Compositions and methods for regulation of chronic toxoplasma infection
11945845 ยท 2024-04-02
Assignee
Inventors
Cpc classification
C12N15/74
CHEMISTRY; METALLURGY
A61P33/02
HUMAN NECESSITIES
A61K2039/52
HUMAN NECESSITIES
International classification
A61P33/02
HUMAN NECESSITIES
Abstract
The present disclosure provides genetically altered protozoan parasites comprising a mutation in a bradyzoite formation deficient 1 (BFD1) gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite. The genetically altered protozoan parasites can be utilized in vaccine compositions and in methods of treating apicomplexan parasite infection.
Claims
1. A genetically altered Toxoplasma gondii comprising a mutation in a bradyzoite formation deficient 1 (BFD1) gene (SEQ ID NO:1), wherein the mutation is a deletion of all or a portion of the coding sequence of the BFD1 gene, and wherein the mutant BFD1 gene is defective in initiating differentiation of the Toxoplasma gondii into a bradyzoite.
2. The Toxoplasma gondii of claim 1, wherein the mutation is a deletion of a portion of the coding sequence of the BFD1 gene.
3. The Toxoplasma gondii of claim 1, wherein the mutation is a deletion of the entire coding sequence of the BFD1 gene.
4. The Toxoplasma gondii of claim 1, wherein the mutation is a loss-of-function mutation.
5. The Toxoplasma gondii of claim 4, wherein the loss-of-function mutation is a null mutation.
6. A vaccine composition comprising the Toxoplasma gondii of claim 1 and a pharmaceutically-acceptable carrier.
7. The vaccine composition of claim 6, further comprising an adjuvant.
8. The vaccine composition of claim 6, comprising a live vaccine.
9. The vaccine composition of claim 6, wherein the Toxoplasma gondii expresses a heterologous antigen.
10. A method of inducing an immune response to Toxoplasma gondii in a subject in need thereof, comprising administering to the subject a vaccine composition comprising a genetically altered Toxoplasma gondii, wherein the Toxoplasma gondii comprises a mutation in a bradyzoite formation deficient 1 (BFD1) gene (SEQ ID NO:1), wherein the mutation is a deletion of all or a portion of the coding sequence of the BFD1 gene, and wherein the mutant BFD1 gene is defective in initiating differentiation of the Toxoplasma gondii into a bradyzoite.
11. The method of claim 10, wherein the subject in need thereof is a human.
12. The method of claim 10, wherein the subject in need thereof is a non-human mammal.
13. The method of claim 10, wherein the subject in need thereof has an acute or chronic Toxoplasma gondii infection.
14. A method of delivering an antigen to a subject in need thereof, the method comprising administering the antigen to the subject a wherein the antigen is delivered in a genetically altered Toxoplasma gondii, wherein the Toxoplasma gondii comprises a mutation in a bradyzoite formation deficient 1 (BFD 1) gene (SEQ ID NO:1), wherein the mutation is a deletion of all or a portion of the coding sequence of the BFD 1 gene, and wherein the mutant BFD 1 gene is defective in initiating differentiation of the Toxoplasma gondii into a bradyzoite.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawings will be provided by the Office upon request and payment of the necessary fee.
(2) The foregoing will be apparent from the following more particular description of example embodiments, as illustrated in the accompanying drawings in which like reference characters refer to the same parts throughout the different views. The drawings are not necessarily to scale, emphasis instead being placed upon illustrating embodiments.
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
DETAILED DESCRIPTION
(22) A description of example embodiments follows.
(23) Several aspects of the invention are described below, with reference to examples for illustrative purposes only. It should be understood that numerous specific details, relationships, and methods are set forth to provide a full understanding of the invention. One having ordinary skill in the relevant art, however, will readily recognize that the invention can be practiced without one or more of the specific details or practiced with other methods, protocols, reagents, cell lines and animals. The present invention is not limited by the illustrated ordering of acts or events, as some acts may occur in different orders and/or concurrently with other acts or events. Furthermore, not all illustrated acts, steps or events are required to implement a methodology in accordance with the present invention. Many of the techniques and procedures described, or referenced herein, are well understood and commonly employed using conventional methodology by those skilled in the art.
(24) Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. It will be further understood that terms, such as those defined in commonly-used dictionaries, should be interpreted as having a meaning that is consistent with their meaning in the context of the relevant art and/or as otherwise defined herein.
(25) The terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. As used herein, the indefinite articles a, an and the should be understood to include plural reference unless the context clearly indicates otherwise.
(26) Toxoplasma gondii chronically infects approximately a quarter of the world's population. Recrudescence of latent infections can cause life-threatening disease in the immunocompromised and recurrent ocular lesions in the immunocompetent. Chronic infection is established when rapidly replicating tachyzoites differentiate into slow-growing bradyzoites, which form tissue cysts resistant to immune clearance and current therapeutics. Despite its central role in the Toxoplasma life cycle, the molecular basis of differentiation is not understood.
(27) The length of infection is a critical parameter in the evolutionary fitness of infectious diseases. Pathogens can extend the period of infection by establishing a latent or chronic state, avoiding clearance through slow replication, altered immunogenicity, and a diminished impact on the host. Oftentimes, these reservoirs are resistant to chemotherapy due to decreased metabolic rates. Such persistent stages can recrudesce or contribute to transmission, and are important barriers to curing and eradicating infectious diseases.
(28) The life cycles of single-celled protist parasites are marked by distinct developmental stages adapted to the specific stages of their complex life cycles. Within the phylum Apicomplexa, several examples of chronic stages play important roles in the life cycles of these pathogens. Plasmodium vivax hypnozoites in the liver are resistant to most antimalarial therapies, leading to long periods of latency, and complicating eradication efforts.sup.2. Toxoplasma gondii tachyzoites are capable of invading any nucleated cell in any warm-blooded animal, disseminating throughout the body and causing pathology through lysis of host cells. A proportion of tachyzoites differentiate into slower-growing bradyzoites, forming intracellular cysts with a tropism for brain and muscle tissue. Tissue cysts cannot be cleared by the immune system or by current therapies, and as a result up to ? of the world's population is thought to be chronically infected with Toxoplasma.sup.3. Tissue cysts are orally infectious to both the definitive felid host and to other intermediate hosts, providing flexibility in route of transmission. Approximately 2% of infections result in ocular lesionsa leading cause of infectious blindnesswith high rates of reactivation from chronic stages that persist after treatment. Toxoplasma infection is life threatening in immunocompromised individuals, and a majority of these cases result from recrudescent infections.sup.4.
(29) Major changes accompany differentiation of Toxoplasma from rapidly proliferating tachyzoites to cyst-forming bradyzoites. The parasitophorous vacuole Toxoplasma replicates within is modified into a heavily glycosylated cyst wall, containing many stage-specific protein products of unknown function.sup.5-8. Parasite metabolism changes drastically, relying on anaerobic glycolysis instead of aerobic respiration and accumulating cytoplasmic starch granules.sup.9-11. Underpinning these dramatic changes in lifestyle, between several hundred and several thousand genes have been identified as differentially regulated between tachyzoites and in vitro or in vivo bradyzoites.sup.12-21. Although differentiation can be induced in vitro through a variety of methods, including alkaline pH, heat shock, small molecules, and nutrient starvation, the molecular mechanisms driving bradyzoite differentiation remain poorly understood.sup.22-25.
(30) Attempts to enrich for mutants no longer able to differentiate have generated strains with decreased rates of stage conversion, though linking these phenotypes to inactivation of individual genes has proven challenging.sup.26,27. Deletion or chemical inhibition of histone modifying proteins has resulted in differentiation defects.sup.17,28-31. Interference with translational control through deletion of RNA-binding proteins or chemical modulation of eIF2? phosphorylation also impairs differentiation.sup.32-35. A single validated class of Apicomplexan transcription factors, the AP2 DNA-binding proteins (ApiAP2s), has been extensively investigated for potential regulators of differentiation. Knockouts of individual ApiAP2s modulate, but ultimately fail to completely ablate, bradyzoite differentiation, leading to the view that no master transcriptional regulator of this process exists in Toxoplasma.sup.36-41.
(31) Differentiation from tachyzoites to bradyzoites establishes chronic Toxoplasma infection; however, the molecular pathways regulating this transition have remained unclear, despite evidence that disparate inputsheat shock, alkaline stress, and nutrient starvation converge on a common transcriptional program.
(32) Using bulk and single-cell RNA sequencing, differentiation is characterized in unprecedented detail. To functionally investigate this transition, over 200 putative DNA-binding proteins were screened, identifying a single factor, BFD1, as indispensable for differentiation. BFD1 knockout parasites are normal under standard conditions but fail to differentiate under all induction conditions tested. Overexpression of BFD1 is sufficient to induce differentiation under standard conditions in both wildtype and knockout parasites, demonstrating its role as a master regulator of bradyzoite formation in Toxoplasma.
(33) By profiling enriched differentiated populations, transcriptional differences between tachyzoites and bradyzoites were captured with greater sensitivity and dynamic range than achieved by previous datasets.sup.15-18,20,21,42. These changes likely reflect a combination of factors including altered replication, nutrient availability, and general stress responses, in addition to the bradyzoite differentiation program. The genetic handle afforded by BFD1 on differentiation will help disentangle the contributions of these variables.
(34) A single family of DNA-binding proteinsthe ApiAP2shas been investigated for their role as T gondii transcription factors and mediators of differentiation. While the phenotypes associated with many ApiAP2 mutants are striking, no single gene knockout has resulted in a complete block in differentiation, leading to the assumption that no single factor regulates bradyzoite development in T gondii.sup.36-41. By screening a wider range of putative nucleic-acid binding proteins, especially those containing well-conserved DNA-binding motifs such as zinc finger and Myb-like domains, it was observed that inactivation of BFD1 completely ablates bradyzoite formation. This does not preclude important roles for ApiAP2 proteins as downstream mediators of the differentiation program. Toxoplasma encodes 13 other proteins containing SANT/Myb-like domains, suggesting the existence of a second extensive transcription factor family. Myb domaincontaining proteins are widespread among eukaryotes, and have been implicated in the regulation of encystation in Entamoeba and Giardia, along with a wide variety of stress responses in plants.sup.43-47. In humans, c-Myb is thought to function as a pioneer transcription factor, binding to chromatin and recruiting histone acetyltransferases to commit cells to specific hematopoietic lineages.sup.48,49. Among apicomplexan parasites, a Myb domaincontaining protein has been identified as important for erythrocytic growth of P. falciparum.sup.50,51 suggesting that other family members will likely play important roles throughout the phylum.
(35) Single-cell RNA-sequencing enables profiling of thousands of cells across asynchronous processes, and has been successfully used to examine commitment to sexual differentiation in Plasmodium spp..sup.52,53 Implementing these approaches in Toxoplasma retained information about cell-cycle residency and timing of gene expression that is lost in bulk analyses. Single-cell sequencing allowed identification of novel markers specific to actively replicating bradyzoites and genes expressed during the earliest stages of differentiation. This detailed view of differentiation revealed that BFD1 knockout parasites progress normally throughout the tachyzoite cycle but completely fail to initiate bradyzoite differentiation. BFD1 therefore stands out from other genes known to influence differentiation for its complete essentiality during the process.
(36) As a necessary and sufficient regulator of differentiation, BFD1 provides a focal point for the molecular mechanisms underlying differentiation. In Plasmodium, identification of AP2-G as the master transcriptional regulator of gametogenesis has permitted placement of multiple genes observed to affect sexual differentiation into a unified regulatory framework, and allowed directed investigation into their mechanisms of action.sup.54-60 The ability to induce synchronized sexual differentiation through conditional overexpression of AP2-G has allowed for finer temporal mapping of the gene expression changes accompanying gametogenesis, and application of a similar approach in Toxoplasma is now possible using BFD1.sup.61.
(37) The transcriptional profiling reveals that BFD1 is expressed in the 75th percentile in tachyzoites, and expression at this level or higher is corroborated by many other RNA-sequencing datasets.sup.19-21,62-65. BFD1 expression therefore does not appear to be stage specific despite a modest 1.5- to 3.6-fold upregulation in bradyzoites observed by bulk or single-cell RNA sequencingthe former below the cutoff for significance. These results suggest that regulation of BFD1 is post-transcriptional. Preferential translation of some transcripts under stress conditions has been reported, and mutations in RNA-binding proteins have resulted in severe defects that suggest an important role for translational control during differentiation.sup.29.sup.32. Post-translational modifications, such as phosphorylation or acylation may provide additional layers of regulation by influencing BFD1 stability or function.
(38) Mutations resulting in decreased rates of differentiation in cell culture generally display more profound defects in mice; however, the specificity of the BFD1 phenotype will help define the role of bradyzoites in pathogenesis and immunological memory during Toxoplasma infection.sup.36,40,66,67. The presence of BFD1 orthologs in other agriculturally significant parasites, such as Neospora caninum and Sarcocystis neurona, suggests ?BFD1 parasites are an ideal attenuated vaccine straincapable of proliferating robustly yet unable to enter a chronic state. Moreover, modulation of BFD1 holds clinical and biotechnological potential, since chronic infections represent a major barrier to both the treatment of Toxoplasma and its use in delivery of heterologous antigens and protein-based therapeutics.
(39) The present invention is directed to compositions and methods for the treatment of apicomplexan parasite infection, such as Toxoplasma infection.
(40) The present invention incorporates new approaches to investigate the tachyzoite to bradyzoite transition. A differentiation reporter strain compatible with Cas9-mediated forward genetic screens was generated, and bulk and single-cell methods to characterize the transcriptional changes that underlie Toxoplasma differentiation were developed. The present disclosure provides a single factor necessary and sufficient for the initiation of the differentiation program. Characterization of this master regulator of bradyzoite formation represents an important step in the understanding of the establishment and maintenance of chronic Toxoplasma infection.
(41) In one aspect, the present invention provides genetically altered protozoan parasites comprising a mutation in a bradyzoite formation deficient 1 (BFD1) gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite. As such, attenuated parasites are provided. In some embodiments, the parasite is an apicomplexan parasite, such as e.g., a Toxoplasma parasite, a Plasmodium parasite, a Hammondia parasite, a Neospora parasite or a Sarcocystis parasite.
(42) In some embodiments, the mutation is a deletion of all or a portion of the coding sequence of the BFD1 gene (the sequence of the BFD1 gene is provided in SEQ ID NO: 1). In some embodiments, the mutation is a deletion of the entire coding sequence of the BFD1 gene. In other embodiments, the mutation is a deletion of a portion of the coding sequence of the BFD1 gene. For example, the deletion can be a deletion of a portion of the BFD1 gene comprising at least about 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more of the BFD1 gene.
(43) As described herein, the BFD1 protein contains two tandem SANT/myb-like DNA-binding domains (SMART accession 00717), flanked by large extensions lacking identifiable motifs. Collectively, the two tandem SANT/myb-like DNA-binding domains are referred to herein as the BFD1 DNA binding domain. Individually, the SANT/myb-like DNA-binding domains are referred to herein as a Myb-like DNA binding domain, Myb-like domain or Myb domain. Accordingly, in some embodiments, the mutation is a deletion of a portion of the BFD1 gene that encodes the BFD1 DNA binding domain (e.g., a deletion of a portion encoding both Myb-like DNA binding domains, a deletion of a portion encoding both Myb-like DNA binding domains along with the flanking extensions). In certain embodiments, the deletion encompasses a portion of the BFD1 gene encoding amino acids 921-1019 of the BFD1 protein.
(44) In other embodiments, the mutation is a deletion of a portion of the BFD1 gene encoding one Myb-like DNA binding domain (e.g., a deletion of a portion encoding one of the Myb-like domains while leaving the other Myb-like domain intact, a deletion of a portion encoding one Myb-like domain and a portion of the second Myb-like domain). An example of a mutation comprising a deletion of a portion of the BFD1 gene encoding the BFD1 DNA binding domain is described in the Examples herein, and is referred to interchangeably as the ?MYB or ?DBD.
(45) In further embodiments, the mutation can be one or more nucleotide base substitutions, one or more nucleotide base deletions, or one or more insertion (of one or more nucleotide bases or constructs (e.g., reporter genes)). In some embodiments, the insertion or deletion results in a frame-shift that changes the reading of subsequent codons, altering the entire amino acid sequence that follows the mutation. In some embodiments, the mutation can introduce a premature stop codon. In some embodiments, a nucleotide sequence of the BFD1 gene comprises a nucleic acid sequence having at least 70% sequence identity to the sequence of SEQ ID NO: 1. In some embodiments, a nucleotide sequence of the BFD1 gene comprises a nucleic acid sequence having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the nucleic acid sequence of SEQ ID NO: 1.
(46) In some embodiments, the mutation is a loss-of-function mutation. As used herein, a loss-of-function mutation refers to a mutation that results in the altered gene product's loss of a specific biological function in which it is involved, such as, e.g., differentiation. Loss-of-function mutations can elicit a complete loss of function of the altered gene product (a null mutation) or a partial loss of function. In certain embodiments, the loss-of-function mutation is a null mutation.
(47) In some embodiments, the mutation is a dominant negative mutation. As used herein, a dominant negative mutation results in an altered gene product that acts antagonistically to the wild-type allele.
(48) As used herein, a coding sequence of a gene consists of the nucleotide residues of the coding strand of the gene and the nucleotides of the non-coding strand of the gene which are homologous with or complementary to, respectively, the coding region of an mRNA molecule which is produced by transcription of the gene.
(49) A coding region of an mRNA molecule also consists of the nucleotide residues of the mRNA molecule which are matched with an anti-codon region of a transfer RNA molecule during translation of the mRNA molecule or which encode a stop codon. The coding region may thus include nucleotide residues corresponding to amino acid residues which are not present in the mature protein encoded by the mRNA molecule (e.g., amino acid residues in a protein export signal sequence).
(50) Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA. Unless otherwise specified, a nucleotide sequence encoding an amino acid sequence includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. Nucleotide sequences that encode proteins and RNA may include introns.
(51) In some embodiments, the apicomplexan parasite is Toxoplasma gondii.
(52) In some embodiments, the apicomplexan parasite is Neospora caninum.
(53) In some embodiments, the apicomplexan parasite is Sarcocystis neurona.
(54) In another aspect, the present invention provides compositions (e.g., vaccine compositions or pharmaceutical compositions) comprising (1) genetically altered protozoan parasites comprising a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite; and (2) a pharmaceutically-acceptable carrier.
(55) As used herein, vaccine composition refers to a composition comprising a microbial immunogen (e.g., antigen or collection of antigens) that is capable of eliciting an adaptive immune response and/or immune memory against the microbe. The vaccine composition can further comprise a pharmaceutically acceptable carrier.
(56) Pharmaceutically acceptable refers to those properties and/or substances which are acceptable to the patient from a pharmacological/toxicological point of view and to the manufacturing pharmaceutical chemist from a physical/chemical point of view regarding composition, formulation, stability, patient acceptance and bioavailability. Pharmaceutically acceptable carrier refers to a medium that does not interfere with the effectiveness of the biological activity of the active ingredient(s) and is not toxic to the host to which it is administered.
(57) As used herein, the term antigen refers to any molecule capable of generating an immune response, such as a peptide, polypeptide, protein, polysaccharide, lipid, cell, cancer cell (such as a self-antigen associated with a cancer cell), live-attenuated pathogen (e.g., microbe), or heat-killed pathogen that has the potential to stimulate an immune response. Additionally, a pathogen refers to any organism capable of eliciting an immune response from a subject upon infection of the subject with pathogen. A nonlimiting example includes the pathogen Toxoplasma gondii. A given pathogen can be comprised of multiple antigens to which the subject's immune response may respond.
(58) In some embodiments, the microbial immunogen comprises a live, genetically altered protozoan parasite that results in attenuation of the parasite. Thus, a vaccine composition refers to any composition that is administered to a subject with the goal of establishing an immune response and/or immune memory to a particular antigen or antigens. The vaccine compositions can comprise other substances designed to increase the ability of the vaccine to generate an immune response. For example, a live-attenuated vaccine can comprise the live-attenuated parasite plus an adjuvant.
(59) Adjuvants can be any substance that enhances the immune response to the antigens in the vaccine composition. Non-limiting examples of adjuvants suitable for use in the present invention include Freund's adjuvant, incomplete Freund's adjuvant, saponin, surfactants such as hexadecylamine, octadecylamine, lysolecithin, demethyldioactadecyl ammonium bromide, N,N-dioctadecyl-N-N-bis (2-hydroxyethylpropane diamine), methoxyhexa-decyl-glycerol, pluronic polyols, polyanions such as pyran, diethylaminoethyl (DEAE) dextran, dextran sulfate, polybrene, poly IC, polyacrylic acid, carbopol, ethylene maleic acid, aluminum hydroxide, and aluminum phosphate peptides, oil or hydrocarbon emulsions, and the like.
(60) It is also contemplated that the vaccine compositions disclosed herein can be therapeutic or prophylactic. Thus, for example, the vaccine compositions disclosed herein can be used to prevent or reduce the likelihood of an infection such as, but not limited to, Toxoplasma. Alternatively, the vaccine compositions disclosed herein can be used therapeutically to treat one or more symptoms of an infection in an individual with a chronic infection.
(61) The term treating as used within the context of the present invention is meant to include therapeutic treatment as well as prophylactic, or suppressive measures for the disease or disorder. Thus, for example, the term treatment includes the administration of an agent prior to or following the onset of a disease or disorder thereby preventing or removing all signs of the disease or disorder. As another example, administration of the agent after clinical manifestation of the disease to combat the symptoms of the disease comprises treatment of the disease. This includes for instance, prevention of parasite propagation to uninfected cells of an organism.
(62) Additionally, the present invention provides additional antigens in combination with the live, attenuated parasite in the vaccine compositions herein disclosed. The antigens provided in the mixture for vaccine compositions or immunization protocols can come from the same, different or unrelated targets. Thus, the antigens may be the same antigen, or the antigens may be heterologous antigens. For example, a vaccine composition can comprise a heterologous antigen, such as, e.g., a peptide of a protein of a target. In certain embodiments, the heterologous antigen is a peptide having a length of at least 5 amino acids (e.g., 5, 6, 7, 8, 9, 10, 11, 12, 15, 20, 25, 50, 75, 100 or more amino acids). The heterologous antigen can be, for example, a cancer antigen. In some embodiments, the parasite expresses the heterologous antigen.
(63) The heterologous antigen can be an antigen found in various pathogens (e.g., viral, bacterial, fungal, protozoal, helminth) that may infect the subject. For example, the heterologous antigen may be derived from a different protozoan parasite (e.g., if the parasite is T gondii, the antigen may be from a Plasmodium species). Alternatively, the heterologous antigen may be derived from a viral pathogen, such as a coronavirus (e.g., a SARS-CoV-2 virus). Examples of suitable antigens may include antigens derived from viral envelope or capsid proteins, proteins present at the cell surface (e.g., the cell surface of protozoan cells, bacterial cells, cancer cells), or secreted proteins. In some embodiments, the antigen is a coronavirus antigen, such as a spike protein or portion thereof (e.g., a SARS-CoV-2 spike protein or portion thereof, such as the S1 subunit or S2 subunit of the SARS-CoV-2 spike protein).
(64) In some embodiments, the parasite that is genetically altered to have a mutation in the BFD1 gene may be genetically altered to express the heterologous antigen. In specific embodiments, a coding sequence for the heterologous antigen can be inserted into the genome of the parasite at a location that is non-essential for parasite viability, e.g., into a non-essential gene. For example, the heterologous antigen can be inserted into a gene that is dispensable (see Example 2). In some embodiments, the coding sequence may be inserted into the BFD1 locus. The coding sequence can be operably linked to a promoter. The promoter can be, for example, the SAG1 or TUB1 promoter. In some embodiments, the heterologous antigen can be expressed as a fusion protein containing the heterologous antigen and all or a portion of an endogenous protein. In some embodiments, the endogenous protein, or portion thereof, is expressed at the cell surface (e.g., a SAG1 protein or a portion thereof), and the resulting fusion protein is expressed at the cell surface (e.g., of the parasite). In other embodiments, the endogenous protein, or portion thereof, is a secreted protein, and the resulting fusion protein is secreted (e.g., by the parasite).
(65) The antigen(s) can be coupled to a carrier protein. Non-limiting examples of suitable carrier proteins include albumin, ovalbumin, Pseudomonas exotoxin, tetanus toxin, ricin toxin, diphtheria toxin, cholera toxin, heat labile enterotoxin, keyhole lympet hemocyanin, epidermal growth factor, fibroblast growth factor, transferrin, platelet-derived growth factor, poly-L-lysine, poly-L-glutamine, mannose-6-phosphate, as well as various cell surface and membrane proteins, and the like.
(66) Vaccine compositions can be formulated in aqueous solutions (carriers) such as water or alcohol, or in physiologically compatible buffers such as Hanks' solution, Ringer's solution, or physiological saline buffer, including PBS. Vaccine compositions can also be prepared as solid form preparations which are intended to be converted, shortly before use, to liquid form preparations suitable for administration to a subject, for example, by constitution with a suitable vehicle, such as sterile water, saline solution, or alcohol, before use.
(67) The vaccine compositions can also be formulated using sustained release vehicles (carriers) or depot preparations. Such long acting formulations may be administered by implantation (for example subcutaneously or intramuscularly) or by intramuscular injection. Thus, for example, the vaccines may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt. Liposomes and emulsions can be used as delivery vehicles suitable for use with hydrophobic formulations. Sustained-release vehicles may, depending on their chemical nature, release the antigens over a range of several hours to several days to several weeks to several months.
(68) The vaccine compositions may further include one or more antioxidants. Exemplary reducing agents include mercaptopropionyl glycine, N-acetylcysteine, (3-mercaptoethylamine, glutathione, ascorbic acid and its salts, sulfite, or sodium metabisulfite, or similar species. In addition, antioxidants can also include natural antioxidants such as vitamin E, C, leutein, xanthine, beta carotene and minerals such as zinc and selenium.
(69) Vaccine compositions may further incorporate additional substances to function as stabilizing agents, preservatives, buffers, wetting agents, emulsifying agents, dispersing agents, and monosaccharides, polysaccharides, and salts for varying the osmotic balance. The vaccine compositions can further comprise immunostimulatory molecules to enhance vaccine efficacy. Such molecules can potentiate the immune response, can induce inflammation, and can be any lymphokine or cytokine. Nonlimiting examples of cytokines include interleukin (IL)-1, IL-2, IL-3, IL-4, IL-12, IL-13, granulocyte-macrophage colony stimulating factor (GMCSF), macrophage inflammatory factor, and the like. In some embodiments, the parasite may be genetically altered to express an immunostimulatory molecule such as any one or more of the aforementioned cytokines.
(70) In some embodiments, the parasite utilized in a vaccine composition can express a therapeutic agent, such as e.g., a peptide or protein. In some embodiments, expression of a therapeutic agent or heterologous antigen in a tachyzoite can be under control of a promotor. In some embodiments, the promoter can be a constitutive promoter. In some embodiments, the promoter can be a promoter of a gene that encodes a protein that is expressed during the tachyzoite stage. For example, in some embodiments, the promoter can be the SAG1 or TUB1 promoter, in the case of T gondii. Further, expression of a heterologous antigen by the parasite, e.g., a cancer antigen or antigen from a different pathogen can be under control of such promoters. A coding sequence of a heterologous polypeptide, e.g., a heterologous antigen or therapeutic agent, may be a codon optimized for expression by the parasite, e.g., T gondii.
(71) In the context of the present invention, the terms peptide, polypeptide and protein are used herein. They refer to an amino acid chain, and include any post-translational modifications thereto (for example phosphorylation or glycosylation). Typically, the term protein is utilized when referring to a full-length product of a gene; and, the use of the term peptide and/or polypeptide is utilized when describing a fragment of a protein.
(72) In some aspects, the present invention provides methods of treating cancer in a subject in need thereof, comprising administering to the subject a vaccine composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite, and wherein the parasite expresses a cancer antigen.
(73) In another aspect, the present invention provides methods of inhibiting development or progression of cancer in a subject, comprising administering to the subject a vaccine composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite, and wherein the parasite expresses a cancer antigen.
(74) In another aspect, the present invention provides recombinant nucleic acid vectors comprising a nucleotide sequence encoding a BFD1 protein. In some embodiments, the nucleotide sequence encoding the amino acid sequence of a BFD1 protein comprises SEQ ID NO:1. In some embodiments, a nucleotide sequence encoding the amino acid sequence of the BFD1 protein comprises a nucleic acid sequence having at least 70% sequence identity to the sequence of SEQ ID NO: 1. In some embodiments, a nucleotide sequence encoding the amino acid sequence of a BFD1 protein comprises a nucleic acid sequence having at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the nucleic acid sequence of SEQ ID NO: 1.
(75) In some embodiments, the amino acid sequence of a BFD1 protein comprises the sequence of SEQ ID NO:2.
(76) In some embodiments, the recombinant nucleic acid vector is an expression vector. Expression vector refers to a vector comprising expression control sequences operatively linked to a nucleotide sequence to be expressed. An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system. Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses) that incorporate the recombinant polynucleotide. The expression vectors can have cis-acting elements such as promoter sequences and non-promoter regulatory elements. As used herein, a non-promoter regulatory element refers to non-promoter sequence(s) of a nucleic acid molecule that are capable of increasing or decreasing the expression of specific genes within the recombinant vector. Such non-promoter regulatory elements include but are not limited to, e.g., enhancer elements, inducer elements, silencer elements, 5 untranslated regions (UTRs), 3UTRs, terminator elements, CAAT boxes, CCAAT boxes, Pribnow boxes, SECIS elements, polyadenylation signals, A-boxes, Z-boxes, C-boxes, E-boxes, G-boxes, and Cis-regulatory elements (CREs).
(77) In some embodiments, the vector is a viral vector. Non-limiting examples of viral vectors that can be utilized by the present invention include DNA or RNA viral vectors including but not limited to retroviral vectors, herpes virus vectors, adenovirus vectors, lentivirus vectors, rabies virus vectors, lentiviral vectors, VSV vectors, vaccinia virus vectors, reovirus vectors, semliki forest virus, and sindbis virus vectors.
(78) In some embodiments, the vector is a non-viral vector. Non-viral vectors can be plasmid DNA, liposome-DNA complexes (lipoplexes), and polymer-DNA complexes (polyplexes). Non-viral vectors can be plasmid RNA, liposome-RNA complexes (lipoplexes), and polymer-RNA complexes (polyplexes).
(79) In some embodiments, the recombinant nucleic acid vector further comprises a selectable marker element. A selectable marker element is an element that confers a trait suitable for artificial selection. Examples of selectable marker elements useful in the present invention include, but are not limited to, Chloramphenicol acetyltransferase, Hypoxanthine-guanine phosphoribosyltransferase, bleomycin binding protein, beta-lactamase, neomycin resistance genes, mutant Fabl genes conferring triclosan resistance, URA3 elements, fluorescent gene products, affinity tags such as GST, His, CBP, MBP, and epitope tags such as Myc HA, FLAG. Selectable marker elements can be negative or positive selection markers.
(80) In a further aspect, the present invention provides host cells comprising recombinant nucleic acid vectors comprising a nucleotide sequence encoding a BFD1 protein.
(81) In some embodiments, the host cell is from an apicomplexan parasite. In some embodiments, the host cell is Toxoplasma gondii.
(82) In another aspect, the present invention provides methods of inducing an immune response to an apicomplexan parasite in a subject in need thereof, comprising administering to the subject a vaccine composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite. In some embodiments, the apicomplexan parasite is Toxoplasma gondii.
(83) As used herein, the term, subject, refers to an animal. Typically, the terms subject and patient may be used interchangeably herein in reference to a subject. As such, a subject includes an animal that is being treated for a disease, being immunized, or the recipient of a mixture of components as described here, such as a vaccine composition. The term animal, includes, but is not limited to, mouse, rat, dog, guinea pig, cow, horse, sheep, chicken, cat, rabbit, pig, monkey, chimpanzee, and human. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a bird.
(84) The vaccine compositions described herein can be formulated for and administered by infusion or injection (intravenously, intraarterially, intramuscularly, intracutaneously, subcutaneously, intrathecally, intraduodenally, intraperitoneally, and the like). The vaccine compositions can also be administered intranasally, vaginally, rectally, orally, topically, buccally, transmucosally, or transdermally.
(85) An effective antigen dosage to treat against apicomplexan parasite infection can be determined empirically, by means that are well established in the art. The effective dose of the vaccine composition may depend on any number of variables, including without limitation, the size, height, weight, age, sex, overall health of the subject, the type of formulation, the mode or manner or administration, whether the parasite is active or attenuated, whether the patient is suffering from secondary infections, or other related conditions.
(86) As an example, a suitable dose of genetically altered apicomplexan parasites, such as Toxoplasma gondii, per inoculation can be between about 1,000 to about 10 million tachyzoites, or between about 1,000 and 1 million tachyzoites, or between 5,000 and 50,000 tachyzoites, or between 10,000 and 50,000 tachyzoites. In some embodiments, a dose of at least about 1,000 genetically altered tachyzoites are administered to a subject, e.g., a human subject, per inoculation. In some embodiments, a dose of at between about 1,000 and 10,000 genetically altered tachyzoites are administered to a subject, e.g., a human subject. In some embodiments of the invention, a dose of at between about 10,000 and 100,000 genetically altered tachyzoites are administered to a subject, e.g., a human subject.
(87) Vaccine regimens can also be based on the above-described factors. Vaccination can occur at any time during the lifetime of the subject, including development of the fetus through adulthood. Supplemental administrations, or boosters, may be required for full protection. To determine whether adequate immune protection has been achieved, seroconversion and antibody titers can be monitored in the patient following vaccination.
(88) As used herein, immune response, refers to an acquired and enhanced degree of protective immunity, preferably complete or sterile protection, against subsequent exposure to the parasites disclosed herein. In some embodiments, the protective immunity achieved after administration of the genetically altered protozoan parasites will not be complete but will reduce the severity of the infection symptoms after exposure to wild-type apicomplexan parasites (i.e., partial protection).
(89) It is generally contemplated that inoculating a subject according to the methods described herein with genetically altered apicomplexan parasite will induce protective immunity against challenge with wildtype apicomplexan parasites of the same species. However, it is also contemplated by the present disclosure that immunization with one apicomplexan parasite can protect against challenge with another apicomplexan parasite of a different species, and eliciting cross-species protection in this manner is also within the scope of the invention.
(90) As used herein, immunization or vaccination is intended for prophylactic or therapeutic immunization or vaccination. Therapeutic vaccination is meant for vaccination of a patient with apicomplexan parasitic infection and/or for vaccination of a subject suffering from cancer, wherein the parasite expresses a cancer antigen.
(91) Also, the disclosed methods can comprise the simultaneous or separate administration of multiple vaccine compositions. Thus, the present invention may further include the administration of a second, third, fourth, etc. antigen, wherein the second, third, fourth, etc. antigen is administered in a separate vaccine composition for administration at the same time as or 1, 2, 3, 4, 5, 6, 10, 14, 18, 21, 30, 60, 90, 120, 180, 360 days (or any number of days in between) after the first antigen.
(92) In some embodiments, the parasite can be genetically altered to encode two or more antigens. In some embodiments, two or more antigens may be encoded as part of a single polypeptide. In some embodiments, two or more antigens may be encoded as separate polypeptides. In some embodiments, at least two of the antigens are from different proteins. In some embodiments, the two or more antigens include two or more different cancer antigens.
(93) In some embodiments, the subject has an acute or chronic apicomplexan parasite infection.
(94) In another aspect, the present invention provides methods of inhibiting or preventing a chronic apicomplexan parasite infection in a subject, comprising administering to the subject a vaccine composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal.
(95) In another aspect, the present invention provides methods of treating a chronic infection by an apicomplexan parasite in a subject in need thereof, comprising administering to the subject a vaccine composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal.
(96) In another aspect, the present invention provides methods for inoculating a subject in need thereof with an apicomplexan parasite, comprising administering to the subject a vaccine composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal.
(97) In another aspect, the present invention provides methods of administering an antigen to a subject in need thereof comprising administering to the subject a composition comprising a genetically altered protozoan parasite, wherein the parasite comprises a mutation in a BFD1 gene, wherein the mutation inhibits differentiation of the parasite into a bradyzoite, and wherein the parasite comprises an antigen. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal.
(98) In some embodiments, the parasite is genetically altered to comprise additional antigen(s).
(99) In certain embodiments, the antigen is a cancer/tumor antigen. Non-limiting examples of possible cancer/tumor antigens that can be utilized in the present invention include alpha-fetoprotein (AFP), cancer antigen 125 (CA125), cancer antigen 15-3 (CA15-3), carbohydrate antigen 19-9 (CA19-9), carcinoembryonic antigen (CEA), HE4, chromogranin A (CgA), CD20, human chorionic gonadotropin (hCG or beta-hCG), lactate dehydrogenase, beta-2-microglobulin (B2M), calcitonin, neuron-specific enolase (NSE), programmed death ligand 1 (PD-L1), nuclear matrix protein 22, thyroglobulin, and prostate-specific antigen (PSA).
(100) The present invention also provides for methods of generating genetically altered protozoan parasites comprising one or more mutations in the BFD1 gene. As would be understood by those skilled in the art, routine molecular biology techniques, including but not limited to, gene knockouts, etc. can be utilized in generation of the genetically altered parasites described herein. For example, targeted mutation of a BFD1 gene can be carried out in a lab setting by routine methods, such as homologous recombination techniques. In certain embodiments, the genetically altered protozoan parasites of the present invention are lab strains. Alternatively, the genetically altered protozoan parasites can be natural isolates.
(101) In some embodiments, a targeted mutation of a BFD1 gene may be generated using CRISPR methodology.
(102) In some embodiments, the genetically altered protozoan parasite generated by the methods described herein is an apicomplexan parasite.
(103) In certain embodiments, the genetically altered protozoan parasite generated by the methods described herein is Toxoplasma gondii.
(104) In certain embodiments, the genetically altered protozoan parasite generated by the methods described herein is Neospora caninum.
(105) In certain embodiments, the genetically altered protozoan parasite generated by the methods described herein is Sarcocystis neurona.
(106) In certain embodiments, the genetically altered protozoan parasite generated by the methods described herein is Hammondia hammondi.
(107) In certain embodiments, the genetically altered protozoan parasite generated by the methods described herein is Hammondia pardalis.
(108) In a further aspect, the present invention provides for methods of identifying a candidate anti-parasitic compound comprising identifying a compound (small or large molecule compounds) that inhibits expression or activity of BFD1. The invention features methods for screening compounds that inhibit the expression or activity of the BFD1 gene. In some embodiments, the screening assays involve contacting a proliferating tachyzoite with a test compound, and determining whether the test compound inhibits the tachyzoite from differentiation into a cyst-forming bradyzoite. In some embodiments, the screening assays involve contacting a proliferating tachyzoite with a test compound, and determining whether the test compound inhibits expression of the BFD1 gene. In some embodiments, determining whether the test compound inhibits expression of the BFD1 gene comprises measuring the level of mRNA encoding BFD1 and/or measuring the level of BFD1 protein in tachyzoites contacted with the test compound and comparing the level of BFD1 mRNA or protein with a suitable control, e.g., the level of BFD1 mRNA or protein found in tachyzoites not contacted with the test compound. In some embodiments, the screening assays involve contacting a proliferating tachyzoite with a test compound, and determining whether the test compound inhibits expression of one or more bradyzoite specific genes.
(109) BFD1 may be necessary to maintain the differentiated state; therefore, interfering with its expression or activity (e.g., using compounds identified using screening methods described herein) may reactivate latent stages, which could subsequently be cleared with available anti-parasitic drugs (e.g., the subject could be treated with an anti-BRD1 compound and an anti-parasite drug).
(110) In some embodiments, reporter assays can be utilized to screen for compounds that inhibit expression of a reporter gene operably linked to a BFD1-responsive promoter or promoter of any gene that is selectively expressed in the bradyzoite stage. The reporter gene may, for example, encode a reporter protein such as a fluorescent protein or an enzyme such as luciferase or beta-galactosidase, etc.
(111) Compounds to be tested by the methods of the present invention include purified molecules, substantially purified molecules, molecules that are one or more components of a mixture of compounds, or a mixture of a compound with any other material. Test compounds can be organic or inorganic chemicals, or biomolecules, and all fragments, analogs, homologs, conjugates, and derivatives thereof. Test compounds can be of natural or synthetic origin, and can be isolated or purified from their naturally occurring sources, or can be synthesized de novo. Test compounds can be defined in terms of structure or composition, or can be undefined. The compound can be an isolated product of unknown structure, a mixture of several known products, or an undefined composition comprising one or more compounds. Examples of undefined compositions include cell and tissue extracts, growth medium in which prokaryotic, eukaryotic, and archaebacterial cells have been cultured, fermentation broths, protein expression libraries, and the like. In some embodiments of this invention, the test compound could be a small peptide. Small peptides can be from 2 to about 10 amino acids in length, from about 10 to about 20 amino acids in length, from about 20 to about 30 amino acids in length, from about 30 to about 40 amino acids in length, from about 40 to about 50 amino acids in length, from about 50 to about 60 amino acids in length, from about 60 to about 70 amino acids in length, from about 70 to about 80 amino acids in length, from about 80 to about 90 amino acids in length, or from about 90 to about 100 amino acids in length. The peptides can contain naturally occurring amino acids, chemically modified amino acids and/or synthetic derivatives of amino acids. In another embodiment, the test compound is an antibody specific for the BFD1 protein. In some embodiments, the test compound is a small molecule. As used herein, a small molecule is a low molecular weight organic compound of about 50 daltons (D) up to about 1 kD or about 2 kD. In some embodiments, the small molecule can be <900 daltons. Most drug active ingredients are small molecules.
(112) In some embodiments, the screening assays involve contacting a proliferating tachyzoite with a test compound, and determining whether the test compound inhibits the tachyzoite from differentiation into a cyst-forming bradyzoite by molecular analysis of differentiation-related proteins or RNAs. If such differentiation-related proteins/RNAs show a reduction or elimination in expression, then the test compound is a candidate anti-parasitic compound. Analyses can be performed by methods understood in the art, such as, e.g., Western blot, Northern blot, and microarray analysis.
(113) In another embodiment, candidate anti-parasitic compounds shown to affect differentiation of a tachyzoite can be further evaluated for their ability to reduce or inhibit progression of the tachyzoite into bradyzoites. In another embodiment, candidate anti-parasitic compounds shown to affect differentiation of a tachyzoite can be further evaluated for their ability to reduce or inhibit progression of acute infection to chronic infection in a subject.
(114) TABLE-US-00001 BFD1genomicsequence: SEQIDNO:1 ATGGAGGGAGCCAGTACTCAGCCAATGCCGCATTCGCAGCGGGAGCGTCA GGCTCCTGTGCACGCCATCAGTGGCACGTGGGAAAACTGCGACCAGGCGG GTGAATACAAGGGGACTGCCTGTTGCGTCGTGGAGAGGCAAGTGTATTCT ACGGAGACGCACGCAGTGGAAGGCTGCTGTTCCACGCGATGGAACGGAGT TAAGGAGGAAAAGGGCGGTGGTGAAGTGTCCTCAAGAACTGCTTTAGCAG GGGTTGTCCATCTTTATACAAATTCAGACGGAAACGCATATACGCACATT TCTGACCAAGGAATGAGACAGGATGAAGCTGTGGCGGGACAGGAGCAGCG TCACCTTAACTGTGAGGGGGAACACGAGAAGAAAGGGAACGTGGCAGCAG GAGGTGGTACCCTCATGGTGACAAAATCGGAGATTGAACCGTGCGACGAC TACTACTCCGTGCAGAGAGGACAGTCGTGCGCGGGAGAGAGAGCGCCGCG TGACGGATGCTGTAGACTCCTTGATGGCAGCCGTGTCGACCCGGCAGAAG GAGGTTCGGAGGAAGATGAAAACTGTTATACACATGTGCTTCAGAAGCAT CTGGGTCAGATGCCGACGGCACCGTACCAAGGCGACGACCGCTTACAGAC TGACTTACGACTGGGAGACTTCCAGTCCGGTCCTTCGGATGCCTTGTCCG GACACCATGTAACACGGACACCAATTCTTTCGCCTCATGGCAGGTACTCT GAATACATCAGCGAACGTCTTGCGTGGCAGTATGCTGAGAGACCGGGGCA TGGTATTGCTGCGGAGAATACCGTTGTGATGCACAGCCATACTGGTGAGG CAACCGGATCATTGCGAGCGGATGCGCCTTCGCAGTGGTCCACAGAGAGC CGCCTTCAGTTTCACGTCGGGTCTCAATTTACCACCGAGAATCCGGAACT GTTCGCTGGCATTGTGGGATTAGACACAGAGCAATTCGACGCGAGAAATG CAGAAGCGCTGCACTGGAGACAACAGGGAGAGGCTCGCTCAACGGAGACC GAATGCATCGCTGACATAACACCAGAGCGAGGCAACCGGAGTACAATACG GCAATGGAATAAACCAGAAGCGGCGCGACAGGAATATCACCGTGCGTCAG gtgagagtggggctgcagtagtttgtctaacaggatgaacactaccagca cactagtcgcctgtaagactcgtgtgttttgtccggagtgtgattccaag atacaaggcgaccaagagctattttttgccagatgtgttgtgtccaacag CCTCTGCTCGAGGGCCAGAGGAGACCAATATCATCACTCGGGGAGCACAC TCCGACGACCAAAGTATAGACGCTGCTGCTCCAGGCTGCTGGGCTGCGCG CCATCTCACGTCTCGACAGCATCCTAACCCGCGACCGAGGATGAAGGAGG AACATTGCGGTCGGGAAAGGGAAGTCTTGTCTTCGGAGCAGCCCTCAGAC TGTGGCGAAACACAGAAAACACCGgttagctgctagaactaaaaaataca tcaacatggctgatatccttcgagcgtacccacttagcctagcgtgaact gttgtgctcgcgtggtaggcgaaaattggtgctgagcactgcccggcgag ttgaaagaagtgacccgcaactcgcactcactaacactgcaccatggcgg aatccgtttaccgattgtttccgtgttccacccacagcgtgatgacttcg ctgtggagggagcctcatttcaattgctgcgtcgatgtgtgtcctggttc ctgtgcagGCGTCTCATTCACTTGTCTTGGATTCCAAGAGTCGAGCAGAC GCGAGTCAAACATCACCGTATACGCGTAACGACGAAATTCAAACGATTCG AGCATTTGAGGAACAATGTCTTGAGGTGCAACTTCCTCAATCACGCTTAA GGCGTGGCATTGACTATGAAGCTGGCATGTCACAGCTGGCTCCCACAACG CAAGAGTTGAAGGCCAAAGTGTTGACAACGGGACTGTCCCCTTCGTGTCC AAACGCAGCCGTTCTTCGAGCTAGTGTACCCTTGTCTATGGATACAACAG TTACGGTTCACCTTGCTGATGTCGAGGATCCGAGTTCGAAGCGTCACACG CCTATCGAAAACTCTATTTCCAGCGGGCATTGTGATCCTCCGTGCTCGAG CCCGGGGGGAATGATGGAGCCCCGTGTATCCGTTTCGGGTTTAGGCAGTC CTCACAACTGCGTGGAGGACAGAGAGATTGCGCGACACGGAGACGGTATT GGAAGGGACATACTGGAAAGGCGTCCGCTACCATTCTCTCCTGCTGCACT CCTGACGGGCTGCTCTAGCACGGCAGCCTCATCCGTTGTGTCTGGTGACG TGTTCACTTCGGTAGCAGCCTCTGCTCGCGCTAACGCGTGTAGATCGAGT ACTGATACCCAGGAAGAGAGTGGCTGTGGCGACGCGCCGCGGTATGTACT ACTGTTCCCTGACGAACAAGACGAGAGATTAGGACATGCGCAAACCAGCA TTGCCACGCCGTCTGGATCAGGCCAATCAAAATGCATGTTTAAGGGCGAC GGAAATGCAGAGGCCACATTCAGGGAGGAGGTAAAGAGTTCAGAACTTCG GACGCCCTCGAGGATACAAACACGGCGTTTGCTTCCCGGGGTACAGCTTC AAGGCATGGACTGTGACGGATGCGGTGCCTCCGATCCCCAGAAAGGGAGA CCTGCGCCAGAGACAGGTTTTTTGCCTGAGATTTGCCATTTCTCACCTCA GCATCCATGGCAACCGGGATCGGAAGTCAACCAGGGGTACCGGGCGGGCG CTGACTACGGGACCTCTCGGGTACAGCAGAGTCTTGAAAATTGTTCATGG GAAGAGTCAGTGGATGAGGGTGAACAACCACGCACCACATCGTCCTCCTC ATACGGACAAGACACGCAGAAACGGGATTCCTTCCTCCAGTCAATCGATA ACAGAATAGCAAGCGAACCGGTTGACCCCACAGGTACATGCGGATATAAC TCAACGCCTGAAACCTTTCGTAGTGGATGCATTATGCGTGATCAGATGCT CGGTGTCAAGCCACATCTGTCTCATGTATCTTTAACGCGCGAGGGCAAGC ATCGGGGACAGCAAACGCACCTACGGAAAACTGGAGTGCCAACATGGAGC GCTGAGGAGGATGCGAGTCTCGCAGAGTTGGTGTCTAGAAAGGGCTTCAA GTGGGCACTGATCTCTTCACAACTTACTGGCGCCTTTGGGATCCCACGGA CTGgtaagcgtggatttgagtataccaagagagggtcatctgagcaagcc aaacaccagatggcacgacggtacgagatttcccaagtgtgaaatcactg cttgtttttggtgattctcgactgtgcgtgtgttctgattgtagGTAAAC AATGTCGGGAACGATGGTTTAATCATGTGAATCCCGAGGTTAAGAAAGGC GACTGGTCAGCCGAGGAGGATGCCATGATACTGATGCTTCAGAATGAACT Ggtgagtggttgtatctcgggtggtcgatttgtttcacaatggcgttaga cctctcaaaagtcagtgattgatgttgcggtgttgtccgaaaaagaaggt tcttctctctgtgtttcgactctgcacgtgagtacccgtacaaggcaggc tcacccagtatttttcctgctccatgggctagtgcagacgagtgaatttt cgtctgtctgcattcttatggaggtcacgaagatccacactgtgcaagca cgcgacgcgtgtgagacttacgcagaaatgaggccgttgtttgccatgtt tttgttcttgatgcagGGAAATCGCTGGGCGACTATCGCAAAGAAGTTGC GGGGCCGCACAGAGAATGCCGTGAAGAACCGCTTTATTTCTCTCAGCAAT GCCCGCCTAGGTTATGGTCGTCCAAAGCGCGATGGCTCGAGCGCGGACTG CTTCAGTAACAGACGTACCGGTAGTGGGAAGTCGTCAGGCATAACAGGGA TGCCGAATCTATGTCAGTCTGTATGTTCCGCTGGCACAACGAAGAAGGAC TCGTCTGAATCGGGTAACCATTTCGTTATGTCCGTTGCCACGAAAGTTTT TGAATTTTCGGACGTGGCAGTGGATTCTGGGGTGAGCCGACCGAGACAGT GCACTGGCACGTCACCCAGTTGTGGGCATCCGTCGGCAGGTGAGGGGGAT CCATCTCATTTAAAGAACACTGACGTTGTCGGCCGGGAACAACCCATACA GCGGAACAACAACGAATCAGGCAAAGCTGCAGAGCAAACTGCGTTTTCAG GCGTGAAGACAGGGACACTATCGGTTTCACAGGATGCTGTCCCTGTCGGT CGTCTAGTCGTAGCAAGTGTAGGGCCTCAGCACATTCGTAGGAGCTTCCC GACTGACGAAACATTACCAAAATTCGCTGCTAAAGAGCATAACAACCAAC AGCTGAACGACGAGAGAGAACATCTCGAACAAAGCAACTCCACGTCAGAG GGGAGCTTTCTGGCATCAGCTCATGAACATGCAGACATCGCGCGAAGTGA TCCTGATGAGGACACGCTGGAGCCCCATCAAAAACGACGACGCAAGCGAT GTGCAATAGCATACCAGGGCGAGGAACGTGGTGACAGCAACGGTCTTGAT TCAATTGCGGATCGTGCAGAGCAAGCAGGGAACTTCCAGGCAATGAGGAA AGCTAACACGGACAACGGAAAAGTCGATTACTTGGAGCCTCATCGCTACG AAAAGTTGTCACCATGCGAGCAGGTGATCCAGCCGTCCTTGCGGCCAGCA TGTGACCATCGTGGTGCACCCCAAAACTCAGTCGAGAGTGGTGAGCAGTC TCCCGATGCACAGCGACAGTTGTGTAATCAAGGCTGTCGGACTTCCAACC GAACAGTACACAGCTCTGTTTACAGCAACGAAGTGGAGTCAAATGAGCTG CGCGGTGTGTTTCGGCTGGCGGAACAATCGCTGCCTTCCCAGAGCGGGGA TCCTGCGTGGTCGACAGCAGGATTTCAGTTGTCTATCCTGCCTCAGAAGG TGGAAGTACACTCCAGGAACAAATGCGATGGTCAAAATGTGATGTATCGG TGTTCGCCCGGTTCTTTGCCGACTACCCATCAGCAGACAGTGTTTCATTA CGATAGAGATTCAAGCAGGTTCCCTTGCGCGGCCAAGCCTGCCGCAGCAA GTGGAGCCCAGGGGACGATCGAGGAGAACGACGGATTAGTTAAAGAAGGA CCGAGCATGATTGTTACCGGGAGCAGTGTGGAAGTAGTACACTGCTGTTC AGTGTCCCTTCGCAGGCGTGACCGGTCGTTACCAAGCGCTCAGTTGTGGA CTTCACAAGAGACTGAGTCTGACACGAATCCATCACCGAACCAGCAGCAT GAGAGTTGCCACCAATACTGTAAGCGCCACGCTGCTTGGTGTGGGAAGAC GGACCAGTTTTCCAAGCTGACTTCTTCGCATCAAGAGAACAGTAGTGGTA AAGATGCATGTCTTGTGTCTGTGTCTCCAACAGTAACGCTAGATGATCTT CAGAAACAATCCCGAGGCACAGTTCTGTCAGCGAAAGAAGAAATCGGCAA GCCGGAGACGTGGTCTCACGTTGTTGACAACACTTACTCGAAGACAGACC ACCAGCGTGCGTCGCTGTGTGCAGAGAATTCGTCAGGATGCGCCGAAGGA AGCACGGAACTCGTCAGATTCTCGGGAGGCTCTGTAAAATCAGGGAGCAG TATGAGCGTCGACTGCGGAAATGGAAACCCAGATGACTGCCAGGATTGCA AAGCTGAGGAGATATGGCGAGGCGAGCAACGATATGCCGAAAGGGGCCAC TCGGTTGAATCCAGGGGTGCTGGTTCAGTAGGTAGGAGCACGGATCTAAC TATCACCGACTCTGGATCGATGCCGCTGTGTGCCAGCCCAATCGGTAGAC CTCCTGCAGACAACGACACGCTGTTTTTAAGTGATGCCAGGTGCAACGTA GTGGCACAACTTAACCATCAAGATAACAGCAGGATTTCCCGATTAGCAAG CTGTGAAGAGGAATTCTTGGCATGCGGAGGTGAGCGTCTGATTAATGCTT CCGGCGGTTTTAAGCCGGATGGTGGATGCTTGTATCGCATGCAGCAAGCT GGTGCATGCAACACAAAACTTCACCGACCAGTGCATAGTTGCTCCACGAT TGACTCGGAACAGCTTGAAGATCTTCCTTCTGTGGAGAAGGCAGTTGGCG ACCGAAGCTTCTCCAGCAAACGAAAAGGAGACATCCCACCTTTCGCTGAA TGGAAAAAAAATGACGAACTACGTGAGTTATACCGCGGCGTGTCAGAAGC AGTTTCCCACGGTCAACCTGGCGACTGGAACGGCAGCTGGCCCGGTATCT CAGGGCGCGCTCATCAAACGTCTTCGTGTTTCCCTGATAGGGTTAATGCA AGCGACCGTAGAGAGCTGAATAGTTGGCGGCTCCACGTCTCCGCCGCCGC CGAGCTAGGGTCAAGTCACATCTGGAACTCGCAATCATACGCTTCGGCCT CTGTGAGTCGGGATAAACAACGGGAGCCACCTAAAAATGGGCTCACTGGC TGTGACGTGCCAGAGTATCTGGGGACCAGTCAAAGTGCAGGACTACCTGC AGCAAACGCGCACGAACGCGGCAACTTCTATGGACATGATAGATGCCGAC CACGTGAAGGAGAGCGGGTCCGTTGGGTGGGCCTACAGCGAAATCGAAAA CCCGAGGCATCGGTATCCTCTGGAGCGAGCAACAGTGCGACAACAGCGAG ACCGAAGGACAGCACGGAACCTGACGAAGGCAACAGTGAAGGAGTGAGCA CGAGGCGAAAAGACTCTGGTTCCACTGCAGCGACTATCAGTCGGGCTGTT TCCCTGGGTATGGTGACACCGAGTGCTGCTTGTGAGAATTCTTCTTCACT AACAGATACGTCTCCTCCTCTGAGCCATCGGCCCTCCTTCAGCTTTACTC ATTGCTGCGAGGAGACTTTGAGCAGGTGTAACTCCTCTAATTATTTGTGT CCTCCAGCAACGTGTCATACGTCGGATGATGGTAGGTCTTTAGGGCCGTC GCGAGAGGCACAAGCTCTCCGGTCATTGAGCCTAGCTTCCGGCTATGGTT ACCCGGGGATACCTGCCGAGGCAACGTCCTTCTGGCAGGGCAGCTCACTG GAGCACTCAATAATGGAACCGCAGATGGTGCCATCCGATGATGAACTTCG ATTGTGGGTCCATCCTCGTGACGCAGCGAATTGGTCGCAGAGCACGTTGA AACCCGTTGCTGTCGTAAGCGGGACCGACGCTGGTGACGATCAACATAAG ACGCCAGAGAACTTGACTCCCGAAAGCGGGCAGGCCCATCGCCGGGACGG CCACGACATGCAGCGTGTGCAACGGTGCGATGACGAGGGGGAGTGCCCCC CTACAACAGTCGAACTGACTTTTCCGCATTCACACTCTAGTGATGAAATG CAGGACTTGCCGTCGAAGGTACAAGGAAATTTTCTCTTGCGAAGAGAGCT CTCGGACTCACTGCAACATGAGACTGCCGAAAGCGTTGCTGGTTACGGGT GGATGCGTATACGGAATGCTGGAGATATTCCAAACTCGAAGGTACCTTGT GCTTGGGAACAGTGCATGCCAGCATCGGAGAGAGAACGGGGAGTGAACGA CCACATGAGTAGTGAAGCCTCACGAATGTCGAAGGCAGCAAGTTCAAGCT TCGTTCCTAGCTCATGCACAGATGCGCCGGTGGTCAGAGTAGGTGAGGAC ACTACCAAGTCGGTCTGTGAGGAGCAACAGCTGTGCGAAGGAGGTAATCG TGGTTCCTTGTCCCCGGAAGCCACAGGCTTTGAGAGCTTGGGCCCACCGC TCCAGTTGTTGCTTGTTGACGGATACACTCCATTCGAGCCCGTAGTGGAA AAGGTCTCTCAAACAATGGAGCAGACTTTATTTCCTGTGCCAGGTCAGGA GACTGATACAAGAGATGAGGATGGACGATACAACTGgtaagaaaaacaat acactcaggcaaggccagggtgcgtgaaagagaagtgtatgctgtcccag tgtaggtagcagtgctatttgtaggccttcgaaagaaagaaagtggaaca gaaggctacttcgatgcggtagttccacagggtggcagggcagccccgcc ttgaggtgatctggcacgaagtcagtgttcaaatgctcaggcaccgattc aagccatatatccatatgtggccaacatagagaaaatggtgaatcaccac atttatttaagcacacataaaacagtcttcagtaactatcagtgtgcaag aggcggctataggcgtccggagccaagtgtaatggattcttgtccctctt cccacacggcagccgtgagatggtctggtgtacaatagccacggacttaa agctgtttccgggagacacagctggagactacacaacgttgtcaccgaag cctggtacgcgatgagtacacgcccgacctgtttcttgcctttctcctgt gttctcagCGAGTGCTTACAAAACCGCCAGCCACCTTTGCATTCGGGGGG CTTGATG BFD1aminoacidsequence: SEQIDNO:2 MEGASTQPMPHSQRERQAPVHAISGTWENCDQAGEYKGTACCVVERQVYS TETHAVEGCCSTRWNGVKEEKGGGEVSSRTALAGVVHLYTNSDGNAYTHI SDQGMRQDEAVAGQEQRHLNCEGEHEKKGNVAAGGGTLMVTKSEIEPCDD YYSVQRGQSCAGERAPRDGCCRLLDGSRVDPAEGGSEEDENCYTHVLQKH LGQMPTAPYQGDDRLQTDLRLGDFQSGPSDALSGHHVTRTPILSPHGRYS EYISERLAWQYAERPGHGIAAENTVVMHSHTGEATGSLRADAPSQWSTES RLQFHVGSQFTTENPELFAGIVGLDTEQFDARNAEALHWRQQGEARSTET ECIADITPERGNRSTIRQWNKPEAARQEYHRASASARGPEETNIITRGAH SDDQSIDAAAPGCWAARHLTSRQHPNPRPRMKEEHCGREREVLSSEQPSD CGETQKTPASHSLVLDSKSRADASQTSPYTRNDEIQTIRAFEEQCLEVQL PQSRLRRGIDYEAGMSQLAPTTQELKAKVLTTGLSPSCPNAAVLRASVPL SMDTTVTVHLADVEDPSSKRHTPIENSISSGHCDPPCSSPGGMMEPRVSV SGLGSPHNCVEDREIARHGDGIGRDILERRPLPFSPAALLTGCSSTAASS VVSGDVFTSVAASARANACRSSTDTQEESGCGDAPRYVLLFPDEQDERLG HAQTSIATPSGSGQSKCMFKGDGNAEATFREEVKSSELRTPSRIQTRRLL PGVQLQGMDCDGCGASDPQKGRPAPETGFLPEICHFSPQHPWQPGSEVNQ GYRAGADYGTSRVQQSLENCSWEESVDEGEQPRTTSSSSYGQDTQKRDSF LQSIDNRIASEPVDPTGTCGYNSTPETFRSGCIMRDQMLGVKPHLSHVSL TREGKHRGQQTHLRKTGVPTWSAEEDASLAELVSRKGFKWALISSQLTGA FGIPRTGKQCRERWFNHVNPEVKKGDWSAEEDAMILMLQNELGNRWATIA KKLRGRTENAVKNRFISLSNARLGYGRPKRDGSSADCFSNRRTGSGKSSG ITGMPNLCQSVCSAGTTKKDSSESGNHFVMSVATKVFEFSDVAVDSGVSR PRQCTGTSPSCGHPSAGEGDPSHLKNTDVVGREQPIQRNNNESGKAAEQT AFSGVKTGTLSVSQDAVPVGRLVVASVGPQHIRRSFPTDETLPKFAAKEH NNQQLNDEREHLEQSNSTSEGSFLASAHEHADIARSDPDEDTLEPHQKRR RKRCAIAYQGEERGDSNGLDSIADRAEQAGNFQAMRKANTDNGKVDYLEP HRYEKLSPCEQVIQPSLRPACDHRGAPQNSVESGEQSPDAQRQLCNQGCR TSNRTVHSSVYSNEVESNELRGVFRLAEQSLPSQSGDPAWSTAGFQLSIL PQKVEVHSRNKCDGQNVMYRCSPGSLPTTHQQTVFHYDRDSSRFPCAAKP AAASGAQGTIEENDGLVKEGPSMIVTGSSVEVVHCCSVSLRRRDRSLPSA QLWTSQETESDTNPSPNQQHESCHQYCKRHAAWCGKTDQFSKLTSSHQEN SSGKDACLVSVSPTVTLDDLQKQSRGTVLSAKEEIGKPETWSHVVDNTYS KTDHQRASLCAENSSGCAEGSTELVRFSGGSVKSGSSMSVDCGNGNPDDC QDCKAEEIWRGEQRYAERGHSVESRGAGSVGRSTDLTITDSGSMPLCASP IGRPPADNDTLFLSDARCNVVAQLNHQDNSRISRLASCEEEFLACGGERL INASGGFKPDGGCLYRMQQAGACNTKLHRPVHSCSTIDSEQLEDLPSVEK AVGDRSFSSKRKGDIPPFAEWKKNDELRELYRGVSEAVSHGQPGDWNGSW PGISGRAHQTSSCFPDRVNASDRRELNSWRLHVSAAAELGSSHIWNSQSY ASASVSRDKQREPPKNGLTGCDVPEYLGTSQSAGLPAANAHERGNFYGHD RCRPREGERVRWVGLQRNRKPEASVSSGASNSATTARPKDSTEPDEGNSE GVSTRRKDSGSTAATISRAVSLGMVTPSAACENSSSLTDTSPPLSHRPSF SFTHCCEETLSRCNSSNYLCPPATCHTSDDGRSLGPSREAQALRSLSLAS GYGYPGIPAEATSFWQGSSLEHSIMEPQMVPSDDELRLWVHPRDAANWSQ STLKPVAVVSGTDAGDDQHKTPENLTPESGQAHRRDGHDMQRVQRCDDEG ECPPTTVELTEPHSHSSDEMQDLPSKVQGNFLLRRELSDSLQHETAESVA GYGWMRIRNAGDIPNSKVPCAWEQCMPASERERGVNDHMSSEASRMSKAA SSSFVPSSCTDAPVVRVGEDTTKSVCEEQQLCEGGNRGSLSPEATGFESL GPPLQLLLVDGYTPFEPVVEKVSQTMEQTLFPVPGQETDTRDEDGRYNCE CLQNRQPPLHSGGLM
(115) The following examples are provided to describe the invention in more detail. They are intended to illustrate, not to limit, the invention.
Materials and Methods
(116) Strains and Cell Culture
(117) Human foreskin fibroblasts were maintained in DMEM (Gibco) supplemented with 3% inactivated fetal serum (IFS) and 10 ?g/mL gentamicin, referred to as standard media. If HFFs were to be used in bradyzoite experiments, host cells were maintained exclusively in DMEM supplemented with 10% IFS and 10 ?g/mL gentamicin prior to infection. Alkaline stress media consists of RPMI 1640 (Sigma), supplemented with 1% IFS and 10 ?g/mL gentamicin, and buffered with 50 mM HEPES adjusted to pH 8.1 with 10N NaOH.
(118) Plasmids and Primers
(119) Oligos were ordered from IDT. All cloning was performed with Q5 2? master mix (NEB) unless otherwise noted. Primers and plasmids used or generated are found in Tables 1 and 2.
(120) TABLE-US-00002 TABLE1 Plasmidsutilizedinpresentdisclosure. SEQ ID Vector Description NO Sequence pU6_Library_ genericgRNA 3 ccagatggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaactat DHFR expression+ ggatgaacgaaatagacagatcgctgagataggtgcctcactgattaagcattggtaa pyrimethamine ctgtcagaccaagtttactcatatatactttagattgatttaaaacttcatttttaatttaaaag resistance. gatctaggtgaagatcattttgataatctcatgaccaaaatcccttaacgtgagttttcgtt Library ccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctg backbone. cgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgcc ggatcaagagctaccaactttttccgaaggtaactggcttcagcagagcgcagatac caaatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcac cgcctacatacctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagt cgtgtcttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcgg gctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaa ctgagatacctacagcgtgagctatgagaaagcgccacgcttcccgaagggagaaa ggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgaggga gcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgactt gagcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagc aacgcggcctttttacggttcctggccttttgctggccttttgctcaCATGgGATG AGACAAAGTGCGCGAGTTGAAATCGTCGTGGGGAC GATTTCACCGCGGCCACATGTTGGAGACACTGAGGG CACACGGGAAACGCGAAAGATTTCAAATTAACGTAC CCAAACGCGAAAGCTTGCGCAGCATACACTCGAAGC GAACATCCCGAACCATCGAGAGGCGGAGAGCGATA AGTCTTTCACGCTGCGAAGTGTTGCGACGGCTGCGC CGCTGCACTGTGAATTGGGCGCCAATATTGCATCCT AGGCCTGACGCGCCTCCTGCAGAACGCGAGACACTG GGATATGTAGAGCCAAGGGGGAAACCTTCGAACTCT CGAATGTCTTCTCTGACAAGAATCATATTTCCATCAG TTCTGTCAGATTTTCAAATGGCGACCTGCAGAGGCC TGCTTCCTCCCTGTGCGCTCTTCGAAGGGGCTTTCTG TCGCGCAGGGTCACCTCGTCCCCGAAGGGGGTGTTT GCCTTCTGGTAAATGGGGATGTCAAGTTAGAGACCG GTCTCAGTTTaAGAGCTAtgctgGAAAcagcaTAGCAAGT TtAAATAAGGCTAGTCCGTTATCAACTTGAAAAAGTG GCACCGAGTCGGTGCTTTTTTTTTCTTTTTCtctagaggtac CATGCA pBAG1-mNG pBAG1-mNG 4 gagaaggggcgggccagagcgttcggaaaattatctgcaaagcccaggtcccgtat reporter gatattcaaaaaagatgatggtgagcaagggcgaggaggataacatggcctctctccc agcgacacatgagttacacatctttggctccatcaacggtgtggactttgacatggtgg gtcagggcaccggcaatccaaatgatggttatgaggagttaaacctgaagtccaccaa gggtgacctccagttctccccctggattctggtccctcatatcgggtatggcttccatca gtacctgccctaccctgacgggatgtcgcctttccaggccgccatggtagatggctcc ggctaccaagtccatcgcacaatgcagtttgaagatggtgcctcccttactgttaactac cgctacacctacgagggaagccacatcaaaggagaggcccaggtgaaggggactg gtttccctgctgacggtcctgtgatgaccaactcgctgaccgctgcggactggtgcag gtcgaagaagacttaccccaacgacaaaaccatcatcagtacctttaagtggagttaca ccactggaaatggcaagcgctaccggagcactgcgcggaccacctacacctttgcca agccaatggcggctaactatctgaagaaccagccgatgtacgtgttccgtaagacgga gctcaagcactccaagaccgagctcaacttcaaggagtggcaaaaggcctttaccgat gtgatgggcatggacgagctgtacaagtaagcgcgcccagcccacagaagctgccc gtctctcgttttcctctcttttcggagggatcagggagagtgcctcgggtcggagagag ctgacgagggggtgccagagacccctgtgtcctttatcgaagaaaagggatgactctt catgtggcatttcacacagtctcacctcgccttgttttctttttgtcaatcagaacgaaagc gagttgcgggtgacgcagatgtgcgtgtatccactcggaatgcgttatcgttctgtatgc cgctagagtgctggactgttgctgtctgcccacgacagcagacaactttccttctatgca cttgcaggatggtgcagcgcaaacgacggagagaaaggagcaccctctcagtttccc tacgatgtgctgtcagtttcgactcttcaccgcgaacgattggcgatacgtctctgttgac ttgttaggctccgaccacgaagctcccttaactagataagccgcgacacctaagtgtac accatttgcagatcgataatctgcgaccgctgaatccgtccagatcagtaaaaccgcac cacctaagtgtaaaccttgtttaggtcgataaaatgctaccaacccccacccacaatcg agccttgagcgtttctgcgcacgcgttggcctacgtgacttgctgatgcctgcctctggc cattcatgccagtcagtgcgcataaaaatgtggacacagtcggttgacaagtgttctgg caggctacagtgacaccgcggtggagggggatccactagttctactcgagggtcgac ggtatcgat pSAG1-mNG pSAG1-mNG 5 ctcccagcgacacatgagttacacatctttggctccatcaacggtgtggactttgacatg reporter(used gtgggtcagggcaccggcaatccaaatgatggttatgaggagttaaacctgaagtcca astemplate ccaagggtgacctccagttctccccctggattctggtccctcatatcgggtatggcttcc only) atcagtacctgccctaccctgacgggatgtcgcctttccaggccgccatggtagatgg ctccggctaccaagtccatcgcacaatgcagtttgaagatggtgcctcccttactgttaa ctaccgctacacctacgagggaagccacatcaaaggagaggcccaggtgaagggg actggtttccctgctgacggtcctgtgatgaccaactcgctgaccgctgcggactggtg caggtcgaagaagacttaccccaacgacaaaaccatcatcagtacctttaagtggagtt acaccactggaaatggcaagcgctaccggagcactgcgcggaccacctacacctttg ccaagccaatggcggctaactatctgaagaaccagccgatgtacgtgttccgtaagac ggagctcaagcactccaagaccgagctcaacttcaaggagtggcaaaaggcctttac cgatgtgatggGCATGGACGAGCTGTACAAGTAAgcgcgccca gcccacagaagctgcccgtctctcgttttcctctcttttcggagggatcagggagagtg cctcgggtcggagagagctgacgagggggtgccagagacccctgtgtcctttatcga agaaaagggatgactcttcatgtggcatttcacacagtctcacctcgccttgttttctttttg tcaatcagaacgaaagcgagttgcgggtgacgcagatgtgcgtgtatccactcggaat gcgttatcgttctgtatgccgctagagtgctggactgttgctgtctgcccacgacagcag acaactttccttctatgcacttgcaggatggtgcagcgcaaacgacggagagaaagga gcaccctctcagtttccctacgatgtgctgtcagtttcgactcttcaccgcgaacgattgg cgatacgtctctgttgacttgttaggctccgaccacgaagctcccttaactagataagcc gcgacacctaagtgtacaccatttgcagatcgataatctgcgaccgctgaatccgtcca gatcagtaaaaccgcaccacctaagtgtaaaccttgtttaggtcgataaaatgctaccaa cccccacccacaatcgagccttgagcgtttctgcgcacgcgttggcctacgtgacttgc tgatgcctgcctctggccattcatgccagtcagtgcgcataaaaatgtggacacagtcg gttgacaagtgttctggcaggctacagtgacaccgcggtggagggggatccactagtt ctactcgagggtcgacggtatcgat pTUB1- Overexpression 6 gtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggatt BFD1_wt-Ty ofBFD1 agcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacg gctacactagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaa aaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttg tttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatctttt ctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgaga ttatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaa agtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatct cagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacg atacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgc tcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcag aagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctaga gtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtgg tgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgag ttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgt cagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctctt actgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattct gagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataatac cgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaa aactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcaccca actgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggc aaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactctt cctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaa tgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccac pTUB1- Overexpression 7 gcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctaca BFD1_?DBD- ofBFD1?DBD ctagaaggacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaaga Ty gttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgca agcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacg gggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatc aaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtat atatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagc gatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatac gggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcac cggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagt ggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaa gtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtc acgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttac atgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcag aagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttact gtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgag aatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgc gccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaac tctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaact gatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaa atgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctt tttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgta tttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccac p312330-Ty EndogenousTy 8 gGCATGGACGAGCTGTACAAGTGAtcaccgttgtgctcacttctc taggingvector aaatcgacaaaggaaacacacttcgtgcagcatgtgccccattataaagaaactgagtt for312330. gttccgctgtggcttgcaggtgtcacatccacaaaaaccggccgactctaaataggagt Co-transfect gtttcgcagcaagcagcgaaagtttatgactgggtccgaatctctgaacggatgtgtgg with cggacctggctgatgttgatcgccgtcgacacacgcgccacatgggtcaatacacaa pCas9-CAT gacagctatcagttgttttagtcgaaccggttaacacaattcttgcccccccgaTGAct agaggtacCATGCATctagcatgtcattcgattttcaccccccgcgtagttcctgt gtgtcattcgttgtcgagacaactctgtcccgccccggtgctgttccatatgcgtgacttt cccgcaattttttcagactttcaggaaagacaggctccggaacgatctcgtccatgactg gtaaatccacgacaccgcaatggcccccagcacctctatctctcgtgccaggggacta acgttgtatgcgtctgcgtcttgtctttttgcattcgctttccaaaaaagagagccatccgtt cccccgcacattcaacgccgcgagtgcggtttttgtcttttttgagtggtaggacgctttt catgcgcgaactacgtggacattaagttccattctctttttcgacagcacgaaaccttgca ttcaaacccgcccgcggaagatccgatcttgctgctgttcgcagtcccagtagcgtcct gtcggccgcgccgtctctGttggtgggcagccgctacacctgttatCtgactgccgtg cgcgaaaatgacgccatttttgggaaaatcggggaacttcattctttaaaagtatgcgga ggtttcctttttcttctgttcgtttctttttctcgggtttgataaccgtgttcgatgtaagcacttt ccgtctctcctccgtgctttgttcgacatcgagaGcaggtgtgcagatccttcgcttgtc gatccggagacgcgtgtctcgtagaaccttttcattttaccacacggcagtgcggagca ctgctctgagtgcagcagggacgggtgaagtttcgctttagtagtgcgtttctgctctac ggggcgttgtcgtgtctgggaag p208740-Ty EndogenousTy 9 gagttgttccgctgtggcttgcaggtgtcacatccacaaaaaccggccgactctaaata taggingvector ggagtgtttcgcagcaagcagcgaaagtttatgactgggtccgaatctctgaacggat for208740. gtgtggcggacctggctgatgttgatcgccgtcgacacacgcgccacatgggtcaata Co-transfect cacaagacagctatcagttgttttagtcgaaccggttaacacaattcttgcccccccgaT withpCas9-CAT GActagaggtacCATGCATctagcatgtcattcgattttcaccccccgcgtagtt cctgtgtgtcattcgttgtcgagacaactctgtcccgccccggtgctgttccatatgcgtg actttcccgcaattttttcagactttcaggaaagacaggctccggaacgatctcgtccat gactggtaaatccacgacaccgcaatggcccccagcacctctatctctcgtgccaggg gactaacgttgtatgcgtctgcgtcttgtctttttgcattcgctttccaaaaaagagagcca tccgttcccccgcacattcaacgccgcgagtgcggtttttgtcttttttgagtggtaggac gcttttcatgcgcgaactacgtggacattaagttccattctctttttcgacagcacgaaac cttgcattcaaacccgcccgcggaagatccgatcttgctgctgttcgcagtcccagtag cgtcctgtcggccgcgccgtctctGttggtgggcagccgctacacctgttatCtgact gccgtgcgcgaaaatgacgccatttttgggaaaatcggggaacttcattctttaaaagta tgcggaggtttcctttttcttctgttcgtttctttttctcgggtttgataaccgtgttcgatgtaa gcactttccgtctctcctccgtgctttgttcgacatcgagaGcaggtgtgcagatccttc gcttgtcgatccggagacgcgtgtctcgtagaaccttttcattttaccacacggcagtgc ggagcactgctctgagtgcagcagggacgggtgaagtttcgctttagtagtgcgtttct gctctacggggcgttgtcgtgtctgggaag pU6-BFD1- anti-BFD1gRNA+ 10 cggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagc DHFR pyrimethamine ttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttga resistance, gcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaac usedto gcggcctttttacggttcctggccttttgctggccttttgctcaCATGgGATGAG generated ACAAAGTGCGCGAGTTGAAATCGTCGTGGGGACGAT BFD1frameshift TTCACCGCGGCCACATGTTGGAGACACTGAGGGCAC ACGGGAAACGCGAAAGATTTCAAATTAACGTACCCA AACGCGAAAGCTTGCGCAGCATACACTCGAAGCGA ACATCCCGAACCATCGAGAGGCGGAGAGCGATAAG TCTTTCACGCTGCGAAGTGTTGCGACGGCTGCGCCG CTGCACTGTGAATTGGGCGCCAATATTGCATCCTAG GCCTGACGCGCCTCCTGCAGAACGCGAGACACTGGG ATATGTAGAGCCAAGGGGGAAACCTTCGAACTCTCG AATGTCTTCTCTGACAAGAATCATATTTCCATCAGTT CTGTCAGATTTTCAAATGGCGACCTGCAGAGGCCTG CTTCCTCCCTGTGCGCTCTTCGAAGGGGCTTTCTGTC GCGCAGGGTCACCTCGTCCCCGAAGGGGGTGTTTGC CTTCTGGTAAATGGGGATGTCAAGTTGTGTCCGGAC ACCATGTAACAgttttagagctagaaatagcaagttaaaataaggctagtcc gttatcaacttgaaaaagtggcaccgagtcggtgcTTTTTTTTTCTTTTTCt
(121) TABLE-US-00003 TABLE2 Primersutilizedinpresentdisclosure. SEQ ID Oligo Sequence Description NO P1 AAGTTGACAAAATCCTCCTCCCTGGG gRNAagainstexon3of 11 HXGPRT P2 AAAACCCAGGGAGGAGGATTTTGTCA gRNAagainstexon3of 12 HXGPRT P3 AAGTTGGACATAGTGCTCGAAGAAGG gRNAagainstexon5of 13 HXGPRT P4 AAAACCTTCTTCGAGCACTATGTCCA gRNAagainstexon5of 14 HXGPRT P5 AAGTTCCACAGAACTTACTTCGGCGG gRNAagainstexon4of 15 HXGPRT P6 AAAACCGCCGAAGTAAGTTCTGTGGA gRNAagainstexon4of 16 HXGPRT P7 ATGGCGTCCAAACCCATTGA screeningforHXGPRT 17 deletions P8 TCGTTGAAGTCGTAGCAGCA screeningforHXGPRT 18 deletions P9 acttccaatccaatttaatTATCCAGTTGCCCGGCTC amplificationofpBAG1 19 P10 ctcaccatCATCTTTTTTGAATATCATACGGGACC amplificationofpBAG1 20 P11 tggggatgtcaagttGACTGTGGGTTGAGTTACAAGg firstgRNAupstreamof 21 ttttagagctagaa Ku80 P12 ttctagctctaaaacCTTGTAACTCAACCCACAGTCaa firstgRNAupstreamof 22 cttgacatcccca Ku80 P13 tggggatgtcaagttGAACAGAGACATCATAGACGTg secondgRNAupstream 23 ttttagagctagaa ofKu80 P14 ttctagctctaaaacACGTCTATGATGTCTCTGTTCaa secondgRNAupstream 24 cttgacatcccca ofKu80 P15 tggggatgtcaagttGTTTTGTCAAAGACCGCCTGAgt firstgRNAdownstream 25 tttagagctagaa ofKu80 P16 ttctagctctaaaacTCAGGCGGTCTTTGACAAAACa firstgRNAdownstream 26 acttgacatcccca ofKu80 P17 tggggatgtcaagttGGTCTTTGACAAAACGGGAGgtt secondgRNA 27 ttagagctagaa downsreamofKu80 P18 ttctagctctaaaacCTCCCGTTTTGTCAAAGACCaac secondgRNA 28 ttgacatcccca downsreamofKu80 P19 CTGCAGAACGCGAGACACTG forsequenceverification 29 ofgRNAconstructs P20 ccgacggttcgatcctgagt screeningforKu80 30 deletion P21 ggactttccgaccagccctc screeningforKu80 31 deletion P22 GTACCGACTCTTCGCAAGCG amplifiesinternalto 32 Ku80,exon3 P23 TACTATCGCGCCTCGTCACG amplifiesinternalto 33 Ku80,exon3 P24 tggggatgtcaagttGTTGAGTCCAAGCAGAGCTCgtt gRNAupstreamof 34 ttagagctagaa BFD1 P25 ttctagctctaaaacGAGCTCTGCTTGGACTCAACaac gRNAupstreamof 35 ttgacatcccca BFD1 P26 tggggatgtcaagttGTGTAGAGTCGTGGAAGGAGgtt gRNAdownstreamof 36 ttagagctagaa BFD1 P27 ttctagctctaaaacCTCCTTCCACGACTCTACACaac gRNAdownstreamof 37 ttgacatcccca BFD1 P28 cgtcacccactcacatcgtgtgagttgagtccaagcag amplificationofpSAG1- 38 agGCTTTTACATCCGTTGcctt mNGwithhomologyto BFD1 P29 tcatactgccgttgcgcgctccactttcagcaccccac amplificationofpSAG1- 39 tcTTACTTGTACAGCTCGTCCA mNGwithhomologyto BFD1 P30 acattaatgcgtgcgccgca sequencingacross 40 BFD1locus P31 tgcttcgggcaggcgactat sequencingacross 41 BFD1locus P32 atggagggagccagtactcag BFD1cDNA 42 amplification,forward P33 CAATCGAGCGGGTCCTGGTTCGTGTGGACCT BFD1cDNA 43 CcaTCAAGCCCCCCGAATGCAAAGGT amplification,reverse P34 ACCATAACCTAGGCGGGCATTTGTTGGCACTC BFD1dDBDcDNA 44 CAGTTTTCCGT amplification,reverse P35 AATGCCCGCCTAGGTTATGGT BFD1dDBDcDNA 45 amplification,forward P36 CTGAGTACTGGCTCCCTCCATTGTCGAAAAAG TUB1promoter 46 GGAATTCAAGaaaaaatgcc P37 ctcgaggtcgacggtatcgatattaattaaCCCCCCAC TUB1promoter 47 TGCAAGCCCTACATTGACAAAATCCTCCTCCCCATGCA TGTCCCGCGTTCG P38 GAGGTCCACACGAACCAGGACCCGCTCGATT BFD13UTR 48 GAtgtaacagatggaagagggt P39 aaagggaacaaaagctggagctGCGGCCGCacttacCA BFD13UTR 49 ACTTCTCAACTCTGTCCTTGACCAATCCACCAtgactc amplificationofL1from gcaagcgtagcacg P40 TTAGACGAGCAGGTTTCTTGCCTAT amplificationofL1from 50 oligonucleotidepool P41 AAGTAAGCTCGCGATGTAGACGTTT amplificationofL1from 51 oligonucleotidepool P42 GCCGATTACACCGTTAAATAACCTG amplificationofL2from 52 oligonucleotidepool P43 TGGCGTGACTATGTTCGGTTACTAC amplificationofL2from 53 oligonucleotidepool P44 TTCTGGTAAATGGGGATGTCAAGTT tomakecompatiblewith 54 Gibsonassembly P45 gctgTTTCcagcaTAGCTCTtAAAC tomakecompatiblewith 55 Gibsonassembly P46 GTAAATGGGGATGTCAAGTTGGACTTTGACAT firstgRNAagainstmNG 56 GGTGGGTCGTTTaAGAGCTAtgctgGAA P47 TTCcagcaTAGCTCTtAAACGACCCACCATGTCA firstgRNAagainstmNG 57 AAGTCCAACTTGACATCCCCATTTAC P48 GTAAATGGGGATGTCAAGTTGGCACCGGCAA secondgRNAagainst 58 TCCAAATGAGTTTaAGAGCTAtgctgGAA mNG P49 TTCcagcaTAGCTCTtAAACTCATTTGGATTGCC secondgRNAagainst 59 GGTGCCAACTTGACATCCCCATTTAC mNG P50 GTAAATGGGGATGTCAAGTTGGATTCTGGTCC thirdgRNAagainst 60 CTCATATCGTTTaAGAGCTAtgctgGAA mNG P51 TTCcagcaTAGCTCTtAAACGATATGAGGGACCA thirdgRNAagainst 61 GAATCCAACTTGACATCCCCATTTAC mNG P52 GTAAATGGGGATGTCAAGTTGGAAGCCATAC fourthgRNAagainst 62 CCGATATGAGTTTaAGAGCTAtgctgGAA mNG P53 TTCcagcaTAGCTCTtAAACTCATATCGGGTATG fourthgRNAagainst 63 GCTTCCAACTTGACATCCCCATTTAC mNG P54 GTAAATGGGGATGTCAAGTTGCGGTAGTTAAC fifthgRNAagainstmNG 64 AGTAAGGGGTTTaAGAGCTAtgctgGAA P55 TTCcagcaTAGCTCTtAAACCCCTTACTGTTAAC fifthgRNAagainstmNG 65 TACCGCAACTTGACATCCCCATTTAC P56 AATGATACGGCGACCACCGAGATCTACACgaat gRNAamplification+P5 66 gacacacaggaactacgcg adapaterforIllumina sequencing P57 CAAGCAGAAGACGGCATACGAGATTCGCCTT gRNAamplification+ TAAGGCGA 67 Agattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P58 CAAGCAGAAGACGGCATACGAGATCTAGTAC gRNAamplification+ CGTACTAG 68 Ggattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P59 CAAGCAGAAGACGGCATACGAGATTTCTGCC gRNAamplification+ AGGCAGAA 69 Tgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P60 CAAGCAGAAGACGGCATACGAGATGCTCAGG gRNAamplification+ TCCTGAGC 70 Agattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P61 CAAGCAGAAGACGGCATACGAGATAGGAGTC gRNAamplification+ GGACTCCT 71 Cgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P62 CAAGCAGAAGACGGCATACGAGATCATGCCT gRNAamplification+ TAGGCATG 72 Agattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P63 CAAGCAGAAGACGGCATACGAGATGTAGAGA gRNAamplification+ CTCTCTAC 73 Ggattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P64 CAAGCAGAAGACGGCATACGAGATCAGCCTC gRNAamplification+ CGAGGCTG 74 Ggattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P65 CAAGCAGAAGACGGCATACGAGATTGCCTCT gRNAamplification+ AAGAGGCA 75 Tgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P66 CAAGCAGAAGACGGCATACGAGATTCCTCTA gRNAamplification+ GTAGAGGA 76 Cgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P67 CAAGCAGAAGACGGCATACGAGATTCATGAG gRNAamplification+ GCTCATGA 77 Cgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P68 CAAGCAGAAGACGGCATACGAGATCCTGAGA gRNAamplification+ ATCTCAGG 78 Tgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P69 CAAGCAGAAGACGGCATACGAGATTAGCGAG gRNAamplification+ ACTCGCTA 79 Tgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P70 CAAGCAGAAGACGGCATACGAGATGTAGCTC gRNAamplification+ GGAGCTAC 80 Cgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P71 CAAGCAGAAGACGGCATACGAGATTACTACG gRNAamplification+ GCGTAGTA 81 Cgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P72 CAAGCAGAAGACGGCATACGAGATAGGCTCC gRNAamplification+ CGGAGCCT 82 Ggattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P73 CAAGCAGAAGACGGCATACGAGATGCAGCGT gRNAamplification+ TACGCTGC 83 Agattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P74 CAAGCAGAAGACGGCATACGAGATCTGCGCA gRNAamplification+ ATGCGCAG 84 Tgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P75 CAAGCAGAAGACGGCATACGAGATGAGCGCT gRNAamplification+ TAGCGCTC 85 Agattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P76 CAAGCAGAAGACGGCATACGAGATCGCTCAG gRNAamplification+ ACTGAGCG 86 Tgattttcaaatggcgacctgc barcode+P7adapter forIlluminasequencing P77 TTTTCAAGTTGATAACGGACTAGCCTTATTTAA Customsequencing 87 ACTTGCTATGCTGTTTCCAGCATAGCTCTTAA primer AC P78 GCGCGACAGAAAGCCCCTTCGAAGAGCGCAC Customindexingprimer 88 AGGGAGGAAGCAGGCCTCTGCAGGTCGCCAT TTGAAAATC P79 AGACTTCCAGTCCGGTCCTT 200385cDNAseq1 89 P80 TCCTCAATCACGCTTAAGGC 200385cDNAseq2 90 P81 GTACAGCTTCAAGGCATGGA 200385cDNAseq3 91 P82 GCGGATCGTGCAGAGCAAGC 200385cDNAseq4 92 P83 GAGGCACAGTTCTGTCAGCG 200385cDNAseq5 93 P84 ACTACGTGAGTTATACCGCG 200385cDNAseq6 94 P85 CACAAGCTCTCCGGTCATTG 200385cDNAseq7 95 P86 CATGCGTGCGTTACATTGTACCT 312330forwardprimer 96 P87 TGACGTGCATGATTTTGTTGTGTCTGT 208740forwardprimer 97 P88 gaccgtcagcagggaaacc mNeonGreenreverse 98 primer P89 aagttGTGTCCGGACACCATGTAACAg gRNAagainstexon1of 99 BFD1 P90 aaaacTGTTACATGGTGTCCGGACACa gRNAagainstexon1of 100 BFD1
(122) Strain Generation
(123) C16-B3. Starting with a robustly cyst-forming ME49 strain that constitutively expresses RFP (dsRed2.0) under control of the GRA1 promoter.sup.68, the endogenous selectable marker HXGPRT was inactivated through transfection with three gRNAs targeting the third, fourth and fifth exons. These gRNA expression vectors were assembled by annealing oligos P1/P2, P3/P4, and P5/P6, ligating into BsaI (NEB) digested pU6-Universal.sup.69, and sequence verifying with P19.sup.69. Transfected parasites were selected with 300 ?g/mL 6-thioxanthine and screened for large deletions with P7/P8.sup.70. This strain was made constitutively Cas9.sup.+by co-transfection with pCas9-CAT and pU6-Decoy as described previously.sup.71. The strain was further transfected with ScaI (NEB) linearized pBAG1-mNeonGreen containing the promoter of BAG1 (1.22 kb upstream of the coding sequence ATG), amplified with primers P9/10 driving expression of mNeonGreen and an HXGPRT resistance cassette, and selected for integration with 25 ?g/ml mycophenolic acid and 50 ?g/ml xanthine.sup.16.sup.72. Note this plasmid contains two identical DHFR 3 UTRs, and care had to be taken to avoid the loss of HXGPRT by recombination during growth in bacteria.
(124) BFD1.sup.frameshift. One gRNA was designed targeting the first exon of BFD1. Oligos P89/P90 were annealed, Gibson-assembled into pU6-Universal, and sequenced verified with P19, generating plasmid pU6-BFD1-DHFR. Bradyzoite reporter strain parasites were transfected with 50 ?g of AseI (NEB) linearized pU6-BFD1-DHFR, and selected with 3 ?M pyrimethamine in standard medium the next day. After stabilization of the population, parasites were subcloned into 96-well plates at 3 parasites per well. Clonal strains isolated from single plaques were screened and sequenced for polymorphisms at the targeted site.
(125) ME49?KU80. Two gRNAs were designed targeting regions immediately upstream or downstream of the KU80 coding sequence. Oligos P11/12, P13/14, P15/16, P17/18 were annealed, Gibson-assembled into pU6-Universal, and sequence verified with P19. An early passage ME49 strain was transfected with 25 ?g of each plasmid, and immediately subcloned into 96-well plates at 20 or 40 parasites per well to account for loss of viability during transfection. Clonal strains isolated from single plaques were screened for deletion of KU80 with P20/21, which amplifies a band of ?5.9 kb in wildtype parasites or ?500 bp if KU80 is excised. A single mixed population was identified from 225 strains tested, and further subcloned to isolate ME49?KU80. Loss of KU80 was also confirmed by complete sequencing of the locus and failure to amplify an internal fragment using P22/P23.
(126) ME49?KU80?BFD1. Two gRNAs were designed targeting regions immediately upstream or downstream of BFD1. Oligos P24/25 and P26/27 were annealed, Gibson-assembled into pU6-Universal, and sequenced verified with P19. A repair template consisting of the SAG1 promoter driving expression of mNeonGreen was amplified from pSAG1-mNeonGreen using primers P28/29 with 40 bp of homology to regions flanking the targeted sites. ME49?Ku80 was transfected with 50 ?g of each gRNA and 10 ?g of repair template. 5 days post-transfection parasites were sorted by green fluorescence and subcloned. Clonal strains isolated from single plaques were further characterized by sequencing the locus using P30/31 to confirm complete deletion of BFD1.
(127) Immunofluorescence Assays
(128) HFFs were grown on coverslips for 2-3 days before inoculation with Toxoplasma. Coverslips were fixed with 4% formaldehyde for 20 minutes, permeabilized with 1% Triton-X 100 for 8 minutes, and blocked (5% normal goat serum and 5% IFS in phosphate buffered saline (PBS)) for at least 15 minutes (
(129) Quantification of Gene Disruption
(130) Cas9-expressing C16-B3 parasites were transfected with 50 ?g of AseI (NEB) linearized pU6-SAG1-DHFR.sup.71, encoding a gRNA targeting SAG1. Selection with 3 ?M pyrimethamine in standard media was initiated the next day, and drug-resistant pools were inoculated onto coverslips two passages (five days) after transfection. Coverslips were fixed 24 h later with methanol, and stained for SAG1 to quantify KO rates, relative to an untransfected control. GAP45 was used as a counterstain. Knockout rates were quantified before each forward genetic screen to ensure Cas9 activity.
(131) Endogenous Tagging
(132) To endogenously tag TGME49_312330 and TGME49_208740, ME49?KU80 was co-transfected with 50 ?g of pCas9-CAT and 50 ?g of BsaI-linearized p312330-Ty or p208740-Ty. Selection with 3 ?M pyrimethamine in standard media was initiated the next day. Parasites were subcloned in 96 well plates, and isolated clones screened for successful integration using primers P86/88 or P87/88, respectively, and validated by Sanger sequencing.
(133) Overexpression Vectors of BFD1.sup.WT and BFD1.sup.?DBD
(134) The sequence of BFD1 was amplified from ME49 cDNA using primers P32/33. To amplify BFD1 lacking the DNA binding domain (removing amino acids 921-1019), primers P32/34 and P35/P33 were used. BFD1 fragments were Gibson assembled together with the TUB1 promoter (amplified with P36/37) and the native BFD1 3 UTR (?1.1 kb amplified with P38/39), and sequence-verified by Sanger sequencing with oligos P79-P85.
(135) Phylogenetic Analysis of BFD1
(136) Protein sequences containing SANT/Myb-like domains were obtained for representative apicomplexan genomes from EupathDB based on their annotation with SMART domain SM00717. Domains from human c-Myb and CDCl5L were used for comparison. Individual domains were extracted from each sequence and aligned using ClustalW and the phylogenetic tree was generated by neighbor-joining (
(137) Library Assembly
(138) The gRNA oligonucleotide library was synthesized by Agilent and resuspended at 1 ng/?L in water. All library amplifications were done using iProof (Bio-Rad), using 2.5 ng of the oligonucleotide pool as template per 50 ?L reaction. Sublibraries were amplified using primers P40/41 for library 1 and P42/43 for library 2, and subsequently amplified with primers P44/45 for cloning. Amplified libraries were Gibson assembled into gel-extracted (Zymo) BsaI-digested pU6_Library_DHFR, dialyzed against water, and electroporated into E. cloni (Lucigen). Coverage was assessed by dilution plating in comparison to a no-insert negative control. Libraries were maxiprepped (Zymo), and retransformed into chemically competent NEB 5-alpha (NEB) to improve yields. Both E. cloni and NEB 5-alpha libraries were sequenced to ensure diversity. Libraries were linearized with AseI, dialyzed 1 h against water, and divided into 50 ?g aliquots. Guide RNAs against mNeonGreen were assembled separately by annealing primer pairs P46/47, P48/49, P50/51, P52/53, or P54/55 and Gibson assembling into gel-extracted, BsaI-digested pU6_Library_DHFR. Constructs were verified by sequencing with P19, and spiked into library aliquots at equimolar concentrations.
(139) Forward Genetic Screening
(140) C16-B3 reporter strain parasites were grown up in ?10 15-cm dishes per screen. 10 transfections were performed for each library as described previously, with 50 ?g of library transfected into approximately 2.6?10.sup.7 parasites in 400 ?L cytomix for each reaction.sup.69. Transfections were pooled and split between four 15-cm dishes. Media was changed the next day to standard media supplemented with 3 ?M pyrimethamine and 10 ?g/mL DNaseI (Sigma-Aldrich). At each passage of the screen, plates were scraped, parasites were mechanically released with a 27-gauge needle, and passed through a 3 ?m filter. For the second passage of screen, all parasites were passed into 4 15-cm plates without counting. All subsequent passages were performed with at a multiplicity of infection (MOI) of 1 (6?10.sup.6 parasites per plate). Plates lysed every 2-3 days under unstressed growth in standard media supplemented with 3 ?M pyrimethamine. At fourth passage (14 days post-transfection), parasites were inoculated into seven 15-cm plates, and media was changed after 4 hours to standard media supplemented with 3 ?M pyrimethamine (3 plates) or alkaline stress media (4 plates). Unstressed parasites were passaged at an MOI of 1 every 2-3 days into 1-2 15-cm plates, in standard media supplemented with 3 ?M pyrimethamine. Parasites under stressed conditions did not lyse out and were not passaged for the duration of the experiment, and media was changed every 2 days to fresh alkaline stress media. At each passage of unstressed parasites, 1-4?10.sup.7 parasites were frozen down. At 10 days post media change, stressed populations were scraped, parasites were mechanically released, passed through a 3 ?m filter, and sorted based on green fluorescence. At final timepoints for stressed parasites, both bulk populations (?2?10.sup.5 parasites) and mNG.sup.+-sorted populations (?7?10.sup.5) were frozen. DNA was isolated using the Qiagen Blood and Tissue kit, following the protocol for blood cells. Integrated gRNAs were amplified and barcoded using primers P56 and P57-76 in 50 ?L reactions. Each reaction contained 200 ng or a maximum of 20 ?L of template DNA. Amplicons were gel extracted (Zymo), eluted in water, and quantified using the QuBit dsDNA HS kit (ThermoFisher). Amplicons were pooled equally at a final concentration of 8 pM each and sequenced using a MiSeq v2 kit. Reads were 40 bp single-end and an 8 bp index. Custom sequencing primer P77 and custom indexing primer P78 were used. Guides were quantified using a custom Perl script. Guides not detected were assigned a pseudocount of 90% of the lowest detected gRNA in that sample. The phenotype or differentiation score for a gene was calculated by determining the mean log.sub.e fold-change of all five gRNAs targeting that gene in the final sample compared to the input library. All analysis done in R (https://www_r-project_org/).
(141) Stage-Specific RNA-Sequencing and Analysis
(142) Parasites were allowed to invade and replicate inside host cells for 24 h in standard media, and then switched to either standard or alkaline stress media. For FACS, parasites were mechanically released from host cells using a 27- followed by a 30-gauge syringe needle, and passed through a 3 ?m filter. At 24 and 48 h post media change, ?1?10.sup.5 unstressed mNG.sup.? or stressed mNG.sup.+ parasites were sorted directly into TRIzol LS and frozen on dry ice. Sorting was done using a BD FACS Aria II, and visualization of events and gates using FCS Express 6. RNA was extracted by TRIzol-chloroform according to manufacturer's protocol, DNaseI digested, and TRIzol-chloroform extracted again. RNA quality was assessed by BioAnalyzer or Fragment analyzer. When possible, two samples were prepared per replicate and timepoint and treated as technical replicates in downstream processing. Libraries were generated using the SMARTseq low-input v4 kit, and sequenced on two lanes of a HiSeq 2000. Reads were 75 bp, paired-end. Alignment to the ToxoDB v. 36 assembly of the ME49 genome was done using STAR.sup.77. Differential expression analysis was done using the DESeq2 R package.sup.78. The cutoff for differential expression was an adjusted p value of 0.001 or lower.
(143) Single-Cell RNA-Sequencing and Analysis
(144) Seq-Well was performed as previously described, with the following amendments to the protocol.sup.79. Single cell suspensions of Toxoplasma were prepared by syringe release of parasites from host cells with a 27 followed by a 30-gauge needle, followed by filtering through a 5 ?m filter and counting on a haemocytometer. Approximately 12,000 parasites were loaded per array, with two arrays per strain and timepoint used for stressed samples, and one array per strain for unstressed. At the 48 h timepoint, one wildtype stressed and one ?BFD1 stressed array failed to seal correctly, resulting in only one array per strain and growth condition at this timepoint. Sequencing was done on two NovaSeq flowcells. Pre-processing, alignment to the ToxoDB v.41 assembly of the ME49 genome, and downstream processing done following the DropSeq Cookbook (http://mccarrolllab.org/dropseq/).sup.80. An estimate of the number of single cells was made using plotCumulativeFractionOfReads (function implemented by the package Dropbead (https://github_com/rajewsky-lab/dropbead) that estimates the number of realistic cells sequenced, based on the fraction of cumulative reads assigned to each individual cell) from Dropbead in R with a maximum of 12,000 cells.sup.81. The corresponding cells were then further parsed and analyzed using the Seurat R package.sup.82. In the analysis of all timepoints, genotypes and growth conditions, cells were required to contain a minimum of 200 and a maximum of 10,000 non-rRNA mapping UMIs and have 40% or fewer total UMIs originating from rRNA. In the analysis of the final timepoint (72 h), cells were required to contain a minimum of 500 and a maximum of 5,000 non-rRNA mapping UMIs and have 10% or fewer total UMIs originating from rRNA. Cells were log-normalized and scaled to 10,000 UMIs, regressing out the number of UMIs detected. Variable genes were identified through outlier analysis of an average expression/dispersion scatter plot. Principal component analysis was run using these variable genes. The number of principal components (PCs) chosen to use for clustering and t-SNE visualization was based on permutation analysis and visual inspection of standard deviations of PCs. Differential gene expression between clusters or groups of clusters was performed using the Wilcoxon rank sum test, with differentially expressed genes required to be expressed in at least 10 percent of cells in one of the compared groups, have a log-fold change of 0.5 or less, and an adjusted p value of 0.001 or less.
Example 1: Generation of a Differentiation Reporter Compatible with Cas9-Mediated Screens
(145) To screen for Toxoplasma mutants deficient in differentiation, a strain compatible with Cas9-mediated gene disruption and enrichment was developed for differentiated parasites.sup.69 (
(146) To characterize transcriptomic differences between tachyzoites and bradyzoites, stage-specific bulk RNA-sequencing was performed using C16-B3. Gene expression of FACS-purified tachyzoites (mNG.sup.?, 24 h unstressed growth) was compared to bradyzoites (mNG.sup.+, 48 h stressed growth), and 1311 genes identified as upregulated and 933 genes as downregulated in bradyzoites (
Example 2: Forward Genetic Screening Identifies a Putative Regulator of T gondii Differentiation
(147) Genome-wide forward screens in Toxoplasma have been performed successfully, but performing these screens in a non-lab-attenuated strain presents additional challenges. In particular, the lower viability and integration rates observed suggest the largest number of genes that can be screened to be in the low hundreds (
(148) Following transfection of the libraries, parasites were passaged in selective media for four passages before being split between unstressed or stressed conditions for 10 days, passaging unstressed parasites as necessary (
Example 3: BFD1 Contains Conserved DNA-Binding Domains and Localizes to the Nucleus
(149) The sequence of the BFD1 open reading frame was defined based on cDNA sequencing, which differed from the annotated gene model and encoded a protein of 2,415 amino acids (
Example 4: Loss of BFD1 Blocks Parasite Differentiation
(150) To provide a clean background for precise genetic manipulation, a low-passage, NHEJ-deficient ME49 strain was generated through deletion of KU80 (
Example 5: Single-cell sequencing can be used to analyze Toxoplasma Cell-cycle Progression
(151) To profile cell cycle progression and the asynchronous process of differentiation, the first single-cell RNA-sequencing of T gondii was performed using Seq-Well.sup.79. Wildtype or ?BFD1 parasites were grown under unstressed or stressed conditions for 24, 48 or 72 h. Following downstream processing and alignment, 26,560 cells passed quality control cutoffs, with an average of 1537 UMIs per cell representing an average of 685 genes per cell. (
Example 6: BFD1 is Necessary for Initiation of Differentiation
(152) Clustering cells from all timepoints, growth conditions and genotypes revealed a clear division between tachyzoite (SAG1+) and bradyzoite (BAG1+) containing clusters (
(153) To understand the nature of the clusters parasites end up in, the clustering of unstressed and stressed parasites of both genotypes from the 72 h timepoint were analyzed (
(154) Examining highly expressed, stage-specific genes identified by the bulk RNA-sequencing showed widespread defects in bradyzoite-specific gene expression by ?BFD1 parasites, including canonical markers such as LDH2 and ENO1 (
Example 7: Overexpression of BFD1 is Sufficient to Induce Differentiation in the Absence of Stress
(155) As BFD1 is necessary for differentiation to occur, it was investigated whether overexpression of BFD1 would be sufficient to induce differentiation. Two constructs expressing epitope-tagged BFD1 under the TUB1 promotereither full-length BFD1 (BFD1.sup.WT) or a mutant protein with its DNA-binding domain removed (BFD1?DBD) were generated (
Example 8: Loss of BFD1 Blocks Parasite Differentiation Regardless of Induction Method
(156) ?BFD1 parasites were complemented by introducing Ty-tagged cDNA copies of BFD1 at the endogenous locus, either full-length (?BFD1::BFD1.sup.WT-Ty) or with its Myb-like domains deleted (?BFD1::BFD1.sup.?MYB-Ty) (
(157) Complementation with the WT but not the ?MYB allele of BFD1 restored differentiation and revealed nuclear localization of the transgenes (
Example 9: ?BFD1 Parasites Fail to Form Brain Cysts in Mice
(158) To determine whether BFD1 is necessary for the formation of tissue cysts in animals, acute virulence and chronic infection of mice were assessed. CD-1 female mice were infected by intraperitoneal injection with 500 tachyzoites of WT, ?BFD1, or ?BFD1::BFD1.sup.WT parasites (
REFERENCES
(159) 1. Behnke, M. S. et al. Coordinated progression through two subtranscriptomes underlies the tachyzoite cycle of Toxoplasma gondii. PLoS One 5, e12354 (2010). 2. Baird, J. K. Resistance to Therapies for Infection by Plasmodium vivax. Clinical microbiology reviews 22, 508-534 (2009). 3. Montoya, J. G. & Liesenfeld, O. Toxoplasmosis. The Lancet 363, 1965-1976 (2004). 4. Porter, S. B. & Sande, M. A. Toxoplasmosis of the Central Nervous System in the Acquired Immunodeficiency Syndrome. New England Journal of Medicine 327, 1643-1648 (1992). 5. Tomita, T. et al. Making Home Sweet and Sturdy: Toxoplasma gondii ppGalNAc-Ts Glycosylate in Hierarchical Order and Confer Cyst Wall Rigidity. MBio 8, e02048-16 (2017). 6. Tomita, T. et al. The Toxoplasma gondii Cyst Wall Protein CST1 Is Critical for Cyst Wall Integrity and Promotes Bradyzoite Persistence. PLOS Pathog 9, e1003823 (2013). 7. Ferguson, D. J. P. Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. International journal for parasitology 34, 347-360 (2004). 8. Coppin, A. et al. Evolution of Plant-Like Crystalline Storage Polysaccharide in the Protozoan Parasite Toxoplasma gondii Argues for a Red Alga Ancestry. J Mol Evol 60, 257-267 (2005). 9. Denton, H., Roberts, C. W., Alexander, J., Thong, K.-W. & Coombs, G. H. Enzymes of energy metabolism in the bradyzoites and tachyzoites of Toxoplasma gondii. FEMS Microbiology Letters 137, 103-108 (1996). 10. Gu?rardel, Y. et al. Amylopectin biogenesis and characterization in the protozoan parasite Toxoplasma gondii, the intracellular development of which is restricted in the HepG2 cell line. Microbes and Infection 7, 41-48 (2005). 11. Sugi, T. et al. Toxoplasma gondii Requires Glycogen Phosphorylase for Balancing Amylopectin Storage and for Efficient Production of Brain Cysts. MBio 8, e01289-17 (2017). 12. Manger, I. D., Hehl, A., Parmley, S. & Sibley, L. D. Expressed sequence tag analysis of the bradyzoite stage of Toxoplasma gondii: identification of developmentally regulated genes. Infection and Immunity (1998). 13. Yahiaoui, B. et al. Isolation and characterization of a subtractive library enriched for developmentally regulated transcripts expressed during encystation of Toxoplasma gondii. Molecular and Biochemical Parasitology 99, 223-235 (1999). 14. Cleary, M. D., Singh, U., Blader, I. J. & Brewer, J. L. Toxoplasma gondii asexual development: identification of developmentally regulated genes and distinct patterns of gene expression. Eukaryotic Cell (2002). 15. Radke, J. R. et al. The transcriptome of Toxoplasma gondii. BMC Biology 2005 3:1 3, 1 (2005). 16. Behnke, M. S., Radke, J. B., Smith, A. T., Sullivan, W. J., Jr & White, M. W. The transcription of bradyzoite genes in Toxoplasma gondii is controlled by autonomous promoter elements. Molecular microbiology 68, 1502-1518 (2008). 17. Naguleswaran, A., Elias, E. V., McClintick, J., Edenberg, H. J. & Sullivan, W. J. Toxoplasma gondii lysine acetyltransferase GCN5-A functions in the cellular response to alkaline stress and expression of cyst genes. PLOS Pathog 6, e1001232 (2010). 18. Lescault, P. J., Thompson, A. B., Patil, V., Lirussi, D. & Burton, A. Genomic data reveal Toxoplasma gondii differentiation mutants are also impaired with respect to switching into a novel extracellular tachyzoite state. PLoS One (2010). 19. Buchholz, K. R. et al. Identification of tissue cyst wall components by transcriptome analysis of in vivo and in vitro Toxoplasma gondii bradyzoites. Eukaryotic cell 10, 1637-1647 (2011). 20. Pittman, K. J., Aliota, M. T. & Knoll, L. J. Dual transcriptional profiling of mice and Toxoplasma gondii during acute and chronic infection. BMC Genomics 201415:1 15, 806 (2014). 21. Ramakrishnan, C. et al. An experimental genetically attenuated live vaccine to prevent transmission of Toxoplasma gondii by cats. Sci Rep 9, 55 (2019). 22. Soete, M., Camus, D. & Dubrametz, J. F. Experimental induction of bradyzoite-specific antigen expression and cyst formation by the RH strain of Toxoplasma gondii in vitro. Experimental parasitology (1994). 23. Fox, B. A., Gigley, J. P. & Bzik, D. J. Toxoplasma gondii lacks the enzymes required for de novo arginine biosynthesis and arginine starvation triggers cyst formation. International journal for parasitology 34, 323-331 (2004). 24. Donald, R. G. K. et al. Toxoplasma gondii cyclic GMP-dependent kinase: chemotherapeutic targeting of an essential parasite protein kinase. Eukaryotic cell 1, 317-328 (2002). 25. Radke, J. R. et al. Changes in the Expression of Human Cell Division Autoantigen-1 Influence Toxoplasma gondii Growth and Development. PLOS Pathog 2, e105 (2006). 26. Singh, U., Brewer, J. L. & Boothroyd, J. C. Genetic analysis of tachyzoite to bradyzoite differentiation mutants in Toxoplasma gondii reveals a hierarchy of gene induction. Molecular microbiology (2002). 27. Matrajt, M., Donald, R. & Singh, U. Identification and characterization of differentiation mutants in the protozoan parasite Toxoplasma gondii. Molecular Microbiology (2002). 28. Saksouk, N. et al. Histone-modifying complexes regulate gene expression pertinent to the differentiation of the protozoan parasite Toxoplasma gondii. Molecular and cellular biology 25, 10301-10314 (2005). 29. Narasimhan, J. et al. Translation regulation by eukaryotic initiation factor-2 kinases in the development of latent cysts in Toxoplasma gondii. J. Biol. Chem. 283, 16591-16601 (2008). 30. Bougdour, A., Maubon, D., Baldacci, P. & Ortet, P. Drug inhibition of HDAC3 and epigenetic control of differentiation in Apicomplexa parasites. The Journal of Experimental Medicine (2009). 31. Maubon, D. et al. Activity of the histone deacetylase inhibitor FR235222 on Toxoplasma gondii: inhibition of stage conversion of the parasite cyst form and study of new derivative compounds. Antimicrob. Agents Chemother. 54, 4843-4850 (2010). 32. Gissot, M. et al. Toxoplasma gondii Alba Proteins Are Involved in Translational Control of Gene Expression. Journal of Molecular Biology 425, 1287-1301 (2013). 33. Sullivan, W. J., Narasimhan, J., Bhatti, M. M. & Wek, R. C. Parasite-specific eIF2 (eukaryotic initiation factor-2) kinase required for stress-induced translation control. Biochemical Journal 380, 523-531 (2004). 34. Konrad, C., Queener, S. F., Wek, R. C. & Sullivan, W. J. Inhibitors of eIF2? dephosphorylation slow replication and stabilize latency in Toxoplasma gondii. Antimicrob. Agents Chemother. 57, 1815-1822 (2013). 35. Holmes, M. J., Augusto, L. D. S., Zhang, M., WEK, R. C. & Sullivan, W. J., Jr. Translational Control in the Latency of Apicomplexan Parasites. Trends in Parasitology 33, 947-960 (2017). 36. Jeffers, V., Tampaki, Z., Kim, K. & Sullivan, W. J. A latent ability to persist: differentiation in Toxoplasma gondii. Cell. Mol. Life Sci. 75, 2355-2373 (2018). 37. Radke, J. B. et al. Transcriptional repression by ApiAP2 factors is central to chronic toxoplasmosis. PLOS Pathog 14, e1007035 (2018). 38. Radke, J. B. et al. ApiAP2 transcription factor restricts development of the Toxoplasma tissue cyst. Proc. Natl. Acad. Sci. U.S.A. 110, 6871-6876 (2013). 39. Walker, R. et al. The Toxoplasma nuclear factor TgAP2XI-4 controls bradyzoite gene expression and cyst formation. Molecular microbiology 87, 641-655 (2013). 40. Huang, S. et al. Toxoplasma gondii AP2IX-4 Regulates Gene Expression during Bradyzoite Development. mSphere 2, e00054-17 (2017). 41. Hong, D.-P., Radke, J. B. & White, M. W. Opposing Transcriptional Mechanisms Regulate Toxoplasma Development. mSphere 2, e00347-16 (2017). 42. Buchholz, K. R., Bowyer, P. W. & Boothroyd, J. C. Bradyzoite pseudokinase 1 is crucial for efficient oral infectivity of the Toxoplasma gondii tissue cyst. Eukaryotic cell 12, 399-410 (2013). 43. Ehrenkaufer, G. M., Hackney, J. A. & Singh, U. A developmentally regulated Myb domain protein regulates expression of a subset of stage-specific genes in Entamoeba histolytica. Cellular Microbiology 11, 898-910 (2009). 44. Sun, C.-H., Palm, D., McArthur, A. G., Sv?rd, S. G. & Gillin, F. D. A novel Myb-related protein involved in transcriptional activation of encystation genes in Giardia lamblia. Molecular microbiology 46, 971-984 (2002). 45. Huang, Y.-C. et al. Regulation of cyst wall protein promoters by Myb2 in Giardia lamblia. J. Biol. Chem. 283, 31021-31029 (2008). 46. Dubos, C. et al. MYB transcription factors in Arabidopsis. Trends in Plant Science 15, 573-581 (2010). 47. Ambawat, S., Sharma, P., Yadav, N. R. & Yadav, R. C. MYB transcription factor genes as regulators for plant responses: an overview. Physiol Mol Biol Plants 19, 307-321 (2013). 48. Sandberg, M. L. et al. c-Myb and p300 regulate hematopoietic stem cell proliferation and differentiation. Dev. Cell 8, 153-166 (2005). 49. Fuglerud, B. M., Ledsaak, M., Rogne, M., Eskeland, R. & Gabrielsen, 0. S. The pioneer factor activity of c-Myb involves recruitment of p300 and induction of histone acetylation followed by acetylation-induced chromatin dissociation. Epigenetics Chromatin 11, 35 (2018). 50. Boschet, C. et al. Characterization of PfMyb 1 transcription factor during erythrocytic development of 3D7 and F12 Plasmodium falciparum clones. Molecular and Biochemical Parasitology 138, 159-163 (2004). 51. Gissot, M., Briquet, S., Refour, P., Boschet, C. & Vaquero, C. PfMybl, a Plasmodium falciparum Transcription Factor, is Required for Intra-erythrocytic Growth and Controls Key Genes for Cell Cycle Regulation. Journal of Molecular Biology 346, 29-42 (2005). 52. Poran, A. et al. Single-cell RNA sequencing reveals a signature of sexual commitment in malaria parasites. Nature 551, 95-99 (2017). 53. Bancells, C. et al. Revisiting the initial steps of sexual development in the malaria parasite Plasmodium falciparum. Nature Microbiology 2018 4:1 4, 144-154 (2019). 54. Eksi, S. et al. Plasmodium falciparum Gametocyte Development 1 (Pfgdv1) and Gametocytogenesis Early Gene Identification and Commitment to Sexual Development. PLOS Pathog 8, e1002964 (2012). 55. Ikadai, H. et al. Transposon mutagenesis identifies genes essential for Plasmodium falciparum gametocytogenesis. Proc. Natl. Acad. Sci. U.S.A. 110, E1676-84 (2013). 56. Sinha, A. et al. A cascade of DNA-binding proteins for sexual commitment and development in Plasmodium. Nature 507, 253 (2014). 57. Kafsack, B. F. C. et al. A transcriptional switch underlies commitment to sexual development in malaria parasites. Nature 507, 248 (2014). 58. Brancucci, N. M. B. et al. Heterochromatin protein 1 secures survival and transmission of malaria parasites. Cell Host & Microbe 16, 165-176 (2014). 59. Coleman, B. I. et al. A Plasmodium falciparum histone deacetylase regulates antigenic variation and gametocyte conversion. Cell Host & Microbe 16, 177-186 (2014). 60. Filarsky, M. et al. GDV1 induces sexual commitment of malaria parasites by antagonizing HP1-dependent gene silencing. Science . . . 359, 1259-1263 (2018). 61. Kent, R. S. et al. Inducible developmental reprogramming redefines commitment to sexual development in the malaria parasite Plasmodium berghei. Nature Microbiology 2018 4:1 3, 1206-1213 (2018). 62. Hassan, M. A., Vasquez, J. J., Guo-Liang, C., Meissner, M. & Nicolai Siegel, T. Comparative ribosome profiling uncovers a dominant role for translational control in Toxoplasma gondii. BMC Genomics 2014 15: 1 18, 961 (2017). 63. Melo, M. B. et al. Transcriptional Analysis of Murine Macrophages Infected with Different Toxoplasma Strains Identifies Novel Regulation of Host Signaling Pathways. PLOS Pathog 9, e1003779 (2013). 64. Reid, A. J. et al. Comparative genomics of the apicomplexan parasites Toxoplasma gondii and Neospora caninum: Coccidia differing in host range and transmission strategy. PLOS Pathog 8, e1002567 (2012). 65. Swierzy, I. J. et al. Divergent co-transcriptomes of different host cells infected with Toxoplasma gondii reveal cell type-specific host-parasite interactions. Sci Rep 7, 7229 (2017). 66. Al-Anouti, F., Tomavo, S., Parmley, S. & Ananvoranich, S. The expression of lactate dehydrogenase is important for the cell cycle of Toxoplasma gondii. J. Biol. Chem. 279, 52300-52311 (2004). 67. Saeij, J., Arrizabalaga, G. & Boothroyd, J. C. A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. Infection and immunity (2008). 68. Oldenhove, G., Bouladoux, N., Wohlfert, E. A. & Hall, J. A. Decrease of Foxp3+ Treg cell number and acquisition of effector cell phenotype during lethal infection. Immunity (2009). 69. Sidik, S. M., Hackett, C. G., Tran, F., Westwood, N. J. & Lourido, S. Efficient genome engineering of Toxoplasma gondii using CRISPR/Cas9. PLoS One (2014). 70. Donald, R. G. K., Carter, D., Ullman, B. & Roos, D. S. Insertional tagging, cloning, and expression of the Toxoplasma gondii hypoxanthine-xanthine-guanine phosphoribosyltransferase gene. Use as a selectable marker for stable transformation. J. Biol. Chem. 271, 14010-14019 (1996). 71. Sidik, S. M. et al. A Genome-wide CRISPR Screen in Toxoplasma Identifies Essential Apicomplexan Genes. Cell 166, 1423-1435.e12 (2016). 72. Bohne, W., Wirsing, A. & Gross, U. Bradyzoite-specific gene expression in Toxoplasma gondii requires minimal genomic elements. Molecular and Biochemical Parasitology March; 85(1):89-98. (1997). 73. Bastin, P., Bagherzadeh, Z., Matthews, K. R. & Gull, K. A novel epitope tag system to study protein targeting and organelle biogenesis in Trypanosoma brucei. Molecular and Biochemical Parasitology 77, 235-239 (1996). 74. Plattner, F. et al. Toxoplasma profilin is essential for host cell invasion and TLR11-dependent induction of an interleukin-12 response. Cell Host & Microbe 3, 77-87 (2008). 75. Burg, J. L., Perelman, D., Kasper, L. H., Ware, P. L. & Boothroyd, J. C. Molecular analysis of the gene encoding the major surface antigen of Toxoplasma gondii. The Journal of Immunology 141, 3584-3591 (1988). 76. Larkin, M. A. et al. Clustal W and Clustal X version 2.0. Bioinformatics 23, 2947-2948 (2007). 77. Dobin, A. et al. STAR: ultrafast universal RNA-seq aligner. Bioinformatics 29, 15-21 (2013). 78. Love, M., Anders, S. & Huber, W. Differential analysis of RNA-Seq data at the gene level using the DESeq2 package. (2013). 79. Gierahn, T. M. et al. Seq-Well: portable, low-cost RNA sequencing of single cells at high throughput. Nature . . . 14, 395-398 (2017). 80. Macosko, E. Z. et al. Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets. Cell 161, 1202-1214 (2015). 81. Alles, J. et al. Cell fixation and preservation for droplet-based single-cell transcriptomics. BMC Biology 2005 3:1 15, 44 (2017). 82. Butler, A., Hoffman, P., Smibert, P., Papalexi, E. & Satija, R. Integrating single-cell transcriptomic data across different conditions, technologies, and species. Nat. Biotechnol. 36, 411-420 (2018). 83. Painter, H. J., Campbell, T. L. & Llinas, M. The Apicomplexan AP2 family: integral factors regulating Plasmodium development. Molecular and Biochemical Parasitology 176, 1-7 (2011). 84. Balaji, S., Babu, M. M., Iyer, L. M. & Aravind, L. Discovery of the principal specific transcription factors of Apicomplexa and their implication for the evolution of the AP2-integrase DNA binding domains. Nucleic acids research (2005). 85. Radke, J. R. et al. Defining the cell cycle for the tachyzoite stage of Toxoplasma gondii. Molecular and Biochemical Parasitology 115, 165-175 (2001). 86. Schwarz, J. A., Fouts, A. E., Cummings, C. A., Ferguson, D. J. P. & Boothroyd, J. C. A novel rhoptry protein in Toxoplasma gondii bradyzoites and merozoites. Molecular and Biochemical Parasitology 144, 159-166 (2005). 87. Dzierszinski, F., Nishi, M., Ouko, L. & Roos, D. S. Dynamics of Toxoplasma gondii differentiation. Eukaryotic cell (2004).