Genome-wide identification of immune evasion functions in a virus

11944679 ยท 2024-04-02

Assignee

Inventors

Cpc classification

International classification

Abstract

A protocol has been developed for genetically engineering an attenuated pathogen such as the influenza virus that can grow in cells without interferons but has suppressed growth in cells with the interferons. The protocol comprises systematically identifying immune evasion functions on the pathogen's genome, then eliminating the immune evasion functions while maintaining a certain replication fitness of the pathogen. The resulting attenuated pathogen causes a strong immunologic response and can be used in a live attenuated vaccine.

Claims

1. A composition of matter, comprising: a genetically engineered influenza A virus genome comprises a combination of nucleotide mutations at more than two amino acid positions selected from: at least one amino acid substitution in SEQ ID NO: 3 at amino acid position N9, Q75 or T76; and/or at least one amino acid substitution in SEQ ID NO: 5 at amino acid position N36, R72 or S225.

2. The composition of matter of claim 1, wherein the genetically engineered influenza A virus genome further comprises at least one amino acid substitution in SEQ ID NO: 7 at amino acid position R38 or K41.

3. The composition of matter of claim 1, wherein each of the nucleotide mutations are located in different segments of the genome.

4. The composition of claim 1, wherein the combination of nucleotide mutations at more than two amino acid positions comprises at least 4 nucleotide mutations.

5. A vaccine or therapeutic agent comprising the composition of matter of claim 1.

6. The composition of matter of claim 1, wherein the genetically engineered influenza A virus genome comprises the combination of nucleotide mutations at more than two amino acid positions which increase an influenza A virus sensitivity to type I interferon.

7. The composition of claim 6, wherein genetically engineered influenza A genome further comprises mutations in at least one single nucleotide in the influenza A: SEQ ID NO: 4 or SEQ ID NO: 2.

8. The composition of claim 1, wherein the at least one mutation is: found at amino acid position N9, Q75, and T76 in SEQ ID NO: 3, and/or found at amino acid position N36, R72, and S225 in SEQ ID NO: 5.

9. The composition of claim 1, wherein the at least one mutation is: selected from at least one of N9D, Q75H, or T76A in SEQ ID NO: 3, and/or selected from at least one of N36Y, R72Q, or S225T in SEQ ID NO: 5.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 Identification of IFN-sensitive mutations using quantitative high-throughput genomics. (A) Relative fitness (RF) scores for individual mutations in A549 cells with (right) and without (left) IFN selection across the influenza A/WSN/33 genome. (B and C) Identification of IFN-sensitive mutations with PB2 protein as an example [Protein Data Bank (PDB) ID, 4WSB] (38, 39). Red and orange represent strong and intermediate IFN sensitivity, respectively. (D) Validation of IFN sensitivity with individually reconstituted mutants (n=4). The top eight mutations on nonsurface virion proteins are shown in black. (E) Induction of IFN-? expression in A549 cells infected with WT virus or indicated mutants at 6 hours post-infection, with mock infection as control (Ctl) (n=3). Error bars, SD. *P<0.05, **P<0.01 [two-tailed t test compared with WT (D) or with Ctl (E)]. Single-letter abbreviations for the amino acid residues are as follows: A, Ala; C, Cys; D, Asp; E, Glu; F, Phe; G, Gly; H, His; I, Ile; K, Lys; L, Leu; M, Met; N, Asn; P, Pro; Q, Gln; R, Arg; S, Ser; T, Thr; V, Val; W, Trp; and Y, Tyr.

(2) FIG. 2 The combination of mutations in HIS virus increases IFN sensitivity and IFN production. (A and B) Replication kinetics of WT, NS1 mutant, and HIS viruses in A549 (A) and Vero (B) cells. (C) IFN sensitivity of WT, NS1 mutant, and HIS viruses (n=4). (D) Induction of IFN-? expression by indicated virus in A549 cells at 6 hours post-infection, with mock infection as Ctl (n=3). (E) Global gene expression in A549 cells infected with indicated viruses was examined by RNA sequencing (n=2). The heatmap shows the genes that were significantly differentially expressed in HIS-infected cells compared with mock-infected cells. IFN response genes are marked on the left with black bars. (F) GO enrichment analysis of genes up-regulated in HIS-infected cells in comparison with mock- (top) or WT-infected (bottom) cells. (G) Induction of IFN-? expression by indicated viruses in primary human alveolar macrophages (AMs), human alveolar epithelial cells (AECs), human small airway epithelial cells (HSAECs), and human bronchial epithelial cells (HBECs) at 6 hours post-infection, with mock infection as Ctl (n=3). (H) Induction of indicated ISGs and inflammatory cytokines in primary human AMs at 6 hours post-infection (n=3). (I) Induction of indicated ISGs. Error bars, SD. *P<0.05, **P<0.01, ***P<0.001 [one-way analysis of variance (ANOVA) with Bonferroni multiple comparisons test]; n.s, not significant.

(3) FIG. 3 HIS virus is replication-deficient in vivo and induces a transient IFN response. (A and B) Survival rate and percentage of body weight loss after intranasal infection (n=5). (C and D) Viral titers at day 2 post-infection (n=4) (C) and replication kinetics (n=3) (D) of WT and HIS viruses in mouse lung tissues. (E) Induction of indicated ISGs in mouse lung tissues at 6, 24, 48, and 120 hours (h) post-infection (n=3), shown as fold of induction over mock infection. RNase H, ribonuclease H. (F) Gene expression of indicated inflammatory cytokines in mouse lung tissues was examined by RNA sequencing (n=2). (G) HE (hematoxylin and eosin) staining of lung tissues at day 9 post-infection. Thick arrows, bronchioles; thin arrows, vessels; red triangles, inflammatory cell infiltration. (H) Percentage of neutrophils, monocytes, and lymphocytes in BAL cytospins at day 9 post-infection (n=3). (I) Cytokines in BAL samples measured by Luminex multiplex assay (n=4). (J) Replication of indicated viruses in lung tissues of IFNAR.sup.?/? mice (n=4). (K) Viral titer of WT and HIS viruses in ferret nasal wash, trachea, and lung tissues (n=3). Dashed lines represent detection limits. (L) Viral titer in lung tissue are shown for indicated virus. Female Balb/c mice age 6-8 weeks were intranasally infected with 10.sup.5 TCID 50 of indicated virus, mice lung tissue were extracted at 2 days post infection (N=3). (M) Replication of indicated virus in IFNAR?/? mice. IFNAR?/? mice were infected intranasally with 10.sup.5 TCID 50 of indicated virus, mice lung tissue were extracted at 2 days post infection (N=3=number of mice per group). (G) Induction of indicated ISGs were examined for mice lung samples infected with WT or HIS virus at 6 h or 24 h. (N) Induction of indicated cytokines were examined with luminex multiplex assay with BAL samples collected at day 2 post infection (N=3). Error bars, SD. *P<0.05, **P<0.01, ***P<0.001 [log-rank test for (A); ANOVA with Bonferroni multiple comparisons test for (C), (H), and (J); and two-tailed t test for (D), (E), (I), and (K)].

(4) FIG. 4 HIS virus induces strong adaptive immune responses in mice and ferrets. (A to D) HA-binding IgG (n=7), HA neutralizing antibody (n=7), and NP- and NA-binding IgG (n=4) in mouse sera at day 28 post-vaccination. HAI, hemagglutinin inhibition. (E) HA-binding IgA in BAL samples at day 28 post-vaccination (n=4). The optical density (OD) in ELISA was 450 nm. (F) HA neutralizing antibody levels in ferret sera at day 22 post-vaccination (n=3). The dashed line represents the detection limit. (G) Mutations not neutralized by mouse sera (red) were mapped onto the HA structure (PDB ID, 1RUZ; n=5) (40). The other five colors represent five well-characterized neutralization epitopes. (H) Tetramer staining of antigen-specific CD8 T cells in mouse lung (left) and spleen (right) at day 10 post-vaccination (n=10). (I) Percentage of antigen-specific memory precursor effector cells in mouse lung and spleen (n=3). (J) NP antigen-specific CD8 T cells during the secondary responses in lung tissues from mice vaccinated with indicated viruses (n=4). (K) Intracellular IFN-? staining of CD4 T cells induced by the indicated viruses (n=3). (L and M) Clonality of TCR? sequences of NP antigen-specific CD8 T cells during the primary (n=5) (L) or secondary (n=4) (M) responses. (N) Box plots show the fitness distribution of mutations on T cell epitopes or antibody epitopes. (O&P) Specific HA binding IgG (O) and neutralizing antibody (B) from infected mice sera were examined by ELISA and hemagglutinin inhibition (HAI) assay. Female Balb/c mice age 6-8 weeks were intranasally infected with 10.sup.5 TCID 50 of indicated virus (N=7), serum were obtained at day 28 post infection. Sera were heat inactivated for HAI assay. (Q) Specific NP binding IgG from infected mice sera were examined by ELISA (N=4). (R) Primary T cell response was examined by flow cytometry with tetramer staining. Female C57/B6 mice were intranasally infected with 10.sup.5 TCID 50 of indicated virus (N=5). Single cell suspension was made from lung and spleen tissues extracted 8 days post infection. Red blood cells were lysed with ACK lysis buffer. 1 million cells were subjected to flow cytometry analysis with CD3, CD8 and tetramer complexes with H-2D.sup.b+influenza A virus NP.sub.366-374 (NPP, ASNENME?) and H-2K.sup.b influenza A virus PBI.sub.703-711 (SSYRRPVGI). (S) TCID50 are shown for challenge infection post vaccination. Female Balb/c mice age 6-8 weeks were intranasally vaccinated with 10.sup.5 TCID 50 of indicated virus (N=4). Mice were challenged with 10.sup.5 TCID 50 of WT virus at 28 days post vaccination. Lung tissues were extracted at 2 days post challenge. Viral titers were measured by TCID50 assay using A549 cells. Dashed line represents the detection limit of TCID50 assay. Error bars, SD. *P<0.05, **P<0.01, ***P<0.001 [ANOVA with Bonferroni multiple comparisons test for (A) to (D), (F), (H), (J), and (K); two-tailed t test for (I), (L), and (M); and Wilcoxon rank sum test for (N)].

(5) FIG. 5 HIS virus protects mice and ferrets from broad viral challenges. (A and B) Viral load in mouse lung tissues at day 2 post-challenge (n=4). DV, double vaccinations with HIS virus at 1?10.sup.4 TCID50, 28 days apart; HD, high-dose vaccination with HIS virus at 1?10.sup.6 TCID50. Dashed lines represent detection limits. (C) Viral replication kinetics in ferret nasal wash after WSN virus challenge at day 35 post-vaccination (n=3). (D and E) Survival rate and body weight loss of HIS-vaccinated mice after challenge with homologous and heterologous strains (n=10). (F) Viral replication kinetics in ferret nasal wash after A/California/07/09 virus challenge at 35 days post-vaccination (n=3). Error bars, SD. *P<0.05, ***P<0.001 [ANOVA with Bonferroni multiple comparisons test for (A) and (B), two-tailed t test for (C) and (F), and log-rank test for (D)].

(6) FIG. 6: Experimental design and rationale of a vaccine development approach

(7) Flow chart shows the experimental design and rationale of our vaccine development approach. Through the development of a quantitative high-throughput genomics system (18, 19, 59-61), we were able to measure the phenotypic effect of single nucleotide mutations in the viral genome under different selection conditions. We dissected the anti-IFN functions encoded by viral proteins from those that are essential for viral replication, and systematically identified IFN sensitive mutations on the viral genome. By combining multiple mutations, we generated a live attenuated vaccine candidate: Hyper-Interferon Sensitive (HIS) virus. This approach simultaneously satisfies the requirement for safety, efficacy and production of vaccine (14, 62).

(8) FIG. 7: Construction of single nucleotide mutant libraries across the entire influenza genome (A) A schematic illustration of the quantitative high-throughput genomics system and its utilization to systematically identify IFN-sensitive mutations. (B) The arrangement of 52 plasmid libraries covering the entire influenza A/WSN/33 genome. Each plasmid library was built on a fragment of 240 bp in length and contained ?1000 different point mutations. (C) Schematic illustration for the mutant library reconstitution and selection procedures (19, 36, 37). 30 million 293T cells were transfected with each small plasmid library together with seven other wild type plasmids to reconstitute the mutant virus library. 15 million A549 cells were then infected at an MOI of 0.05 for 24 h to passage the mutant virus library. Biological duplicates were examined for both transfection and infection steps. The mutant plasmid library, mutant viral library after transfection and infection were high-throughput sequenced by Illumina MiSeq with 250 bp paired-end reads.

(9) FIG. 8: Correlation of relative fitness scores (RF scores) from independent biological replicates. The correlation between RF scores in biological replicates is shown with scatter plots. Reconstitution and selection of mutant libraries was performed for each viral segment separately. Strong correlation was obtained for the RF scores between biological replicates. Mutant RF scores without IFN selection were reported previously for segment 2, 3 and 7, and were used by this study (21-23). The final RF score for each mutant was calculated as the average between replicates.

(10) FIG. 9: Validations of high-throughput fitness profiling (A) Histograms of the RF scores of synonymous and nonsense mutations. RF scores of synonymous mutations were centered at around 1 (log 10 RF scores centered around 0, mean=?0.08, V=0.27), suggesting that the majority of synonymous mutations were neutral for viral replication. A clear separation of distributions was observed between synonymous and nonsense mutations, suggesting effective selection during passaging of viral mutant libraries. (B) 26 single nucleotide mutations were randomly selected across the genome with a wide range of RF scores. Mutants were reconstructed individually in the context of the whole virus. Relative growth capacities of each mutant were examined by TCID50 assay and compared with RF scores in the fitness profiling. As the TCID50 of 7 mutants was below the detection limit (plotted as 0 in linear scale), scatter plots are shown in both linear (left) and log (right) scales. The relative growth of individually reconstructed mutant viruses correlated well with the fitness profiling data.

(11) FIG. 10: Fitness distribution of missense mutations. Distribution of fitness effect (DFE) for all single nucleotide missense mutations is shown. Using synonymous mutations as bench mark, we designated a mutation to be deleterious if the RF score <mean-2V, beneficial if the RF score >mean+2V, and nearly neutral if within. Across the entire viral genome, around 50.7% missense mutations are deleterious and only 1.5% are beneficial.

(12) FIG. 11: Identification of potential IFN sensitive mutations. Selection of possible IFN sensitive mutations for validation is shown on PB1, PA, NP and M1. Mutations on PB2 and NS1 are shown in FIG. 1C and S7. The focus is on non-surface virion proteins (PB2, PB1, PA, NP, M1 and M2), because HA and NA are highly variable and NS1 has been extensively studied (16, 63-66). Putative IFN sensitive mutations are highlighted with orange and red colors. Orange for segment 2, 5 and 7: mutations with RF scores >0.7 without IFN and <0.2 with IFN selection; Red for segment 2, 5 and 7: mutations with RF scores >0.7 without IFN and <0.1 with IFN selection. Orange for segment 3: mutations with RF scores >0.7 without IFN and <0.3 with IFN selection; Red for segment 3: mutations with RF scores >0.7 without IFN and <0.2 with IFN selection. The corresponding residues were mapped onto protein structures (PDB: 4WSB, 2IQH &1EA3) with the same colors (38-40, 48-50). We preferentially chose the IFN-sensitive mutations that are clustered on the protein surface for validation. Up to 7 mutations per segment were selected for experimental validations.

(13) FIG. 12: Establishing conditions for interferon selection of mutant viral libraries (A) Dose response curve of type I IFN (IFN-D2) on WT WSN viral replication was measured. A549 cells were pre-treated with different doses of IFN-D2 for 20 h, and infected with WT virus at an MOI of 0.1. Cells were washed twice with PBS at 2 h post-infection and equal concentrations of IFN-D2 was supplied to the cells. Supernatants were collected at 24 h post-infection and viral copy numbers were measured by real-time PCR. 1000 U/ml IFN-D2 was selected as the concentration for screening, which is at IC80. (B) Known residues of NS1 protein that have a functional role in interfering with IFN pathway and their corresponding mutations were labeled (26, 27, 67). We identified R37, Q40, K41, R46 and K62 in the RNA binding domain to be key residues interfering with IFN function. However, some mutations at residues that have known anti-IFN function (such as R38, E96 and E97), were not identified as top IFN-sensitive mutations, indicating the existence of false negatives in our screening results. (C) Putative IFN sensitive mutations identified on NS1 were highlighted with orange and red colors (PDB: 4OPH) (68). Orange: mutations with RF scores >0.7 without IFN and <0.3 with IFN selection; Red: mutations with RF scores >0.7 without IFN and <0.2 with IFN selection. (D) Profiling results were validated with individual constructed mutant viruses on NS1. A previously reported double mutation (R38A/K41A) was used as the positive control. Error bars denote SD. *P<0.05, **P<0.01, ***P<0.001 (two-tailed t-test compared with WT).

(14) FIG. 13: Validation of IFN-sensitivity with individual mutant viruses (A) Viral replication capacity of selected IFN sensitive mutants. Viruses were reconstituted by co-transfecting plasmid containing the single mutation together with 7 plasmids encoding other wild type proteins. A549 cells were infected with the indicated mutant at an MOI of 0.1. Supernatants were collected at 24 h post-infection and the viral titer was measured by TCID50 assay. All the mutants were neutral or nearly neutral for viral replication (N=2). (B) Relative polymerase activity for single mutations in the polymerase complex proteins (N=3). Most mutants showed nearly intact polymerase activity. Error bars denote SD.

(15) FIG. 14: Induction of IFN production by IFN sensitive mutants in vitro

(16) (A) The induction of IFN-E expression is more significant for cells pre-treated with IFN. A549 cells were pretreated with 1000 U/ml IFN-D2 for 20 h or un-treated before infection. Cells were then infected with WT or indicated mutants at an MOI of 1. RNAs were extracted at 6 h post-infection. IFN-E gene expression was quantified by real-time PCR and calculated as fold of induction compared with WT infected cells (N=3). Error bars denote SD. *P<0.05, **P<0.01, ***P<0.001 (two-tailed t-test). (B&C). Induction of ISG54 expression is shown for WT and indicated mutants (N=3). A549 cells were infected at an MOI of 1. RNAs were extracted at 6 h post-infection. ISG54 gene expression was quantified by real-time PCR and shown as fold of induction normalized to mock infected cells (Ctl, B) or actual CT number (C) (69). Error bars denote SD. *P<0.05, **P<0.01, ***P<0.001 (two-tailed t-test compared with Ctl).

(17) FIG. 15: Nuclear translocation of IRF3 upon infection with WT or indicated mutants was examined by immunofluorescence analysis. A549 cells were infected at an MOI of 1. Cells were fixed and subjected to immunofluorescence analysis (IFA) at 8 h post-infection with antibodies against IRF3 protein. The three mutations on PB2 (N9D, Q75H, T76A) and three mutations on M1 (N36Y, R72Q, S225T), but not WT, showed clear nuclear localization of IRF3, indicating their functional interactions with IFN pathway upstream of IRF3.

(18) FIG. 16: MAVS is required for the high induction of IFN-E by PB2 and M1 mutants. Induction of ISG54 expression was examined in STING or MAVS knockout THP1 cells. THP1 cells stably overexpressing Cas9 protein were used as a control. Cells were infected with WT or the indicated mutants at an MOI of 1 and RNAs were extracted at 6 h post-infection. ISG54 gene expression was quantified by real-time PCR and calculated as fold of induction normalized to WT infected cells (N=3). Error bars denote SD. *P<0.05, **P<0.01, ***P<0.001 (two-tailed t-test compared with WT infection of corresponding cell types).

(19) FIG. 17: Induction of IFN production by HIS virus (A) Induction of IFN-? expression by indicated virus in A549 cells at 6 h post-infection, with mock infection as Ctl (N=3). Actual CT number were shown for real-time PCR analysis. (B) Induction of IFN-E expression was examined at 1 h, 2 h and 4 h post-infection with WT, NS1 mutant or HIS viruses (N=3). (C) Induction of indicated ISG expression. THP1 cells were infected with WT or HIS virus at an MOI of 0.1. RNAs were extracted at 24 h post-infection. Gene expression was quantified by real-time PCR and calculated as fold of induction compared with mock infected cells (N=3). (D) Average reads per million (RPM) for indicated viral segments in A549 cells (N=2) as quantified by RNA sequencing. (E) Cell viability upon infection with the indicated virus. A549 cells were infected with indicated virus at an MOI of 0.1 for 72 h in 96-well plates. Cell viability was examined by CCK8 assay (N=3). (F&G) Relative IFN-sensitivity (F) and IFN-E induction (G) were examined for HIS virus in PR8 background (N=3). The same eight mutations (PB2: N9D, Q75H, T76A, M1: N36Y, R72Q, S225T, NS1: R38A, K41A) were introduced into PR8 through reverse genetic system. HIS virus in PR8 background showed higher IFN-sensitivity and IFN-E induction compared with WT PR8 or NS1 mutant (R38A/K41A). Error bars denote SD for all panels. *P<0.05, **P<0.01, ***P<0.001 (one-way analysis of variance (ANOVA) with Bonferroni multiple-comparisons test).

(20) FIG. 18: Characterization of cold-adapted (CA) virus in WSN strain, WSN-CA (A) Viral titers assessed under different temperatures are shown for WT and WSN-CA virus. A549 cells were infected with the indicated virus at an MOI of 0.1, and supernatant was collected at 72 h post-infection. Viral titer was determined by TCID50 assay (N=3). (B) Induction of IFN-? expression in A549 cells infected with WT or indicated mutants was examined by real-time PCR with mock infection as control (Ctl) (N=3). Error bars denote SD for all panels. *P<0.05, **P<0.01, ***P<0.001 (two-tailed t-test for panel A and one-way analysis of variance (ANOVA) with Bonferroni multiple-comparisons test for panel B).

(21) FIG. 19: Replication of HIS virus and induction of cytokines in IFN competent mice (A&B) Viral titers in lung tissues are shown for the indicated viruses as relative copy number. Female BALB/c mice at the age of 6-8 weeks were intranasally infected with 1?104 TCID50 of the indicated virus. Lung tissues were harvested at day 2 post-infection (N=3). Viral copy numbers were examined by real-time PCR and normalized to WT infected mice. Dashed line represents the detection limit. (C) HE staining of lung tissues at day 2 post-infection. (D) Epithelial integrity was examined by albumin concentration in mouse BAL samples collected at day 2 post-infection (N=4). WT infected mice showed a significantly higher albumin concentration than HIS or mock infected mice, with no-significant loss of lung integrity caused by HIS. (E&F) BAL cytospins are shown for WT or HIS infected mice at day 2 post-infection as percentage (E) and number (F) of indicated cell types (N=4). (G&H) Pathology scores were quantified for lungs on HE staining slides, at day 2 post-infection (G) and day 9 (H) post-infection. 4-5 areas were averaged for each mouse (N=4). (I) BAL cytospins are shown for WT or HIS infected mice at day 9 post-infection as number of indicated cell types (N=3). (J) Induction of indicated cytokines was examined with Luminex multiplex assay with BAL samples collected at day 2 post-infection (N=4). The concentration of each cytokine in WT, HIS or mick infected mice BAL samples is shown. (K) IFN-D concentration in BAL samples were determined using VeriKine Mouse Interferon Alpha ELISA kit at day 2 post-infection (N=4). Error bars denote SD for all panels. *P<0.05, **P<0.01, ***P<0.001 (one-way analysis of variance (ANOVA) with Bonferroni multiple-comparisons test for panel A, two-tailed t-test for panel B, D-F, I&J, Mann-Whitney U test for panel G&H).

(22) FIG. 20: Antibody response induced by HIS vaccination. (A) Neutralizing antibodies in sera of vaccinated mice. Female BALB/c mice at the age of 6-8 weeks were intranasally infected with 1?104 TCID50 of the indicated virus (N=4). Sera were obtained at day 28 post-infection and heat inactivated for neutralization antibody assay. (B&C) HA-specific IgG and HA neutralizing antibodies were examined for sera of vaccinated mice at indicated time points by ELISA (B) and hemagglutination inhibition (HAI) assay (C) (N=3). HA proteins from four different viral strains were purified and used as targets for IgG binding: WSN/H1, PR8/H1, HK68/H3 and Viet04/H5 (60). WT and HIS infected mice elicited antibody response against other strains within the same HA group (PR8/H1, Viet04/H5) but not across different HA group (HK68/H3). Similar to the WT vaccinated group, the HA antibody titer in HIS immunized mice increased steadily from days 14, 21 to 28 post-vaccination. (D) HA neutralizing antibodies in sera of vaccinated mice were examined at 21 days post-infection by HAI assay (N=3). HIS induced higher levels of HA neutralizing antibodies than inactivated WT or inactivated HIS viruses. (E) M1 specific IgG antibody was examined in mouse sera at day 28 post-infection by ELISA (N=4). (F) NP specific IgA antibody was examined in BAL samples at day 28 post-infection by ELISA (N=4). (G) HA neutralizing antibodies in sera of vaccinated ferrets were examined at 15, 22 and 50 days post-infection by HAI assay (N=3). The antibody response induced by HIS is stable and long-lasting. Error bars denote SD for all panels. *P<0.05, **P<0.01, ***P<0.001 (one-way analysis of variance (ANOVA) with Bonferroni multiple-comparisons test for panel D&E, two-tailed t-test for panel C).

(23) FIG. 21: Mutant viruses non-neutralized by sera of vaccinated mice were profiled with HA mutant library (A) Relative enrichment scores (RE scores) of HA point mutations under selection with indicated mouse serum are shown across the amino acid positions of the HA protein. HA single nucleotide mutant libraries were selected under sera of WT or HIS vaccinated mice (N=5) at the concentration of IC80. Sera from mock infected mice were used as control. RE score of each mutant was calculated as the relative fitness under serum selection compared with the control. (B) Numbers of non-neutralized mutations are shown for each mouse, suggesting similar diversity of antibody responses in different mice. Non-neutralized mutations were defined as the ones with RE score >5 for each condition and with RF scores >0.05. (C) Percentage of non-neutralized mutations located in the head and stem region of

(24) HA proteins is shown. 51 and 61 non-neutralized mutations were identified with more than one serum selection, in WT and HIS vaccinated groups respectively (N=5). ?60% of these mutations are located in the head domain of the HA protein, while ?40% of them are in the stem region. The percentage is similar between the two groups.

(25) FIG. 22: Robust T cell response induced by HIS virus (A) CD8 T cell responses were examined by tetramer staining and flow cytometry. Representative flow cytometry dot plots are shown for lung and spleen samples. Upper-right quadrants indicate portion of NP epitope specific CD8 T cells, which are positive for CD3, CD8 and NP366-374 tetramer. (B) NP specific CD8 T cells in mouse lung tissues were examined by tetramer staining and flow cytometry. (C&D) Number of viral antigen-specific CD8 T cells in mouse spleen (C) and lung (D) tissues induced by indicated virus were examined by flow cytometry using tetramers against NP or PB1 (N=10). (E) Functionality of CD8 T cell responses was examined by peptide stimulation and intracellular IFN-J staining of splenocytes at day 28 post-vaccination. Percentages of IFN-J positive CD8 T cells was quantified for indicated viral peptide from PA, PB2 and NP (N=3). (F) Percentage of antigen specific short lived effector cells (SLEC) in mouse lung and spleen tissues were examined by flow cytometry using Tetramer+CD127.sup.lowKLRG1.sup.high as the markers (N=3). (G) Percentage of antigen specific central memory like CD8 T cells in mouse lung and spleen tissues were examined by flow cytometry using Tetramer+CD44+CD62L+CCR7+ as the markers (N=3). (H) Percentage of antigen specific effector memory like CD8 T cells in mouse lung and spleen tissues were examined by flow cytometry using Tetramer+CD44+CD62L?CCR7? as the markers (N=3). (I) Number of NP antigen specific CD8 T cells during secondary responses were examined in lung tissues from mice vaccinated with the indicated viruses (N=4). Error bars denote SD for all panels. *P<0.05, **P<0.01, ***P<0.001 (one-way analysis of variance (ANOVA) with Bonferroni multiple-comparisons test for panel B, C, D&I, two-tailed t-test for panel E-H).

(26) FIG. 23: Diversity of T cell responses induced by HIS virus (A&B) TCR VE gene usage was analyzed for NP specific CD8 T cells during the primary (A) and the secondary (B) response in HIS or WT infected mice. Deep sequencing was performed for TCRE loci of influenza NP366-374 specific CD8 T cells. For the primary response, mouse lung and spleen tissues were harvested at day 10 post-infection. For the secondary response, vaccinated mice were challenged with WT virus at day 28 post-infection, and tissues were harvested at day 10 post-challenge. NP specific T cells were sorted out by FACS and genomic DNA was extracted for deep sequencing. Error bars denote SE. (C&D) Overlapping rates of T cell lineages identified through CDR3 rearrangements are shown between different mice for the primary (C) and the secondary (D) response. For the primary responses, the CDR3 rearrangement is diverse among different mice, as shown with low overlap between or within WT and HIS vaccinated groups. However, the rearrangement converged within groups for the secondary responses, as shown with a significantly more overlap within the same vaccination group comparing between groups (two tailed t-test, p=0.00008).

(27) FIG. 24: Protection of HIS vaccinated mice from viral challenges (A) Protection of vaccinated mice from WT infection was quantified by relative viral copy number in lung tissues. Female BALB/c mice at the age of 6-8 weeks were intranasally vaccinated with 1?10.sup.4 TCID50 of indicated virus (N=4). Mice were challenged with 1?10.sup.4 TCID50 of WT virus at day 28 post vaccination. Lung tissues were extracted at day 2 post challenge. Viral copy number was quantified by real-time PCR and normalized to WT vaccinated mice. Dashed line represents the detection limit. (B) Protection efficiency of HIS vaccinated mice from WT infection was examined with a high dose vaccination or double vaccinations. DV: double vaccination with 1?104 TCID50HIS virus at 28 days apart; HD: high dose vaccination with HIS virus at 1?106 TCID50. Mice were challenged with 1?104 TCID50 of WT virus and viral growth was quantified by real-time PCR in lung tissues at day 2 post-challenge. Dashed line represents the detection limit (N=4). (C) Protection of vaccinated mice from WT PR8 infection was quantified by relative viral copy number in lung tissues. Dashed line represents the detection limit (N=4). (D) Clinical scores of mice challenged with homologous and heterologous viral strains. HIS vaccinated or mock (PBS) vaccinated C57/B6 mice were challenged with A/WSN/33 (H1N1), A/PR8/34 (H1N1) and A/Cal/04/09 (H1N1) at a dose of LD90 and A/X-31 (H3N2) at LD50 (N=10). Clinical scores were obtained twice daily for 10 days. (E) Protection of HIS vaccinated ferrets from A/California/07/09 virus challenge is shown with percentage of body weight loss (N=2). Female ferrets at the age between four to six months were vaccinated with HIS or PBS (Ctl). At day 35 post-vaccination, ferrets were challenged with 1?106 TCID50 of A/California/07/09 virus. Clinical scores were obtained twice daily for 10 days. *P<0.05, **P<0.01, ***P<0.001 (one-way analysis of variance (ANOVA) with Bonferroni multiple-comparisons test). Error bars denote SD for all panels.

(28) FIG. 25: Secondary T cell responses post viral challenges. The secondary T cell responses were examined by tetramer staining and flow cytometry. HIS vaccinated mice were challenged with A/WSN/33, A/PR8/34, A/Cal/04/09 or A/X-31 at day 28 post-vaccination. 14 days after challenge, lung and spleen samples were collected from vaccinated mice from each challenge group (N=5). Antigen specific CD8 T cells against H-2Db influenza A virus NP366-374 (NPP, ASNENME?) and H-2Kb influenza A virus PB1703-711 (SSYRRPVGI) were examined. Robust CD8 T cell rebound response against NP epitope was observed in all challenge groups.

(29) FIG. 26 is a flowchart illustrating a method of making a genome using a genetic platform.

(30) FIG. 27 is a flowchart illustrating a method of making a composition of matter.

DETAILED DESCRIPTION OF THE INVENTION

(31) In the detailed description of the invention, reference may be made to the accompanying drawings which form a part hereof, and in which is shown by way of illustration specific embodiments in which the invention may be practiced. It is to be understood that other embodiments may be utilized and structural changes may be made without departing from the scope of the present invention. A number of different publications are also referenced herein as indicated throughout the specification. A list of these different publications can be found below in the section entitled REFERENCES. All publications, patents, and patent applications cited herein (e.g. Simultaneous and complete genome sequencing of influenza A and B with high coverage by Illumina MiSeq Platform Journal of Virological Methods, Volume 193, Issue 2, November 2013, Pages 394-404) are hereby incorporated by reference in their entirety for all purposes.

(32) Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. Many of the techniques and procedures described or referenced herein are generally well understood and commonly employed using conventional methodology by those skilled in the art. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.

(33) Embodiments of the present invention describe a surprisingly different and radical way for developing live attenuated vaccines: controlling a combination of interferon sensitive mutations in the vaccine so as to fine-tune a replication/immune response tradeoff that achieves the best or desirable efficiency with sufficient safety. On one hand the interferon sensitivity attenuates the virus in vivo. On the other hand, the ability to induce higher interferon response induces a higher and more effective adaptive immune response.

(34) Further aspects and embodiments of the invention are disclosed in the following examples.

Example: Influenza A Virus

(35) The present disclosure describes the establishment of a high throughput genetic platform to examine the fitness effect of single mutations across the entire influenza genome.

(36) To tackle the challenges described herein, we developed a quantitative high-throughput genomics system, which combines saturation mutagenesis and next-generation sequencing, to comprehensively identify IFN-modulating functions in the entire viral genome (18). This system has enabled us to quantitatively measure the replication capacity of a large number of mutants in parallel under specific conditions (18, 19). We performed comparative profiling of the entire influenza genome with and without IFN selection, which led to the identification of IFN-modulating functions on multiple viral segments. By combining eight IFN-sensitive mutations across the viral genome, we generated a hyper-interferon-sensitive (HIS) virus that is replication-competent in vitro but highly attenuated in IFN-competent hosts in vivo. The HIS virus showed desired properties as a safe and effective live attenuated influenza vaccine with robust humoral and cellular responses, and it provided broad protection against homologous and heterologous viral challenges in mice and ferrets.

(37) Compared with previous methods, we significantly improved the quality and reproducibility, getting rid of the noise from multiple mutations. Moreover, to our knowledge, the genetic profiling system described herein is the first whole genome fitness profile for the influenza virus.

(38) a. Fitness Profile of the Influenza a Viral Genome at Single-Nucleotide Resolution

(39) An eight-plasmid reverse genetic system carrying the influenza A/WSN/33 (H1N1) virus genome was used for the construction of mutant plasmid libraries (20). The mutants were divided into 52 sublibraries, each of which contained single-nucleotide mutations in a small genome region of 240 base pairs that were generated by error-prone polymerase chain reaction (FIG. 7A) (21-23). Viral mutant libraries were reconstituted in human embryonic kidney 293T cells by cotransfecting the plasmid encoding the sublibrary of mutants with the other seven plasmids encoding wild-type (WT) viral proteins. To systematically identify IFN-modulating functions, all viral libraries were selected in A549 cells with or without exogenous IFN treatment (IFN-?2 at inhibitory concentration 80) (19). Illumina sequencing was used to identify each mutant and to calculate the corresponding frequency within each sublibrary. The relative fitness (RF) score of a mutant virus was calculated as the ratio of the relative frequency in the selected virus library to that in the plasmid library (FIG. 1A). There were strong correlations between biological duplicates of transfection and of selection (FIG. 8). We observed a clear separation of the distribution of fitness effects between synonymous mutations and nonsense mutations (FIG. 9A), indicating effective selection on virus mutants. To further validate the accuracy of the fitness profiling, we randomly selected 26 missense mutations and characterized the corresponding mutant viruses individually. The replication capacity of each mutant was highly correlated with the RF scores from the fitness profiling (FIG. 9B). Using synonymous mutations as a benchmark, 50.7% of missense mutations across the whole genome were deleterious, in accordance with previous findings that single mutations are poorly tolerated in the genomes of RNA viruses (FIG. 10A) (24, 25).

(40) b. Systematic Identification of IFN-Sensitive Mutations

(41) The RF scores of most mutants are correlated in the presence and absence of exogenous IFN treatment; however, we observed a set of mutations that were nearly neutral in the absence of IFN but highly deleterious under IFN selection (FIG. 1B and FIG. 11). These putative IFN-sensitive mutations were widespread on multiple viral segments. Among all influenza A viral proteins, NS1 has been extensively studied for its interaction with the IFN pathway (19, 26, 27), which is validated both in our fitness profiling and individually constructed NS1 mutant viruses (FIG. 12). To further explore IFN-modulating functions across the genome, we focused on IFN-sensitive mutations outside NS1, especially the solvent-exposed and structurally clustered residues in the polymerase complex (PB2, PB1, PA, and NP), as well as the M1 and M2 proteins (FIG. 1C and FIG. 11). Twenty-six mutations were constructed individually, most of which were nearly neutral for viral replication with nearly intact polymerase activity (FIG. 13). These included the previously characterized mutations PB2-N9D, which is known to counteract the inhibition of MAVS (mitochondrial antiviral signaling protein)-induced IFN-? production by PB2 (16), and M1-D30N, which has been shown to induce IFN-? production (17). Several mutations significantly increased IFN sensitivity compared with WT, and the top eight were chosen for further characterization (FIG. 1D). Six of them (PB2-N9D, PB2-Q75H, PB2-T76A, M1-N36Y, M1-R72Q, and M1-S225T) elevated the expression of IFN-? and ISG54 (FIG. 1E and FIG. 14) and stimulated nuclear translocation of IRF3 (FIG. 15). We also observed that the IFN induction was MAVS-dependent and STING (stimulator of interferon genes)-independent (FIG. 16). Moreover, these six mutants were not sensitive to IFN treatment in Vero cells, which are deficient in IFN production. However, the other two mutations (PB1-L155H and PA-E181D) did not induce higher IFN production (FIG. 1E) and were still IFN-sensitive in Vero cells, suggesting that these mutants likely affect processes downstream of IFN production.

(42) c. Combining Mutations Increases IFN Sensitivity and IFN Induction In Vitro

(43) To maximize IFN sensitivity and IFN induction, we combined three IFN-inducing mutations on PB2 (N9D, Q75H, and T76A), three on M1 (N36Y, R72Q, and S225T), and two previously reported ones on NS1 (R38A and K41A) to create the HIS virus. The growth of HIS virus in IFN-competent A549 cells showed significant attenuation compared with that of WT virus (1.4-log decrease at 36 hours and 1.8-log decrease at 60 hours) but was fully restored in IFN-deficient Vero cells (FIGS. 2, A and B). The IFN sensitivity of HIS virus was significantly higher than that of the NS1-R38A/K41A mutant, indicating an independent effect of mutations on PB2 and M1 (FIG. 2C). Gene expression data from lung epithelial and macrophage cell lines (A549 and THP1) showed that HIS virus induced higher IFN production and responses (FIG. 2D and FIG. 17, A to C). Using RNA sequencing, we evaluated the global gene expression changes in A549 cells infected with WT, NS1-R38A/K41A, or HIS virus. At 6 hours post-infection, the expression of 120 genes was significantly up-regulated (fold change >2 and P<0.001) in HIS-infected cells, of which 24% were IFN response genes (FIG. 2E, FIG. 17D). Gene Ontology (GO) enrichment analysis revealed that the pathways related to IFN production and response were the dominant ones activated by HIS virus, to a greater extent than by WT or mock infection (FIG. 2F). Furthermore, HIS virus induced negative regulators of apoptosis process, such as TNFAIP3, an important inhibitor of TNF-mediated apoptosis. Slower cell death was observed with HIS infection than with WT infection (FIG. 17E).

(44) We further defined the phenotypes of HIS virus with a panel of human lung cells, including immortalized small airway epithelial cells, bronchial epithelial cells, primary alveolar epithelial cells, and primary alveolar macrophages (FIG. 2G). HIS virus induced the strongest up-regulation of IFN-? expression (?50-fold relative to WT) in the primary alveolar macrophages, an important target for influenza infection (FIG. 2G), and greater up-regulation of ISGs than WT virus (FIG. 2F). HIS virus did not enhance the expression of other inflammatory cytokines [CXCL1, CXCL5, or interleukin-1? (IL-1?)] in the infected macrophages, highlighting its specific effects on the IFN pathway (FIG. 2H). The phenotype of HIS virus is not limited to the WSN background: Introducing these eight mutations into another H1N1 strain of influenza, A/PR8/34 (PR8-HIS), led to a similar phenotype (FIGS. 17, F and G). The up-regulation of the IFN pathway requires active viral infection, given that formalin-inactivated HIS virus lost the ability to induce higher IFN-? expression (FIG. 2G).

(45) d. HIS Virus is Highly Attenuated in IFN-Competent Mice and Ferrets

(46) We next measured the replication and pathogenesis of HIS virus in mice and ferrets, the most commonly used animal models for influenza virus. BALB/c mice were intranasally inoculated with WT or HIS virus at different doses. Whereas the median lethal dose of WT virus was 5?10.sup.5 TCID50 (50% tissue culture infective dose), and 1?10.sup.3 TCID50 caused obvious body weight loss in all animals, neither weight loss nor indicative clinical symptoms were observed in HIS-infected mice given 1?10.sup.7 TCID50, the highest dose that we have tested (FIGS. 3, A and B). To compare the HIS virus approach with the live attenuated vaccine strategy used in FluMist, we incorporated the five cold-adapted (CA) mutations from FluMist into the WSN background and generated a WSN-CA virus (28, 29). WSN-CA virus replicated well at 33? C. but was highly attenuated at 39? C. and induced IFN-? expression to a similar level as WT virus, which was significantly lower than that induced by HIS virus (FIG. 18). By day 2 post-inoculation, replication of HIS virus in mouse lung tissues was significantly lower than that of WT virus (?3.6-log decrease) or the NS1-R38A/K41A mutant (?2-log decrease) and comparable to that of WSN-CA virus (FIG. 3C and FIG. 19A). In contrast with the robust viral replication observed for WT infection, which peaked at 48 hours, no increase in viral copy number was detected in HIS-infected mice at any tested time point (FIG. 3D). PR8-HIS virus was also significantly attenuated compared with WT PR8 virus in mouse lung tissues (FIG. 19B). Although highly attenuated in replication, HIS virus showed transient yet significant up-regulation of IFN and ISGs at 6 and 24 hours post-infection, after which the response was diminished (FIG. 3E). In contrast, WT virus induced a robust pro-inflammatory response throughout the course of infection, exemplified by the high induction of CXCL10 at 48 and 120 hours post-infection (FIG. 3F). These results correlate well with histological analysis of infected lungs and cytospins of bronchoalveolar lavage (BAL) fluid (FIGS. 3, G and H, and FIG. 19, C to G). HIS-infected lungs showed infiltration of neutrophils and lymphocytes at day 2 post-infection; however, the infiltration was transient and cleared by day 9. Sustained inflammation and tissue damage was observed for WT-infected lungs, which became more severe by day 9 post-infection (FIG. 3H and FIGS. 19, H and I). We also examined the cytokine response in the BAL samples at 48 hours post-infection by means of Luminex multiplex assay (FIG. 3I and FIGS. 19, J and K). WT infection showed significantly higher levels of IL-6 and CXCL1, consistent with the observed severe inflammation. In contrast, HIS virus induced higher amounts of IL-12 and G-CSF, which is important for granulocyte stimulation and T cell development. Furthermore, replication of HIS virus was fully restored to WT levels in IFNAR.sup.?/? mice, indicating that the inability to counteract IFN response was the underlying mechanism for the highly attenuated replication of HIS virus in wild-type mice (FIG. 3J). In the ferret model, we also observed significant attenuation of HIS virus (FIG. 3K). By day 3 post-infection, HIS virus showed a ?2-log decrease in trachea and a ?1.5-log decrease in lung tissues compared with WT virus. Moreover, no infectious viral particles were detected in nasal washes of HIS-infected ferrets, in contrast to the robust viral shedding observed during WT infection.

(47) e. HIS Virus Induces Strong and Broad Adaptive Immune Responses

(48) We then examined the ability of the HIS virus to induce humoral and cellular responses. Mouse sera and BAL samples were collected at day 28 after single-dose (1?10.sup.4 TCID50) vaccination with WT, HIS, or WSN-CA virus. HIS virus induced robust antibody responses, as measured by ELISA (enzyme-linked immunosorbent assay) and hemagglutinin (HA) inhibition and neutralization antibody assays (FIG. 4, A to E, and FIG. 20). The level of HA antibody responses elicited by HIS virus was lower than for WT virus, yet significantly higher than for the WSN-CA, inactivated WT, and inactivated HIS viruses (FIGS. 4, A and B, and FIGS. 20, C and D). Immunoglobulin G (IgG) antibodies against NP, NA, and M1 proteins, which have been shown to play an important role in limiting viral replication (30, 31), were also detected in the sera of HIS-vaccinated mice at a level comparable to that in WT-infected mice (FIGS. 4, C and D, and FIG. 20E). Furthermore, mucosal immune responses, indicated by secretory IgA antibodies against HA and NP proteins, were elicited by HIS vaccination (FIG. 4E and FIG. 20F). Robust HA antibody responses were also observed in ferrets vaccinated with HIS virus (FIG. 4F and FIG. 20G), which were sustained for at least 50 days post-vaccination. To examine the epitope coverage of the neutralizing antibodies generated by HIS virus, we profiled the HA mutants in the presence or absence of mouse serum antibodies by using the high-throughput genomic approach (32). Mutations not neutralized by sera were observed in both head (Ca2 and Sa sites) and stem regions, with no significant difference in the number or the distribution of mutations between the WT and HIS viruses (FIG. 4G, FIG. 21). This suggests that the breadth and diversity of neutralizing antibodies induced by the HIS virus are comparable to those induced by the WT virus.

(49) In addition to humoral responses, HIS virus elicited NP and PB1 antigen-specific CD8 T cell responses, similarly to WT virus and much more strongly than the WSN-CA, inactivated WT, and inactivated HIS viruses (FIG. 4H and FIG. 22, A to D). The CD8 T cells induced by the WT and HIS viruses had a similar capacity for IFN-? production upon stimulation by viral epitope peptides (FIG. 22E). We further examined the phenotypes of virus-specific T cells by quantifying the expression of KLRG1, CD127, CD44, CD62L, and CCR7. By day 21 post-infection, the NP and PB1 antigen-specific CD8 T cells induced by the WT and HIS viruses displayed similar levels of memory precursor effector cells with a CD127.sup.highKLRG1.sup.low phenotype and short-lived effector cells with a CD127.sup.lowKLRG1.sup.high phenotype (FIG. 4I and FIG. 22F). These virus-specific CD8 T cells also displayed a similar effector/memory phenotype, as measured by CD62L, CD44, and CCR7 expression (FIGS. 22, G and H). Consistently, after challenge infection at 1 month post-vaccination, HIS virus induced the secondary CD8 T cell responses similarly to WT but more strongly than WSN-CA virus (FIG. 4J and FIG. 221). Moreover, similar frequencies of influenza-specific CD4 T cells were elicited by the WT and HIS viruses (FIG. 4K). To examine the diversity of the primary and secondary T cell responses, we analyzed the T cell receptor repertoire by sequencing the ? T cell receptor (TCR?) loci of NP-specific CD8 T cells in mice vaccinated with WT or HIS virus. The V? usage and clonality for both primary and secondary T cell responses were comparable between the WT and HIS viruses, documenting the diversity of T cell lineages induced by HIS vaccination (FIGS. 4, L and M, and FIG. 23).

(50) We analyzed the potential impact of immune responses on the viral genome at the population level. Our whole-genome fitness profiling provides a data set for examining the genetic flexibility of viral sequences. We calculated the fitness cost of mutations in the previously identified B and T cell epitopes. Mutations on several T cell epitopes, but not on antibody epitopes, were generally correlated with lower fitness scores (FIG. 4N). Our results suggest that an escape from T cell selection will impose a higher fitness cost for the virus, and thus T cell responses will be effective against vaccine escape.

(51) f. HIS Virus Protects Against Homologous and Heterologous Viral Challenge

(52) We examined whether HIS vaccination could offer protection against homologous and heterologous viral challenges. Immunized mice were challenged 28 days post-vaccination with 1?10.sup.4 TCID50 of WT virus. Vaccination by HIS virus reduced viral replication by ?3 log, with no sign of weight loss (FIG. 5 and FIG. 24). Complete protection without detectable viral titers in the lung was achieved with one vaccination at a high dose (1?10.sup.6 TCID50) or two vaccinations at a low dose (1?10.sup.4 TCID50) (FIG. 5B and FIG. 24B). Similar protective effects were observed in ferrets, which were challenged with 1?10.sup.7 TCID50 of WT virus at day 35 post-vaccination. Nasal washes were collected at days 1, 3, 4, 7, and 9 post-challenge, and no infectious viral particles were detected in nasal washes from HIS-vaccinated ferrets throughout this time period (FIG. 5C).

(53) To test whether HIS vaccination provides protection against heterologous strains, we first challenged immunized mice with PR8 virus and examined viral titer at day 2 post-challenge. HIS vaccination reduced viral titer by ?3 log compared with mock vaccination and significantly more than WSN-CA vaccination (FIG. 24C). We further challenged vaccinated mice with a lethal dose of three different influenza strains: H1N1 subtypes A/PR8/34 and A/Cal/04/09 and H3N2 subtype A/X-31. Protection by HIS vaccination was observed in all measures, including survival rate, percentage of body weight loss, and clinical scores (FIGS. 5, D and E, and FIG. 24D). Strong secondary antigen-specific T cell responses were observed in the challenged mice for all strains (FIG. 25). HIS vaccination also protected ferrets from heterologous A/Cal/07/09 challenge, as shown by viral titer in nasal washes and percentage of body weight loss (FIG. 5F and FIG. 24E).

(54) g. Discussion of Results for the Example

(55) Although NS1 is the best studied IFN antagonist in influenza genome, the anti-IFN function has been recently appreciated in other proteins. It is reported that PB2 and PB1F2 could bind to MAVS and inhibit interferon production; ESIE motif in PB1 and PA can mediate type I interferon response, and NP of newly emerged H7N9 can counteract anti-viral ISG: MxA. Here, using a high-throughput genetic approach, we have identified multiple IFN sensitive mutations in the PB2, PA, PB1 and M1 proteins, suggesting the anti-IFN functions of corresponding WT proteins. As anti-IFN functions are essential for efficient viral replication in vivo, it is reasonable that the functions are distributed in different segments. Identified IFN sensitive mutations also work on different parts of IFN system. Mutations on PB2 and M1 can induce higher IFN production, indicating that they work at the upstream of IFN system. On the other hand, mutation on PB1 and PA cannot induce higher IFN production and response, and the sensitivity still remains in IFN deficient Vero cells, suggesting that they might be interacting with JAK/STAT pathway or a specific anti-viral ISG. Identification of these mutations open the path to dissect the underlying mechanisms.

(56) Conventional approaches to develop vaccines render the virus avirulent but also reduce immunogenicity. We developed a quantitative high-throughput genomics approach to systematically identify and eliminate immune-modulating functions in the virus genome while maintaining replication fitness in vitro. This is a systems-based strategy to enhance viral immunogenicity while attenuating replication and pathogenesis. In this proof-of-principle study, we generated a HIS virus with a combination of eight IFN-sensitive mutations. These mutations also induced higher IFN production and response. We demonstrated that HIS virus is highly attenuated in vivo but is able to induce transient IFN responses, elicit robust and diverse humoral and cellular immunity, and provide protection against homologous and heterologous viral challenges in mice and ferrets.

(57) Recent studies have suggested several strategies to design live attenuated vaccines (14, 15, 33-37). Our method is distinctive in the following aspects: (i) We systematically investigated the whole viral genome, and we eliminated immune-evasion functions at multiple loci to obtain a safe strain that has no detectable replication in vivo; (ii) we selected mutants that induce a higher IFN response, because a transient IFN response has been shown to be essential for adaptive immunity, including the strong and diverse T cell responses; (iii) HIS virus selectively induced a transient IFN response but no other tested inflammatory responses, which reduced potential pathogenesis or side effects for future clinical usage. We have also applied this approach to a DNA virus and generated an effective vaccine candidate.

(58) In general, this unbiased and quantitative high-throughput genomics system can be widely applied to other pathogens to define the impact of genome-wide mutations under certain selection conditions. Similar profiling of a viral genome can be performed with other immune components, such as cytokines, natural killer cells, or T cells, in vitro and in vivo. Inactivating additional immune evasion functions in the virus will further increase the safety and immunogenicity of its derivatives for prevention or therapy.

(59) II. Materials and Methods Used for the Examples in Section I (Influenza A Virus).

(60) a. Viruses, Cells, Mice, and Ferrets

(61) Influenza A/WSN/33 virus (WSN) and Influenza A/PR8/34 virus (PR8) were used to generate WT and mutant viruses. An eight-plasmid reverse genetics system was utilized to reconstitute WT virus (20,41). A live attenuated cold adapted WSN strain (WSN-CA) was generated by introducing 5 mutations in 3 polymerase genes: PB1 (391E, 581G, and 661T), PB2 (265S), and NP (34G). These 5 mutations were derived from A/Ann Arbor/6/60, which was identified in the backbone for vaccine FluMist (28, 42, 43). Influenza A/X-31 (H3N2) and A/Cal/04/09 (H1N1), A/Cal/07/09 (H1N1), in addition to WSN and PR8, were used for the challenge experiments in mice and ferrets.

(62) 293T cells were cultured in DMEM (Corning) with 10% FBS (Corning). Madin-Darby Canine Kidney (MDCK) cells were cultured in DMEM with 10% FBS, but changed to OPTI-MEM (Thermo Fisher) with 0.8 mg/ml TPCK trypsin for viral infection with PR8 backgrounds. A549 cells and THP1 cells were cultured in RPMI1640 (Corning) with 10% FBS. THP1 cells with knockout were generated by CRISPR-Cas9 using a lentivirus expressing a gRNA (targets STING or MAVS) and Cas9-T2A cassette (44). THP1 cells were transduced with the lentivirus and selected with 5 ?g/ml puromycin (Life Technologies). Human small airway epithelial cells (HSAEC) were cultured in small airway epithelial cell basal media (SABM) with growth supplements (Lonza). Human bronchial epithelial cells (HBEC) were cultured in keratinocyte serum free media include bovine pituitary extract (BPE, 30 Pg/ml) and hrEGF supplements (0.2 ng/ml) (Invitrogen). Human alveolar macrophages were isolated from lungs of de-identified donors and cultured as previously described (45). For culture of human alveolar epithelial cells, the isolated ATII cells were plated in Dulbecoo modified Eagle medium (DMEM) with 10% fetal bovine serum (FBS) on rat tail collagen-coated tissue culture plate and after 2 days of adherence, media were switched to DMEM with 5% FBS. AECs were cultured for another 4 days before influenza virus infection. The Committee for Oversight of Research and Clinical Training Involving Decedents and the University of Pittsburgh Institutional Review Board approved the usage of these human tissues.

(63) Female BALB/c mice (Jackson Laboratory) at the age of 6-8 weeks were used to determine safety, pathology, humoral immune responses and protection. Female C57BL/6J mice (Jackson Laboratory) of the same age were used for T cell studies. IFNAR?/? mice in C57BL/6J background were used for viral replication studies (46). Four-six month old female ferrets (body weight around 1 kg) were purchased from Wuxi Cay Ferret Farm (Jiangsu, China) to determine the safety and efficacy of vaccines.

(64) b. Construction of Influenza Mutant Plasmid Library

(65) Interferon sensitivity is defined using a high-throughput genetic system. FIG. 7A illustrates an exemplary single-nucleotide resolution high-throughput genetics approach used to systematically map the interferon sensitive mutations. Thus, we present a novel approach for vaccine development: systematically reprogramming the biological functions after genome-wide functional characterization of the virus.

(66) Libraries of influenza A/WSN/33 mutant viruses were generated using the eight-plasmid transfection system as previously described (18, 21-23, 47). The WSN strain was used to generate the mutant library as it provides flexibility for passaging large complex mutant libraries in a variety of cell lines. In brief, the whole length influenza genome was separated into 52 small fragments of 240 bp each. Random mutagenesis was performed with error-prone polymerase Mutazyme II (Stratagene) for each fragment separately. We have carefully controlled the mutation rate to maximize the proportion of point mutations. 0-3 mutations were expected to be generated for every template. For each small library, the mutated fragment was amplified and gel purified, BsaI or BsmbI (NEB) digested, ligated to the vector and transformed into MegaX DH10B T1R cells (Life Technologies). As each small library was expected to have 1,000 single mutations, 50,000 bacterial colonies were collected to cover the complexity at ?50?. Plasmids from collected bacteria were midi-prepped as the input plasmid library. In each small library, single nucleotide mutation account for 30% of the entire population. Mutant libraries for PB1, PA and M segments were previously constructed (21, 22).

(67) c. Reconstitution, Selection and Tittering of Virus Libraries

(68) To reconstitute the mutant virus library, ?30 million 293T cells were transfected with each plasmid library (one out of 52 small libraries) together with the other 7 plasmids encoding WT viral proteins (32 Pg of DNA in total) using Lipofectamine 2000 (Life Technologies). Media was changed at 24 h post transfection. Viruses were collected at 72 h post transfection. Viral titer (TCID50) was measured using limiting dilution with A549 cells by observing cell cytopathic effect (CPE). To passage viral libraries without IFN treatment, ?10 million A549 cells were infected with individual mutant virus library at an MOI of 0.05. Cells were washed with PBS three times at 2 h post-infection. Viruses were collected at 24 h post-infection from supernatants, cleared of cell debris and stored at ?80? C. in aliquots. For selection under exogenous type I interferon treatment, A549 cells were pre-treated with 1000 U/ml IFN-D2 (PBL Assay Science) for 20 h and then infected with viral libraries at an MOI of 0.05. Cells were washed with PBS three times at 2 h post-infection, and 1000 U/ml IFN-D2 was added back into culture media. Similarly, viruses were collected at 24 h post-infection from supernatants, clarified of debris and stored at ?80? C. in aliquots.

(69) d. Sequencing Mutant Libraries and Data Analysis

(70) Sequencing libraries were prepared as previously described (21, 22). Briefly, viral RNA was extracted using QIAamp Viral RNA Mini Kit (Qiagen Sciences). DNaseI (Life Technologies) treatment was performed, followed by reverse transcription using Superscript III system (Life Technologies).

(71) Real-time PCR was used to quantify viral copy number. At least 1?106 viral RNA copies were used to amplify the mutated fragment. The amplified fragment was then digested with BpuEI or BpmI and ligated with the sequencing adaptor, which had three-nucleotide multiplexing ID to distinguish among different samples.

(72) Deep sequencing was performed with Illumina PE250. Raw sequencing reads were de-multiplexed using the three-nucleotide ID. Sequencing error was corrected by filtering out low quality reads (quality score <30) and un-matched base-pairs between forward and reverse reads. We achieved at least 20,000?sequencing coverage for each nucleotide position. Mutations were called by comparing sequencing reads with the wild-type sequence. Reads containing two or more mutations were excluded from the downstream analysis, which enables us to eliminate potential complications
RF score.sub.mutant i=Relative Frequency of Mutant i.sub.infection/Relative Frequency of Mutant i.sub.plasmid
Where Relative Frequency of Mutant i=Reads of Mutant i/Reads of wild type caused by multiple mutations. Relative fitness score (RF score) in each condition was calculated for individual mutations. To reduce sampling errors in the estimating relative fitness, only those mutations with frequency >0.05% in the input plasmid library were reported.

(73) Where relative frequency of mutant i=reads of mutant i/reads of wild type.

(74) All the data processing and analyses was performed with customized python scripts, which are deposited at https://github.com/YushenDu/Influenza-Vaccine

(75) e. Construction of Viruses with Specific Mutation(s)

(76) Viruses with specific mutation(s) were generated using a PCR-based site-directed mutagenesis strategy. To reconstitute mutant viruses on WSN background, 1.5 million 293T cells were transfected with 4 Pg plasmid DNA. Transfections were performed using Lipofectamine 2000 (Life Technologies). Viruses were collected at 72 h post-transfection. Mutant viruses were further amplified in A549 cells. Supernatants were collected, clarified of debris and stored at ?80? C. in aliquots. Viral titers were measured by a TCID50 assay with A549 cells. Virion RNA was extracted, and reverse transcribed to cDNA. Coding sequences of all mutants were PCR amplified, and subjected to Sanger DNA sequencing for confirmation. To measure growth kinetics of mutant viruses, ?1 million A549 cells were infected with each mutant virus at an MOI of 0.1 and supernatants were collected at indicated time. To generate mutants on PR8 background, 1.5 million 293T cells were transfected with 4 Pg DNA and co-cultured with MDCK cells. Media was changed to OPTI-MEM with 0.8 mg/ml TPCK Trypsin at 24 h post-transfection. Viruses were collected at 72 h post transfection. Viral titers were measured by TCID50 assay with MDCK cells. Mutant viruses were further amplified in MDCK cells, supernatants were collected, clarified of debris and stored at ?80? C. in aliquots.

(77) In one or more examples, using silent mutation as benchmark, we observed that on average, ?60% of missense mutations are deleterious for influenza viral replication and only ?2% are beneficial. Similarly to previous results, the high percentage of deleterious mutations suggested the general conserved nature of an RNA viral genome. However, different proteins in the influenza A genome also showed diverse levels of mutation tolerance. We quantified the average fitness cost as well as the percentage of lethal mutations of every viral protein. Polymerase subunits (PB2, PB1, PA and NP) are highly conserved while NS1 and M2 are relatively mutable.

(78) f. Selection of Possible IFN Sensitive Mutations for Measuring IFN-Sensitivity Using Individually Constructed Mutant Viruses

(79) Because anti-IFN function of NS1 protein has been extensively studied, we focused on proteins (PB2, PB1, PA, NP, M1, M2) for further validation. To select possible IFN sensitive mutations, we followed the following criteria: 1) RF scores >0.7 in A549 cells without IFN selection; 2) RF scores <0.3 under interferon selection; 3) Residues that give similar interferon sensitive phenotypes when mutated into different amino acids were preferred. Moreover, we mapped the potential interferon sensitive residues onto protein structures (PDB: 4WSB, 1RUZ, 2IQH, and 1EA3) (38-40, 48-50) and preferentially selected the ones clustered on the protein surface for validation. Up to 7 mutations per segment were selected.

(80) To measure IFN-sensitivity using individually constructed mutant viruses, 1 million A549 cells were pre-treated with 1000 U/ml IFN-D2 (PBL Assay Science) for 20 h or left untreated. Then cells were infected with indicated virus at an MOI of 0.1. Cells were washed with PBS three times at 2 h post-infection, and 1000 U/ml IFN-D2 was added back into culture media. Supernatants were collected at 24 h post-infection and viral copy numbers were quantified by real-time PCR. Relative IFN-sensitivity for each mutant was calculated as the fold of viral copy number change with IFN selection, normalized to WT.

(81) In one or more embodiments, well-known interferon sensitive mutations were captured by our interferon screen. For example, amino acids of RNA binding domain of NS1 protein, especially R37, R38, K41, R46 were shown to be highly interferon sensitive. This domain was reported to be important to sequester viral dsRNA from cytoplasmic RNA sensors and inhibit certain ISG functions. Our screen results correlate well with the reported key residues for this function.

(82) g. Polymerase Activity Assay

(83) Plasmid DNAs (100 ng of PB2, PB1, PA, and NP; 50 ng of virus-inducible luciferase reporter and 5 ng PGK-Renilla luciferase reporter) were co-transfected into 293T cells in 24-well plates (51). Cells were lysed at 24 h post-transfection and followed by the Dual-Luciferase Assay (Promega).

(84) h. Immunofluorescence Assay

(85) Intracellular localization of IRF3 protein was determined by immunofluorescence. Infected A549 cells were fixed in 2% paraformaldehyde, permeabilized with 0.1% Triton-X100, and blocked with 3% BSA and 10% FBS. Viral NP protein was detected with anti-NP monoclonal antibody (GeneTex). IRF3 was detected with anti-IRF3 rabbit polyclonal antibody (Cell signaling). Hoechst 33342 dye was used for staining DNA.

(86) i. Cell Viability (CCK8) Assay

(87) A549 cells were infected with WT, NS1 R38A/K41A or HIS virus at an MOI of 0.1 in 96-well plates. Mock infection were used as control. 72 h post-infection, CCK8 solution (VitaScientific) were added in each well and incubated for 4 h at 37? C. Signals were detected at OD 450 nm.

(88) j. RNA-Seq Library Preparation and Sequencing

(89) RNA-seq libraries were prepared using a modified method based on the ScriptSeq mRNA-Seq library preparation kit (Epicentre) (48). Multiplex sequencing was performed by 50 bp single-end read with Illumina HiSeq 2000 machine at UCLA Clinical Microarray Core. Raw reads were aligned to the human genome assembly (hg19) or the mouse genome assembly (mm10) using TopHat under default parameter (52, 53). Results were quantified by reads per million total reads (RPM). Differential expression analysis was performed with edgeR (54). Gene ontology enrichment analysis was performed through metascape (55). Genes related to certain cellular pathways were extracted from MsigDB (56,57).

(90) k. Measuring Viral Replication in Mice

(91) To measure viral replication, BALB/c mice were anesthetized with isoflurane (IsoFlo, Henry Schein) and intranasally inoculated with indicated virus in a volume of 30 Pl. Body weight loss was monitored daily for 14 days. To quantify viral growth in mouse lung tissues, mice were intranasally inoculated with indicated virus at a dose of 1?104 TCID50 and sacrificed at day 2 post-infection. DMEM was used as a control for infection. To quantify viral titer by TCID50, lung tissues were harvested, homogenized, and freeze-thawed three times to release the virus. To quantify the viral genome copy number, RNA was extracted from mouse lung tissues using Trizol (Thermo Fisher). Similarly, to quantify the viral growth kinetics and gene expression in mouse lung tissues, lung samples were collected at 2, 6, 24, 48 and 120 h post-infection. Viral copy number and gene expression was quantified by real-time PCR. All mice experiments were performed in accordance with the guidelines of the animal protocols approved by UCLA, CDC China, Trudeau Institute and University of Pittsburgh.

(92) l. Measuring Pathogenesis in Mice

(93) To determine the pathology and cytokine expression, BALB/c mice were intranasally inoculated with indicated virus at a dose of 1?104 TCID50. Bronchoalveolar lavage (BAL) and lung samples were collected at day 2 and day 9 post-infection. Albumin concentration in BAL was determined using mouse albumin ELISA Quantitation kit (Bethyl Alboratories) and cytokine response was analyzed by Lincoplex (BioRad). BAL cell cytospin slides were stained with a HEMA-3 stain kit (Fisher Scientific) for inflammatory cell differential counts. In addition, lung tissues were fixed with 10% neutral buffered formalin (EMD Millipore) and paraffin embedded for histology. Hematoxylin and Eosin (H&E) stained lung tissue slides were scored for their pathology with the following criteria (Score 1-5):

(94) 1=No Observable Pathology.

(95) 2=perivascular/peribronchus or lung parenchyma inflammatory infiltration <25% of the lobe section.

(96) 3=perivascular/peribronchus or lung parenchyma inflammatory infiltration 25%-50% of the lobe section.

(97) 4=perivascular/peribronchus or lung parenchyma inflammatory infiltration 50%-75% of the lobe section.

(98) 5=perivascular/peribronchus or lung parenchyma inflammatory infiltration >75% of the lobe section. Cytokines in BAL samples were measured by Bio-Plex Pro Mouse Cytokine 23-plex assay according to the product protocol (Bio-Rad)

(99) m. Measuring Antibody and T Cell Responses in Mice

(100) For measuring antibody responses, BALB/c mice were intranasally inoculated with the indicated virus at a dose of 1?104 TCID50. DMEM was used as a control. Mouse sera were collected at days 14, 21 and 28 post-infection. Sera and BAL samples were collected at day 28 post-infection. Sera were used for immunoglobulin G (IgG) antibody detection, hemagglutination inhibition and neutralization assays. BAL samples were used for immunoglobulin A (IgA) antibody detection.

(101) To measure T cell response, C57BL/6J mice were intranasally inoculated with indicated virus at a dose of 1?104 TCID50. To examine primary T cell responses, lungs and spleens were harvested at day 10 post-infection. Fresh cells were used for tetramer staining and flow cytometry. For peptide stimulation of T cells, spleens were harvested at day 28 post-infection. To examine secondary T cell responses, lungs and spleens were harvested at 14 days post challenge of indicated virus at day 28 post-vaccination with HIS virus.

(102) n. Protection from Challenging Infections in Mice

(103) For protection studies, BALB/c mice were intranasally inoculated with the indicated virus at a dose of 1?104 or 1?106 TCID50. DMEM was used as control. Mice were then intranasally challenged with 1?104 TCID50 WT. Viral titers were quantified by both TCID50 and real-time PCR assays at day 2 post challenge.

(104) To examine protection from homologous and heterologous viral challenges, C57BL/6J mice were intranasally vaccinated with HIS virus or PBS as a control. At day 28 post vaccination, A/PR8/34 (H1N1), A/Cal/04/09 (H1N1) and WSN (H1N1) were used for intranasal challenge at a dose of LD90 which was 6000 50% Egg Infective Dose (EID50), 8000 EID50 and 14,000 EID50 respectively. A/X-31(H3N2) was given at 45,000 EID50 (LD50) because it was difficult to reach LD90. Body weight loss was monitored twice daily for 14 days. The following clinical scores were used to quantify the clinical symptoms:

(105) 0=no visible signs of disease

(106) 1=slight ruffling of fur

(107) 2=ruffled fur, reduced mobility

(108) 3=ruffled fur, reduced mobility, rapid breathing

(109) 4=ruffled fur, minimal mobility, huddled appearance, rapid and/or labored breathing

(110) 5=found dead.

(111) o. Enzyme-Linked Immunosorbent Assay (ELISA)

(112) Viral protein specific IgG and IgA antibodies were detected using an enzyme-linked immunosorbent assay (ELISA). 96 well ELISA plates (Costar, Corning) were coated with 1 Pg/ml recombinant viral proteins (HA-WSN, HA-PR8, HA-HK68, HA-Viet04, NP, NA or M1) in bicarbonate/carbonate buffer (pH 9.5) at 4? C. overnight. Wells were washed with PBST between each step for 3-5 times. Wells were then blocked with 10% FBS in PBS for 1 h at room temperature. Serum or BAL samples were diluted in blocking buffer and added to wells for incubation at 4? C. overnight. HRP-conjugated anti-mouse IgG antibody (Cell Signaling) or HRP-conjugated anti-mouse IgA antibody (Thermo Fisher) was diluted in blocking buffer and added into wells for 1 h at room temperature. SIGMA FAST OPD (Sigma) was used to detect the signals at OD 450 nm.

(113) Luminex multiplex assay was performed according to the manufacturer's protocol (Bio-Rad). IFN-D concentration in mouse BAL samples were determined using VeriKine Mouse Interferon Alpha ELISA kit (pbl Assay Science) according to the manufacturer protocol.

(114) p. Hemagglutination Inhibition (HAI) Assay

(115) Mouse sera were pre-treated at 56? C. for 30 min. 4 HA units of WT virus were incubated with 2-fold serially diluted sera at 37? C. for 1 h in V shaped 96-well plate. The starting concentration of sera was 1:4. Washed turkey red blood cells (Lampire) at a concentration of 0.5% were added into each well and incubated at room temperature for 30 min. The HA titer was then read as the highest dilution of serum that prevented hemagglutination.

(116) q. Antibody Neutralization Assay

(117) Mouse sera were pre-treated at 56? C. for 30 min. WT viruses were incubated with serial diluted serum at 37? C. for 1 h. Sera from mock-infected mice were used as control. Viral titer after incubation was measured by TCID50 assay using A549 cells.

(118) r. Determining Mutations on HA Protein Non-Neutralized by Serum Antibodies

(119) Dose response curve of mouse sera against WT viral replication was measured by an antibody neutralizing assay. Reconstituted mutant viral libraries on HA protein were incubated with individual mouse serum (5 mice from WT vaccinated group and 5 mice from HIS vaccinated group) at the concentration of IC80 at 37? C. for 1 h. Sera from unvaccinated mice were used as mock control. After incubation with a serum, mutant libraries were used to infect 30 million A549 cells, and washed with PBS twice at 2 h post-infection. Corresponding serum was added back into the culture media that matched IC80. Supernatants were collected at 48 h post-infection, viral RNA was extracted and reverse transcribed. The relative frequency of each mutant was determined by Illumina MiSeq PE250 as described before.

(120) For each mouse serum selection condition, relative enrichment scores (RE scores) of HA point mutations were calculated by comparing the relative frequencies of the mutations with and without serum selection.
RF score.sub.mutant i=Relative Frequency of Mutant i.sub.serum/Relative Frequency of Mutant i.sub.plasmid
Where

(121) Relative Frequency of Mutant i=Reads of Mutant i/Reads of wild type.

(122) Mutations with RE score >5 and with RF scores >0.05 were classified as non-neutralized mutations by the corresponding serum antibodies. Mutations that occurred in at least two mouse sera in the WT or HIS group were selected and compared.

(123) s. Quantitation of Viral-Specific CD4 T Cells

(124) Splenocytes were stimulated with WT WSN virus for 16 h at 37? C. with the presence of 1 Pg/ml brefeldin A. Cells were stained with CD3-efluorofore450, CD4-FITC and intracellularly stained with IFNJ-PE. Percentage of IFNJ positive CD3+CD4+ cells was quantified by flow cytometry.

(125) t. Determining the Usage of T Cell Receptor Repertoire

(126) The TCRE loci of influenza NP366-374 specific CD8 T cells from both primary and secondary responses were deep sequenced. For the primary response, mouse lung and spleen tissues were harvested at day 10 post-infection. For the secondary response, vaccinated mice were challenged with WT virus at day 28 post-infection, and tissues were harvested at day 10 post-challenge. To isolate NP-specific CD8 cells, mouse lung and spleen tissues were harvested and single cell suspensions were generated. T cell population was enriched using the EasySep mouse T cell isolation kit (Stemcell) and stained with CD3-efluorofore450, CD8a-FITC and NP366-374 tetramer conjugated with PE. NP positive CD8 T cells were sorted out by FACS. A total of 18 samples were deep sequenced (Adaptivebiotech), including 10 mice for the primary response (5 for WT vaccination and 5 for HIS vaccination), and 8 mice for the secondary response (4 for WT vaccination and 4 for HIS vaccination). VDJ recombination was analyzed for each sample by immunoSEQ Analyzer. Clonality was calculated for NP-specific T cells as the inverse of the normalized Shannon's entropy.

(127) u. Determining Viral Replication and Protection Effects in Ferrets

(128) Ferret experiments were performed in ABSL-2 laboratory in the animal facility at Center for Disease Control and Prevention, China. All animals were determined to be seronegative by HAI to circulating seasonal influenza viruses. To evaluate the replication of HIS and WT viruses, 18 ferrets were divided into 3 groups (6 ferrets each) and intranasally inoculated with 500 Pl of 1?106 TCID50 HIS or WSN. PBS was used as control. Body weight, body temperature and clinical symptoms were observed and recorded daily. At days 1, 3, 4, 7, 9 and 14 post-inoculation, nasal washes and rectal swabs were collected in 1.5 ml PBS. At day 3 post-inoculation, 3 ferrets in HIS or WSN groups and 1 ferret in PBS group were euthanized and tissue specimens (lungs, tracheas and turbinates) were collected.

(129) To evaluate protection efficiency, 8 ferrets were inoculated with 1?10.sup.6 TCID50 HIS. PBS was used as control. At day 35 post-inoculation, ferrets were intranasally challenged with either 1?10.sup.7 TCID50 A/WSN/33 (H1N1) or 1?10.sup.6 TCID50 A/California/07/09 (H1N1pdm) respectively. Body weight, body temperature and clinical symptoms were recorded daily. At days 1, 3, 4, 7 and 9 post challenge, nasal washes and rectal swabs were collected in 1.5 ml PBS. At day 3 post challenge, 2 ferrets in each group were euthanized. Tissue specimens (lungs, tracheas and turbinates) were collected and homogenized in

(130) 1 ml of PBS using stainless steel balls and a tissue lyser (TissueLyserII QIAGEN) operated at 25 Hz for 5 mins. Viral titers in supernatants of homogenized tissues, nasal washes and rectal swabs were examined using TCID50 on MDCK cells. Ferret experiments were approved by Animal Ethics Committee of National Institute for Viral Disease Control and Prevention, China.

(131) v. Viral Titer Assay for Ferret Experiments

(132) Viral titers (TCID50) of nasal washes, rectal swabs and tissue samples were detected in MDCK cells with virus culture medium containing 2 ?g/ml TPCK-trypsin in 96-well flat-bottom cell culture plates. 50 ?l of serial one-half log 10 dilutions for nasal washes and rectal swabs, or 10 fold dilutions for tissue samples were added to MDCK cells and incubated at 37? C. for 1 hour. 100 ?l of virus culture medium was added to each well and incubated at 37? C. for 18 to 20 h. Cells were fixed by precooled 80% acetone for 10 mins, followed by ELISA using 1:4000 anti-influenza A NP monoclonal antibody pool (IRR) and 1:2000 goat anti-mouse IgG conjugated with HRP (KPL). Each sample was titrated in triplicate. TCID50 of each sample was calculated by the Reed Muench method.

(133) w. Analyzing Fitness Cost of Mutations in T Cell and Antibody Epitope Regions

(134) T cell epitopes, linear antibody epitopes and conformational antibody epitope sequences were extracted according to the Immune Epitope Database and Analysis Resource (IEDB) (58). We included the epitopes that with conservation >90% for WSN virus for analysis. For T cells epitopes, only human epitopes were considered. The RF scores for mutations within or outside of epitope regions were compared.

(135) x. Mapping onto Protein Structures, Gene Expression, Viral Replication, Polymerase Activity,

(136) We mapped the list of potential interferon sensitive residues onto protein structures. We reasoned that if a residue is interacting with interferon pathway, then it is more likely to be located on the exposable surface. Moreover, it is likely that multiple mutations around the same domain or same pocket showed a similar phenotype. For example, we observed two clusters of interferon sensitive mutations, located on the N terminus of PB2 protein and M1 protein, respectively. Thus, we preferably picked the residues that clustered on the protein surface for validation (FIG. 1D). We constructed 24 single mutations in total and examined their interferon sensitivity in the context of viral replication. R38A-K41A double mutations on NS1 were introduced as positive control. We first evaluated the viral replication of these mutations by infecting A549 cells with MOI 0.1. TCID50 were quantified at 48 h post infection. All the mutations showed to be neutral or nearly neutral for viral replication. Furthermore, we measured the polymerase activity for the mutations in polymerase complex (PB2, PB1, PA and NP) by minigenome replicon assay. Consistent with viral growth, the polymerase activity of the selected mutations are all nearly intact. We further examined the interferon sensitivity of these mutations by infecting them with A549 cells with and without interferon selection. Compared with wild type WSN virus, all the mutants showed higher sensitivity, as the decrease of viral growth is more significant under interferon selection. Although not as dramatic as R38A-K41A mutation on NS1, 8 out of the 24 mutations on internal genes showed higher interferon sensitivity compared with wild type. 8 out of them showed significant higher interferon sensitivity.

(137) To further examine if each mutant can induce higher interferon production or is deficient in inhibiting interferon response, we infected A549 cells at MOI=1 with different mutants and examined gene expression at 6 h post infection by RT-qPCR. Compared with wild type, the three mutations on PB2 (N9D, Q75H, T76A) and three mutations on M1 (N36Y, R72Q, S225T) induced significantly higher IFN-? gene expression (FIG. 1F). The induction can be more dramatically seen with ISG54, a target gene of IRF3 same with IFNb. We also examined the nuclear translocation of IRF3 post infection. Consistent with gene expression results, these 6 mutations that induce higher IFNb expression also induce strong nuclear translocation of IRF3, indicating a stronger IFN production and response. The higher induction of IFN is MAVS dependent and Sting independent, as knocking out MAVS would abolish the induction while no effect with STING knockouts. These results suggested that the three mutations on PB2 (N9D, Q75H, T76A) and three mutations on M1 (N36Y, R72Q, S225T) might lose the function of inhibiting interferon production at early time points post infection. The other two mutations (PB1 L155H, PA E181D), however, did not induce higher interferon production. These two mutations are still IFN sensitive in vero cells which have defect in IFN production, indicating that they might loss the inhibition of downstream interferon pathway (JAK-STAT pathway or ISG functions). siRNA screening or cDNA overexpression screening of JAK-STAT pathway or ISGs can be performed to identify the cellular factor interacting with the mutants.

(138) y. Safety, Efficiency, and In Vitro Growth

(139) Safety and efficiency are two major considerations for vaccine development. Combinations of interferon sensitive mutations generate a virus that is more sensitive to interferons, and enables exploration of potential use as live attenuated vaccine candidate. On one hand, the interferon sensitive phenotype would make the virus highly attenuated in vivo, on the other hand, the higher induction of interferon system might induce stronger adaptive immune response. Moreover, as the combination of multiple mutations are located in different gene segments and are mostly neutral for viral replication without interferon selection, the risk of a revertant due to do novo mutation or gene assortment is greatly reduced.

(140) Another important consideration for generating a live attenuated vaccine candidate is the capacity of viral growth in vitro. The strain should retain sufficient growth capacity in order for mass production. Thus, to generate a combination strain, we first picked those that can induce higher interferon production, then we tried to add additional interferon sensitive mutations while preserving the viral replication capacity in vitro. After testing a plurality of combinations, we selected one of the combinations, which we called HIS strain. It contains 3 mutations from PB2 (N9D, Q75H, T76A), three mutations on M1 (N36Y, R72Q, S225T), and two mutations on NS1 (R38A, K41A). HIS virus is highly sensitive to interferon treatment (FIG. 2C). The interferon sensitivity is significantly higher than NS1 mutations (R38A-K41A), indicating the accumulative effect of mutations on PB2 and M1. We also quantified the viral growth of WT, NS1 mutant and HIS virus in IFN competent A549 cells and IFN deficient vero cells by TCID50 assays. The HIS virus showed about 2 log attenuation compare with WT in A549 cells, which is more deleterious than NS1 double mutations alone. However, the growth of HIS virus is restored in Vero cells, which grow at similar speed and reach similar peak viral load compared with wild type cells. HIS virus induced higher interferon production and response in A549 cells (FIG. 2D,I). At an early time point after infection (6 h), it can induce higher IFNb and ISG54 gene transcription. And at 24 h post infection, the induction of certain ISGs (ISG15, IFI6, RIG-I, Mx1) is also significantly higher than wild type. To examine the global change in gene transcription, we performed mRNA sequencing for WT, NS1 R38A-K41A HIS and mock control virus infected A549 cells at 6 h post infection. Biological duplicates were performed. Raw reads were aligned to human genome assembly, and the expression levels of individual genes were expressed as reads per million total reads (RPMs). An Edge package was used for statistical analysis. Compared with mock infected cells, 381 genes are significantly upregulated (fold change >2 and p<0.01) for HIS infected cells (FIG. 2E), and 181 genes are downregulated. Gene Ontology (GO) enrichment analysis of the upregulated genes revealed that the type I interferon production and response related genes are highly enriched. Top 4 GO terms are all related to interferon related defense response. Up-regulation of interferon production and ISGs are more significant in HIS compare with NS1 mutations. This suggested the key difference for cellular response of HIS and wild type virus relies on the ability of induce interferon response.

(141) To examine if the IFN sensitive phenotype of HIS virus is independent of WSN background, we introduced the same 8 mutations into a PR8 background. As expected, HIS virus on the PR8 background also showed higher IFN sensitivity than WT PR8 or NS1 mutations.

(142) We next investigated the replication and pathogenesis of HIS virus in a mouse model. 6-8 weeks Balb/c mice were intranasal inoculated with WT virus or HIS virus at a dose of 10.sup.5 or 10.sup.6 TCID50. Body weight loss was monitored daily for 10 days. 10.sup.6 TCID50 WT virus resulted in significant weight loss of all animals, while same amount of HIS did not cause weight loss. 10.sup.5 TCID50 WT virus caused very mild (?5%) weight loss and quickly recovered. Thus, we consistently used 10.sup.5 TCID50 as the vaccination dose for further studies.

(143) The only FDA-approved LAIV is a recombined virus with internal (PB2, PB1, PA, NP, M and NS) segments derived from A/Ann Arbor/6/60 (H2N2) that is cold adapted, therefore temperature sensitive (TS) and attenuated. The temperature-sensitive phenotype comes form 5 mutations in 3 polymerase genes: PB1 (391E, 581G, and 661T), PB2 (265S), and NP (34G). Similar phenotypes can be achieved in different strains by introducing the same mutations, including A/WSN/33 strain that we used here. Thus, we constructed and used the temperature sensitive WSN (WSN-TS) strain as control. We further investigated the viral replication in lungs of vaccinated mice. Viral titers of mice lung were quantified by TCID50 and viral copy number at day 2 post vaccination (FIG. 3L). Replication of the HIS virus was significantly lower than WT and NS1 R38A-K41A mutation, and comparable with WSN-TS virus. We also performed a time scale viral replication assay for HIS and wild type virus. Mice lung samples were collected at 2, 6, 24, 48 and 120 hours post vaccination and viral copy number were quantified. WT virus showed robust viral replication with viral peak at 48 h. In contrast, HIS virus only showed very limited replication at early time points followed by steady decay of copy number in lung tissues. It suggested HIS virus is highly attenuated in animal models, which is safe as a vaccine candidate. To examine if the attenuation is due to IFN sensitivity, we further tested viral replication in IFNAR?/? mice. The replication of HIS virus was fully rescued back to a WT level in IFNAR?/? mice, indicating that competent IFN response attenuates HIS virus in wild type mice (FIG. 3M).

(144) To further examine global gene transcription change upon infection in vivo, we performed mRNA sequencing of lung samples at 6, 24, 48, 120 hours post infection of HIS and WT virus. Compared with mock infected controls, the IFN pathway was most significantly upregulated at 48 h post infection for wild type virus, correlated with viral replication. Although highly attenuated in replication, HIS virus also showed early but significant upregulation of certain IFN related genes (FIG. 3E,F). The upregulation is most obviously seen in 6 h and 24 h post infection.

(145) z. Adaptive Immune Responses and Protection

(146) As the HIS virus is highly attenuated in vivo, we then examined if it still can induce robust adaptive immune response for protection. We first evaluated the humeral response. Balb/c mice were intranasal infected with 10.sup.5 TCID50 WT and HIS virus. At 14, 21 and 28 days post infection, serum samples were collected and HA-specific antibody were assessed through ELISA. We purified 4 types of HA protein from different strains of virus: WSN, PR8, HK68, and Viet04. WSN and PR8 belong to H1, HK68 is H3, and Veit04 is H5. According to the classification of HA proteins, H1 and H5 are class I, while H3 belongs to class II. Specific antibodies were detected for both WT and HIS vaccinated mice at all three time points against WSN, PR8 and Veit04 HA protein. The antibody titer kept increasing throughout the days post infection. HIS virus elicits a lower amount of specific antibodies compared with WT, majorly due to the attenuated replication. Notably, the antibody against HK58 HA was under the detection limit for both the WT and HIS virus using ELISA assay, suggesting there might be limited antibody that can recognize conserved epitope across class I and II HA. We also performed neutralization assay by hemagglutinin inhibition (HI) assays (FIG. 4E). 8 HA unit of WSN virus was incubated with serial dilution of heat inactivated serum in 37 degree for 2 h followed by the examination of HI ability. Consistent with ELISA result, the HIS virus elicits a significant amount of neutralizing antibody, although not high as WT.

(147) We then examined the ability of the HIS virus to induce T cell response. 6-8 week female C57/B6 mice were infected with 10.sup.5 TCID50 of WT and HIS virus or mock infected with DMEM. A Single cell suspension was prepared from mice lung samples and T cell responses were examined by tetramer staining. HIS virus developed similar levels of NP-specific T cells compared with WT although the replication was three logs lower. Furthermore, we evaluate the memory T cell response 1 month post vaccination by peptide stimulation assay. Solenocytes were incubated with viral peptide of known epitopes overnight and the amount of IFN-g secreting CD8 T cells were quantified by intracellular cytokine staining. Again, similar levels of memory T cell response were observed between HIS and WT vaccinated mice. These results suggested HIS stimulate more robust T cell responses because of the knockout of immune evasion functions.

(148) Finally, we examined if HIS virus can protect mice from challenges. 6-8 week female C57/B6 mice were intranasal vaccinated with 10.sup.5 TCID50 of WT, NS1 R38A-K41A, HIS, WSN-TS virus or mock infected with DMEM. 4 mice were used per group. All mice were challenged with 10.sup.5 TCID50 of WT virus 21 days post vaccination and viral titer in lung tissues were quantified at day 2 post challenge. By both RT-qPCR and TCID50 assay, we observed a ?3 log titer drop in HIS vaccinated mice compare with mock vaccination. The decrease of viral titer is more significant than WSN-TS vaccinated group (FIG. 4Q).

(149) We then challenged the HIS vaccinated mice with three heterologous strains (PR8, ACal/04/09 and X31) at lethal dose. Strong protection was seen across the board in terms of survival rate, percentage of body weight loss, and clinic scores (FIG. 5D, E).

(150) Although NS1 is the best studied IFN antagonist in influenza genome, the anti-IFN function has been recently appreciated in other proteins. It is reported that PB2 and PB1F2 could bind to MAVS and inhibit interferon production; ESIE motif in PB1 and PA can mediate type I interferon response, and NP of newly emerged H7N9 can counteract anti-viral ISG: MxA. Here, using a high-throughput genetic approach, we have identified multiple IFN sensitive mutations in the PB2, PA, PB1 and M1 proteins, suggesting the anti-IFN functions of corresponding WT proteins. As anti-IFN functions are essential for efficient viral replication in vivo, it is reasonable that the functions are distributed in different segments. Identified IFN sensitive mutations also work on different parts of IFN system. Mutations on PB2 and M1 can induce higher IFN production, indicating that they work at the upstream of IFN system. On the other hand, mutation on PB1 and PA cannot induce higher IFN production and response, and the sensitivity still remains in IFN deficient Vero cells, suggesting that they might be interacting with JAK/STAT pathway or a specific anti-viral ISG.

(151) III. Process Steps

(152) a. Identifying Interferon Sensitive Mutations Using a Genetic Platform

(153) To systematically identify interferon sensitive mutations across the entire influenza genome, we performed the interferon selection using a high-throughput genetic platform.

(154) FIG. 26 is a flowchart illustrating a method of making a genome using a genetic platform.

(155) The method comprises the following steps.

(156) Block 2600 represents optionally constructing a mutant plasmid library.

(157) In one example, a mutant plasmid library was constructed on the backbone of influenza A/WSN/1933 (H1N1) strain. In order to control mutant library size, the entire viral genome was divided into 240 bp small fragments, and error-prone polymerase was used to introduce random mutations into each small fragment so as to generate a mixed mutant population. In one or more examples, each resulting plasmid population is considered a mutant plasmid library, with ?1000 different mutations, and total of 52 plasmid libraries are established to cover the whole genome.

(158) Block 2602 represents co-transfecting a mutant DNA library with a plurality of plasmids encoding different fragments of a pathogen genome, so as to form a mutant pathogen library. In one or more examples, 30 million 293T cells are transfected with the DNA library together with seven other wild type plasmids to reconstitute the mutant virus library.

(159) Block 2604 represents passaging the mutant pathogen library in host cells with and without interferons, so as to form a plurality of first infected segments obtained from the passaging with the host cells with the interferons and a plurality of second infected segments obtained from the passaging with the host cells without the interferons. In illustrative embodiments described herein, the mutant viral library was passaged in A549 cells under interferon selection at a concentration of 1000 U/ml, virus was collected 24 h post selection, and biological duplicates were also conducted. In one or more examples, 15 million A549 cells were used to passage the viral library with MOI 0.05 for 24 h. In one or more examples, biological duplications are conducted for both transfection and infection steps.

(160) Block 2606 represents gene sequencing each of the infected segments so as to identify single nucleotide mutations or one or more nucleotide mutations.

(161) Block 2608 represents calculating a relative fitness score (RF score) of each single nucleotide mutation, or each of one or more of the nucleotide mutations, in each of the infected segments, wherein the RF score is a ratio of a frequency of the single nucleotide mutation or one or more nucleotide mutations in the infected segment/infection library as compared with the mutant DNA library. For example, the relative fitness (RF) score of a mutant virus may be calculated as the ratio of the relative frequency in the selected virus library to that in the plasmid library. In one or more examples, ?90% of nucleotide positions across the genome were covered, and ?95% of single mutations were detected in the DNA library. In one or more embodiments, to further increase the measurement of viral fitness, filtering was performed to identify mutations that only occur <0.05% in the input library. In one or more embodiments and silent mutations form a normal distribution with RF score centered around 1. In one or more examples, there is a clear separation between silent mutations and lethal mutations, suggesting sufficient selection during passage.

(162) Furthermore, in one or more embodiments, interferon sensitivity may be calculated as the difference of relative fitness with and without interferon selection, and correlation between biological duplicates may be observed.

(163) Block 2610 represents selecting the mutations having an RF score less than 0.2 in the first infected segments and the RF score greater than 0.5 in the second infected segments, so as to form selected mutations. In one or more examples, the basic criteria for selection include RF scores of fitness >0.5; RF scores of fitness under interferon selection <0.2; and preferring residues that give similar interferon sensitive phenotypes when mutated into different amino acids.

(164) Block 2612 represents forming the genome comprising the selected mutations. The genome composition of matter may be embodied in many ways, including, but not limited to, the following embodiments listed below. 1. A genetically engineered pathogen genome, wherein, as compared to wild type pathogen, the genetically engineered genome comprises a combination of nucleotide mutations selected to (1) increase the pathogen's sensitivity to type I interferon, and (2) induce an antibody and/or T cell response to the pathogen when used as an immunogen in vivo that is at least 10% of the antibody and/or T cell response induced when a wild type pathogen genome lacking the plurality of mutations is used as an immunogen in vivo; or suppress replication of the pathogen in a host cell in the presence of type I interferon by at least 50% as compared to replication of the pathogen in the host cell in the absence of the interferon. This genome composition of matter may be embodied in many ways, including, but not limited to, the following embodiments listed below. 2. The composition of matter of embodiment 1 wherein the combination suppresses replication of the pathogen in the host cell comprising interferons by a factor, e.g., of at least 10, at least 100, or by a factor in a range of 10-1000, as compared to replication in the host cell without the interferons. 3. The composition of matter of any of the previous embodiments 1-2, wherein the combination comprises nucleotide mutations each having a relative fitness score (RF) of less than 0.2 in the host cell comprising interferons and the RF score of greater than 0.5 in the host cell without the interferons, the RF score defined as a ratio of a frequency of the nucleotide mutation in the host cell as compared a frequency of the nucleotide mutation in a mutant DNA library. 4. The composition of matter of any of the preceding embodiments 1-3, wherein the pathogen is an influenza A virus and the combination at least sustains the antibody response to the virus. 5. The composition of matter of any of the preceding embodiments 1-4, wherein the mutations do not comprise mutations that only occur in less than e.g., 0.1% or 1% or 0.1%-5% of the mutant DNA library. 6. The composition of matter of any of the preceding embodiments 1-5, wherein each of the nucleotide mutations are located in different segments of the genome. 7. The composition of matter of any of the preceding embodiments 1-6, wherein the combination is selected from a set of mutations at, e.g., >50%, >60%, >70%, >80%, >90%, or 50-95% of the nucleotide positions in the genome. 8. The composition of matter of any of the preceding embodiments 1-7, wherein the nucleotide mutations comprise single, double, or triple nucleotide mutations, so that the combination is selected with single, double, or triple nucleotide resolution. 9. The composition of matter of any of the preceding embodiments 1-8, wherein the nucleotide mutations alter an amino acid sequence of a polypeptide encoded by the genome (e.g., with single amino acid resolution, e.g., so that a protein can be encoded with single amino acid resolution). 10. The composition of matter of any of the preceding embodiments 1-9, wherein the combination comprises e.g., at least 4 nucleotide mutations, at least 5 nucleotide mutations, at least 6 nucleotide mutations, at least 7 nucleotide mutations, or a number of nucleotide mutations in a range of 4-8. 11. The composition of matter of any of the preceding embodiments 1-10, wherein the pathogen is an influenza virus (e.g. influenza A). 12. The composition of matter of embodiment 11, wherein the pathogen is an influenza A virus, and the influenza A virus genome encodes a mutation comprising at least one amino acid substitution in PB2 at amino acid position N9, Q75 or T76; at least one amino acid substitution in M1 at amino acid position N36, R72 or 5225, and/or at least one amino acid substitution in NS1 at amino acid position R38 or K41. 13. The composition of embodiment 12, wherein the pathogen is an influenza A virus, and the influenza A virus genome encodes a mutation comprising at least one amino acid substitution in PB2 selected from N9D, Q75H and T76A; at least one amino acid substitution in M1 selected from N36Y, R72Q and S225T, and/or at least one amino acid substitution in NS1 selected from R38A and K41A. 14. The composition of matter of any of the preceding embodiments 1-13, wherein the pathogen comprises a protein including residues and the genome encodes the protein so as to form clustered residues on a surface of the protein. 15. The composition of matter of any of the preceding embodiments 1-14, wherein the genetically engineered genome comprises a combination of nucleotide mutations selected to suppress replication of the pathogen in a host cell in the presence of type I interferon so that vaccination of a mouse with 1?10.sup.7 pfu of the composition of matter does not result in death of the mouse.

(165) Block 2614 represents optionally fabricating a vaccine, therapeutic agent, or other pharmaceutical composition comprising the composition of matter of Block 2612.

(166) Thus, FIG. 26 further illustrates a method of making a genome, comprising systematically identifying immune evasion functions of a genome; and eliminating the immune evasion functions so as to tune a replication fitness of the genome and an antibody response to a pathogen comprising the genome.

(167) Exemplary approaches described herein can be used to identify mutations that impact the production of INFs and the sensitivity to IFNs at single nucleotide or single amino acid resolution. In one or more embodiments, the high resolution enabled us to re-engineer the virus with precision that was not previously possible. For example, we are able to rationally change one amino acid at a defined location. Deletion mutation, on the other hand, as described in U.S. Pat. No. 9,387,240 (50) may impact other functions of the viral protein. However, as illustrated herein, we identified and utilized (e.g., 8) mutations that are different from the mutations described in the U.S. Pat. No. 9,387,240 (50). Each of the 8 mutations are very specific for INF induction and do not impact other functions. Moreover, the embodiments of the influenza A mutant described in the examples section herein are strongly suppressed in vivo and did not result in any death of vaccinated mice even at 1?10{circumflex over ()}7 pfu. However, the U.S. Pat. No. 9,387,240 (50) describes 2 mice were dead after being vaccinated with NS1-99 at 5?10{circumflex over ()}6 pfu.

(168) b. Method of Fabricating a Composition of Matter and Generating an Immune Response

(169) FIG. 27 illustrates a method of making a composition of matter, e.g., including the composition of matter of block 2612 in FIG. 26.

(170) Block 2700 represents mutating the genome of the wild type influenza A virus so as to generate an influenza A viral genome having a plurality of mutations selected to (a) increase the influenza A virus sensitivity to type I interferon; and (b) induce an antibody and/or T cell response to the influenza A virus when used as an immunogen in vivo that is at least 5%, 10% 25% or 50% of the antibody and/or T cell response induced when a wild type influenza A viral genome lacking the plurality of mutations is used as an immunogen in vivo.

(171) Block 2702 represents the end result, a composition of matter comprising an influenza A viral genome having a plurality of mutations selected to (a) increase the influenza A virus sensitivity to type I interferon; and (b) induce an antibody and/or T cell response to the influenza A virus as described in Block 2700. This genome composition of matter may be embodied in many ways including, but not limited to, the examples listed below. 1. The composition of matter, wherein at least one of the plurality of mutations is at least one single nucleotide mutation in the influenza A: PA, PB1, PB2, NS1 or M1 genes. 2. The composition of any of the preceding embodiments, wherein the at least one mutation is found at amino acid position N9, Q75, or T76 in PB2, and/or found at amino acid position N36, R72, 5225 in M1, and/or found at acid position R3A, K41 in NS1. 3. The composition of any of the preceding embodiments 1-2, wherein the at least one mutation is selected from at least one of N9D, Q75H, T76A in PB2, and/or selected from at least one of N36Y, R72Q, S225T in M1, and/or selected from at least one of R38A, K41A in NS1.

(172) The method illustrated in FIG. 27 can be used to generate an immune response to influenza A in a human, a pig or a bird (e.g. a duck) by administering to the human, a pig or a bird a composition as disclosed herein.

Advantages and Improvements

(173) With rapid genome replication, high mutation rate and genome assortment, influenza viruses constantly evolve and adapt to diverse selection pressures, including different host responses. The type I interferon system (IFN), one of the most critical components of innate immune responses, plays essential roles for limiting influenza replication. It is also the bridge between innate immune responses and adaptive immune responses. Determining which viral proteins, more specifically which domain or residues are involved in managing interferon responses, is crucial for better understanding the mechanisms of viral-host interactions and informative for vaccine design.

(174) As these proteins are essential for viral replication, generating mutations is the most direct way to examine their potential anti-IFN function in the context of viral replication. Specifically, using the fact that type I IFN system is the key player of innate immune response, we engineered a virus to be IFN sensitive by mutating IFN evasion genes and so as to efficiently attenuate the virus in vivo. As the IFNs are critical for the development of T cell and B cell response, the IFN inducing strains used as a vaccine stimulated a more robust adaptive immune response (despite reduced replication of the virus). Moreover, the anti-IFN functions of the virus are usually on multi-loci: by selecting a combination of mutations that are introduced into the vaccine strain, the level of replication and the ability to induce protective immune response can be fine tuned in order to maximize the efficacy and limit the risk.

(175) Finally, since NS1 is the major IFN counteracter among influenza genome, different versions of the truncated NS1 protein (deltaFlu) are also being used as vaccine candidates and show impressive CD4, CD8 T cell development and antibody production. However, one limitation is that by focusing on one protein, there is risk of a revertant by gene reassortment. Embodiments of the present invention, on the other hand, use a genome wide screen to systematically identify IFN sensitive mutations across the whole genome that are neutral in viral replication. By combining together multiple mutations located in different gene segments, the risk of a revertant due to do novo mutation or gene assortment is reduced while maintaining the efficiency of vaccination.

(176) Thus, we disclose here a framework for developing a live attenuated vaccine: systematically identifying immune evasion functions on the virus genome, then eliminating the immune evasion functions while maintaining and/or tuning the replication fitness. This systematic method is a generally applicable way for developing live attenuated vaccines and/or therapeutic agents that stimulate antibody responses to viruses in general (including, but not limited to, influenza, Zika, and NiV viruses) as well as other types of pathogens. A therapeutic agent comprising a pathogen genetically engineered according to the method(s) described herein would be particularly useful for patients infected with drug resistant virus and such a patient population would be suitable for the first group of clinical trials. Moreover, the method(s) described herein are suitable for use in human and agricultural (e.g., poultry, pig) applications.

(177) Further information on one or more embodiments of the present invention can be found in reference (47).

(178) IV. Sequences for Proteins and Viruses Described Herein.

(179) TABLE-US-00001 a.InfluenzaAWSNstrainHISaccordingtoembodimentsof thepresentinvention Firstsegment(WSNflu1) (SEQIDNO:1) TCAATTATATTCAATATGGAAAGAATAAAAGAACTAAGGAATCTAATGTCGCAGTCTCGC ACTCGCGAGATACTCACAAAAACCACCGTGGACCATATGGCCATAATCAAGAAGTACACA TCAGGAAGACAGGAGAAGAACCCAGCACTTAGGATGAAATGGATGATGGCAATGAAATAT CCAATTACAGCAGACAAGAGGATAACGGAAATGATTCCTGAGAGAAATGAGCAGGGACAA ACTTTATGGAGTAAAATGAATGACGCCGGATCAGACCGAGTGATGGTATCACCTCTGGCT GTGACATGGTGGAATAGGAATGGACCAGTGACAAGTACAGTTCATTATCCAAAAATCTAC AAAACTTATTTTGAAAAAGTCGAAAGGTTAAAACATGGAACCTTTGGCCCTGTCCATTTT AGAAACCAAGTCAAAATACGTCGAAGAGTTGACATAAATCCTGGTCATGCAGATCTCAGT GCCAAAGAGGCACAGGATGTAATCATGGAAGTTGTTTTCCCTAACGAAGTGGGAGCCAGG ATACTAACATCGGAATCGCAACTAACGACAACCAAAGAGAAGAAAGAAGAACTCCAGGGT TGCAAAATTTCTCCTCTGATGGTGGCATACATGTTGGAGAGAGAACTGGTCCGCAAAACG AGATTCCTCCCAGTGGCTGGTGGAACAAGCAGTGTGTACATTGAAGTGTTGCATTTGACC CAAGGAACATGCTGGGAACAGATGTACACTCCAGGAGGGGAGGCGAGGAATGATGATGTT GATCAAAGCTTAATTATTGCTGCTAGAAACATAGTAAGAAGAGCCACAGTATCAGCAGAT CCACTAGCATCTTTATTGGAGATGTGCCACAGCACGCAGATTGGTGGAATAAGGATGGTA AACATCCTTAGGCAGAACCCAACAGAAGAGCAAGCCGTGGATATTTGCAAGGCTGCAATG GGACTGAGAATTAGCTCATCCTTCAGTTTTGGTGGATTCACATTTAAGAGAACAAGCGGA TCATCAGTCAAGAGAGAGGAAGAGGTGCTTACGGGCAATCTTCAGACATTGAAGATAAGA GTGCATGAGGGATATGAAGAGTTCACAATGGTTGGGAGAAGAGCAACAGCTATACTCAGA AAAGCAACCAGGAGATTGATTCAGCTGATAGTGAGTGGGAGAGACGAACAGTCGATTGCC GAAGCAATAATTGTGGCCATGGTATTTTCACAAGAGGATTGTATGATAAAAGCAGTTAGA GGTGACCTGAATTTCGTCAATAGGGCGAATCAGCGATTGAATCCCATGCACCAACTTTTG AGACATTTTCAGAAGGATGCAAAGGTGCTCTTTCAAAATTGGGGAATTGAATCCATCGAC AATGTGATGGGAATGATCGGGATATTGCCCGACATGACTCCAAGCACCGAGATGTCAATG AGAGGAGTGAGAATCAGCAAAATGGGGGTAGATGAGTATTCCAGCGCGGAGAAGATAGTG GTGAGCATTGACCGTTTTTTGAGAGTTAGGGACCAACGTGGGAATGTACTACTGTCTCCC GAGGAGATCAGTGAAACACAGGGAACAGAGAAACTGACAATAACTTACTCATCGTCAATG ATGTGGGAGATTAATGGTCCTGAATCAGTGTTGGTCAATACCTATCAGTGGATCATCAGA AACTGGGAAACTGTTAAAATTCAGTGGTCCCAGAATCCTACAATGCTGTACAATAAAATG GAATTTGAGCCATTTCAGTCTTTAGTTCCAAAGGCCGTTAGAGGCCAATACAGTGGGTTT GTGAGAACTCTGTTCCAACAAATGAGGGATGTGCTTGGGACATTTGATACCGCTCAGATA ATAAAACTTCTTCCCTTCGCAGCCGCTCCACCAAAGCAAAGTAGAACGCAGTTCTCCTCA TTGACTATAAATGTGAGGGGATCAGGAATGAGAATACTTGTAAGGGGCAATTCTCCAGTA TTCAACTACAACAAGACCACTAAAAGACTCACAGTTCTCGGAAAGGATGCTGGCCCTTTA ACTGAAGACCCAGATGAAGGCACAGCTGGAGTTGAGTCCGCAGTTCTGAGAGGATTCCTC ATTCTGGGCAAAGAAGACAGGAGATATGGACCAGCATTAAGCATAAATGAACTGAGCAAC CTTGCGAAAGGAGAGAAGGCTAATGTGCTAATTGGGCAAGGAGACGTGGTGTTGGTAATG AAACGGAAACGGAACTCTAGCATACTTACTGACAGCCAGACAGCGACCAAAAGAATTCGG ATGGCCATCAATTAGTGTCGAATAGTTTAAAAA Secondsegment(WSN_flu2) (SEQIDNO:8) ATTTGAATGGATGTCAATCCGACTTTACTTTTCTTAAAAGTGCCAGCACAAAATGCTATA AGCACAACTTTCCCTTATACTGGAGACCCTCCTTACAGCCATGGGACAGGAACAGGATAC ACCATGGATACTGTCAACAGGACACATCAGTACTCAGAAAGGGGAAGATGGACAACAAAC ACCGAAACTGGAGCACCGCAACTCAACCCGATTGATGGGCCACTGCCAGAAGACAATGAA CCAAGTGGTTATGCCCAAACAGATTGTGTATTGGAAGCAATGGCCTTCCTTGAGGAATCC CATCCTGGTATCTTTGAGACCTCGTGTCTTGAAACGATGGAGGTTGTTCAGCAAACACGA GTGGACAAGCTGACACAAGGCCGACAGACCTATGACTGGACTCTAAATAGGAACCAGCCT GCTGCAACAGCATTGGCCAACACAATAGAAGTGTTCAGATCAAATGGCCTCACGGCCAAT GAATCTGGAAGGCTCATAGACTTCCTTAAGGATGTAATGGAGTCAATGAACAAAGAAGAA ATGGAGATCACAACTCATTTTCAGAGAAAAAGACGAGTGAGAGACAATATGACTAAGAAA ATGGTGACACAGAGAACAATAGGTAAAAGGAAGCAGAGATTGAACAAAAGGAGTTATCTA ATTAGGGCATTAACCCTGAACACAATGACCAAAGATGCTGAGAGAGGGAAGCTAAAACGG AGAGCAATTGCAACCCCAGGGATGCAAATAAGGGGGTTTGTATACTTTGTTGAGACACTA GCAAGGAGTATATGTGAGAAACTTGAACAATCAGGATTGCCAGTTGGAGGCAATGAGAAG AAAGCAAAGTTGGCAAATGTTGTAAGGAAGATGATGACCAATTCTCAGGACACTGAAATT TCTTTCACCATCACTGGAGATAACACCAAATGGAACGAAAATCAGAACCCTCGGATGTTT TTGGCCATGATCACATATATAACCAGAAATCAGCCCGAATGGTTCAGAAATGTTCTAAGT ATTGCTCCAATAATGTTCTCAAACAAAATGGCGAGACTGGGAAAGGGGTACATGTTTGAG AGCAAGAGTATGAAAATTAGAACTCAAATACCTGCAGAAATGCTAGCAAGCATCGATTTG AAATACTTCAATGATTCAACTAGAAAGAAGATTGAAAAAATCCGGCCGCTCTTAATAGAT GGGACTGCATCATTGAGCCCTGGAATGATGATGGGCATGTTCAATATGTTAAGTACTGTA TTAGGAGTCTCCATCCTGAATCTTGGACAAAAGAGACACACCAAGACTACTTACTGGTGG GATGGTCTTCAATCTTCTGATGATTTTGCTCTGATTGTGAATGCACCCAATCATGAAGGG ATTCAAGCCGGAGTCAACAGGTTTTATCGAACCTGTAAGCTACTTGGAATTAATATGAGC AAGAAAAAGTCTTACATAAACAGAACAGGTACATTTGAATTCACAAGTTTTTTCTATCGT TATGGGTTTGTTGCCAATTTCAGCATGGAGCTTCCCAGCTTTGGGGTGTCTGGGATCAAC GAGTCTGCGGACATGAGTATTGGAGTTACTGTCATCAAAAACAATATGATAAACAATGAT CTTGGTCCAGCAACCGCTCAAATGGCCCTTCAGCTGTTCATCAAAGATTACAGGTACACG TACCGGTGCCATAGAGGTGACACACAAATACAAACCCGAAGATCATTTGAAATAAAGAAA CTGTGGGAGCAAACCCATTCCAAAGCTGGACTGCTGGTCTCCGACGGAGGCCCAAATTTA TACAACATTAGAAATCTCCACATTCCTGAAGTCTGCTTGAAATGGGAATTAATGGATGAG GATTACCAGGGGCGTTTATGCAACCCACTGAACCCATTTGTCAACCATAAAGACATTGAA TCAGTGAACAATGCAGTGATAATGCCAGCACATGGTCCAGCCAAAAACATGGAGTATGAT GCTGTTGCAACAACACACTCCTGGATCCCCAAAAGAAATCGATCCATCTTGAATACAAGC CAAAGAGGAATACTTGAAGATGAACAAATGTACCAAAAGTGCTGCAACTTATTTGAAAAA TTCTTCCCCAGCAGTTCATACAGAAGACCAGTCGGGATATCCAGTATGGTGGAGGCTATG GTTTCCAGAGCCCGAATTGATGCACGAATTGATTTCGAATCTGGAAGGATAAAGAAAGAG GAGTTCACTGAGATCATGAAGATCTGTTCCACCATTGAAGAGCTCAGACGGCAAAAATAG TGAATTTAGCTTGTCCTTCATGA Thirdsegment(WSNflu3) (SEQIDNO:9) CTGATTCAAAATGGAAGATTTTGTGCGACAATGCTTCAATCCGATGATTGTCGAGCTTGC GGAAAAGGCAATGAAAGAGTATGGAGAGGACCTGAAAATCGAAACAAACAAATTTGCAGC AATATGCACTCACTTGGAAGTGTGCTTCATGTATTCAGATTTTCACTTCATCGATGAGCA AGGCGAGTCAATAGTCGTAGAACTTGGCGATCCAAATGCACTTTTGAAGCACAGATTTGA AATAATCGAGGGAAGAGATCGCACAATAGCCTGGACAGTAATAAACAGTATTTGCAACAC TACAGGGGCTGAGAAACCAAAGTTTCTACCAGATTTGTATGATTACAAGAAGAATAGATT CATCGAAATTGGAGTAACAAGGAGAGAAGTTCACATATACTATCTGGAAAAGGCCAATAA AATTAAATCTGAGAAGACACACATCCACATTTTCTCATTCACTGGGGAGGAAATGGCCAC AAAGGCCGACTACACTCTCGATGAAGAAAGCAGGGCTAGGATCAAAACCAGGCTATTCAC CATAAGACAAGAAATGGCTAGCAGAGGCCTCTGGGATTCCTTTCGTCAGTCCGAGAGAGG CGAAGAGACAATTGAAGAAAGATTTGAAATCACAGGAACAATGCGCAAGCTTGCCGACCA AAGTCTCCCGCCAAACTTCTCCAGCCTTGAAAAATTTAGAGCCTATGTGGATGGATTCGA ACCGAACGGCTACATTGAGGGCAAGCTTTCTCAAATGTCCAAAGAAGTAAATGCTAGAAT TGAACCTTTTTTGAAATCAACACCACGACCACTTAGACTTCCGGATGGGCCTCCCTGTTC TCAGCGGTCCAAATTCCTGCTGATGGATGCCTTAAAATTAAGCATTGAGGACCCAAGTCA TGAGGGAGAGGGGATACCGCTATATGATGCAATCAAATGCATGAGAACATTCTTTGGATG GAAGGAACCCAATGTTGTTAAACCACACGAAAAGGGAATAAATCCAAATTATCTTCTGTC ATGGAAGCAAGTACTGGCAGAACTGCAGGACATTGAGAATGAGGAGAAAATTCCAAGGAC TAAAAATATGAAGAAAACGAGTCAGTTAAAGTGGGCACTTGGTGAGAACATGGCACCAGA AAAGGTAGACTTTGACGATTGTAAAGATGTAGGCGATTTGAAGCAATATGATAGTGATGA ACCAGAATTGAGGTCGCTTGCAAGTTGGATTCAGAATGAGTTCAACAAGGCATGTGAACT GACCGATTCAAGCTGGATAGAGCTCGATGAGATTGGAGAAGATGCGGCTCCAATTGAACA CATTGCAAGCATGAGAAGGAATTATTTCACAGCAGAGGTGTCTCATTGCAGAGCCACAGA ATACATAATGAAGGGGGTGTACATCAATACTGCCTTGCTTAATGCATCCTGTGCAGCAAT GGATGATTTCCAATTAATTCCAATGATAAGCAAGTGTAGAACTAAGGAGGGAAGGCGAAA GACCAATTTGTACGGTTTCATCATAAAAGGAAGATCCCACTTAAGGAATGACACCGATGT GGTAAACTTTGTGAGCATGGAGTTTTCCCTCACTGACCCAAGACTTGAACCACACAAATG GGAGAAGTACTGTGTTCTTGAGGTAGGAGATATGCTTCTAAGAAGTGCCATAGGCCATGT GTCAAGGCCTATGTTCTTGTATGTGAGGACAAATGGAACCTCAAAAATTAAAATGAAATG GGGGATGGAAATGAGGCGTTGCCTCCTTCAGTCACTTCAACAAATCGAGAGTATGATTGA AGCTGAGTCCTCTGTCAAGGAGAAAGACATGACCAAAGAGTTCTTTGAAAACAAATCAGA AACATGGCCCGTTGGAGAGTCCCCCAAAGGAGTGGAGGAAGGTTCCATTGGGAAGGTCTG CAGAACTTTATTGGCAAAGTCGGTATTCAACAGCTTGTATGCATCTCCACAACTAGAAGG ATTTTCAGCTGAATCAAGAAAACTGCTTCTTATCGTTCAGGCTCTTAGGGACAACCTGGA ACCTGGGACCTTTGATCTTGGGGGGCTATATGAAGCAATTGAGGAGTGCCTGATTAATGA TCCCTGGGTTTTGCTTAATGCTTCTTGGTTCAACTCCTTCCTCACACATGCATTGAGATA GTTGTGGCAATGCTACTATTTGCTATCCATACTGTCCAAAAA Fourthsegment(WSNflu4) (SEQIDNO:10) CCAAAATGAAGGCAAAACTACTGGTCCTGTTATATGCATTTGTAGCTACAGATGCAGACA CAATATGTATAGGCTACCATGCGAACAACTCAACCGACACTGTTGACACAATACTCGAGA AGAATGTGGCAGTGACACATTCTGTTAACCTGCTCGAAGACAGCCACAACGGGAAACTAT GTAAATTAAAAGGAATAGCCCCACTACAATTGGGGAAATGTAACATCACCGGATGGCTCT TGGGAAATCCAGAATGCGACTCACTGCTTCCAGCGAGATCATGGTCCTACATTGTAGAAA CACCAAACTCTGAGAATGGAGCATGTTATCCAGGAGATCTCATCGACTATGAGGAACTGA GGGAGCAATTGAGCTCAGTATCATCATTAGAAAGATTCGAAATATTTCCCAAGGAAAGTT CATGGCCCAACCACACATTCAACGGAGTAACAGTATCATGCTCCCATAGGGGAAAAAGCA GTTTTTACAGAAATTTGCTATGGCTGACGAAGAAGGGGGATTCATACCCAAAGCTGACCA ATTCCTATGTGAACAATAAAGGGAAAGAAGTCCTTGTACTATGGGGTGTTCATCACCCGT CTAGCAGTGATGAGCAACAGAGTCTCTATAGTAATGGAAATGCTTATGTCTCTGTAGCGT CTTCAAATTATAACAGGAGATTCACCCCGGAAATAGCTGCAAGGCCCAAAGTAAGAGATC AACATGGGAGGATGAACTATTACTGGACCTTGCTAGAACCCGGAGACACAATAATATTTG AGGCAACTGGTAATCTAATAGCACCATGGTATGCTTTCGCACTGAGTAGAGGGTTTGAGT CCGGCATCATCACCTCAAACGCGTCAATGCATGAGTGTAACACGAAGTGTCAAACACCCC AGGGAGCTATAAACAGCAATCTCCCTTTCCAGAATATACACCCAGTCACAATAGGAGAGT GCCCAAAATATGTCAGGAGTACCAAATTGAGGATGGTTACAGGACTAAGAAACATCCCAT CCATTCAATACAGAGGTCTATTTGGAGCCATTGCTGGTTTTATTGAGGGGGGATGGACTG GAATGATAGATGGATGGTATGGTTATCATCATCAGAATGAACAGGGATCAGGCTATGCAG CGGATCAAAAAAGCACACAAAATGCCATTAACGGGATTACAAACAAGGTGAACTCTGTTA TCGAGAAAATGAACACTCAATTCACAGCTGTGGGTAAAGAATTCAACAACTTAGAAAAAA GGATGGAAAATTTAAATAAAAAAGTTGATGATGGGTTTCTGGACATTTGGACATATAATG CAGAATTGTTAGTTCTACTGGAAAATGAAAGGACTTTGGATTTCCATGACTTAAATGTGA AGAATCTGTACGAGAAAGTAAAAAGCCAATTAAAGAATAATGCCAAAGAAATCGGAAATG GGTGTTTTGAGTTCTACCACAAGTGTGACAATGAATGCATGGAAAGTGTAAGAAATGGGA CTTATGATTATCCAAAATATTCAGAAGAATCAAAGTTGAACAGGGAAAAGATAGATGGAG TGAAATTGGAATCAATGGGGGTGTATCAGATTCTGGCGATCTACTCAACTGTCGCCAGTT CACTGGTGCTTTTGGTCTCCCTGGGGGCAATCAGTTTCTGGATGTGTTCTAATGGGTCTT TGCAGTGCAGAATATGCATCTGAGATTAGGATTTCAGAAATATAA Fifthsegment(WSNflu5) (SEQIDNO:11) TAGATAATCACTCACAGAGTGACATCGAAATCATGGCGACCAAAGGCACCAAACGATCTT ACGAACAGATGGAGACTGATGGAGAACGCCAGAATGCCACTGAAATCAGAGCATCTGTCG GAAAAATGATTGATGGAATTGGACGATTCTACATCCAAATGTGCACCGAACTTAAACTCA GTGATTATGAGGGACGGCTGATTCAGAACAGCTTAACAATAGAGAGAATGGTGCTCTCTG CTTTTGACGAGAGGAGGAATAAATATCTAGAAGAACATCCCAGTGCGGGGAAAGATCCTA AGAAAACTGGAGGACCTATATACAGGAGAGTAGATGGAAAGTGGAGGAGAGAACTCATCC TTTATGACAAAGAAGAAATAAGACGAATCTGGCGCCAAGCTAATAATGGTGACGATGCAA CGGCTGGTCTGACTCACATGATGATCTGGCACTCCAATTTGAATGATGCAACTTACCAGA GGACAAGAGCTCTTGTTCGCACAGGAATGGATCCCAGGATGTGCTCACTGATGCAGGGTT CAACCCTCCCTAGGAGGTCTGGGGCCGCAGGTGCTGCAGTCAAAGGAGTTGGAACAATGG TGATGGAATTGATCAGAATGATCAAACGTGGGATCAATGATCGGAACTTCTGGAGGGGTG AGAATGGACGGAGAACAAGGATTGCTTATGAAAGAATGTGCAACATTCTCAAAGGGAAAT TTCAAACAGCTGCACAAAGAACAATGGTGGATCAAGTGAGAGAGAGCCGGAATCCAGGAA ATGCTGAGTTCGAAGATCTCATCTTTTTAGCACGGTCTGCACTCATATTGAGAGGGTCAG TTGCTCACAAGTCCTGCCTGCCTGCCTGTGTGTATGGATCTGCCGTAGCCAGTGGATACG ACTTTGAAAGAGAGGGATACTCTCTAGTCGGAATAGACCCTTTCAGACTGCTTCAAAACA GCCAAGTATACAGCCTAATCAGACCAAATGAGAATCCAGCACACAAGAGTCAACTGGTGT GGATGGCATGCCATTCTGCTGCATTTGAAGATCTAAGAGTATCAAGCTTCATCAGAGGGA CGAAAGTGGTCCCAAGAGGGAAGCTTTCCACTAGAGGAGTTCAAATTGCTTCCAATGAAA ACATGGAGACTATGGAATCAAGTACCCTTGAACTGAGAAGCAGATACTGGGCCATAAGGA CCAGAAGTGGAGGGAACACCAATCAACAGAGGGCTTCCTCGGGCCAAATCAGCATACAAC CTACGTTCTCAGTACAGAGAAATCTCCCTTTTGACAGACCAACCATTATGGCAGCATTCA CTGGGAATACAGAGGGGAGAACATCTGACATGAGAACCGAAATCATAAGGCTGATGGAAA GTGCAAGACCAGAAGATGTGTCTTTCCAGGGGCGGGGAGTCTTCGAGCTCTCGGACGAAA AGGCAACGAGCCCGATCGTGCCCTCCTTTGACATGAGTAATGAAGGATCTTATTTCTTCG GAGACAATGCAGAGGAGTACGACAATTAAAGAAAAAT Sixthsegment(WSNflu6) (SEQIDNO:12) GAGTTTAAATGAATCCAAACCAGAAAATAATAACCATTGGGTCAATCTGTATGGTAGTCG GAATAATTAGCCTAATATTGCAAATAGGAAATATAATCTCAATATGGATTAGCCATTCAA TTCAAACCGGAAATCAAAACCATACTGGAATATGCAACCAAGGCAGCATTACCTATAAAG TTGTTGCTGGGCAGGACTCAACTTCAGTGATATTAACCGGCAATTCATCTCTTTGTCCCA TCCGTGGGTGGGCTATACACAGCAAAGACAATGGCATAAGAATTGGTTCCAAAGGAGACG TTTTTGTCATAAGAGAGCCTTTTATTTCATGTTCTCACTTGGAATGCAGGACCTTTTTTC TGACTCAAGGCGCCTTACTGAATGACAAGCATTCAAGGGGGACCTTTAAGGACAGAAGCC CTTATAGGGCCTTAATGAGCTGCCCTGTCGGTGAAGCTCCGTCCCCGTACAATTCAAGGT TTGAATCGGTTGCTTGGTCAGCAAGTGCATGTCATGATGGAATGGGCTGGCTAACAATCG GAATTTCTGGTCCAGATGATGGAGCAGTGGCTGTATTAAAATACAACCGCATAATAACTG AAACCATAAAAAGTTGGAGGAAGAATATATTGAGAACACAAGAGTCTGAATGTACCTGTG TAAATGGTTCATGTTTTACCATAATGACCGATGGCCCAAGTGATGGGCTGGCCTCGTACA AAATTTTCAAGATCGAGAAGGGGAAGGTTACTAAATCGATAGAGTTGAATGCACCTAATT CTCACTACGAGGAATGTTCCTGTTACCCTGATACCGGCAAAGTGATGTGTGTGTGCAGAG ACAATTGGCACGGTTCGAACCGACCATGGGTGTCCTTCGACCAAAACCTAGATTATAAAA TAGGATACATCTGCAGTGGGGTTTTCGGTGACAACCCGCGTCCCAAAGATGGAACAGGCA GCTGTGGCCCAGTGTCTGCTGATGGAGCAAACGGAGTAAAGGGATTTTCATATAAGTATG GCAATGGTGTTTGGATAGGAAGGACTAAAAGTGACAGTTCCAGACATGGGTTTGAGATGA TTTGGGATCCTAATGGATGGACAGAGACTGATAGTAGGTTCTCTATGAGACAAGATGTTG TGGCAATAACTAATCGGTCAGGGTACAGCGGAAGTTTCGTTCAACATCCTGAGCTAACAG GGCTAGACTGTATGAGGCCTTGCTTCTGGGTTGAATTAATCAGGGGGCTACCTGAGGAGG ACGCAATCTGGACTAGTGGGAGCATCATTTCTTTTTGTGGTGTGAATAGTGATACTGTAG ATTGGTCTTGGCCAGACGGTGCTGAGTTGCCGTTCACCATTGACAAGTAG Seventhsegment(WSNflu7) (SEQIDNO:13) GTAGATATTGAAAGATGAGTCTTCTAACCGAGGTCGAAACGTACGTTCTCTCTATCGTCC CGTCAGGCCCCCTCAAAGCCGAGATCGCACAGAGACTTGAAGATGTCTTTGCAGGGAAGA ACACCGATCTTGAGGTTCTCATGGAATGGCTAAAGACAAGACCAATCCTGTCACCTCTGA CTAAGGGGATTTTAGGATTTGTGTTCACGCTCACCGTGCCCAGTGAGCGGGGACTGCAGC GTAGACGCTTTGTCCAAAATGCTCTTAATGGGAACGGAGATCCAAATAACATGGACAAAG CAGTTAAACTGTATAGGAAGCTTAAGAGGGAGATAACATTCCATGGGGCCAAAGAAATAG CACTCAGTTATTCTGCTGGTGCACTTGCCTGTTGTATGGGCCTCATATACAACAGGATGG GGGCTGTGACCACTGAAGTGGCATTTGGCCTGGTATGCGCAACCTGTGAACAGATTGCTG ACTCCCAGCATCGGTCTCATAGGCAAATGGTGACAACAACCAATCCACTAATCAGACATG AGAACAGAATGGTTCTAGCCAGCACTACAGCTAAGGCTATGGAGCAAATGGCTGGATCGA GTGAGCAAGCAGCAGAGGCCATGGATATTGCTAGTCAGGCCAGGCAAATGGTGCAGGCGA TGAGAACCGTTGGGACTCATCCTAGCTCCAGTGCTGGTCTAAAAGATGATCTTCTTGAAA ATTTACAGGCCTATCAGAAACGAATGGGGGTGCAGATGCAACGATTCAAGTGATCCTCTC GTCATTGCAGCAAATATCATTGGAATCTTGCACTTGATATTGTGGATTCTTGATCGTCTT TTTTTCAAATGCATTTATCGTCGCTTTAAATACGGTTTGAAAAGAGGGCCTTCTACCGAA GGAGTGCCAGAGTCTATGAGGGAAGAATATCGAAAGGAACAGCAGAATGCTGTGGATGTT GACGATGGTCATTTTGTCAACATAGAGCTGGAGTAA Eighthsegment(WSNflu8) (SEQIDNO:14) TGACAAAGACATAATGGATCCAAACACTGTGTCAAGCTTTCAGGTAGATTGCTTTCTTTG GCATGTCCGCAAAAGAGTTGCAGACCAAGAACTAGGTGATGCCCCATTCCTTGATCGGCT TCGCCGAGATCAGAAGTCCCTAAGAGGAAGAGGCAGCACTCTTGGTCTGGACATCGAAAC AGCCACCCGTGCTGGAAAGCAAATAGTGGAGCGGATTCTGAAGGAAGAATCTGATGAGGC ACTCAAAATGACCATGGCCTCTGTACCTGCATCGCGCTACCTAACTGACATGACTCTTGA GGAAATGTCAAGGCACTGGTTCATGCTCATGCCCAAGCAGAAAGTGGCAGGCCCTCTTTG TATCAGAATGGACCAGGCGATCATGGATAAGAACATCATACTGAAAGCGAACTTCAGTGT GATTTTTGACCGGCTGGAGACTCTAATATTACTAAGGGCCTTCACCGAAGAGGGGACAAT TGTTGGCGAAATTTCACCACTGCCCTCTCTTCCAGGACATACTGATGAGGATGTCAAAAA TGCAGTTGGGGTCCTCATCGGAGGACTTGAATGGAATAATAACACAGTTCGAGTCTCTGA AACTCTACAGAGATTCGCTTGGAGAAGCAGTAATGAGAATGGGAGACCTCCACTCACTCC AAAACAGAAACGGAAAATGGCGGGAACAATTAGGTCAGAAGTTTGAAGAAATAAGGTGGT TGATTGAAGAAGTGAGACACAGACTGAAGATAACAGAGAATAGTTTTGAGCAAATAACAT TTATGCAAGCCTTACAACTATTGCTTGAAGTGGAGCAAGAGATAAGAACTTTCTCGTTTC AGCTTATTTAATAA b.PB1(polymerasebasicprotein1) (SEQIDNO:2) MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSER GRWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGIFET SCLETMEVVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVERSNGLT ANESGRLIDELKDVMESMNKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGK RKQRLNKRSYLIRALTLNTMTKDAERGKLKRRAIATPGMQIRGEVYFVETLA RSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTEISFTITGDNTKWNE NQNPRMFLAMITYITRNQPEWERNVLSIAPIMFSNKMARLGKGYMFESKSMK LRTQIPAEMLASIDLKYENDSTRKKIEKIRPLLIDGTASLSPGMMMGMFNMLS TVLGVSILNLGQKRHTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVNRFYR TCKLLGINMSKKKSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESAD MSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYRCHRGDTQIQTRRSF EIKKLWEQTHSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCN PLNPFVNHKDIESVNNAVIMPAHGPAKNMEYDAVATTHSWIPKRNRSILNTS QRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFES GRIKKEEFTEIMKICSTIEELRRQK c.PB2(polymerasebasicprotein2) (SEQIDNO:3) MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPALRMKWMM AMKYPITADKRITEMIPERNEQGQTLWSKMNDAGSDRVMVSPLAVTWWNR NGPVTSTVHYPKIYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADL SAKEAQDVIMEVVFPNEVGARILTSESQLTTTKEKKEELQGCKISPLMVAYML ERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEARNDDVDQSL IIAARNIVRRATVSADPLASLLEMCHSTQIGGVRMVNILRQNPTEEQAVDICK AAMGLRISSSFSFGGFTFKRTSGSSVKREEEVLTGNLQTLKIRVHEGYEEFTM VGRRATAILRKATRRLIQLIVSGRDEQSIAEAIIVAMVFSQEDCMIKAVRGDLN FVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIESIDNVMGMIGILPDMTPST EMSMRGVRISKMGVDEYSSAEKIVVSIDRFLRVRDQRGNVLLSPEEVSETQGT EKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKME FEPFQSLVPKAVRGQYSGFVRTLFQQMRDVLGTFDTAQIIKLLPFAAAPPKQS GMQFSSLTINVRGSGMRILVRGNSPVFNYNKTTKRLTVLGKDAGPLTEDPDE GTAGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVL VMKRKRNSSILTDSQTATKRIRMAIN d.PA(polymeraseacidicprotein) (SEQIDNO:4) MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLQLEGFSAESR KLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALR e.M1(Matrixprotein1) (SEQIDNO:5) MSLLTEVETYVLSIVPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILS PLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKR EITFHGAKEIALSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQ HRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMDIASQA RQMVQAMRTIGTHPSSSAGLKDDLLENLQAYQKRMGVQMQRFK f.M2Matrixprotein2 (SEQIDNO:6) MSLLTEVETPIRNEWGCRCNDSSDPLVIAANIIEILHLILWILDRLFFKCIYRRFK YGLKRGPSTEGVPESMREEYRKEQQNAVDVDDGHFVNIELE g.NS1Non-structuralprotein1 (SEQIDNO:7) MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTLG LDIETATRAGKQIVERILKEESDEALKMTMASVPASRYLTDMTLEEMSRHWF MLMPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGTIV GEISPLPSLPGHTDEDVKNAVGVLIGGLEWNNNTVRVSETLQRFAWRSSNEN GRPPLTPKQKRKMAGTIRSEV

REFERENCES

(180) Note: This application references a number of different publications as indicated throughout the specification by reference numbers enclosed in brackets, e.g., (x). A list of these different publications ordered according to these reference numbers can be found below.

(181) All publications mentioned herein are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. Publications cited herein are cited for their disclosure prior to the filing date of the present application. Nothing here is to be construed as an admission that the inventors are not entitled to antedate the publications by virtue of an earlier priority date or prior date of invention. Further, the actual publication dates may be different from those shown and require independent verification. 1. M. T. Osterholm, N. S. Kelley, A. Sommer, E. A. Belongia Lancet Infect. Dis. 12, 36-44 (2012). 2. A. C. Tricco et al., BMC Med. 11, 153 (2013). 3. M. Darvishian, M. J. Bijlsma, E. Hak, E. R. van den Heuvel, Lancet Infect. Dis. 14, 1228-1239 (2014). 4. A. Garcia-Sastre, Virus Res. 162, 12-18 (2011). 5. J. M. Gonz?lez-Navajas, J. Lee, M. David, E. Raz, Nat. Rev. Immunol. 12, 125-135 (2012). 6. A. Iwasaki, P. S. Pillai, Nat. Rev. Immunol. 14, 315-328(2014). 7. J. W. Schoggins et al., Nature 472, 481-485 (2011). 8. J. P. Huber, J. D. Farrar, Immunology 132, 466-474 (2011). 9. A. Le Bon et al., Immunity 14, 461-470 (2001). 10. R. M. Welsh, K. Bahl, H. D. Marshall, S. L. Urban, PLOS Pathog. 8, e1002352 (2012). 11. A. Le Bon, D. F. Tough, Curr. Opin. Immunol. 14, 432-436 (2002). 12. J. Crouse, U. Kalinke, A. Oxenius, Nat. Rev. Immunol. 15, 231-242 (2015). 13. F. Krammer, P. Palese, Nat. Rev. Drug Discov. 14, 167-182 (2015). 14. J. Talon et al., Proc. Natl. Acad. Sci. U.S.A. 97, 4309-4314 (2000). 15. C. M?ssier et al., Vaccine 31, 6194-6200 (2013). 16. K. M. Graef et al., J. Virol. 84, 8433-8445 (2010). 17. M. Perez-Cidoncha et al Virol. 88, 4632-4646 (2014). 18. N. C. Wu et al., Sci. Rep. 4, 4942 (2014). 19. N. C. Wu et al., J. Virol. 88, 10157-10164 (2014). 20. E. Hoffmann, G. Neumann, Y. Kawaoka, G. Hobom, R. G. Webster, Proc. Natl. Acad. Sci. U.S.A. 97, 6108-6113 (2000). 21. Y. Du et al., MBio 7, e01801-16 (2016). 22. N. C. Wu et al., PLOS Genet. 11, e1005310 (2015). 23. N. C. Wu et al., BMC Genomics 17, 46 (2016). 24. S. F. Elena, P. Carrasco, J.-A. Dar?s, R. Sanjuan, EMBO Rep. 7, 168-173 (2006). 25. E. Visher, S. E. Whitefield, J. T. McCrone, W. Fitzsimmons, A. S. Lauring, PLOS Pathog. 12, e1005856 (2016). 26. B. G. Hale, R. A. Albrecht, A. Garcia-Sastre, Future Microbiol. 5, 23-41 (2010). 27. B. G. Hale, R. E. Randall, J. Ortin, D. Jackson, J. Gen. Virol. 89, 2359-2376 (2008). 28. H. F. Maassab, M. L. Bryant, Rev. Med. Virol. 9, 237-244 (1999). 29. H. Jin, H. Zhou, B. Lu, G. Kemble, J. Virol. 78, 995-998 (2004). 30. M. J. Memoli et al., MBio 7, e00417-e16 (2016). 31. D. M. Carragher, D. A. Kaminski, A. Moquin, L. Hartson, T. D. Randall, J. Immunol. 181, 4168-4176 (2008). 32. M. B. Doud, S. E. Hensley, J. D. Bloom, PLOS Pathog. 13, e1006271 (2017). 33. S. Mueller et al., Nat. Biotechnol. 28, 723-726 (2010). 34. L. Si et al., Science 354, 1170-1173 (2016). 35. C.-Y. Wu et al., Proc. Natl. Acad. Sci. U.S.A. 114, 280-285 (2017). 36. L. Wang et al., Cell Host Microbe 21, 334-343 (2017). 37. J. Steel et al., J. Virol. 83, 1742-1753 (2009). 38. A. Pflug, D. Guilligay, S. Reich, S. Cusack, Nature 516, 355-360 (2014). 39. S. Reich et al., Nature 516, 361-366 (2014). 40. S. J. Gamblin et al., Science 303, 1838-1842 (2004) 41. PB1 sequence found at website having the address www.fludb.org/brc/proteinSequence.spg?ncbiProteinId=ABF47963&decorator=influenza 42. PB2 sequence found at web site having the address www.fludb.org/brc/proteinSequence.spg?ncbiProteinId=ACF54608&decorator=influenza 43. PA sequence found at web site having the address www.fludb.org/brc/proteinSequence.spg?ncbiProteinId=BAA01431&decorator=influenza 44. M1 sequence found at website having the address www.fludb.org/brc/proteinSequence.spg?ncbiProteinId=AAA91325&decorator=influenza 45. M2 sequence found at website having the address www.fludb.org/brc/proteinSequence.spg?ncbiProteinId=AAA9132 4&decorator=influenza 46. NS1 sequence found at web site having the address www.fludb.org/brc/proteinSequence.spg?ncbiProteinId=ACF54603 &decorator=influenza. 47. Genome-wide identification of interferon-sensitive mutations enables influenza vaccine design by Yushen Du.sup.1 et. al., Science 19 Jan. 2018: Vol. 359, Issue 6373, pp. 290-296 DOI: 10.1126/science.aan8806, including supplementary information. 48. H. Jin et al., Multiple amino acid residues confer temperature sensitivity to human influenza virus vaccine strains (flumist) derived from cold-adapted a/ann arbor/6/60. Virology. 306, 18-24 (2003). 49. Vincent A L.sup.1, Ma W, Lager K M, Richt J A, Janke B H, Sandbulte M R, Gauger P C, Loving C L, Webby R J, Garcia-Sastre A. Live attenuated influenza vaccine provides superior protection from heterologous infection in pigs with maternal antibodies without inducing vaccine-associated enhanced respiratory disease. J Virol. 2012 October; 86(19):10597-605. doi: 10.1128/JVI.01439-12. Epub 2012 Jul. 18. 50. U.S. Pat. No. 9,387,240. 51. complete sequence for influenza A wild type strain A/WSN/1933 can be found at www.fludb.org/brc/fluStrainDetails.spg?strainName=A/WSN/1933(H1N1) &decorator=influenza.

CONCLUSION

(182) This concludes the description of the preferred embodiment of the present invention. The foregoing description of one or more embodiments of the invention has been presented for the purposes of illustration and description. It is not intended to be exhaustive or to limit the invention to the precise form disclosed. Many modifications and variations are possible in light of the above teaching. It is intended that the scope of the invention be limited not by this detailed description, but rather by the claims appended hereto.