperature and at 300 g for 5 min respectively, discard the supernatant, and then re-suspended the cells in 1640+10%FBS culture medium to 2?10.sup.5 cells/mL; add 100 ?L of target cells to each well of 96-well plates respectively; [0177] 2) According to the CAR positive rate and effector-target ratio of the CAR-T sample to be tested, add the corresponding CAR-T cells to each well of the 96-well plate respectively, well mix with the target cells, put the mixed cells in a 37? C. 5% CO.sub.2 incubator to incubate for 24 h; [0178] 3) detect the luciferase activity of the sample in each well using a luciferase detection kit.
Main Samples and Reagents:
[0179] Target cells CCRF-CEM, JURKAT, MOLT4, SUP-T1, CCRF-CD5 KO, K562 and RAJI; [0180] Steady-Glo Luciferase Assay System, Promega, Cat. No. E2520.
Experimental Results:
[0181] CAR-T cell samples and a fixed number of target cells (2?10.sup.4) were mixed according to different effector-target ratios (E:T), co-incubated for 24 h, and then the luciferase activity (RLU) in the samples was detected. Since the luciferase activity can reflect the number of target cells in the sample, the cytotoxicity/inhibiting ability of CAR-T cells on target cells can be obtained through the change of luciferase activity in the sample. The lower the luciferase activity readout (RLU), the more target cells are killed.
[0182] As shown in
CAR-T/T Cell Apoptosis Detection
[0183] 1) Take the CAR-T cells cultured to Day 10-12, CD5 KO T and MOCK T cells, each 1*10{circumflex over ()}6, centrifuge at 600 g at room temperature for 5 min, and wash twice with PBS. [0184] 2) Add 100 ?L of binding buffer to each well for resuspension, add 10 ?L of annexin V (FITC) and 5 ?L of PI(PE), incubate at room temperature for 15 min, add 200 ?L of binding buffer, and carry out flow cytometry.
Main Samples and Reagents:
[0185] H65, FHVH1, FHVH3, FHVH1VH3, FHVH3VH1 CAR-T cells, CD5 KO T, MOCK T cells; [0186] FITC Annexin V Apoptosis Detection Kit with PI, Biolegend, Cat. No. 640914.
Experimental Results:
[0187] As shown in
Repeated Stimulation Proliferation Experiment
Experimental Purpose and Principle:
[0188] Mitomycin C-treated target cells (CCRF-CEM) were mixed with different groups of CD5 KO CAR-T cells for multiple stimulations, and then the CAR-T cells and target cells were co-incubated to determine the ability of different CAR-T to proliferate after being repeatedly stimulated by target cells.
Brief Experimental Steps of Repeated Stimulation Experiment:
[0189] 1) Take CCRF-CEM cells at 7?10.sup.6 cells, and centrifuge at 300 g at room temperature for 5 min; [0190] 2) Adjust the density to 0.2?10.sup.6 cells/mL with a complete medium, add 5 ?L of Mitomycin C stock solution (1 ?g/?L) and mix well, then incubate at 37? C. and 5% CO.sub.2 for 24 h before use. [0191] 3) Take the CCRF-CEM-Mitomycin C cells treated with Mitomycin C for 24 h, centrifuge at 300 g to change the medium, wash 6 times with PBS, resuspend the CCRF-CEM-Mitomycin C cells in CTS medium, count and adjust the density to 6?10.sup.6 cells/mL before use. [0192] 4) Take 3?10.sup.5 CD5KO CAR-T cells respectively, and transfer them into 24-well plates. Add 50 ?L of CCRF-CEM-Mitomycin cells to each well to make the effector-to-target ratio E: T=1:1.
[0193] Replenish with CTS complete medium until the final culture volume reaches 500 ?L, mix well, culture at 37? C., 5% CO.sub.2 for 72 h and count, treat the target cells (CCRF-CEM) with Mitomycin again, and repeat the Repeated stimulation in the above 1-4 steps and plot the amplification curve.
Main Samples and Reagents:
[0194] FHVH1, FHVH3, FHVH3VH1, H65 CAR-T cells, CCRF-CEM cell lines: [0195] Mitomycin C, STEMCELL Technologies, Cat. No. 73274; [0196] CTS?M OpTmizerTM T Cell Expansion SFM, Gibco, Cat. No. A1048501; [0197] Fetal bovine serum (FBS), Gibco, Cat. No.10099141.
Experimental Results:
[0198] As shown in
Example 3. In Vivo Functional Verification of CAR-T Cells in Mouse Tumor Model
Experimental Purpose and Principle:
[0199] The fully human single-domain clone and tandem clone bound with CD5 antigen that are constructed into the CAR structure had been proved in the in vitro functional verification to have good functions of activating and killing tumor cells, and the ability to kill CD5+target cells and the ability to expand upon stimulation with target cells of the fully human single-domain tandem clone FHVH3VH1 was enhanced relative to single single-domain clones. To this end, we performed an in vivo biological potency assessment of CAR-T cells. The human acute T-cell leukemia cell line CCRF-CEM-ffLuc was used to establish a tumor model, and the functional verification of CAR-T was carried out in mice to prove the effectiveness and safety of CAR-T.
Brief Experimental Steps:
[0200] 1) Six-week-old female NCG mice were inoculated with tumors by tail vein injection of 1?10.sup.6 CCRF-CEM-ffLuc cells on day 0. [0201] 2) On day 4 and day 7, 2?10.sup.6 and 1?10.sup.6 CD5KO CAR+ T cells, CD5KO T cells or PBS (n=5) were infused via tail vein injection, respectively. [0202] 3) Tumor burden was assessed weekly using bioluminescent imaging, and mouse survival curves were monitored.
Main Samples and Reagents:
[0203] FHVH1, FHVH3, FHVH3VH1 and H65 CAR-T cells, and human acute T-cell leukemia cell [0204] line CCRF-CEM-ffLuc cell line;
[0205] NCG severe immunodeficiency mice, GemPharmatech Co., Ltd. (Jiangsu).
Experimental Results:
[0206] As shown in
[0207] In order to further study the function of FHVH3VH1 CAR-T (hereinafter referred to as CT125A) cells, the following studies were carried out.
Example 4 Study on Binding of CT125A Cells to Target Antigen CD5
[0208] Study purpose: To investigate the ability of CT125A cells to bind to the target antigen CD5. Study method: After incubation of CT125A cells (2?10.sup.5 cells/well) with different concentrations of fluorescent dye-labeled human CD5 protein, the cells were detected by FCM (flow cytometry). The relationship between the percentage of the fluorescence-labeled CAR+positive cells and the concentration of CD5 protein was fitted by Graphpad Prism software to calculate the affinity EC50 constant. This experiment was completed by Shanghai IASO Biotherapeutics Co., Ltd., and a total of three independent experiments were repeated.
[0209] Study results: In the 3 validation batches, the apparent affinity EC50 between CT125A and human CD5 antigen was 2.07?1.03nM, and the results are shown in Table 2 and
TABLE-US-00002 TABLE 2 Summary of detection results of affinity between CT125A and human CD5 antigen Number Apparent of times affinity Average Standard Cell name Group of experiments EC.sub.50 (nM) (nM) deviation CT125A CD5 Protein 1st time 3.82 2.07 1.23 injection 2nd time 1.22 3rd time 1.18
[0210] Study conclusion: CT125A cells have stable, good and specific binding ability to human CD5 antigen.
Example 5 Study on Degranulation Activity of CT125A In Vitro
[0211] Study purpose: To evaluate the degranulation activity of CT125A under specific stimulation by positive target cells.
[0212] Study protocol: Flow cytometry was used to detect the translocation of CD107a molecules on the membrane surface of 3 batches of CAR-T cells. The cytoplasm of CAR-T cells contains a high concentration of cytotoxic granules in the form of vesicles. When CAR-T cells are co-incubated with target cells, the toxic granules will reach the serosal surface and fuse with the cell membrane, causing the release of the granule contents, eventually leading to the death of the target cells. With the occurrence of degranulation, CD107a molecules are transported to the surface of the cell membrane and can bind to CD107a antibody. The expression of CD107a was quantitatively analyzed by the FCM method to evaluate the degranulation function of CT125A. This experiment was completed by Shanghai IASO Biotherapeutics Co., Ltd., and a total of three independent experiments were repeated.
[0213] Study results: After incubation of CT125A with 4 lines of CD5-positive target cells, the degranulation reaction was significantly increased, and the positive rates of CD107a were 33.22%?3.18% (CCRF-CEM-Luc), 35.43?7.33nM (SUP-T1-Luc); 29.71?10.01nM (JVM-2-Luc-CD5); 36.38?8.56nM (MEC-1-CD5-Luc), respectively; in the group without the target cell, the positive rate of CD107a was only 3.07%?3.34%. The data are detailed in Table 3 and
TABLE-US-00003 TABLE 3 The degranulation activity of CT125A stimulated by different kinds of positive target cells Proportion of CD107a.sup.+ Number of positive in times of CD8.sup.+CAR.sup.+ Average Standard Name Cell group experiments population (%) (%) deviation CD107a CAR-T + 1st time 32.14 33.22 3.18 CCRF- 2nd time 37.54 CEM-Luc 3rd time 29.99 CAR-T + 1st time 36.54 35.43 7.33 SUP- 2nd time 43.80 T1-Luc 3rd time 25.95 CAR-T + 1st time 21.88 29.71 10.01 JVM-2- 2nd time 43.84 Luc-CD5 3rd time 23.41 CAR-T + 1st time 30.59 36.38 8.56 MEC-1- 2nd time 48.47 CD5-Luc 3rd time 30.07 CAR-T only 1st time 0.93 3.07 3.34 2nd time 0.50 3rd time 7.78
[0214] Study conclusion: After co-incubating CT125A cells with the 4 positive target cell lines, the positive rate of CD107a was significantly increased compared to CT125A cells themselves. This result indicates that CT125A cells had stable, specific and good degranulation activity.
Example 6 Study on CT125A Cytotoxicity in Vitro
[0215] Study purpose: To evaluate the cytotoxicity of CT125 injection on positive target cells in vitro. Study method: CAR-T cells and target cells were co-incubated and cultured according to different effector-to-target ratios (from 10:1 to 0.5:1, 2-fold dilution). When target cells are killed by CAR-T cells, luciferase is released and quickly inactivated. If the target cells are not killed or inhibited by CAR-T cells, more luciferases will be produced as the target cells proliferate and continue to express luciferase. Therefore, the cytotoxicity of CAR-T on target cells can be detected by the activity of luciferase.
[0216] Study results: Compared to the MOCK-T group, CT125A had significant cytotoxicity on the 4 positive target cell lines for the first two effector-target ratios in the three effector-target ratios (high, medium, low) measured, which had a dose-effect relationship: for CCRF-CEM-Luc cells, the cytotoxicity when the effector-target ratio was 2:1 and 1:1 was respectively 96.91% and 95.58%; for SUP-T1-Luc cells, when the effector-target ratio was 2:1 and 1:1, the cytotoxicity was respectively 91.04% and 56.94%; for JVM-2-Luc-CD5 cells, the cytotoxicity when the effector-to-target ratio was 10:1 and 5:1 was respectively 98.51% and 96.40%; and for MEC-1-CD5-Luc cells, when the effector-to-target ratio was 2:1 and 1:1, the cytotoxicity was 98.25% and 97.71%, respectively. See Table 4 and
TABLE-US-00004 TABLE 4 Cytotoxicity of CT125A on different kinds of positive target cells Number of CT125A times of cytotoxicity (%) Mock-T Cell group experiments 2 (or 10) 1 (or 5) 0.1 (or 0.5) 2 (or 10) CAR-T + 1st time 96.84 95.33 18.69 11.70 CCRF- 2nd time 96.80 95.16 12.47 6.46 CEM-Luc 3rd time 97.08 96.26 36.32 18.76 CAR-T + 1st time 85.51 33.96 ?702.95 ?13.83 SUP-T1-Luc 2nd time 92.33 56.33 ?509.90 ?12.36 3rd time 95.29 80.52 ?345.02 ?48.32 CAR-T + 1st time 98.40 94.01 ?139.47 ?42.54 JVM-2-Luc- 2nd time 98.61 97.37 ?71.61 ?42.15 CD5 3rd time 98.52 97.81 ?47.83 ?27.56 CAR-T + 1st time 98.13 97.46 74.18 26.40 MEC-1- 2nd time 98.07 97.53 76.83 27.00 CD5-Luc 3rd time 98.56 98.13 85.98 55.22
[0217] Study conclusions: CT125A cells had stable, specific and good cytotoxicity on the 4 positive target cell lines assayed in vitro.
Example 7 Study on the Expression of ? Interferon of CT125A Injection
[0218] Study purpose: To study the expression level of Interferon-? (IFN-?) secreted by CT125A injection after co-incubation with target cells, so as to understand the cytotoxicity of this injection on tumor cells.
[0219] Study method: The CBA (Cytometric Bead Array, flow microsphere chip technology) method was used to detect the secretion level of IFN-? expression in the supernatant after co-incubation of different types of CD5 positive target cells and CT125 injection.
[0220] Study results: Compared to only CAR-T cell group: under the stimulation of positive target cells CCRF-CEM-Luc and SUP-T1-Luc, the release of IFN-? was slightly increased; under the stimulation of positive target cells JVM-2-Luc-CD5 and MEC-1-CD5-Luc, the release of IFN-? was significantly increased; and the release of IFN-? was not significantly changed under the stimulation of negative target cells CCRF-CEM-CD5 KO. See
[0221] Study conclusion: For CT125A, the average release of IFN-? tended to increase under the stimulation of the 4 positive target cell lines, but without statistically significant difference. The release of IFN-? did not change significantly under the stimulation of one negative target cell line.
Example 8 Study on Cetuximab-Mediated Elimination of CT125A Cells by Natural Killer Cells in Vitro
[0222] Study purpose: To investigate whether EGFRt, a molecular switch on the surface of CT125A cells, can mediate the elimination of CT125A cells by natural killer cells under the action of cetuximab.
[0223] Study method: The survival rate of CAR.sup.+ cells under the action of NK with different concentrations of cetuximab was mainly investigated.
[0224] Study results: The cytotoxicity data of NK from three test subjects showed that cetuximab could effectively kill CT125A. The three tested effector-target ratios were all similarly effective, and the cytotoxicity was dose-dependent with the antibody. The EC50 was between 0.01-0.03 nM, and the maximum cytotoxicity was 30%-70%. See
[0225] Research conclusion: Cetuximab can mediate the cytolysis and elimination of CT125A by NK cells in vitro, which proves that the molecular switch mechanism of EGFRt-CART is effective. It is consistent with the reported mechanism of action of cetuximab: antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and antibody-dependent complement-mediated cytotoxicity (CDC). Some test subjects showed that CT125A had suicide phenomenon at high concentrations of cetuximab, which may be related to the presence of a small amount of CAR-NK and CAR-NKT in CT125A preparations (some NKTs had low CD16 expression).
Example 9 Study on the Effect of CT125A on Immunodeficient Mice Bearing SUP-T1-Luci Transplanted Tumors
[0226] Study purpose: In this experiment, the test product CT125A injection was administered intravenously to NOG mice transplanted with human T-lymphoblastomas cells (SUP-T1-Luci) (NOD-Cg.Prkdc.sup.SCID IL-2rg.sup.tm1sug/JicCrl mice, purchased from Beijing Vital River Laboratory Animal Technology Co., Ltd.) to evaluate its inhibitory effect on tumor cell proliferation.
[0227] Study method: 65 female NOG mice were inoculated with 0.2 mL of human T-lymphoblastoma cell (SUP-T1-Luci) suspension in the tail vein under sterile conditions (cell density 5.33?10.sup.6 cells/mL, cell viability 100.00%). On Day 4 after inoculation, 50 animals with suitable tumor signals and similar body weight were selected and randomly divided into 5 groups: cytoprotective solution group (10 animals), Mock-T group (10 animals, 9.87?10.sup.6 T-cells/animal), the low-dose group of the test product (10 animals, 0.3?10.sup.6 CAR-T cells/animal), the medium-dose group of the test product (10 animals, 1.0?10.sup.6 CAR-T cells/animal) and the high-dose group of the test product (10 animals, 3.0?10.sup.6 CAR-T cells/animal). All animals were administered with a single injection through the tail vein, the day of administration was regarded as D1, the second day after administration was regarded as D2, and so on.
[0228] General clinical observations were carried out twice a day after the first administration. Before grouping, the animals were weighed once on each of D3, D7, D11, D14, D18, D21 and D23. Before grouping, on D7, D14, D21 and D23, for all the animals, chemiluminescence signals were captured by a small animal in vivo imager. On each of D2, D3, D5, D7 and D23, lymphocyte subsets (CD45.sup.+, CD45.sup.+CD3.sup.+ and CD45.sup.+CD3.sup.+CD5.sup.+), and peripheral blood cytokines (IL-2, IL-4, IL-6, IL-10, TNF-? and IFN-?) were detected once.
Study results: 1) General Clinical Observation and Survival Rate
[0229] During the experiment, animals in the cytoprotective solution group began to die on D17, and the clinical manifestations before death included bowed back and/or weakness of hind limbs, and 3 animals survived on D23. Animals in the Mock-T group began to die on D13. The clinical manifestations before death included bowed back, weakness of hind limbs, tilted head and lack of energy. On D23, 3 animals survived. Animals in the low, medium and high dose groups of the test product began to die on D21, D15 and D18 respectively, and 8, 9 and 8 animals survived on D23 respectively. The remaining animals were euthanized on D23. See
2) Body Weight
[0230] After dosing, each group of the test product showed a steady upward trend. The body weight of the animals in the cytoprotective solution group and the Mock-T group first increased and then decreased. Compared to the cytoprotective solution group, the body weight of the animals in the Mock-T group had no significant difference during the experiment, and the body weight in the low, medium and high dose groups of the test product was significantly higher than in the cytoprotective solution group from D18 (P?0.05). The results are shown in
[0232] After dosing, the tumor signal intensity in the cytoprotective solution group and the Mock-T group continued to increase. The tumor signal intensity in the low, medium and high dose groups of the test product continued to decrease. Compared to the cytoprotective solution group, there was no significant difference in tumor signal intensity in the Mock-T group during the experiment. The tumor signal intensity in each group of the test product decreased significantly from D7 (P?0.05), and the weakening of the tumor signal intensity decreased with the increase of the test product dose, and there was an obvious dose-dependent relationship. The results are shown in
4) Flow Cytometry
[0233] During the experiment, the ratio of peripheral blood CD45.sup.+ lymphocytes in the low-dose group of the test product was basically stable, and it was 0.4+0.3% on D23. In the cytoprotective solution group, Mock-T group, test product medium and high dose groups, it fluctuated slightly during D2-D7, and increased by D23. The ratio of peripheral blood CD45.sup.+ lymphocytes in each group of the test product showed a significant dose-dependent increase during the experiment.
[0234] During the experiment, the ratio of peripheral blood CD45.sup.+CD3.sup.+ lymphocytes in the cytoprotective solution group decreased in a fluctuating manner. The Mock-T group showed a stable trend. The low, medium and high dose groups of the test product all showed a trend of decreasing first and then increasing.
[0235] During the experiment, the ratio of peripheral blood CD45.sup.+CD3.sup.+CD.sup.+ lymphocytes in the cytoprotective solution group showed an overall upward trend. The Mock-T group showed a fluctuating upward trend. The low, medium and high dose groups of the test product all showed a trend of increasing first and then decreasing.
5) Cytokine Detection
[0236] In the cytoprotective solution group, the peripheral blood IL-2 content was basically stable, and rose slightly to 0.36?0.09 pg/mL by D23. The change of peripheral blood IL-2 content was basically stable in the Mock-T group. The low, medium and high dose groups of the test product all showed an overall trend of decreasing. The results are shown in
[0237] During the experiment, the peripheral blood IL-4 content in the cytoprotective solution group increased from 0.00?0.00 pg/mL on D2 to 58.55+9.42 pg/mL on D23. The peripheral blood IL-4 content in the other groups basically remained unchanged and remained stable at around the baseline of 0.00?0.00 pg/mL. The IL-6 content in the peripheral blood of animals in all groups was basically stable around the baseline of 0.00?0.00 pg/mL. The results are shown in
[0238] During the experiment, the levels of peripheral blood IL-10 in the cytoprotective solution group and the Mock-T group fluctuated slightly, and were basically stable near the baseline. In the high dose group of the test product, it increased slightly from 0.35?6.29 pg/mL onD2 to 6.29?3.38 pg/mL on D28. The peripheral blood IL-10 content in the other groups was basically stable around the baseline, with no obvious trend of change. The results are shown in
[0239] During the experiment, the peripheral blood TNF-a content in the cytoprotective solution group rose slightly to 0.29?0.26 pg/mL on D23. In the Mock-T group, it increased first and then decreased. In the low, medium and high dose groups of the test product, it increased until D5, and then decreased, all decreased to 0.00?0.00 pg/mL on D7, and then slightly increased on D23, showing a fluctuating change. The peripheral blood TNF-a content in each group of the test product had an obvious dose-dependent increase from D2 to D5 and on D23, suggesting that the changes of peripheral blood TNF-a content in each group of the test product may be dose-dependent. The results are shown in
[0240] During the experiment, the peripheral blood IFN-? content in the cytoprotective solution group was basically stable at 0.00?0.00 pg/mL. The Mock-T group showed a continuous rising trend. In the test product low dose group, it increased on D5, then dropped until D23. In the medium and high dose groups of the test product, it rose until D5, then dropped until D7, and then rose until D23. The peripheral blood IFN-? content in each group of the test product had an obvious dose-dependent increase at every time point, suggesting that the changes of peripheral blood IFN-? content in each group of the test product may be dose-dependent. The results are shown in
[0241] Conclusion: This experiment successfully established the NOG mouse vein xenograft tumor model of human T-lymphoblastoma cells (SUP-T1-Luci). Under the conditions of this experiment, a single intravenous injection of the test product CT125A injection at doses of 0.3?10.sup.6, 1.0?10.sup.6 and 3.0?10.sup.6 CAR-T cells/animal had inhibitory and clearing effects on the growth of NOG mouse vein transplanted tumors of human T lymphoblastoma SUP -TI-Luci cells, and the tumor inhibiting and clearing effects were enhanced with the increase of the dose of the test product, suggesting an obvious dose-dependent relationship.
Example10 Pharmacodynamic Experiment of CT125A on NPG Mouse Systemic Xenograft Tumor Model of Human Mantle Cell Lymphoma JVM-2-Luc-CD5 Cell Line
[0242] Study purpose: To study the anti-tumor efficacy of CD5-targeting CAR-T cell injection CT125A on NPG mice systemic xenografts of CD5-positive human mantle cell lymphoma JVM-2-Luc-CD5 cells.
Study Method:
1) Cell Culture
[0243] The human mantle cell lymphoma JVM-2-Luc-CD5 cell suspension used in this experiment was self-made by the inventor. Commercially available JVM-2 cells were utilized to overexpress Luc to construct the JVM-2-Luc cell line, and then CD5 was expressed on the JVM-2-Luc cell line to obtain JVM-2-Luc-CD5 cells. Cells were collected and counted, resuspended in PBS, and inoculated into the tail vein of 50 NPG mice. Each mouse was inoculated with 3?10.sup.6 JVM-2-Luc-CD5 cells. The cells were resuspended in PBS and inoculated into the mice by tail vein injection with an inoculation volume of 200 ?L.
2) Animal Grouping and Dosing Regimen
[0244] On Day 4 after inoculation, the mice will be randomly divided into 3 groups with 10 mice in each group according to body weight and tumor size (fluorescence intensity) using E-workbook. grouping and dosing regimen are shown in Table 5. The injection of CAR-T cells was performed on the day of grouping, and the day of grouping and administration was defined as Day 0.
TABLE-US-00005 TABLE 5 Grouping and dosing regimen JVM- Dosage Group 2-Luc N Drug (CAR.sup.+ cells/mouse) Dosing regimen 1 3 ? 10 CS10 i.v., Day 0 2 10.sup.6 10 Mock T The total cell number is i.v., Day 0 the same as CT125A 3 10 CT125A 2 ? 10.sup.6 i.v., Day 0 Note: 1. N represents the number of animals in each group; 2. Administration volume: The administration volume was adjusted according to 200 ?L/animal. 3. CT125A cells are as mentioned above, CS10 is commercially available.
3) Drug Formulation Method
[0245] Drug formulation method: Four tubes of CT125A were taken out from the cryopreservation place, quickly placed in a 37? C. water bath, shaken gently until the cells were just completely thawed, and then cells were aseptically taken out in a biological safety cabinet. The CT125A cells were transferred to a suitable sterile container, mixed upside down and then an appropriate amount of cells were taken to count the cell density and viability. CT125A viable cell density was 2.58?10.sup.7/mL (viability rate 85.52%), CAR+ (41.59%) viable cells were 1.07?10.sup.7/mL, a total of 4 mL, then CS10 was added to dilute to the required density and volume to 4.28 mL. The same method was used to adjust the Mock T cell density to be consistent with the CT125A total T-cell density. The prepared cell suspension was placed on wet (crushed) ice and passed into the animal room for administration to the animal, and the administration was completed within 2 h after resuscitation.
4) Evaluation Method
[0246] Cage side observation: The appearance and behavior of each mouse were observed every day, starting from the beginning of grouping to the end of the experiment. All abnormal appearances and behaviors were recorded in the clinical observation form of the PharmaLegacy lab.
[0247] In vivo imaging: before grouping (Day 0), and Day 5, Day 10, Day 15 and Day 18 after grouping, a total of 4 times of imaging was performed. Before imaging, the mice were maintained under anesthesia with 3 - 4% isoflurane.
[0248] Animal body weight: After grouping, the body weight of the mice was measured and recorded twice a week until the end of the experiment.
[0249] Clinical observation of animals: observations were made once a day during the experiment, and the observations included but not limited to the mental state, diet of the animals, and the like. All abnormal appearances and behaviors were recorded in the clinical observation form of the PharmaLegacy lab and fed back to the client in time. Whether there was an allergic reaction after dosing, whether ascites occurred, etc. should be observed after dosing. If there was any abnormality or death, it needed to be recorded and reported.
[0250] Sample collection: On Day 7 after grouping, about 100 ?L of whole blood was collected from each mouse and stored at ?80? C.; at the end of the experiment on Day 18, about 300 ?L of whole blood was collected from each mouse and stored at ?80? C.
5) Euthanasia
[0251] During the experiment, if any one or more of the following situations occur, the animal should be euthanized: [0252] 1) Health status: Severe emaciation and body score (according to SOP PL-ONC023) less than 2. [0253] 2) Impaired animal function: Nodules interfere with normal animal function (such as eating, drinking, or ambulating). [0254] 3) Other disease symptoms.
[0255] Animals displaying the above symptoms would be recorded as abnormal.
[0256] At the end of the in vivo experiment on Day 18, all mice were asphyxiated with CO.sub.2 and then sacrificed by dislocation of the cervical spine. Before the end of the in vivo experiment, dead animals would not be subject to sample collection.
6) Statistical analysis
[0257] Results would be presented as mean ?S.E.M. The body weight and tumor fluorescence intensity of the mice in each group were plotted and statistically analyzed using the statistical software GraphPad Prism8 for Windows (serial number: GPS-1766552-EDSH-0204F). After performing Log transformation on the tumor fluorescence intensity (if there is zero value data, it is taken as 1 and then subjected to Log transformation), Two-way ANOVA (mixed model) and Turkey test were used to determine whether there was a significant difference in the fluorescence signal value between the groups, and P<0.05 was considered significant difference.
Study Results
1) Animal Weight and Status
[0258] During the experiment, some animals in the CS10 control group and the CT125A group lost more than 15% of their body weight or died. Of the 10 mice in the CS10 group, 2 mice died, and in the CT125A group, 1 mouse died. On Day 18, the average weight loss rate of the CS10 control group was 8.96%, and the average body weight loss rate of the CT125A group was 8.64%, indicating that the model itself could cause moderate weight loss of animals, while CT125A had no effect on animal body weight, without obvious toxicity. See
TABLE-US-00006 TABLE 6 Body weight statistical table of each group at each time point (g) Days after grouping Group 0 3 5 7 10 14 15 17 18 G1: CS10, Mean 22.72 22.75 21.98 21.89 22.03 21.35 21.38 20.78 20.62 0.2 mL/mouse, SEM 0.26 0.33 0.47 0.36 0.48 0.57 0.60 0.54 0.50 i.v., Day0 G2: Mock T, Mean 22.03 22.04 21.32 20.86 21.16 20.63 20.80 20.47 20.61 4.81 ? 10.sup.6 T SEM 0.40 0.50 0.51 0.61 0.92 0.69 0.52 0.41 0.43 cells/mouse, i.v., Day0 G3: CT125A, Mean 21.95 22.07 21.62 20.61 20.21 20.29 20.15 19.35 20.12 2 ? 10.sup.6 CAR-T SEM 0.30 0.35 0.35 0.61 0.61 0.79 0.84 0.87 0.76 cells/mouse, i.v., Day0
2) Tumor Growth
[0259] Four days after inoculation of human mantle cell lymphoma JVM-2-Luc-CD5 cell line, dosing was performed in groups. The day of dosing was regarded as Day 0. Fluorescence imaging was performed on Day 5, Day 10, Day 15 and Day 18 during the experiment, and statistical analysis was performed on the tumor growth in animals in each group. See
[0260] During the experiment, the tumor fluorescence intensity of mice in the vehicle CS10 group (G1) decreased first and then increased; the tumor fluorescence intensity was 8.77?10.sup.7?0.88?10.sup.7 p/s on Day 0 of grouping; the tumor fluorescence intensity decreased to 1.19*?10.sup.7?0.1.sup.7?*10.sup.7 p/s on Day 5; after that, the tumor fluorescence intensity maintained an upward trend; by Day 18, the fluorescence intensity of the control group animals was 6.65?10.sup.7?2.57?10.sup.7 p/s. The results showed that this study successfully established a systemic xenograft model of human mantle cell lymphoma JVM-2-Luc-CD5 cells in NPG mice.
[0261] Animals in the G2 group were given a single dose of Mock T cells at 4.81?10.sup.6 T-cells/mouse on Day 0, and the tumor fluorescence intensity was regularly detected. The data showed that the trend of the tumor fluorescence intensity of animals in the Mock T group (G2) was similar to that of the control group, and the tumor fluorescence intensity was 1.36?10.sup.8?2.44?10.sup.7 p/s by Day 18; the fluorescence intensity of tumor at each time point was not significantly different from that of the vehicle control group CS10.
[0262] Animals in group G3 were given a single dose of CT125A at 2?10.sup.6 CAR+cells/mouse on Day 0, and then the tumor fluorescence intensity was regularly detected. The data showed that CT125A group (G3) had significantly lower tumor fluorescence intensity at each time point after dosing compared to the day of grouping, and the tumor fluorescence intensity on Day 0 was 8.77?10.sup.7?9.08?10.sup.6 p/s, and the tumor fluorescence intensity was 1.15?10.sup.7?1.15?10.sup.7 p/s by Day 18. The tumor fluorescence intensity at each time point in the CT125A group was significantly lower than that in the CS10 control group or Mock T group during the same period (P<0.01, see Table7). And at the end of the experiment, 8 of 9 surviving mice in the CT125A group had zero tumor fluorescence intensity, while none of the surviving animals in the CS10 control group and Mock T group had tumor fluorescence Intensity of zero.
TABLE-US-00007 TABLE 7 Tumor growth in each group at each time point (?10.sup.7, Bioluminescence intensity, p/s) Days after grouping Group 0 5 10 15 18 G1: CS10, 0.2 Mean 8.77 1.19 2.32 7.46 6.65 mL/mouse, i.v., SEM 0.88 0.17 0.40 3.13 2.57 Day0 G2: Mock T, Mean 8.75 1.42 2.49 5.98 13.63 4.81 ? 10.sup.6 T SEM 0.92 0.15 0.33 0.98 2.44 cells/mouse, P Value (v.s. G1) >0.9999 0.5050 0.9137 0.9012 0.3666 i.v., Day0 P Value (v.s. G3) 0.9997
G3: CT125A, Mean 8.76 0.60 0.17 0.58 1.15 2 ? 10.sup.6 SEM 0.91 0.11 0.10 0.51 1.15 CAR-T P Value (v.s. G1) 0.9997 0.0234 0.0014 0.0014 0.0001 cells/mouse, P Value (v.s. G2) 0.9997
i.v., Day0
Conclusions
[0263] In summary, under the conditions of this experiment, a single intravenous injection of CT125A injection at a dose of 2?10.sup.6 CAR-T cells/mouse had a strong inhibitory and clearing effect on the growth of NPG mouse systemic xenograft tumors of human mantle cell lymphoma JVM-2-Luc-CD5 cells, with good animal tolerance.
Example 11 Human Membrane Protein Array Study
[0264] Study purpose: To investigate the non-specific cross-reactivity of CT125A tandem single-domain antibody rabbit FC fusion protein RD125 61-42 rFc (constructed by fusing the above FHVH3VH1 with rFc) with human membrane proteins
[0265] Study method: A membrane protein array platform (Membrane Proteome Array, MPA) composed of about 6,000 different human membrane protein clones from Integral Molecular Company of the United States was used to detect the binding between CT125A single-chain antibody rabbit FC fusion protein RD125 61-42 rFc and cells expressing human membrane protein clones, positive bound cells were screened out, and the results were confirmed for the second time.
[0266] Study results: In the screening test, at a concentration of 5 ?g/mL, RD125 61-42 rFc had a strong signal of binding with cells expressing human CD5 clones, and weakly bound to a small number of cells expressing human membrane proteins. In the second concentration gradient confirmation test, it was confirmed that RD125 61-42 rFc had dose-dependent strong binding to human CD5 membrane expressing cells, and weakly binding to CAMKIG calmodulin kinase membrane expressing cells; the fluorescence value for binding to CD5 membrane expressing cells was about 40-100 times higher than that for binding to CAMKIG membrane expressing cells.
[0267] Study conclusions: Human membrane protein array detection results showed that CT125A single-chain antibody rabbit FC fusion protein RD125 61-42 rFc only had weak non-specific binding to CAMKIG calmodulin kinase, indicating that CT125A single-domain antibody has better specificity.
Example 12 Determination of the Affinity Of Anti-CD5 sdAbs
Experimental Purpose and Principle:
[0268] The affinity between CD5 sdAbs and the antigen may have an important impact on the cytotoxicity and persistence of CAR-T in patients. In order to determine this important property, we used ForteBio's Octet molecular interaction technology to measure it. The biomembrane interferometry technology used in the Octet system is a label-free technology that provides high-throughput biomolecular interaction information in real time. The instrument emits white light to the surface of a sensor and collects the reflected light. The reflected light spectra of different frequencies is affected by the thickness of the optical film layer of the biosensor. Some frequencies of reflected light forms constructive interference (blue), while others are affected by destructive interference (red). These interferences are detected by a spectrometer to form an interference spectrum, which is displayed as the phase shift intensity (nm) of the interference spectrum. Therefore, once the number of molecules bound to the sensor surface increases or decreases, the spectrometer will detect the shift of the interference spectrum in real time, and this shift directly reflects the thickness of the biofilm on the sensor surface, from which high-quality data of biomolecular interaction can be obtained, so as to determine the kinetic parameters of biomolecular interactions (Kon, Kdis and KD), providing important information for the research and development process.
Brief Experimental Steps:
[0269] 1) Dilute anti-CD5 IgG (constructed by fusing the VHH sequence of CD5 with human IgG4 Fc) to 20 pg/mL with loading buffer (1?PBS, pH 7.4, 0.01% BSA and 0.02% Tween 20), and load it onto the biosensor at approximately 0.8 nM. [0270] 2) After a 60 s equilibration period, monitor the binding kinetics of the CD5 antigen (Acro, CD5-H52H5) at various antigen concentrations (100 to 1.563 nM). Carry out 160 s association and 300 s dissociation at each concentration, respectively. [0271] 3) Wash 3 times with 10mMGlycine-HCl, pH1.5 to regenerate the chip. [0272] 4) Analyze the binding constant by using a 1:1 binding site model (Biacore X-100 evaluation software).
Experimental Results:
[0273] Affinity refers to the strength of the binding of a single molecule to its ligand and is usually measured and reported by the equilibrium dissociation constant (KD), which is used to assess and rank the intensity of interaction between two molecules. The binding of an antibody to its antigen is a reversible process, and the rate of the binding reaction is directly proportional to the concentration of the reactants. The smaller the KD value, the greater the affinity of the antibody for its target. As shown in Table 8, FHVH1, FHVH3, FHVH3VH1 (FHVH3 and FHVH1 linked by linker (GGGGSGGGGSGGGGS) (SEQ ID NO: 21)), FHVH4 and FHVH2 could all bind to CD5 antigen, and the affinity of FHVH3VH1 was slightly higher than that of FHVH1, FHVH3, FHVH4 and FHVH2.
TABLE-US-00008 TABLE 8 Anti-CD5 IgG affinity determination Analyte KD (M) kon(1/Ms) kdis(1/s) FHVH1 (#42 IgG) 2.90E?09 4.80E+04 1.39E?04 FHVH3 (#61 IgG) 3.96E?09 7.28E+04 2.88E?04 FHVH3VH1 (#61-42 IgG) 1.67E?09 1.13E+05 1.89E?04 FHVH4 (#62 IgG) 2.74E?08 1.25E+04 3.09E?04 FHVH2 (#60 IgG) 8.32E?09 2.55E+04 2.12E?04
Example 13 Study on Binding of Tandem Single-Domain Antibody to CD5.SUP.+ .Target Cells
[0274] Study purpose: To investigate the binding ability of CD5 single-domain antibody to CD5.sup.+ target cells.
[0275] Study method: Different concentrations of CD5 tandem single-domain antibody rabbit Fc fusion protein 61-42-rFc (i.e., a fusion protein constructed by linking #61 clone (FHVH3) with #42 clone (FHVH1) by linker (GGGGSGGGGSGGGGS) and then linking them to rabbit Fc) were incubated with CD5.sup.+ target cells respectively, the cells were washed twice with PBS, and then fluorescent dye-labeled rabbit Fc antibody was added to mark the positive cells, and detected by FCM (flow cytometry). The relationship between the percentage of fluorescence-labeled positive CD5.sup.+ target cells and different concentrations of CD5 tandem single-domain antibody was analyzed by fitting using Graphpad Prism software to calculate the EC50 constant. A total of three independent repetitions were performed in this experiment.
[0276] Study results: The CD5 tandem single-domain antibody rabbit FC fusion protein 61-42 rFc had high affinity with each of the 4 lines of CD5 positive cells, with the Kd being: 2.99?0.35nM (CCRF-CEM-Luc); 4.02?0.92nM (SUP-T1-Luc); 0.64?0.07nM (JVM-2-Luc-CD5); 1.14?0.16nM (MEC-1-CD5-Luc), respectively. The specific results are shown in Table 9 and
TABLE-US-00009 TABLE 9 Summary of affinity between 61-42-rFc single-domain antibody and each CD5 positive cell Cell Number Name name of times Apparent Average Standard 61- CCRF- 1st time 3.04 2.99 0.35 42-rFc CEM-Luc 2nd time 2.54 3rd time 3.39 SUP- 1st time 2.72 4.02 0.92 T1-Luc 2nd time 4.58 3rd time 4.75 JVM-2- 1st time 0.64 0.64 0.07 Luc-CD5 2nd time 0.56 3rd time 0.72 MEC-1- 1st time 1.30 1.14 0.16 CD5-Luc 2nd time 0.92 3rd time 1.20
[0277] Study conclusions: The CD5 tandem single-domain antibody rabbit Fc fusion protein 61-42-rFc had stable, good and specific binding ability to the 4 CD5 positive cell lines tested, with EC50 values of 1-5 nM.
REFERENCES
[0278] 1. Castella, M., et al., Development of a Novel Anti-CD19 Chimeric Antigen Receptor: A Paradigm for an Affordable CAR T Cell Production at Academic Institutions. Molec?lar TherapyMethods & Clinical Development, 2019. 12: p. 134-144. [0279] 2. Castella, M., et al., Point-Of-Care CAR T-Cell Production (ARI-0001)Using a Closed Semi-automatic Bioreactor: Experience From an Academic Phase 1 Clinical Trial. Frontiers in immunology, 2020. 11: p. 482. [0280] 3. Ort?z-Maldonado, V., et al., CART19-BE-01: A M?lticenter Trial of ARI-0001 Cell Therapy in Patients with CD19(+) Relapsed/Refractory Malignancies. Mol Ther, 2020. [0281] 4. Gill, S., et al., CD19 CAR-T cells combined with ibrutinib to induce complete remission in CLL. Journal of Clinical Oncology, 2017. 35(15_suppl): p. 7509-7509. [0282] 5. Neelapu, S. S., et al., Axicabtagene Ciloleucel CAR T-Cell Therapy in Refractory Large B-Cell Lymphoma. New England Journal of Medicine, 2017. 377(26): p. 2531-2544. [0283] 6. Maude, S. L., et al., CD19-targeted chimeric antigen receptor T-cell therapy for acute lymphoblastic leukemia. Blood, 2015. 125(26): p. 4017. [0284] 7. Jacobson, C. A., CD19 Chimeric Antigen Receptor Therapy for Refractory Aggressive B-Cell Lymphoma. Journal of Clinical Oncology, 2018. 37(4): p. 328-335. [0285] 8. Kochenderfer, J., et al., Anti-CD19 chimeric antigen receptor T cells preceded by low-dose chemotherapy to induce remissions of advanced lymphoma. Journal of Clinical Oncology, 2016. 34(18_suppl): p. LBA3010-LBA3010. [0286] 9. Grupp, S. A., et al., Chimeric Antigen Receptor-Modified T Cells for Acute Lymphoid Leukemia. New England Journal of Medicine, 2013. 368(16): p. 1509-1518. [0287] 10. Hirayama, A. V., et al., The response to lymphodepletion impacts PFS in aggressive non-Hodgkin lymphoma patients treated with CD19 CAR-T cells. Blood, 2019: p. blood-2018-11-887067. [0288] 11. Davila, M. L., et al., Efficacy and toxicity management of 19-28z CAR T cell therapy in B cell acute lymphoblastic leukemia. Sci Transl Med, 2014. 6(224): p. 224ra25. [0289] 12. Jones, N. H., et al., Isolation of complementary DNA clones encoding the human lymphocyte glycoprotein T1/Leu-1. Nature, 1986. 323(6086): p. 346-349. [0290] 13. Huang, H. J., et al., Molec?lar cloning of Ly-1, a membrane glycoprotein of mouse T lymphocytes and a subset of B cells: molecular homology to its human counterpart Leu-1/T1 (CD5). Proceedings of the National Academy of Sciences of the United States of America, 1987. 84(1): p. 204-208. [0291] 14. Mamonkin, M., et al., A T-cell-directed chimeric antigen receptor for the selective treatment of T-cell malignancies. Blood, 2015. 126(8): p. 983-992. [0292] 15. Hill, L. C., et al., Safety and Anti-Tumor Activity of CD5 CAR T-Cells in Patients with Relapsed/Refractory T-Cell Malignancies. Blood, 2019. 134(Supplement_1): p. 199-199.
[0293] The specific sequences of the amino acids and nucleotides mentioned in the examples and other parts of the present application are as follows:
TABLE-US-00010 CD8?signalpeptidenucleicacidsequenceofFHVH1,FHVH2,FHVH3andFHVH4,63bp (SEQIDNO:1): ATGGCCCTGCCTGTGACAGCTCTGCTCCTCCCTCTGGCCCTGCTGCTCCATGCCGCCAGACCC CD8?signalpeptideproteinsequenceofFHVH1,FHVH2,FHVH3andFHVH4,21aa(SEQ IDNO:2): MALPVTALLLPLALLLHAARP CD8?hingeregionnucleicacidsequenceofFHVH1,FHVH2,FHVH3andFHVH4:165bp (SEQIDNO:3) TTCGTGCCCGTGTTCCTGCCCGCCAAACCTACTACTACCCCTGCACCTAGGCCTGCCACCCCAGC CCCAACAATCGCCAGCCAGCCTCTGTCTCTGCGGCCCGAAGCCTGTAGACCTGCTGCCGGCGGA GCCGTGCACACCAGAGGCCTGGACTTCGCCTGCGAC CD8?hingeregionproteinsequenceofFHVH1,FHVH2,FHVH3andFHVH4,55aa(SEQID NO:4) FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD CD8?transmembraneregionnucleicacidsequenceofFHVH1,FHVH2,FHVH3andFHVH4, 84bp(SEQIDNO:5): ATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCTGCTGAGCCTGGTGATCACCCT GTACTGCAACCACCGGAAC CD8?transmembraneregionproteinsequenceofFHVH1,FHVH2,FHVH3andFHVH4,28aa (SEQIDNO:6) IYIWAPLAGTCGVLLLSLVITLYCNHRN 4-1BBco-stimulatorydomainnucleicacidsequenceofFHVH1,FHVH2,FHVH3and FHVH4,126bp,(SEQIDNO:7): AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTAC TCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTG 4-1BBco-stimulatorydomainproteinsequenceofFHVHI,FHVH2,FHVH3andFHVH4, 42aa(SEQIDNO:8): KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL CD3zintracellularsignalingdomainnucleicacidsequenceofFHVH1,FHVH2,FHVH3and FHVH4,336bp(SEQIDNO:9): AGAGTGAAGTTCAGCAGATCCGCCGACGCCCCTGCCTACCAGCAGGGACAGAACCAGCTGTAC AACGAGCTGAACCTGGGCAGACGGGAAGAGTACGACGTGCTGGACAAGCGGAGAGGCCGGGA CCCCGAGATGGGCGGAAAGCCCAGACGGAAGAACCCCCAGGAAGGCCTGTATAACGAACTGCA GAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAAGGGCGAGCGGAGGCGGGGCA AGGGCCACGATGGCCTGTACCAGGGCCTGAGCACCGCCACCAAGGACACCTACGACGCCCTGG ACATGCAGGCCCTGCCCCCCAGA CD3zintracellularsignalingdomainproteinsequenceofFHVH1,FHVH2,FHVH3and FHVH4,112aa(SEQIDNO:10): RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKD KMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR; CleavingpeptideT2AnucleicacidsequenceofFHVH1,FHVH2,FHVH3andFHVH4,54bp (SEQIDNO:11): CAGGGAAGGGGCAGCTTATTAACATGTGGCGATGTGGAAGAGAACCCCGGTCCC; CleavingpeptideT2AproteinsequenceofFHVH1,FHVH2,FHVH3andFHVH4,18aa,(SEQ IDNO:12): EGRGSLLTCGDVEENPGP; CSF2RAsignalnucleicacidsequenceofFHVH1,FHVH2,FHVH3andFHVH4,66bp,(SEQ IDNO:13): ATGCTGCTGCTCGTGACCTCTTTACTGTTATGTGAGCTGCCCCACCCCGCTTTTTTACTGATCCCT CSF2RAsignalproteinsequenceofFHVH1,FHVH2,FHVH3andFHVH4,22aa,(SEQID NO:14): MLLLVTSLLLCELPHPAFLLIP tEGFRnucleicacidsequenceofFHVH1,FHVH2,FHVH3andFHVH4:1005bp(SEQIDNO: 15) CGTAAGGTGTGTAACGGAATCGGCATTGGCGAGTTCAAGGACTCTTTAAGCATCAACGCCACA AACATCAAGCACTTCAAGAATTGTACCTCCATCAGCGGCGATTTACACATTCTCCCCGTGGCTT TTCGTGGCGATTCCTTCACCCACACCCCCCCTCTGGACCCCCAAGAGCTGGACATTTTAAAAAC CGTGAAGGAGATCACCGGCTTTCTGCTGATCCAAGCTTGGCCCGAGAATCGTACCGACCTGCAC GCCTTCGAGAATTTAGAGATTATTCGTGGAAGGACCAAGCAGCACGGCCAGTTCTCTTTAGCCG TCGTGTCTTTAAACATTACCAGCCTCGGTTTAAGGTCTTTAAAGGAGATTAGCGACGGCGACGT GATCATCTCCGGCAACAAGAACCTCTGCTACGCCAACACCATCAACTGGAAGAAGCTGTTCGG AACCAGCGGCCAAAAGACCAAGATCATCAGCAATCGTGGAGAGAACTCTTGTAAGGCCACTGG TCAAGTTTGCCACGCCCTCTGTAGCCCCGAAGGATGTTGGGGCCCCGAGCCTAGGGACTGTGTT AGCTGCAGAAACGTGAGCAGAGGCAGAGAGTGTGTGGACAAATGCAATTTACTGGAAGGAGA GCCTAGGGAGTTCGTGGAGAACAGCGAATGTATCCAGTGCCACCCCGAGTGTTTACCTCAAGCC ATGAACATCACTTGTACCGGAAGGGGCCCCGATAACTGCATCCAATGGGCCCACTACATCGAC GGACCCCACTGCGTGAAAACTTGTCCCGCCGGAGTGATGGGAGAGAATAACACTTTAGTGTGG AAGTACGCCGACGCTGGCCACGTCTGCCATCTGTGCCACCCCAACTGTACCTACGGCTGCACTG GTCCCGGTTTAGAGGGATGTCCTACCAACGGCCCCAAGATCCCCTCCATCGCCACCGGAATGGT GGGCGCTCTGTTATTACTGCTGGTGGTGGCTCTGGGCATCGGTTTATTCATG tEGFRproteinsequenceofFHVH1,FHVH2,FHVH3andFHVH4,335aa(SEQIDNO:16): RKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITG FLLIQAWPENRTDLHAFENLEHRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYA NTINWKKLFGTSGQKTK IISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECI QCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLC HPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM FHVH3VH1,FWVH2VH1andFWVH4VH1CD8?signalpeptidenucleicacidsequence,63bp (SEQIDNO:17) ATGGCCCTACCTGTGACAGCCCTACTGTTACCCCTGGCCCTCCTTCTGCATGCTGCTAGACCT FHVH3VH1,FWVH2VH1andFWVH4VH1CD8?hingeregionnucleicacidsequence:249 bp(SEQIDNO:18) TTTGTGCCTGTATTTCTGCCTGCCAAGCCCACCACAACACCTGCCCCTAGACCACCCACCCCTGC CCCCACCATTGCTTCTCAGCCCCTTAGCTTAAGACCTGAAGCCTGTAGACCTGCTGCTGGGGGG GCTGTGCACACAAGAGGCCTGGACTTTGCCTGTGACATCTACATCTGGGCCCCCCTGGCTGGCA CCTOTGGGGTGCTGCTGCTGAGCCTGGTGATCACCCTGTACTGCAACCACAGAAAC FHVH3VH1,FWVH2VH1andFWVH4VH14-1BBintracellularco-stimulatorydomain nucleicacidsequence,126bp,(SEQIDNO:19) AAGAGAGGCAGAAAGAAGCTGCTGTACATCTTCAAGCAGCCCTTCATGAGACCTGTGCAGACC ACCCAAGAGGAGGATGGCTGCAGCTGCAGATTCCCTGAGGAGGAGGAGGGGGGCTGTGAGCT G FHVH3VH1,FWVH2VH1andFWVH4VH1CD3zintracellularsignalingdomainnucleicacid sequence,336bp(SEQIDNO:20) AGAGTGAAGTTCAGCAGATCTGCTGATGCCCCTGCCTATCAGCAAGGGCAGAATCAGCTGTAC AATGAGCTGAATCTGGGCAGAAGAGAGGAGTATGATGTGCTGGACAAGAGAAGAGGCAGAGA CCCTGAGATGGGGGGCAAGCCTAGAAGAAAGAACCCCCAAGAGGGCCTGTATAATGAGCTGCA GAAGGACAAGATGGCTGAGGCCTACTCTGAGATTGGCATGAAGGGGGAGAGAAGAAGAGGCA AGGGCCATGATGGCCTGTACCAAGGCCTGAGCACAGCCACCAAGGACACCTATGATGCCCTAC ACATGCAAGCTCTGCCTCCTAGA FHVH3VH1,FWVH2VH1andFWVH4VH1cleavingpeptideT2Anucleicacidsequence, 54bp(SEQIDNO:21): GAAGGAAGGGGCAGCCTACTGACCTGTGGGGATGTGGAGGAGAACCCTGGCCCC FHVH3VH1,FWVH2VH1andFWVH4VH1CSF2RAsignalnucleicacidsequence,66bp, (SEQIDNO:22): ATGTTGCTATTAGTAACCAGCCTGCTGCTGTGTGAGCTGCCCCACCCTGCCTTCCTGTTAATCCCA FHVH3VH1,FWVH2VH1andFWVH4VH1tEGFRnucleicacidsequence:1005bp(SEQID NO:23) CGAAAGGTATGTAATGGCATTGGCATTGGGGAGTTTAAGGACAGCCTGAGCATCAATGCCACC AACATCAAGCACTTCAAGAACTGCACAAGCATCAGTGGGGACTTGCACATGCTGCCTGTGGCCT TCAGAGGGGACAGCTTCACCCACACCCCCCCCCTGGACCCCCAAGAGCTGGACATCCTGAAGA CAGTGAAGGAGATCACTGGCTTCTTGCTGATCCAAGCCTGGCCTGAGAACAGAACAGACCTGC ATGCCTTTGAGAACCTGGAGATCATCAGAGGCAGAACCAAGCAGCATGGGCAGTTCAGCCTGG CTGTGGTGAGCCTGAACATCACAAGCCTGGGCCTGAGAAGCTTAAAGGAGATCTCTGATGGGG ATGTGATCATCTCTGGCAACAAGAACCTGTGCTATGCCAACACCATCAACTGGAAGAAGCTGTT TGGCACCTCTGGGCAGAAGACCAAGATCATCAGCAACAGAGGGGAGAACTCCTGTAAGGCCAC TGGCCAAGTGTGTCATGCCCTATGCAGCCCTGAGGGGTGCTGGGGCCCTGAGCCTAGAGACTGT GTGAGCTGCAGAAATGTGAGCAGAGGCAGAGAGTGTGTGGACAAGTGCAACCTGCTGGAGGG GGAGCCTAGAGAGTTTGTGGAGAACTCTGAGTGTATTCAGTGTCATCCTGAGTGCCTGCCCCAA GCCATGAACATCACCTGCACTGGCAGAGGCCCTGACAACTGCATTCAGTGTGCCCACTACATTG ATGGCCCCCACTGTGTGAAGACCTGCCCTGCTGGGGTGATGGGGGAGAACAACACCCTGGTGT GGAAGTATGCTGATGCTGGCCATGTGTGTCACCTGTGCCATCCCAACTGCACCTATGGCTGCAC TGGCCCTGGCCTGGAGGGCTGCCCCACCAATGGTCCCAAGATTCCTAGCATTGCCACTGGCATG GTGGGGGCCCTGCTCCTACTTCTGGTGGTTGCCCTGGGCATTGGCCTGTTCATG FHVH3VH1,FWVH2VH1andFWVH4VH1Linkernucleicacidsequence,45bp(SEQID NO:24) GGGGGGGGGGGGTCTGGGGGGGGTGGCTCAGGTGGCGGTGGCTCT FHVH3VH1,FWVH2VH1andFWVH4VH1Linkerproteinsequence,15aa(SEQIDNO:25) GGGGSGGGGSGGGGS FHVH1:CARnucleicacidsequence,2271bp(SEQIDNO:26): ATGGCCCTGCCTGTGACAGCTCTGCTCCTCCCTCTGGCCCTGCTGCTCCATGCCGCCAGACCCGA AGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGTAGCCTGCGTCTGAGCTGT GCAGCAACCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTCGTCAGGCACCTGGTAAAG GTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGCGGCTATACCTATTATGCAGATAGCGTTAA AGGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTGCAGATGAATAGTCTG CGTGCAGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATCTGGAATACATGGTTTCTC AGGATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCATTCGTGCCCGTGTTCCTGCCCGCC AAACCTACTACTACCCCTGCACCTAGGCCTGCCACCCCAGCCCCAACAATCGCCAGCCAGCCTC TGTCTCTGCGGCCCGAAGCCTGTAGACCTGCTGCCGGCGGAGCCGTGCACACCAGAGGCCTGG ACTTCGCCTGCGACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCTGCTGAG CCTGGTGATCACCCTGTACTGCAACCACCGGAACAAACGGGGCAGAAAGAAACTCCTGTATAT ATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCG ATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGATCCGCCGACGC CCCTGCCTACCAGCAGGGACAGAACCAGCTGTACAACGAGCTGAACCTGGGCAGACGGGAAGA GTACGACGTGCTGGACAAGCGGAGAGGCCGGGACCCCGAGATGGGCGGAAAGCCCAGACGGA AGAACCCCCAGGAAGGCCTGTATAACGAACTGCAGAAAGACAAGATGGCCGAGGCCTACAGC GAGATCGGCATGAAGGGCGAGCGGAGGCGCGGCAAGGGCCACGATGGCCTGTACCAGGGCCT GAGCACCGCCACCAAGGACACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCCAGAGGATC CGGAGAGGGAAGGGGCAGCTTATTAACATGTGGCGATGTGGAAGAGAACCCCGGTCCCATGCT GCTGCTCGTGACCTCTTTACTGTTATGTGAGCTGCCCCACCCCGCTTTTTTACTGATCCCTGGTA AGGTGTGTAACGGAATCGGCATTGGCGAGTTCAAGGACTCTTTAAGCATCAACGCCACAAACA TCAAGCACTTCAAGAATTGTACCTCCATCAGCGGCGATTTACACATTCTCCCCGTGGCTTTTCGT GGCGATTCCTTCACCCACACCCCCCCTCTGGACCCCCAAGAGCTGGACATTTTAAAAACCGTGA AGGAGATCACCGGCTTTCTGCTGATCCAAGCTTGGCCCGAGAATCGTACCGACCTCCACGCCTT CGAGAATTTAGAGATTATTCGTGGAAGGACCAAGCAGCACGGCCAGTTCTCTTTAGCCGTCGTG TCTTTAAACATTACCAGCCTCGGTTTAAGGTCTTTAAAGGAGATTAGCGACGGCGACGTGATCA TCTCCGGCAACAAGAACCTCTGCTACGCCAACACCATCAACTGGAAGAAGCTGTTCGGAACCA GCGGCCAAAAGACCAAGATCATCAGCAATCGTGGAGAGAACTCTTGTAAGGCCACTGGTCAAG TTTGCCACGCCCTCTGTAGCCCCGAAGGATGTTGGGGCCCCGAGCCTAGGGACTGTGTTAGCTG CAGAAACGTGAGCAGAGGCAGAGAGTGTGTGGACAAATGCAATTTACTGGAAGGAGAGCCTA GGGAGTTCGTGGAGAACAGCGAATGTATCCAGTGCCACCCCGAGTGTTTACCTCAAGCCATGA ACATCACTTGTACCGGAAGGGGCCCCGATAACTGCATCCAATGCGCCCACTACATCGACGGAC CCCACTGCGTGAAAACTTGTCCCGCCGGAGTGATGGGAGAGAATAACACTTTAGTGTGGAAGT ACGCCGACGCTGGCCACGTCTGCCATCTGTGCCACGCCAACTGTACCTACGGCTGCACTGGTCC CGGTTTAGAGGGATGTCCTACCAACGGCCCCAAGATCCCCTGCATCGCCACCGGAATGGTGGGC GCTCTGTTATTACTGCTGGTGGTGGCTCTGGGCATCGGTTTATTCATG FHVH1:CARproteinsequence,757aa(SEQIDNO:27): MALPVTALLLPLALLLHAARPEVQLLESGGGLVQPGGSLRLSCAASGFTESHSAMGWVRQAPGKG LEWVSSIYARGGYTYYADSVKGRATISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQD VWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSIRPEACRPAAGGAVHTRGLDFACDI YIWAPLAGTCGVLLLSLVITLYCNHRNKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGC ELRVKESRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNEL QKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGEGRGSLLTCGD VEENPGPMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEPKDSLSINATNIKHFKNCTSISGDLHILPV AFRGDSFTHTPPLDPQELDILKTVKETTGFLLIQAWPENRTDLHAFENLEURGRTKQHGQFSLAVVSL NITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCS PEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDN CIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKI PSIATGMVGALLLLLVVALGIGLFM FHVH3CARnucleicacidsequence.2262bp(SEOIDNO:28): ATGGCCCTGCCTGTGACAGCTCTGCTCCTCCCTCTGGCCCTGCTGCTCCATGCCGCCAGACCCCA GGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCCTG CAAGGCTTCTGGAGGCACCTTCAGCAACTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAA GGGCTTGAGTGGATGGGATGGATCAGCGCCTACAATGGTGACACAAAATATGCACAGAGGCTCC AGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAACC TAAGATCTGACGACACGGCCGTGTATTACTGTGCGCGCTACGAATCTATGTCTGGTCAGGATATCT GGGGTCAAGGTACTCTGGTGACCGTCTCCTCATTCGTGCCCGTGTTCCTGCCCGCCAAACCTACT ACTACCCCTGCACCTAGGCCTCCCACCCCAGCCCCAACAATCGCCAGCCAGCCTCTGTCTCTGCG CCCCGAAGCCTGTAGACCTGCTGCCGGCGGAGCCGTGCACACCAGAGGCCTGGACTTCGCCTG CGACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCTGCTGAGGCTGGTGATCA CCCTGTACTGCAACCACCGGAACAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACC ATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTGCAGAAGAA GAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGATCCGCCGACGCCCCTGCCTACCAG CAGGGACAGAACCAGCTGTACAACGAGCTGAACCTGGGCAGACGGGAAGAGTACGACGTGCTG GACAAGCGGAGAGGCCGGGACCCCGAGATGGGCGGAAAGCCCAGACGGAAGAACCCCCAGGA AGGCCTGTATAACGAACTGCAGAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAA GGGCGAGCGGAGGCGCGGCAAGGGCCACGATGGCCTGTACCAGGGCCTGAGCACCGCCACCAA GGACACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCCAGAGGATCCGGAGAGGGAAGGGG CAGCTTATTAACATGTGGCGATGTGGAAGAGAACCCCGGTCCCATGCTGCTGCTCGTGACCTCTT TACTGTTATGTGAGCTGCCCCACCCCGCTTTTTTACTGATCCCTCGTAAGGTGTGTAACGGAATCG GCATTGGCGAGTTCAAGGACTCTTTAAGCATCAACGCCACAAACATCAAGCACTTCAAGAATTG TACCTCCATCAGCGGCGATTTACACATTCTCCCCGTGGCTTTTCGTGGCGATTCCTTCACCCACAC CCCCCCTCTGGACCCCCAAGAGCTGGACATTTTAAAAACCGTGAAGGAGATCACCGGCTTTCTG CTGATCCAAGCTTGGCCCGAGAATCGTACCGACCTCCACGCCTTCGAGAATTTAGAGATTATTCG TGGAAGGACCAACCAGCACGGCCAGTTCTCTTTAGCCGTCGTGTCTTTAAACATTACCAGCCTGG GTTTAAGGTCTTTAAAGGAGATTAGCGACGGCGACGTGATCATCTCCGGCAACAAGAACCTCTG CTACGCCAACACCATCAACTGGAAGAAGCTGTTCGGAACCAGCGGCCAAAAGACCAAGATCAT CAGCAATCGTGGAGAGAACTCTTGTAAGGCCACTGGTCAAGTTTGCCACGCCCTCTGTAGCCCC GAAGGATGTTGGGGCCCCGAGCCTAGGGACTGTGTTAGCTGCAGAAACGTGAGCAGAGGCAGA GAGTGTGTGGACAAATGCAATTTACTGGAAGGAGAGCCTAGGGAGTTCGTGGAGAACAGCGAA TGTATCCAGTGCCACCCCGAGTGTTTACCTCAAGCCATGAACATCACTTGTACCGGAAGGGGCCC CGATAACTGCATCCAATGCGCCCACTACATCGACGGACCCCACTGCGTGAAAACTTGTCCCGCCG GAGTGATGGGAGAGAATAACACTTTAGTGTGGAAGTACGCCGACGCTGGCCACGTCTGCCATCT GTGCCACCCCAACTGTACCTACGGCTGCACTGGTCCCGGTTTAGAGGGATGTCCTACCAACGGCC CCAAGATCCCCTCCATCGCCACCGGAATGGTGGGCGCTCTGTTATTACTGCTGGTGGTGGCTCTG GGCATCGGTTTATTCATG FHVH3CARproteinsequence,754aa(SEQIDNO:29): MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAISWVRQAPGQGL EWMGWISAYNGDTKYAQRLQGRVTMTIDTSTSTAYMELRNLRSDDTAVYYCARYESMSGQDIWG QGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAP LAGTCGVLLLSIVITLYCNHRNKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKF SRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMA EAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGEGRGSLLTCGDVEENPGP MLLLVTSLLLCELPHPAFLLIPRKYCNGIGIGEFKDSLSINATNIKHFENCTSISGDLHILPVAFRGDSFT HTPPLDPQELDILKTVKETIGFLLIQAWPENKIDLHAFENLEHRGRTKQHGQFSLAVVSLNITSLGLRS LKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEP RDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYID GPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVG ALLLLLVVALGIGLFM FHVH3VH1CARnucleicacidsequence,2262bp(SEQIDNO:30): ATGGCCCTACCTGTGACAGCCCTACTGTTACCCCTGGCCCTCCTTCTGCATGCTGCTAGACCTCAG GTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTG?AGGTCTGCTGC AAGGCTTCTGGAGGCACCTTCAGCAACTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAG GGCTTGAGTGGATGGGATGGATCAGCGCCTACAATGGTGACACAAAATATGCACAGAGGCTCCA GGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAACCT AAGATCTGACGACACGGCCGTGTATTACTGTGCGCGCTACGAATCTATGTCTGGTCAGGATATCTG GGGTCAAGGTACTCTGGTGACCGTCTCCTCAGGGGGGGGGGGGTCTGGGGGGGGTGGCTCAGG TGGCGGTGGCTCTGAACTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGTAGC CTGCGTCTGAGCTGTGCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTCGTCA GGCACCTGGTAAAGGTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGCGGCTATACCTATTATGC AGATAGCGTTAAAGGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTGCAGA TGAATAGTCTGCGTGCAGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATCTGGAATACA TGGTTTCTCAGGATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCATTTGTGCCTGTATTTC TGCCTGCCAAGCCCACCACAACACCTGCCCCTAGACCACCCACCCCTGCCCCCACCATTGCTTCT CAGCCCCTTAGCTTAAGACCTGAAGCCTGTAGACCTGCTGCTGGGGGGGCTGTGCACACAAGAG GCCTGGACTTTGCCTGTGACATCTACATCTGGGCCCCCCTGGCTGGCACCTGTGGGGTGCTGCTG CTGAGCCTGGTGATCACCCTGTACTGCAACCACAGAAACAAGAGAGGCAGAAAGAAGCTGCTG TACATCTTCAAGCAGCCCTTCATGAGACCTGTGCAGACCACCCAAGAGGAGGATGGCTGCAGCT GCAGATTCCCTGAGGAGGAGGAGGGGGGCTGTGAGCTGAGAGTGAAGTTCAGCAGATCTGCTG ATGCCCCTGCCTATCAGCAAGGGCAGAATCAGCTGTACAATGAGCTGAATCTGGGCAGAAGAGA GGAGTATGATGTGCTGGACAAGAGAAGAGGCAGAGACCCTGAGATGGGGGGCAAGCCTAGAAG AAAGAACCCCCAAGAGGGCCTGTATAATGAGCTGCAGAAGGACAAGATGGCTGAGGCCTACTCT GAGATTGGCATGAAGGGGGAGAGAAGAAGAGGCAAGGGCCATGATGGCCTGTACCAAGGCCTG AGCACAGCCACCAAGGACACCTATGATGCCCTACACATGCAAGCTCTGCCTCCTAGAGGCTCTG GGGAAGGAAGGGGCAGCCTACTGACCTGTGGGGATGTGGAGGAGAACCCTGGCCCCATGTTGC TATTAGTAACCAGCCTGCTGCTGTGTGAGCTGCCCCACCCTGCCTTCCTGTTAATCCCACGAAAG GTATGTAATGGCATTGGCATTGGGGAGTTTAAGGACAGCCTGAGCATCAATGCCACCAACATCAA GCACTTCAAGAACTGCACAAGCATCAGTGGGGACTTGCACATCCTGCCTGTGGCCTTCAGAGGG GACAGCTTCACCCACACCCCCCCCCTGGACCCCCAAGAGCTGGACATCCTGAAGACAGTGAAG GAGATCACTGGCTTCTTGCTGATCCAAGCCTGGCCTGAGAACAGAACAGACCTGCATGCCTTTG AGAACCTGGAGATCATCAGAGGCAGAACCAAGCAGCATGGGCAGTTCAGCCTGGCTGTGGTGA GCCTGAACATCACAAGCCTGGGCCTGAGAAGCTTAAAGGAGATCTCTGATGGGGATGTGATCAT CTCTGGCAACAAGAACCTGTGCTATGCCAACACCATCAACTGGAAGAAGCTGTTTGGCACCTCT GGGCAGAAGACCAAGATCATCACCAACAGAGGGGAGAACTCCTGTAAGGCCACTGGCCAAGTG TGTCATGCCCTATGCAGCCCTGAGGGGTGCTGGGGCCCTGAGCCTAGAGACTGTGTGAGCTGCA GAAATGTGAGCAGAGGCAGAGAGTGTGTGGACAAGTGCAACCTGCTGGAGGGGGAGCCTAGA GAGTTTGTGGAGAACTCTGAGTGTATTCAGTGTCATCCTGAGTGCCTGCCCCAAGCCATGAACAT CACCTGCACTGGCAGAGGCCCTGACAACTGCATTCAGTGTGCCCACTACATTGATGGCCCCCACT GTGTGAAGACCTGCCCTGCTGGGGTGATGGGGGAGAACAACACCCTGGTGTGGAAGTATGCTG ATGCTGGCCATGTGTGTCACCTGTGCCATCCCAACTGCACCTATGGCTGCACTGGCCCTGGCCTG GAGGGCTGCCCCACCAATGGTCCCAAGATTCCTAGCATTGCCACTGGCATGGTGGGGGCCCTGC TCCTACTTCTGGTGGTTGCCCTGGGCATTGGCCTGTTCATG FHVH3VH1,CARproteinsequence,890aa(SEQIDNO:31): MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKYSCKASGGTFSNYAISWYRQAPGQGL EWMGWISAYNGDTKYAQRLQGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYESMSGQDIWG QGTLVTVSSGGGGSGGGGSGGGGS EVQLLESGGGLVQPGGSLRLSCAASGFTFSHSAMGWVRQAPGKGLEWVSSIYARGGYTYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQDVWGQGTLVTVSSFVPVFLPAKP TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAYHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCN HRNKRGRKKLLVIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKESRSADAPAYQQGQNQLY NELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPROSGEGRGSLLTCGDVEENPGPMLLLVTSLLLCELPHPAFL LIPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHIPPLDPQELDILKTVKEI TGFLLIQAWPENKTDLHAFENLEIIRGRTKQHGQFSLAVVSLNTTISLGLRSLKEISDGDVIISGNKNLCY ANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVD KCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENN TLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM FHVH1:sdAbnucleicacidsequence,363bp(SEQIDNO:32) GAAGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGTAGCCTGCGTCTGACCT GTGCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTCGTCAGGCACCTGGTAAA GGTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGCGGCTATACCTATTATGCAGATAGCGTTAAA GGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTGCAGATGAATAGTCTGCGT GCAGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATCTGGAATACATGGTTTCTCAGGAT GTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA FHVH1:sdAbproteinsequence,121aa(SEQIDNO:33) EVQLLESGGGLVQPGGSLRLSCAASGFTFSHSAMGWVRQAPGKGLEWVSSIYARGGYTYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQDVWGQGTLVTVSS FHVH3:sdAbnucleicacidsequence,354bp(SEQIDNO:34) CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCC TGCAAGGCTTCTGGAGGCACCTTCAGCAACTATGCTATCAGCTGGGTGCGACAGGCCCCTGGAC AAGGGCTTGAGTGGATGGGATGGATCAGCGCCTACAATGGTGACACAAAATATGCACAGAGGCT CCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAA CCTAAGATCTGACGACACGGCCGTGTATTACTCTGCGCGCTACGAATCTATGTCTGGTCAGGATAT CTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA FHVH3:sdAbproteinsequence,118aa(SEQIDNO:35) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAISWVRQAPGQGLEWMGWISAYNGDTKYAQRL QGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYESMSGQDIWGQGTLVTVSS FHVH3VH1sdAbnucleicacidsequence,762bp(SEQIDNO:36): CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGGTGAAGGTCTCC TGCAAGGCTTCTGGAGGCACCTTCAGCAACTATGCTATCAGCTGGGTGCGACAGGCCCCTGGAC AAGGGCTTGAGTGGATGGGATGGATCAGCGCCTACAATGGTGACACAAAATATGCACAGAGGCT CCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTACATGGAGCTGAGGAA CCTAAGATCTGACGACACGGCCGTGTATTACTGTGCGCGCTACGAATCTATGTCTGGTCAGGATAT CTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCAGGGGGGGGGGGCTCTGGGGGGGGTGGCTC AGGTGGCGGTGGCTCTGAAGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGT AGCCTGCGTCTGAGCTGTGCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTCG TCAGGCACCTGGTAAAGGTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGGGGCTATACCTATT ATGCAGATAGCGTTAAAGGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTG CAGATGAATAGTCTGCGTGCAGAGGATACCGCACTGTATTATTGTGCGCGCGGTTACCATCTGGA ATACATGGTTTCTCAGGATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA FHVH3VH1sdAbproteinsequence,254aa(SEQIDNO:37): QVQLVQSGAEVKKPGSSVKVSCKASGGTESNYAISWVRQAPGQGLEWMGWISAYNGDTKYAQRL QGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYESMSGQIWGQGTLVTVSSGGGGSGGGGSG GGGSEVQLLESGGGLVQPGGSLRLSCAASGFTEFSHSAMGWVRQAPGKGLEWVSSIYARGGYTYYA DSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQDVWGQGTLVTVSS CDRsequenceofFHVH1: TheaminoacidsequenceofHCDR1isGFTFSHSA(SEQIDNO:38); TheaminoacidsequenceofHCDR2isIYARGGYT(SEQIDNO:39); TheaminoacidsequenceofHCDR3isARGYHLEYMVSQDV(SEQIDNO:40); CDRsequenceofFHVH3: TheaminoacidsequenceofHCDR1isGGTFSNYA(SEQIDNO:41); TheaminoacidsequenceofHCDR2isISAYNGDT(SEQIDNO:42); TheaminoacidsequenceofHCDR3isARYESMSGQDI(SEQIDNO:43); FHVH1VH3CARnucleicacidsequence(SEQIDNO:44) ATGGCCCTGCCTGTGACAGCTCTGCTCCTCCCTCTGGCCCTGCTGCTCCATGCCGCCAGACCCGA AGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGTAGCCTGCGTCTGAGCTGT GCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTCGTCAGGCACCTGGTAAAGG TCTGGAATGGGTTAGCAGCATCTATGCCCGCCGCGGCTATACCTATTATGCAGATAGCGTTAAAGG TCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTGCAGATGAATAGTCTGCGTGC AGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATCTGGAATACATGGTTTCTCAGGATGT TTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCAGGGGGGGGGGGCTCTGGGGGGGGTGGCTC AGGTGGCGGTGGCTCTCAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTC CTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAACTATGCTATCAGCTGGGTGC GACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCCTACAATGGTGACACAA AATATGCACAGAGGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGCACAGCCTA CATGGAGCTGAGGAACCTAAGATCTGACGACACGGCCGTGTATTACTGTGCGCGCTACGAATCTA TGTCTGGTCAGGATATCTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCATTCGTGCCCGTGTTC CTGCCCGCCAAACCTACTACTACCCCTGCACCTAGGCCTCCCACCCCAGCGCCAACAATCGCCAG CCAGCCTCTGTCTCTGCGGCCCGAAGCCTGTAGACCTGCTGCCGGCGGAGCCGTGCACACCAGA GGCCTGGACTTCGCCTGCGACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCT GCTGAGCCTGGTGATCACCCTGTACTGCAACCACCGGAACAAACGGGGCAGAAAGAAACTCCT GTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCT GCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGATCCGCCG ACGCCCCTGCCTACCAGCAGGGACAGAACCAGCTGTACAACGAGCTGAACCTGGGCAGACGGG AAGAGTACGACGTGCTGGACAAGCGGAGAGGCCGGGACCCCGAGATGGGCGGAAAGCCCAGA CGGAAGAACCCCCAGGAAGGGCTGTATAACGAACTGCAGAAAGACAAGATGGCCGAGGCCTAC AGCGAGATCGGCATGAAGGGCGAGCGGAGGCGCGGCAAGGGCCACGATGGCCTGTACCAGGGC CTGAGCACCGCCACCAAGGACACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCCAGAGGAT CCGGAGAGGGAAGGGGCAGCTTATTAACATGTGGCGATGTGGAAGAGAACCCCGGTGCCATGCT GCTGCTCGTGACCTCTTTACTGTTATGTGAGCTGCCCCACCCCGCTTTTTTACTGATCCCTGGTAA GGTGTGTAACGGAATCGGCATTGGCGAGTTCAAGGACTCTTTAAGCATCAACGCCACAAACATC AAGCACTTCAAGAATTGTACCTCCATCAGCGGCGATTTACACATTCTCCCCGTGGCTTTTCGTGG CGATTCCTTCACCCACACCCCCCCTCTGGACCCCCAAGAGCTGGACATTTTAAAAACCGTGAAG GAGATCACCGGCTTTCTGCTGATCCAAGCTTGGCCCGAGAATCGTACCGACCTCCACGCCTTGGA GAATTTAGAGATTATTCGTGGAAGGACCAAGCAGCACGGCCAGTTCTCTTTAGCCGTCGTGTCTT TAAACATTACCAGCCTCGGTTTAAGGTCTTTAAAGGAGATTAGCGACGGCGACGTGATCATCTCC GGCAACAAGAACCTCTGCTACGCCAACACCATCAACTGGAAGAAGCTGTTCGGAACCAGCGGC CAAAAGACCAAGATCATCAGCAATCGTGGAGAGAACTCTTGTAAGGCCACTGGTCAAGTTTGCC ACGCCCTCTGTAGCCCCGAAGGATGTTGGGGCCCCG?GCCTAGGGACTGTGTTAGCTGCAGAAA CGTGAGCAGAGGCAGAGAGTGTGTGGACAAATGCAATTTACTGGAAGGAGAGCCTAGGGAGTT CGTGGAGAACAGCGAATGTATCCAGTGCCACCCCGAGTGTTTACCTCAAGCCATGAACATCACTT GTACCGGAAGGGGCCCCGATAACTGCATCCAATGCGCCCACTACATCGACGGACCCCACTGCGT GAAAACTTGTCCCCCCGGAGTGATGGGAGAGAATAACACTTTAGTGTGGAAGTACGCCGACGCT GGCCACGTCTGCCATCTGTGCCACCCCAACTGTACCTACGGCTGCACTGGTCCCGGTTTAGAGGG ATGTCCTACCAACGGCGCCAAGATCCCCTCCATCGCCACCGGAATGGTGGGCGCTCTGTTATTAC TGCTGGTGGTGGCTCTGGGCATCGGTTTATTCATG FHVH1VH3CARaminoacidsequence(SEQIDNO:45) MALPVTALLLPLALLLHAARPEVQLLESGGGLVQPGGSLRLSCAASGFTFSHSAMGWVRQAPGKG LEWVSSIYARGGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQD VWGQGTLVTVSSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYAISWV ROAPGQGLEWMGWISAYNGDTKYAQRLQGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYES MSGQDIWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD FACDIYTWAPLAGTCGVLLLSLVITLYCNHRNKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPRE EEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGEGRGSL LTCGDVEENPGPMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLSINATNIKHEKNCTSISGDL HILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSL AVVSLNITSLGLRSLKEISDGDVIISGNKVLCYANTINWKKLFGTSGQKTKHSNRGENSCKATGQVC HALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTG RGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCP TNGPKIPSIATGMVGALLLLLVVALGIGLFM FHVH1VH3sdAbnucleicacidsequence(SEQIDNO:46) GAAGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGTAGCCTGCGTCTGAGCT GTGCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTCGTCAGGCACCTGGTAA AGGTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGCGGCTATACCTATTATGCAGATAGCGTT AAAGGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTGCAGATGAATAGTC TGCGTGCAGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATCTGGAATACATGGTTTC TCAGGATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCAGGGGGGGGGGGGTCTGGGGG GGGTGGCTCAGGTGGCGGTGGCTCTCAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAA GCCTGGCTCCTCGGTGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAACTATGCTATC AGCTGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGCCTACAAT GGTGACACAAAATATGCACAGAGGCTCCAGGGCAGAGTCACCATGACCACAGACACATCCACG AGCACAGCCTACATGGAGCTGAGGAACCTAAGATCTGACGACACGGCCGTGTATTACTGTGCG CGCTACGAATCTATGTCTGGTCAGGATATCTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCA FHVH1VH3sdAbaminoacidsequence(SEQIDNO:47) EVQLLESGGGLVQPGGSLRISCAASGFTFSHSAMGWVRQAPGKGLEWVSSIYARGGYTYYADSVK GRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQDVWGQGTLVTVSSGGGGSGGG GSGGGGSQVQLVQSGAEVEKPGSSVKVSCKASGGTFSNYAISWVRQAPGQGLEWMGWISAYNGD TKYAQRLQGRVTMTTDTSTSTAYMELRNLRSDDTAVYYCARYESMSGQDIWGQGTLVTVSS FHVH2CARnucleicacidsequence(SEQIDNO:48) ATGGCCCTGCCTGTGACAGCTCTGCTCCTCCCTCTGGCCCTGCTGCTCCATGCCGCCAGACCCCA GGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGAGGGTCCCTGAGACTCTCCTGT GCAGCCTCTGGATTCACCTTCAGTAGTTATGAAATGAACTGGGTCCGCCAGGCTGCAGGGAAGG GGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTACGCAGACTCTGTGAAG GGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGAACAGTCTGA GAGCCGAGGACACGGCTGTTTATTACTGTGCGAGAGTCGCCCAGAGAGAAGGGGACGTCTGGG GCAAAGGGACCACGGTCACCGTCTCCTCATTCGTGCCCGTGTTGCTGCCCGCCAAACCTACTACT ACCCCTGCACCTAGGCCTCCCACCCCAGCCCCAACAATCGCCAGCCAGCCTCTGTCTCTGCGGC CCGAAGCCTGTAGACCTGCTGCCGGCGGAGCCGTGCACACCAGAGGCCTGGACTTCGCCTGCG ACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCTGCTGCTGAGCCTGGTGATCACC CTGTACTGCAACCACCGGAACAAACGGGGCAGAAAGAAACTGCTGTATATATTCAAACAACCAT TTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGA AGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGATCCGCCGACGCCCCTGCCTACCAGCA GGGACAGAACCAGCTGTACAACGAGCTGAACCTGGGCAGACGGGAAGAGTACGACGTGCTGGA CAAGCGGAGAGGCCGGGACCCCGAGATGGGGGGAAAGCCCAGACGGAAGAACCCCCAGGAAG GCCTGTATAACGAACTGCAGAAAGACAAGATGGCCGAGGCCTACAGCGAGATCGGCATGAAGG GCGAGCGGAGGCGCGGCAAGGGCCACGATGGCCTGTACCAGGGCCTGAGCACCGCCACCAAGG ACACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCCAGAGGATCCGGAGAGGGAAGGGGCA GCTTATTAACATGTGGCGATGTGGAAGAGAACCCCGGTCCCATGCTGCTGCTCGTGACCTCTTTA CTGTTATGTGAGCTGCCCCACCCCGCTTTTTTACTGATCCCTCGTAAGGTGTGTAACGGAATCGGC ATTGGCGAGTTCAAGGACTCTTTAAGCATCAACGCCACAAACATCAAGCACTTCAAGAATTGTAC CTCCATCAGCGGCGATTTACACATTCTCCCCGTGGCTTTTCGTGGCGATTCCTTCACCCACACCCC CCCTCTGGACCCCCAAGAGCTGGACATTTTAAAAACCGTGAAGGAGATCACCGGCTTTCTGCTG ATCCAAGCTTGGCCCGAGAATCGTACCGACCTCCACGCCTTCGAGAATTTAGAGATTATTCGTGG AAGGACCAAGCAGCACGGCCAGTTCTCTTTAGCCGTCGTGTCTTTAAACATTACCAGCCTCGGTT TAAGGTCTTTAAAGGAGATTAGCGACGGCGACGTGATCATCTCCGGCAACAAGAACCTCTGCTA CGCCAACACCATCAACTGGAAGAAGCTGTTCGGAACCAGCGGCCAAAAGACCAAGATCATCAG CAATCGTGGAGAGAACTCTTGTAAGGCCACTGGTCAAGTTTGCCACGCCCTCTGTAGCCCCGAA GGATGTTGGGGCCCCGAGCCTAGGGACTGTGTTAGCTGCAGAAACGTGAGCAGAGGCAGAGAG TGTGTGGACAAATGCAATTTACTGGAAGGAGAGCCTAGGGAGTTCGTGGAGAACAGCGAATGTA TCCAGTGCCACCCCGAGTGTTTACCTCAAGCCATGAACATCACTTGTACCGGAAGGGGCCCCGAT AACTGCATCCAATGCCCCCACTACATCGACGGACCCCACTGCGTGAAAACTTGTCCCGCCGGAG TGATGGGAGAGAATAACACTTTAGTGTGGAAGTACGCCGACGCTGGCCACGTCTGCCATCTGTG CCACCCCAACTGTACCTACGGCTGCACTGGTCCCGGTTTAGAGGGATGTCCTACCAACGGCCCCA AGATCCCCTCCATCGCCACCGGAATGGTGGGCGCTCTGTTATTACTGCTGGTGGTGGCTCTGGGC ATCGGTTTATTCATG FHVH2CARproteinsequence(SEQIDNO:49) MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEMNWVRQAPGKG LEWYSYISSSGSTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVAQREGDVWGK GTTVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAP LAGTCGVLLLSLVITLYCNHRNKRGRKELLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVK FSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKM AEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGEGRGSLLTCGDVEENPG PMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDS FTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLG LRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCW GPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCA HYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIAT GMYGALLLLLVVALGIGLFM FHVH4CARnucleicacidsequence(SEQIDNO:50) ATGGCCCTGCCTGTGACAGCTCTGCTCCTCCCTCTGGCCCTGCTGCTCCATGCCGCCAGACCCCA GGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAAAAGCCCGGGGAGTCTCTGAGGATCTCCTG TAAGGCTTCTGGATACAGTTTTAGCAACCATTGGATCGGCTGGGTGCGCCAGAAGCCCGGGAA AGGCCTGGAGTGGATGGGGAGCGTCTATCCTGGTGACTCCGATACCAGATACAGCCCGTCCTTC CAAGGCCACGTCACTGTCTCAGCCGACAAGTCCATGAATACCGCCTACCTGCAGTGGAGCAGC CTGAAGACCTCGGACACCGCCATGTATTATTGTGCGAGAGGTGGGACTATTGACGGTGACTACGT GGGGGAGGCAAGACTTCTGGGGCCAGGGAACCATGGTCACCGTCTCTTCATTCGTGCCCGTGTT CCTGCCCGCCAAACCTACTACTACCCCTGCACCTAGGCCTCCCACCCCAGCCCCAACAATCGCC AGCCAGCCTCTGTCTCTGCGGCCCGAAGCCTGTAGACCTGCTGCCGGCGGAGCCGTGCACACCA GAGGCCTGGACTTCGCCTGCGACATCTACATCTGGGCCCCTCTGGCCGGCACCTGTGGCGTGCT GCTGCTGAGCCTGGTGATCACCCTGTACTGCAACCACCGGAACAAACGGGGCAGAAAGAAACT CCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGT AGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAGAGTGAAGTTCAGCAGATCC GCCGACCCCCCTGCCTACCAGCAGGGACAGAACCAGCTGTACAACGAGCTGAACCTGGGCAGA CGGGAAGAGTACGACGTGCTGGACAAGCGGAGAGGCCGGGACCCCGAGATGGGCGGAAAGCC CAGACGGAAGAACCCCCAGGAAGGCCTGTATAACGAACTGCAGAAAGACAAGATGGCCGAGG CCTACAGCGAGATCGGCATGAAGGGCGAGCGGAGGCGCGGCAAGGGCCACGATGGCCTGTAC CAGGGCCTGAGCACCGCCACCAAGGACACCTACGACGCCCTGCACATGCAGGCCCTGCCCCCC AGAGGATCCGGAGAGGGAAGGGGCAGCTTATTAACATGTGGCGATGTGGAAGAGAACCCCGG TCCCATGCTGCTGCTCGTGACCTCTTTACTGTTATGTGAGCTGCCCCACCCCGCTTTTTTACTGAT CCCTCGTAAGGTGTGTAACGGAATCGGCATTGGCGAGTTCAAGGACTCTTTAAGCATCAACGCC ACAAACATCAAGCACTTCAAGAATTGTACCTCCATCAGCGGCGATTTACACATTCTCCCCGTGG CTTTTCGTGGCGATTCCTTCACCCACACCCCCCCTCTGGACCCCCAAGAGCTGGACATTTTAAAA ACCGTGAAGGAGATCACCGGCTTTCTGCTGATCCAAGCTTGGCCCGAGAATCGTACCGACCTCC ACGCCTTCGAGAATTTAGAGATTATTCGTGGAAGGACCAAGCAGCACGGCCAGTTCTCTTTAGC CGTCGTGTCTTTAAACATTACCAGCCTCGGTTTAAGGTCTTTAAAGGAGATTAGCGACGGCGAC GTGATCATCTCCGGCAACAAGAACCTCTGCTACGCCAACACCATCAACTGGAAGAAGCTGTTGG GAACCAGCGGCCAAAAGACCAAGATCATCAGCAATCGTGGAGAGAACTCTTGTAAGGCCACTG GTCAAGTTTGCCACGCCCTCTGTAGCCCCGAAGGATGTTGGGGCCCCGAGCCTAGGGACTGTGT TAGCTGCAGAAACGTGAGCAGAGGCAGAGAGTGTGTGGACAAATGCAATTTACTGGAAGGAG AGCCTAGGGAGTTCGTGGAGAACAGCGAATGTATCCAGTGCCACCCCGAGTGTTTACCTCAAG CCATGAACATCACTTGTACCGGAAGGGGCCCCGATAACTGCATCCAATGCGCCCACTACATCGA CGGACCCCACTGCGTGAAAACTTGTCCCGCCGGAGTGATGGGAGAGAATAACACTTTAGTGTG GAAGTACGCCGACGCTGGCCACGTCTGCCATCTGTGCCACCCCAACTGTACCTACGGCTGCACT GGTCCCGGTTTAGAGGGATGTCCTACCAACCGCCCCAAGATCCCCTCCATCGCCACCGGAATGG TGGGCGCTCTGTTATTACTGCTGGTGGTGGCTCTGGGCATCGGTTTATTCATG FHVH4CARproteinsequence(SEQIDNO:51) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGESLRISCKASGYSFSNHWIGWVRQKPGKGL EWMGSVYPGDSDTRYSPSFQGHVTVSADKSMNTAYLQWSSLKTSDTAMYYCARGGTIDGDYGGR QDFWGQGTMVTVSSPVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCNHRNKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEE GGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGEGRGSLLT CGDVEENPGPMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHI LPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAV YSLNITSLGLRSLKEISDGDVISGNKNLCYANTINWKKLEGTSGQKTKIISNROENSCKATGQVCHA LCSPECCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRG PDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTN GPKIPSIATGMVGALLLLLVVALGIGLEM FHVH2VH1CARnucleicacidsequence(SEQIDNO:52) ATGGCCCTACCTGTGACAGCCCTACTGTTACCCCTGGCCCTCCTTCTGCATGCTGCTAGACCTCA GGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGAGGGTCCCTGAGACTCTCCTGT GCAGCCTCTGGATTCACCTTCAGTAGTTATGAAATGAACTGGGTCCGCCAGGCTCCAGGGAAGG GGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTACGCAGACTCTGTGAA GGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGA?CAGTCT GAGAGCCGAGGACACGGCTGTTTATTACTGTGCGAGAGTCGCCCAGAGAGAAGGGGACGTCTG GGGCAAAGGGACCACGGTCACCGTCTCCTCAGGGGGGGGGGGCTCTGGGGGGGGTGGCTCAGG TGCCGGTGGCTCTGAAGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGTAGC CTGCGTCTGAGCTGTGCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTGGTC AGGCACCTGGTAAAGGTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGCGGCTATACCTATTA TGCAGATAGCGTTAAAGGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTACCTG CACATGAATAGTCTGCGTGCAGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATCTGG AATACATGGTTTCTCAGGATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCATTTGTGCCT GTATTTCTGCCTGCCAAGCCCACCACAACACCTGCCCCTAGACCACCCACCCCTGCCCCCACCA TTGCTTCTCAGCCCCTTAGCTTAAGACCTGAAGCCTGTAGACCTGCTGCTGGGGGGGCTGTGCA CACAAGAGGCCTGGACTTTGCCTGTGACATCTACATCTGGGCCCCCCTGGCTGGCACCTGTGGG GTGCTGCTGCTGAGCCTGGTGATCACCCTGTACTGCAACCACAGAAACAAGAGAGGCAGAAAG AAGCTGCTGTACATCTTCAAGCAGCCCTTCATGAGACCTGTGCAGACCACCCAAGAGGAGGAT GGCTGCAGCTGCAGATTCCCTGAGGAGGAGGAGGGGGGCTGTGAGCTGAGAGTGAAGTTCAGC AGATCTGCTGATGCCCCTGCCTATCAGCAAGGGCAGAATCAGCTGTACAATGAGCTGAATCTGG GCAGAAGAGAGGAGTATGATGTGCTGGACAAGAGAAGAGGCAGAGACCCTGAGATGGGGGGC AAGCCTAGAAGAAAGAACCCCCAAGAGGGCCTGTATAATGAGCTGCAGAAGGACAAGATGGC TGAGGCCTACTCTGAGATTGGCATGAAGGGGGAGAGAAGAAGAGGCAAGGGCCATGATGGCC TGTACCAAGGCCTGAGCACAGCCACCAAGGACACCTATGATGCCCTACACATGCAAGCTCTGC CTCCTAGAGGCTCTGGGGAAGGAAGGGGCAGCCTACTGACCTGTGGGGATGTGGAGGAGAACC CTGGCCCCATGTTGCTATTAGTAACCAGCCTGCTGCTGTGTGAGCTGCCCCACCCTGCCTTCCTG TTAATCCCACGAAAGGTATGTAATGGCATTGGCATTGGGGAGTTTAAGGACAGCCTGAGCATC AATGCCACCAACATCAAGCACTTCAAGAACTGCACAAGCATCAGTGGGGACTTGCACATCCTG CCTGTGGCCTTCAGAGGGGACAGCTTCACCCACACCCCCCCCCTGGACCCCCAAGAGCTGGACA TCCTGAAGACAGTGAAGGAGATCACTGGCTTCTTGCTGATCCAAGCCTGGCCTGAGAACAGAA CAGACCTGCATGCCTTTGAGAACCTGGAGATCATCAGAGGCAGAACCAAGCAGCATGGGCAGT TCAGCCTGGCTGTGGTGAGCCTGAACATCACAAGCCTGGGCCTGAGAAGCTTAAAGGAGATCT CTGATGGGGATGTGATCATCTCTGGCAACAAGAACCTGTGCTATGCCAACACCATCAACTGGAA GAAGCTGTTTGGCACCTCTGGGCAGAAGACCAAGATCATCAGCAACAGAGGGGAGAACTGCTG TAAGGCCACTGGCCAAGTGTGTCATGCCCTATGCAGCCCTGAGGGGTGCTGGGGCCCTGAGCCT AGAGACTGTGTGAGCTGCAGAAATGTGAGCAGAGGCAGAGAGTGTGTGGACAAGTGCAACCTG CTGGAGGGGGAGCCTAGAGAGTTTGTGGAGAACTCTGAGTGTATTCAGTGTCATCCTGAGTGCC TGCCCCAAGCCATGAACATCACCTGCACTGGCAGAGGCCCTGACAACTGCATTCAGTGTGCCCA CTACATTGATGGCCCCCACTGTGTGAAGACCTGCCCTGCTGGGGTGATGGGGGAGAACAACAC CCTGGTGTGGAAGTATGCTGATGCTGGCCATGTGTGTCACCTGTGCCATCCCAACTGCACCTAT GGCTGCACTGGCCCTGGCCTGGAGGGCTGCCCCACCAATGGTCCCAAGATTCCTAGCATTGCCA CTGGCATGGTGGGGGCCCTGCTCCTACTTCTGGTGGTTGCCCTGGGCATTGGCCTGTTCATG FHVH2VH1CARproteinsequence(SEQIDNO:53) MALPVTALLLPLALLLHAARPQVQLVESGGGLVQPGGSLRLSCAASGFTESSYEMNWVRQAPGKG LEWYSYISSSGSTIYYADSVEGRETISRDNAKNSLYLQMNSLRAEDTAVYYCARVAQREGDYWGK GTTVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAASGFTFSHSAMGWVRQAPG KGLEWVSSIYARGGYTYYADSVKGRFTISRDNSKNTLYLQMNSERAEDTAVYYCARGYHLEYMVS QDVWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYTWAPLAGTCGVLLLSLVTILYCNHRNKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEE GGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGEGRGSLLT CGDVEENPGPMLLLVTSLLLCELPHPAFLLIPRKVCNGIGHIGEFKDSLSINATNIKHFKNCTSISGDLHI LPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAV VSINITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHA LCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREPVENSECIQCHPECLPQAMNITCTGRG PDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTN GPKIPSIATGMVGALLLLLVVALGIGLFM FHVH4VH1CARnucleicacidsequence(SEQIDNO:54) ATGGCCCTACCTGTGACAGCCCTACTGTTACCCCTGGCCCTCCTTCTGCATGCTGCTAGACCTCA GGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAAAAGCCCGGGGAGTCTCTGAGGATCTGCTG TAAGGCTTCTGGATACAGTTTTAGCAACCATTGGATCGGCTGGGTGCGCCAGAAGCCCGGGAA AGGCCTGGAGTGGATGGGGAGCGTCTATCCTGGTGACTCCGATACCAGATACAGCCCGTCCTTC CAAGGCCACGTCACTGTCTCAGCCGACAAGTCCATGAATACCGCCTACCTGCAGTGGAGCAGC CTGAAGACCTCGGACACCGCCATGTATTATTGTGCGAGAGGTGGGACTATTGACGGTGACTACG GGGGGAGGCAAGACTTCTGGGGCCAGGGAACCATGGTCACCGTCTCTTCAGGGGGGGGGGGCT CTGGGGGGGGTGGCTCAGGTGGCGGTGGCTCTGAAGTTCAGCTGCTGGAAAGCGGTGGTGGTC TGGTTCAGCCTGGTGGTAGCCTGCGTCTGAGCTGTGCAGCAAGCGGTTTTACCTTTAGCCATAG CGCCATGGGTTGGGTTCGTCAGGCACCTGGTAAAGGTCTGGAATGGGTTAGCAGCATCTATGCC CGCGGCGGCTATACCTATTATGCAGATAGCGTTAAAGGTGGTTTTACCATTAGCCGTGATAACA GCAAAAATACCCTGTACCTGCAGATGAATAGTCTGCGTGCAGAGGATACCGCAGTGTATTATTG TGCGCGCGGTTACCATCTGGAATACATGGTTTCTCAGGATGTTTGGGGTCAAGGTACTCTGGTG ACCGTCTCCTCATTTGTGCCTGTATTTCTGCCTGCCAAGCCCACCACAACACCTGCCCCTAGACC ACCCACCCCTGCCCCCACCATTGCTTCTCAGCCCCTTAGCTTAAGACCTGAAGCCTGTAGACCT GCTGCTGGGGGGGCTGTGCACACAAGAGGCCTGGACTTTGCCTGTGACATCTACATCTGGGCCC CCCTGGCTGGCACCTGTGGGGTGCTGCTGCTGAGCCTGGTGATCACCCTGTACTGCAACCACAG AAACAAGAGAGGCAGAAAGAAGCTGCTGTACATCTTCAAGCAGCCCTTCATGAGACCTGTGCA GACCACCCAAGAGGAGGATGGCTGCAGCTGCAGATTCCCTGAGGAGGAGGAGGGGGGCTGTG ACCTGAGAGTGAAGTTCAGCAGATCTGCTGATGCCCCTGCCTATCAGCAAGGGCAGAATCAGC TGTACAATGAGCTGAATCTGGGCAGAAGAGAGGAGTATGATGTGCTGGACAAGAGAAGAGGC AGAGACCCTGAGATGGGGGGCAAGCCTAGAAGAAAGAACCCCCAAGAGGGGCTGTATAATGA GCTGCAGAAGGACAAGATGGCTGAGGCCTACTCTGAGATTGGCATGAAGGGGGAGAGAAGAA GAGGCAAGGGCCATGATGGCCTGTACCAAGGGCTGAGCACAGCCACCAAGGACACCTATGATG CCCTACACATGCAAGCTCTGCCTCCTAGAGGCTCTGGGGAAGGAAGGGGCAGCCTACTGACCT GTGGGGATGTGGAGGAGAACCCTGGCCCCATGTTGCTATTAGTAACCAGCCTGCTGCTGTGTGA GCTGCCCCACCCTGCCTTCCTGTTAATCCCACGAAAGGTATGTAATGGCATTGGCATTGGGGAG TTTAAGGACAGCCTGAGCATCAATGCCACCAACATCAAGCACTTCAAGAACTGCACAAGCATG AGTGGGGACTTGCACATCCTGCCTGTGGCCTTCAGAGGGGACAGCTTCACCCACACCCCCCCCC TGGACCCCCAAGAGCTGGACATCCTGAAGACAGTGAAGGAGATCACTGGCTTCTTGCTGATCC AAGCCTGGCCTGAGAACAGAACAGACCTGCATGCCTTTGAGAACCTGGAGATCATCAGAGGCA GAACCAAGCAGCATGGGCAGTTCAGCCTGGCTGTGGTGAGCCTGAACATCACAAGCCTGGGCC TGAGAAGCTTAAAGGAGATCTCTGATGGGGATGTGATCATCTCTGGCAACAAGAACCTGTGCT ATGCCAACACCATCAACTGGAAGAAGCTGTTTGGCACCTCTGGGCAGAAGACCAAGATCATCA GCAACAGAGGGGAGAACTCCTGTAAGGCCACTGGCCAAGTGTGTCATGCCCTATGCAGCCCTG AGGGGTGCTGGGGCCCTGAGCCTAGAGACTGTGTGAGCTGCAGAAATGTGAGCAGAGGCAGAG AGTGTGTGGACAAGTGCAACCTGCTGGAGGGGGAGCCTAGAGAGTTTGTGGAGAACTCTGAGT GTATTCAGTGTCATCCTGAGTGCCTGCCCCAAGCCATGAACATCACCTGCACTGGCAGAGGCCC TGACAACTGCATTCAGTGTGCCCACTACATTGATGGCCCCCACTGTGTGAAGACCTGCCCTGCT GGGGTGATGGGGGAGAACAACACCCTGGTGTGGAAGTATGCTGATGCTGGCCATGTGTGTCAC CTGTGCCATGCCAACTGCACCTATGGCTGCACTGGCCCTGGCCTGGAGGGCTGCCCCACCAATG GTCCCAAGATTCCTAGCATTGCCACTGGCATGGTGGGGGCCCTGCTCCTACTTCTGGTGGTTGC CCTGGGCATTGGCCTGTTCATG FHVH4VH1CARproteinsequence(SEQIDNO:55) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGESLRISCKASGYSFSNHWIGWVRQKPGKGL EWMGSVYPGDSDTRYSPSFQGHVTVSADKSMNTAYLQWSSLKTSDTAMYYCARGGTIDGDYGGR QDFWGQGTMVTVSSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAASGFTFSHSAMG WVRQAPGKGLEWVSSIYARGGYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARG YHLEYMVSQDVWGQGTLVTVSSFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSERPEACRPAAGGAV HIRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNKRGRKKLLYIFKQPFMRPVQTTQEEDGCS CRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGE GRGSLLTCGDVEENPGPMLLLVTSLLLCELPHPAFLLIPRKVCNGIGIGEFKDSLSINATNIKHFKNCT SISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQH GQPSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKHISNRGENSCKAT GQYCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDECNLLEGEPREFVENSECIQCHPECLPQAMN ITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHYCHLCHPNCTYGCTGPGL EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFM FHVH2sdAbnucleicacidsequence(SEQIDNO:56) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGAGGGTCCCTGAGACTCTCC TGTGCAGCCTCTGGATTCACCTTCAGTAGTTATGAAATGAACTGGGTCCGCCAGGCTCCAGGGA AGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTACGCAGACTCTGT GAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGAACAG TCTGAGAGCCGAGGACACGGCTGTTTATTACTGTGCGAGAGTCGCCCAGAGAGAAGGGGACGT CTGGGGCAAAGGGACCACGGTCACCGTCTCCTCA FHVH2sdAbproteinsequence(SEQIDNO:57) QVQLVESGGGLVQPGGSLRLSCAASGETESSYEMNWVRQAPGKGLEWYSYISSSGSTIYYADSVKG RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVAQREGDVWGKGTTVTVSS FHVH4sdAbnucleicacidsequence(SEQIDNO:58) CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAAAAGCCCGGGGAGTCTCTGAGGATCTCC TGTAAGGCTTCTGGATACAGTTTTAGCAACCATTGGATCGGCTGGGTGCGCCAGAAGCCCGGGA AAGGCCTGGAGTGGATGGGGAGCGTCTATCCTGGTGACTCCGATACCAGATACAGCCCGTCCTT CCAAGGCCACGTCACTGTCTCAGCCGACAAGTCCATGAATACCGCCTACCTGCAGTGGAGCAG CCTGAAGACCTGGGACACCGCCATGTATTATTGTGCGAGAGGTGGGACTATTGACGGTGACTAC GGGGGGAGGCAAGACTTCTGGGGCCAGGGAACCATGGTCACCGTCTCTTCA FHVH4sdAbproteinsequence(SEQIDNO:59) QVQLYQSGAEVKKPGESLRISCKASGYSESNHWIGWVRQKPGKGLEWMGSVYPGDSDTRYSPSFQ GHVTVSADKSMNTAYLQWSSLKTSDTAMYYCARGGTIDGDYGGRQDFWGQGTMVTVSS FHVH2VH1sdAbnucleicacidsequence(SEQIDNO:60) CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGAGGGTCCCTGAGACTCTCC TGTGCAGCCTCTGGATTCACCTTCAGTAGTTATGAAATGAACTGGGTCCCCCAGGCTCCAGGGA AGGGGCTGGAGTGGGTTTCATACATTAGTAGTAGTGGTAGTACCATATACTACGCAGACTCTGT GAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACTCACTGTATCTGCAAATGAACAG TCTGAGAGCCGAGGACACGGCTGTTTATTACTGTGCGAGAGTCGCCCAGAGAGAAGGGGACGT CTGGGGCAAAGGGACCACGGTCACCGTCTCCTCAGGGGGGGGGGGCTCTGGGGGGGGTGGCTC AGGTGGCGGTGGCTCTGAAGTTCAGCTGCTGGAAAGCGGTGGTGGTCTGGTTCAGCCTGGTGGT AGCCTGCGTCTGAGCTGTGCAGCAAGCGGTTTTACCTTTAGCCATAGCGCCATGGGTTGGGTTC GTCAGGCACCTGGTAAAGGTCTGGAATGGGTTAGCAGCATCTATGCCCGCGGCGGCTATACCTA TTATGCAGATAGCGTTAAAGGTCGTTTTACCATTAGCCGTGATAACAGCAAAAATACCCTGTAC CTGCAGATGAATAGTCTGCGTGCAGAGGATACCGCAGTGTATTATTGTGCGCGCGGTTACCATC TGGAATACATGGTTTCTCAGGATGTTTGGGGTCAAGGTACTCTGGTGACCGTCTGCTCA FHVH2VH1sdAbproteinsequence(SEQIDNO:61) QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYEMNWVRQAPGKGLEWVSYISSSGSTIYYADSVKG RFTISRDNAKNSLYLQMNSLRAEDTAVYYCARVAQREGDVWGKGTTVTVSSGGGGSGGGGSGGG GSEVQLLESGGGLVQPGGSLRLSCAASGFTFSHSAMGWYRQAPGKGLEWVSSIYARGGYTYYADS VKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGYHLEYMVSQDVWGQGTLVTVSS FHVH4VH1sdAbnucleicacidsequence(SEQIDNO:62) CAGGTCCAGCTGGTGCAGTCTGGGGCTGAGGTGAAAAAGCCCGGGGAGTCTCTGAGGATCTGC TGTAAGGCTTCTGGATACAGTTTTAGCAACCATTGGATCGGCTGGGTGGGCCAGAAGCCCGGGA AAGGCCTGGAGTGGATGGGGAGCGTCTATCCTGGTGACTCCGATACCAGATACAGCCCGTCCTT CCAAGGCCACGTCACTGTCTCAGCCGACAAGTCCATGAATACCGCCTACCTGCAGTGGAGCAG CCTGAAGACCTCGGACACCGCCATGTATTATTGTGCGAGAGGTGGGACTATTGACGGTGACTAC GGGGGGAGGCAAGACTTCTGGGGCCAGGGAACCATGGTCACCGTCTCTTCAGGGGGGGGGGGG TCTGGGGGGGGTGGCTCAGGTGGCGGTGGCTCTGAAGTTCAGCTGCTGGAAAGCGGTGGTGGT CTGGTTCAGCCTGGTGGTAGCCTGCGTCTGAGCTGTGCAGCAAGCGGTTTTACCTTTAGCCATA GCGCCATGGGTTGGGTTCGTCAGGCACCTGGTAAAGGTCTGGAATGGGTTAGCAGCATCTATGC CCCCGGCGGCTATACCTATTATGCAGATAGCGTTAAAGGTCGTTTTACCATTAGCCGTGATAAC AGCAAAAATACCCTGTACCTGCAGATGAATAGTCTGCGTGCAGAGGATACCGCAGTGTATTATT CTGCGCGCGGTTACCATCTGGAATACATGGTTTCTCAGGATGTTTGGGGTCAAGGTACTCTGGT GACCGTCTCCTCA FHVH4VH1sdAbproteinsequence(SEQIDNO:63) QVQLVQSGAEVKKPGESLRISCKASGYSESNHWIGWVRQKPGKGLEWMGSVYPGDSDTRYSPSFQ GHVTVSADKSMNTAYLQWSSLKTSDTAMYYCARGGTIDGDYGGRQDFWGQGTMVTVSSGGGGS GGGGSGGGGSEVQLLESGGHLVQPGHSLRLSCAASGFTFSHSAMGWVRQAPGKGLEWVSSIYARG QYTYYADSVKGRETISRDNSKNTLYLQMNSERAEDTAVYYCARGYHLEYMVSQDVWGQGTLVTV SS AminoacidsequenceofFHVH2HCDR1(SEQIDNO:64) GFTFSSYE AminoacidsequenceofFHVH2HCDR2(SEQIDNO:65) ISSSGSTI AminoacidsequenceofFHVH2HCDR3(SEQIDNO:66) ARVAQREGDV AminoacidsequenceofFHVH4HCDR1(SEQIDNO:67) GYSFSNHW AminoacidsequenceofFHVH4HCDR2(SEQIDNO:68) VYPGDSDT AminoacidsequenceofFHVH4HCDR3(SEQIDNO:69) ARGGTIDGDYGGRQDF CD5KOsgRNA: GCTGTAGAACTCCACCACGC(SEQIDNO:70)