Treatment of abnormal bone conditions in acid sphingomyelinase deficiency patients

11898175 ยท 2024-02-13

Assignee

Inventors

Cpc classification

International classification

Abstract

The invention provides methods of using a human acid sphingomyelinase (e.g., olipudase alfa) in treating an abnormal bone condition in acid sphingomyelinase deficiency patients such as low bone density, high bone marrow burden, and other skeletal abnormalities presented in acid sphingomyelinase deficiency patients.

Claims

1. A method of treating an abnormal bone condition in a patient with acid sphingomyelinase deficiency (ASMD), comprising: selecting a patient with ASMD for treatment of an abnormal bone condition, administering to the patient a plurality of doses of recombinant human acid sphingomyelinase (rhASM) over a period of six to thirty months, measuring a bone indicator of the patient, and comparing the bone indicator of the patient to the baseline bone indicator of the patient before the administering step, wherein the patient's bone indicator improves after the plurality of doses of rhASM.

2. The method of claim 1, wherein the bone indicator is (i) bone mineral density (BMD), wherein the BMD improves after the plurality of doses of rhASM, (ii) bone marrow burden (BMB), wherein the BMB decreases after the plurality of doses of rhASM, (iii) bone maturation, wherein the bone maturation improves after the plurality of doses of rhASM, or (iv) linear growth, wherein the linear growth improves after the plurality of doses of rhASM.

3. The method of claim 1, wherein the abnormal bone condition is osteopenia or osteoporosis.

4. The method of claim 1, wherein the patient has Niemann-Pick disease type B.

5. The method of claim 1, wherein the patient has Niemann-Pick disease type A/B.

6. The method of claim 1, wherein the patient is an adult patient.

7. The method of claim 1, wherein the patient is a pediatric patient.

8. The method of claim 1, wherein (i) the first two or more doses are escalating doses and are administered at a successively increasing amount, (ii) the doses after the escalating doses are maintenance doses and are administered in the same amount as or less than the last escalating dose, (iii) the first dose is in the amount of 0.1 mg/kg and the patient is a pediatric patient, (iv) the first dose is in the amount of 0.1 mg/kg and the patient is an adult patient, (v) the highest maintenance dose is in the amount of 0.3 mg/kg to 3 mg/kg, (vi) the highest maintenance dose is in the amount of 1 mg/kg, (vii) the highest maintenance dose is in the amount of 2 mg/kg, (viii) the highest maintenance dose is in the amount of 3 mg/kg, (ix) the highest maintenance dose is the highest dose tolerated by the patient, and/or (x) the escalating doses are administered in the order of 0.1 mg/kg, 0.3 mg/kg, 0.3 mg/kg, 0.6 mg/kg, 0.6 mg/kg, 1.0 mg/kg, 2.0 mg/kg, and 3.0 mg/kg.

9. The method of claim 1, wherein the plurality of doses are administered at an interval of every 2 weeks.

10. The method of claim 1, wherein the plurality of doses are administered through intravenous injection.

11. The method of claim 1, wherein the rhASM is olipudase alfa.

Description

BRIEF DESCRIPTION OF THE FIGURES

(1) FIGS. 1A-C are graphs summarizing the changes in ceramide (A), lyso-sphingomyelin (B) and chitotriosidase (C) activity during 30 months of treatment with olipudase alfa. Normal range for plasma ceramide was 1.8-6.5 mg/L. The upper limit of normal for lyso-sphingomyelin in dried blood spots was <69 g/L, and normal chitotriosidase serum levels were 181 nmol/hr/mL (note: activity was not corrected for two patients heterozygous for a chitotriosidase null mutation).

(2) FIGS. 2A and 2B are graphs summarizing the effect of olipudase alfa on liver and spleen volume (A) and lung disease (B). FIG. 2A: Liver and spleen volumes were calculated by integrating cross-sectional magnetic resonance images and expressed as multiples of normal (MN) where normal spleen volume (L) was assumed to be 0.2% of body weight, and normal liver volume (L) to be 2.5% of body weight. FIG. 2B: Lung Disease. By-patient percent predicted DLco, adjusted for hemoglobin (Hb), at baseline and during treatment, were calculated using observed values for male and female patients (Crapo et al., Am. Rev. Respir. Dis. 123(2):185-189 (1981); Macintyre et al., Eur. Respir. J. 26(4):720-735 (2005)). Degree of severity: 80%=lower limit of normal; >60%-79%=mild decrease; 40%-60%=moderate decrease; <40%=severe decrease. HRCT assessment of infiltrative lung disease at baseline and during treatment with olipudase alfa included ground glass appearance (GGA), interstitial lung disease (ILD), and reticulo-nodular density (RD) scored on a 4 point system where 0=No interstitial lung disease; 1=Mild (affecting 1-25% of the lung volume); 2=Moderate (affecting 26-50% of the lung volume); 3=Severe (affecting 51-100% of the lung volume).

(3) FIGS. 3A and 3B are photographs depicting the effect of olipudase alfa on bone marrow burden. FIG. 3A (femur): Bone marrow burden changes in the coronal femur of Patient 2, (female, 32 years old at baseline). Proximal epiphysis bone marrow hypointensity at screening in the T1-weighted (A) and T2-weighted (B) images is compared with the reduced amount and slightly hypointense diaphyseal bone marrow following 30 months of treatment (T1-weighted, C and T2-weighted, D). Full vertical scale bar, 20 cm. FIG. 3B (spine): Bone marrow burden in the sagittal lumbar spine of Patient 2. At screening, diffuse infiltration of the bone marrow is observed with T1-weighted isointensity of the non-diseased intervertebral discs (A) and T2-weighted hyperintense signal intensity of presacral fat (B). After 30 months of treatment, the infiltration of the bone marrow remains unchanged (T1-weighted, C) while the presacral fat is improved to slightly hyperintense (T2-weighted, D). Full vertical scale bar, 20 cm.

(4) FIGS. 4A-D are graphs depicting fasting lipid parameters at baseline and during treatment (30 months) with olipudase alfa. Mean (SD) pre-infusion fasting levels of total cholesterol (A), triglycerides (B), HDL cholesterol (C), and LDL cholesterol (D) are shown. Total cholesterol normal range: US<5.18 mmol/L; UK 0-3.9 mmol/L. HDL-C normal range: US male >0.777; US female >0.9065 mmol/L; UK >1.2 mmol/L. LDL-C normal range: US<3.3411 mmol/L; UK 0-2 mmol/L. Triglycerides normal range: <1.7 mmol/L.

DETAILED DESCRIPTION OF THE INVENTION

(5) The present invention is based on the discovery that ASM enzyme replacement therapy (ERT) alleviates abnormal bone conditions in ASMD patients, including increasing their bone density and decreasing their bone marrow burden. This improvement may be seen within as few as 6-30 months of therapy. This discovery was unexpected because it was not clear whether an ASM ERT would reverse all symptoms of ASMD, including low bone density, and if so, how long it would take for the therapy to achieve the reversal of the symptoms. In other lipid storage disorders, ERT alone is very slow in improving bone mineral density. For example, in Gaucher Disease, another genetic lipid storage disorder, patients' response to treatment with ERT is slower for bone mineral density (BMD) than for hematologic and visceral aspects of GD. Studies have shown that eight years of ERT (imiglucerase) was required to restore patients' BMD to normal levels (Wenstrup et al., J Bone Miner Res. 22(1):119-26 (2007)). The present discovery also is significant because ASMD patients cannot take bisphosphonates, the standard-of-care medications for low BMD, while on ASM ERT, because bisphosphonates interfere with ASM activity.

(6) Accordingly, the present invention provides methods of treating an abnormal bone condition in an ASMD patient by using ASM ERT. ASMD causes accumulation of sphingomyelin in bone marrow cells, especially precursor cells of the mononuclear-macrophage lineage. These cells become engorged and trapped in the bone marrow, causing bone marrow infiltration and a high bone marrow burden (BMB). ASMD patients often have chronic inflammation as well, including in the bones. Bone disease in ASMD adversely impacts bone metabolism and structure. Patients suffer from a number of symptoms, including growth delays, growth retardation, maturation delays, bone pain, and fractures. Indeed, ASMD has been shown to be inversely correlated with lumbar spine bone mineral density (BMD) Z-score (Wasserstein et al. J. Inherit. Metab. Dis. 36(1):123-7 (2013)) and to impact the skeletal system. As used herein, an abnormal bone condition or a bone disease refers to any bone issue associated with ASMD and the resulting manifestations such as high bone marrow burden, low bone mineral density, osteopenia, osteoporosis, delayed skeletal development (e.g., delayed bone age (maturation) and delayed linear growth), increased disability, bone pain, decreased mobility, osteonecrosis, and increased risk of fractures.

(7) In some embodiments, the abnormal bone condition treated in the ASMD patient by the methods of the invention is osteopenia or osteoporosis. In some embodiments, the patients are adults (e.g., patients 18 years or older, including geriatric patients who are 65 years or older). In other embodiments, the patients are pediatric patients (patients who are younger than 18 years old, e.g., patients who are newborn to 6 years old, who are 6 to 12 years old, or who are 12 to 18 years old). In some embodiments, the patient may have Niemann-Pick Disease type A, Niemann-Pick Disease type B, or Niemann-Pick Disease type A/B. In particular embodiments, the methods described herein are used to treat adult patients with chronic visceral ASMD (NPD B). In some embodiments, the methods described herein are used to treat pediatric patients with chronic visceral ASMD (NPD B). In other embodiments, the methods described herein are used to treat adult and pediatric patients with non-neurological manifestations of ASMD.

(8) Assessment of Bone Conditions

(9) Bone conditions in a subject can be assessed by analyzing bone parameters, collectively referred herein as bone indicators, using various methods. Bone indicators may comprise, e.g., bone mineral density (BMD), bone marrow burden (BMB), bone age, linear growth, and the status of certain bone biomarkers. In certain embodiments, abnormal bone conditions may be assessed by bone imaging such as X-ray imaging and magnetic resonance imaging (MRI). Bone scan images may be obtained from, for example, femur and lumbar spine at various time points to evaluate bone mineral density (BMD) and bone marrow burden (BMB) as indicators of bone condition in patients before, during, and after treatment with a composition of the present invention. In certain embodiments, the images are obtained using DXA (dual-energy X-ray absorptiometry) or MRI. In some embodiments, bone scan images may be obtained approximately every week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, six weeks, month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, year, 2 years, 3 years, 4 years, or 5 years, and compared to baseline images obtained before treatment of the present invention. In certain embodiments, the bone scan images may be obtained approximately every 6 months or every year.

(10) BMD may be calculated for each patient using T- and Z-scores. The T-score ranks a patient's bone density compared to that of a healthy person of the same gender. The Z-score rank a patient's bone density compared to that of a healthy person of the same age, gender, weight, and ethnicity.

(11) From serial MRI scans, BMB may be evaluated using the BMB scoring system, which relies on a bone marrow signal intensity scoring system giving a categorical score out of a possible eight points each for the lumbar spine and femurfemur scores averaged from the left and right femurfor a total score of 16 points. The bone marrow signal intensity scoring system is described in, for example, Hangartner et al., Skeletal Radiol. 37(3): 185-188 (2008); Robertson et al., AJM Am J Roentgenol. 188(6): 1521-1528 (2007); and Maas et al., Radiology 229(2): 554-561 (2003), all of which are incorporated herein by reference in their entirety.

(12) In other embodiments, bone biomarkers will be analyzed to assess bone conditions of a subject. Bone biomarkers, as used herein, refer to biomarkers associated with bone formation and resorption. For example, bone biomarkers such as serum bone-specific alkaline phosphatase (ALP) and C-telopeptide may be analyzed in samples collected from a patient. Bone-specific ALP, a marker for active bone formation, and C-telopeptide, an indicator of bone resorption, may be used as indicators of bone condition. For example, in Gaucher Disease, another lipid storage disorder, the C-telopeptide serum concentration is decreased. In some embodiments, bone biomarkers may be analyzed approximately every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 months, or every 1, 2, 3, 4, or 5 years, and compared to baseline levels obtained before treatment of the present invention. In certain embodiments, the bone biomarkers may be analyzed every 3 or 6 months.

(13) Most children with ASMD have delayed growth. The Z scores for height and weight in ASMD pediatric patients are often lower than in children unaffected by ASMD. In ASMD pediatric patients, additional bone indicators such as bone age (e.g., as determined by hand X-ray) and linear growth may be analyzed to assess bone growth or skeletal development. In an exemplary embodiment, hand X-ray may be performed to collect images of the patients' hands, fingers and wrists. Bone age (maturation) may be calculated from the X-ray using the Greulich & Pyle Atlas (1959). Linear growth, as measured by height Z-score, is another bone indicator to assess growth in pediatric patients.

(14) Treatment of Abnormal Bone Conditions with ASM

(15) Patients with abnormal bone conditions, such as ASMD patients, can be treated with ASM ERT. As used herein, treat, treating and treatment refer to a method of alleviating, abrogating, or preventing or delaying the onset or worsening (i.e., progression) of a biological disorder or condition and/or at least one of its attendant symptoms. As used herein, to alleviate a disease, disorder or condition means reducing the severity and/or occurrence frequency of the symptoms of the disease, disorder, or condition.

(16) In some embodiments, the ASM used in the ASM ERT may be human ASM, e.g., a recombinant human ASM (rhASM). The recombinant ASM may be produced using recombinant technology in prokaryotic or eukaryotic host cells such as mammalian host cells (e.g., Chinese hamster ovary (CHO) cells). In certain embodiments, the rhASM is olipudase alfa, the glycoform alpha of a human ASM (EC-3.1.4.12) produced in CHO cells. Mature olipudase alfa is a 570 amino acid polypeptide that retains the enzymatic and lysosomal targeting activity of the native human protein. The amino acid sequence of olipudase alfa, including its leader sequence (residues 1-57), is shown below, where the leader sequence is italicized and in boldface. The mature olipudase alfa sequence (SEQ ID NO:2, which spans residues 58-627 of the following sequence) does not have the leader sequence.

(17) TABLE-US-00001 (SEQIDNO:1) custom character custom character custom character custom character custom character custom character HPLSPQGHPARLHRIVPRLRDVF GWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNL LKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLG STCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRIL FLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAG YWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAH DVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHEST PVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLR IGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQ LQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRI VARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLA PSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLT QANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRG DMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSARAD SPALCRHLMPDGSLPEAQSLWPRPLFC

(18) In some embodiments, the ASM is 99%, 98%, 97%, 96%, or 95% identical in amino acid sequence to olipudase alfa. For example, an ASM useful in the present invention has the ASM sequence shown in U.S. Pat. No. 6,541,218, the disclosure of which is incorporated herein in its entirety. That sequence is shown below, with the leader sequence italicized and boldfaced, where the mature protein does not have the leader sequence:

(19) TABLE-US-00002 (SEQIDNO:3) custom character custom character custom character custom character custom character custom character HPLSPQGHPARLHRIVPRLRD VFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLC NLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLL LGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSR ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPG AGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIP AHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHE SIPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRT LRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPA GQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYY RIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAF LAPSATTYIGLNPGYRVYQIDGNYSRSSHVVLDHETYILN LTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRM RGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSAR ADSPALCRHLMPDGSLPEAQSLWPRPLFC

(20) An ASM useful in the present invention may also be identical in amino acid sequence to the human ASM disclosed in the UNIPROT database as sequence P17405-1, or polymorphic variants thereof. The P17405-1 sequence is shown below, with the leader sequence italicized and boldfaced, where the mature protein does not have the leader sequence:

(21) TABLE-US-00003 (SEQIDNO:4) custom character custom character custom character custom character custom character custom character HPLSPQGHPARLHRIVPRLRD VFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLC NLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLL LGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSR ILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPG AGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIP AHDVWHQTRQDQLRALTTVTALVRKFLGPVPVYPAVGNHE STPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRT LRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPA GQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYY RIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAVAF LAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILN LTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRM RGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLSAR ADSPALCRHLMPDGSLPEAQSLWPRPLFC

(22) Proof of concept for olipudase alfa therapy was demonstrated in an ASM knock-out (ASMKO) mouse model (See, e.g., Miranda et al., FASEB 14 (13):1988-95 (2000); Dhami et al., Lab. Inves. 81(7): 987-99 (2001)). Those studies showed that repeated intravenous administration of olipudase to ASMKO mice led to dose-dependent reduction of sphingomyelin in visceral organs. Sphingomyelin reduction was also observed in the lungs. The ASMKO studies also showed that olipudase alfa may cause toxicity when given in high doses. However, when the ASMKO mice were given multiple low doses followed by a high dose, olipudase alfa did not cause the toxicity observed with a single high dose.

(23) Olipudase alfa has been used in clinical studies for the treatment of non-neurologic ASMD manifestations. The observations in mice led to the development of a Phase 1 study to evaluate the safety and pharmacokinetics of olipudase alfa treatment, in which single, ascending doses of olipudase alfa (0.03, 0.1, 0.3, 0.6 and 1.0 mg/kg) were evaluated in 11 patients (McGovern et al., Genet. Med. 15(8):618-623 (2013) and WO 2011/025996; the disclosures of which are incorporated herein by reference in their entirety). The patients in that study showed dose-related increases in acute phase reactants including ceramide, bilirubin, and high sensitivity C-reactive protein (hsCRP). Dose-related adverse events involving constitutional symptoms (pain, fever, nausea, and vomiting) consistent with first-dose toxicity were also reported.

(24) A Phase 1b study to evaluate the safety and tolerability of olipudase alfa during a 26-week treatment period was conducted with 5 adult patients (Wasserstein et al., Mol. Genet. Metab. 116(1-2):88-97 (2015), incorporated herein by reference in its entirety). The patients in this study were given olipudase alfa in a dose-escalated manner with an initial dose of 0.1 mg/kg followed by stepwise biweekly increases to reach the target dose of 3.0 mg/kg. The study showed that the dose escalation regimen was well tolerated with no serious or severe adverse events, and resulted in gradual debulking of sphingomyelin and its catabolites. Debulking refers to the removal of sphingomyelin that has been accumulated in a patient's visceral organs due to ASMD. Improvements observed in the patients included decreased spleen and liver volumes, decreased interstitial lung disease scores, increased lung function, and reduction in serum chitotriosidase, CCL18, ACE, and other disease biomarkers. The inventors have now found that when these patients continued to be treated and monitored for 30 months in a long-term safety and efficacy assessment, they showed sustained safety profile and continued improvement in clinically relevant parameters, including spleen and liver volumes, lung disease score, lipid profiles, and ASM biomarkers. The inventors have also unexpectedly found that the patients displayed marked improvement in bone mineral density (BMD) and bone marrow burden (BMB). These data demonstrate that ASM ERT can alleviate or prevent the worsening of a patient's abnormal bone condition such as osteopenia and osteoporosis.

(25) Dosage and Route of ASM Administration

(26) Pharmaceutical compositions comprising an ASM as described herein will be administered in a therapeutically effective amount for treatment of the condition in question (e.g., an ASMD-associated abnormal bone condition), i.e., at dosages and for periods of time necessary to achieve a desired result. A therapeutically effective amount may vary according to factors such as the particular condition being treated, the age, sex, and weight of the patient, and whether the enzyme replacement therapy is being administered as a stand-alone treatment or in combination with one or more additional treatments. Therapeutically effective amount refers to the amount of the therapeutic agent being administered that will relieve to some extent or prevent the worsening of one or more of the symptoms of the disorder or condition being treated. The ASM compositions may be administered through intravenous injection.

(27) In some embodiments, efficacy may be indicated as improvement in bone mineral density T-scores (e.g., spinal and/or femur T-scores). In certain embodiments, the T-score is improved by at least 0.5 points. In some embodiments, efficacy may be indicated as improvement in bone mineral density Z-scores (e.g., spinal and/or femur Z-scores). In certain embodiments, the Z-score is improved by at least 0.1 points. In some embodiments, efficacy may be indicated as improvement, non-worsening, or a delay in progression of bone diseases such as osteopenia or osteoporosis. In some embodiments, efficacy may be indicated by improvements in skeletal development such as linear growth or bone age (maturation). In certain embodiments, the improvement in skeletal development may be measured against data collected from study of pediatric patients (Wasserstein et al., J Pediatr 142(4):424-428 (2003)). In other embodiments, improvement in skeletal development may be measured against each patient's growth chart before ASM therapy.

(28) In some embodiments, the methods of the invention involve a dose escalation protocol in which increasing doses of ASM (e.g., an rhASM such as olipudase alfa) are administered over an appropriate period to gradually debulk previously accumulated sphingomyelin and to minimize toxic side effects caused by sphingomyelin catabolites. For example, treatment may involve the administration of one or more initial, low, non-toxic doses of ASM to a patient to reduce the amount of sphingomyelin that has accumulated in the patient. Each escalating dose may be separated from the previous dose by one week, two weeks, or three weeks. In particular embodiments, the escalating doses are given two weeks apart. As used herein, the term non-toxic dose(s) and the like refers to a dosage of an ASM administered to ASMD patients without resulting in one, two, three or all of the following: (i) a moderate or severe related adverse event as defined by a clinical symptom that interferes with normal daily functioning and requires additional monitoring, intervention, or treatment, or, an abnormal laboratory value or procedural result of clinical concern that requires further monitoring, treatment, or investigation. See, e.g., the Clinical Data Interchange Standards Consortium Study Data Tabulation Model standard terminology v. 3.1.1; (ii) a total bilirubin value of greater than 1.5 mg/dL, 2 mg/dL, 3 mg/dL, or 4 mg/dL, that lasts for greater than one week, two weeks or three weeks after administration of a dose of rhASM; (iii) a plasma ceramide concentration of greater than 8.2 g/dL, 9 g/dL, 10 g/dL, 15 g/dL, 20 g/dL, 30 g/dL, 40 g/dL, 50 g/dL, 60 g/dL, 70 g/dL, or 80 g/dL, 24 hours, 36 hours, 48 hours or 72 hours after administration of the dose of ASM; or (iv) an acute phase response/reaction. The non-toxic dose of ASM may vary depending upon, e.g., the stability of the enzyme used, the activity of the enzyme used, and/or the route of administration of the enzyme. For example, the dosage of a modified ASM enzyme with increased activity may be lower than the dosage of an unmodified ASM. One skilled in the art would be able to adjust the dose of enzyme administered based on the stability of the enzyme, the activity of the enzyme, and/or the route of administration of the enzyme.

(29) After a certain period of time, the dose of ASM can be escalated until the highest therapeutically effective dosage tolerated by the patient is achieved. Once this dosage is identified, it can be used as a maintenance dose to treat the patient. Alternatively, the maintenance dose may be reduced from the highest escalating dose once the patient's ASMD condition has stabilized after the dose escalation regimen. Maintenance doses can be administered every 1, 2, 3, or 4 weeks to the patient. In certain embodiments, the maintenance dose is administered biweekly.

(30) As used herein, the term maintenance dose refers to a dosage of an ASM described herein administered to ASMD patients to maintain the desired therapeutic effect, e.g., an improvement or non-worsening in one or more abnormal bone conditions such as those described herein. In specific embodiments, the maintenance dose(s) maintains one, two, three, four or more of the following desired therapeutic effects: (i) a reduction in spleen volume as assessed by techniques known in the art, e.g., MRI; (ii) a reduction in liver sphingomyelin levels as assessed by techniques known in the art, e.g., biochemical analysis and/or histomorphometric analysis of liver samples; (iii) an increase in exercise capacity as assessed by techniques known in the art, e.g., maximum workload by cycle ergometry, including percent predicted maximum workload, peak oxygen consumption and carbon dioxide production; (iv) an increase in pulmonary function as assessed by techniques known in the art, e.g., techniques described in American Thoracic Society, Am. Rev. Respir. Dis. 144: 1202-1218 (1991), such as diffusing capacity (DLco), percent predicted forced vital capacity (FVC) as measured by, e.g., spirometric techniques, forced expiratory volume within 1 second (FEV1) as measured by, e.g., spirometric techniques, and total lung capacity; (v) a decrease in bronchial alveolar lavage (BAL) sphingomyelin; (vi) a decrease in liver volume as assessed by techniques known in the art, e.g., MRI: (vii) an improvement in lung appearance as assessed by techniques known in the art, e.g., high resolution computed tomography (CT) scan or chest X-ray; (viii) a decrease in sphingomyelin or lyso-sphingomyelin concentration in the liver, skin, plasma and dried blood spot (DBS) as measured by, e.g., tandem mass spectrometry; (ix) a reduction or the amelioration of the severity of ASMD and/or a symptom associated therewith; (x) a reduction in the duration of a symptom associated with ASMD; (xi) the prevention in the recurrence of a symptom associated with ASMD; (xii) a reduction in hospitalization of a subject; (vi) a reduction in hospitalization length; (xiii) an increase in the survival of a subject; (xiv) a reduction in mortality; (xv) a decrease in hospitalization rate; (xvi) a reduction in the number of symptoms associated with ASMD; (xvii) an increase in symptom-free survival of ASMD patients; (xviii) an improvement in neurological function (e.g., psychomotor function, social responsiveness, etc.); (xix) an improvement in lung clearance as measured by, e.g., BAL cell count and profile; (xx) a decrease in serum levels of chitotriosidase; (xxi) a decrease in serum levels of chemokine (c-c) motif ligand 18 (CCL18); (xxii) an improvement in lipid profile (e.g., HDL, LDL, cholesterol, triglycerides, and total cholesterol:HDL ratio); (xxiii) an improvement in abnormal bone conditions; and (xxiv) improved quality of life (QOL) as assessed by, e.g., a questionnaire such as the Brief Fatigue Inventory (BFI) (Mendoza et al., Cancer 85(5):1186-1196 (1999)), Brief Pain Inventory-Short Form (BPI-SF) (Cleeland C., Acta Paediatr. Suppl. 91(439):43-47 (2002)), or Pediatric Quality of Life (PedsQL) questionnaire (Varmi et al., Medical Care 39(8):800-812 (2001)), or PedsQL Multidimensional fatigue scale (Varmi et al., J Rheumatol 31(12):2494-2500 (2004)). In certain embodiments, the highest maintenance dose is the highest or maximum dose tolerated by a patient.

(31) In some embodiments, a patient receiving a maintenance dose is monitored every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 months, or every year or every two years for one or more of the following: (i) related adverse events; (ii) total/direct/indirect bilirubin concentrations; (iii) plasma ceramide concentration; or (iv) an acute phase response. In some embodiments, the patient is monitored every 3 months, every 6 months, or yearly. If the patient experiences a related adverse event of moderate intensity, a total bilirubin concentration greater than the total bilirubin value for a human without ASMD (e.g., a healthy human), a plasma ceramide concentration greater than the plasma ceramide concentration of a human without ASMD (e.g., a healthy human), or an acute phase response, then the dose administered to the patient can be evaluated by a physician or other medical professional to determine whether the dose should be adjusted.

(32) In certain embodiments, a method for treating a human patient having ASMD comprises: (a) a dose-escalation regimen (e.g., for debulking accumulated sphingomyelin substrate in the human patient) comprising: (i) administering an initial dose (e.g., a low non-toxic dose such as 0.1 mg/kg) of an ASM (e.g., olipudase alfa) as described herein to the human patient; (ii) administering successively higher doses of the ASM to the human patient, and (iii) monitoring the patient for one or more adverse side effects after each successive dose as indicated by, e.g., elevated total bilirubin concentration, elevated plasma ceramide concentration, lyso-sphingomyelin, chitotriosidase, the production of acute phase reactants, the production of inflammatory mediators, or an adverse event (e.g., as defined by the Clinical Data Interchange Standards Consortium Study Data Tabulation Model standard terminology v. 3.1.1); and (b) a maintenance regimen comprising administering a dose equal to or less than the highest dose tolerated by the patient (e.g., equal or less than 3 mg/kg) as the maintenance dose for the patient.

(33) In certain embodiments, a method for treating a human patient having ASMD, comprises: (a) a dose-escalation regimen (e.g., for debulking accumulated sphingomyelin substrate in the human patient) comprising: (i) administering an initial dose (e.g., a low non-toxic dose such as 0.1 mg/kg) of an ASM (e.g., olipudase alfa) as described herein to the human patient; (ii) administering successively higher doses of the ASM to the human patient if the patient does not manifest one or more adverse side effects as indicated by, e.g., elevated total bilirubin concentration, elevated plasma ceramide concentration, the production of acute phase reactants, lyso-sphingomyelin, chitotriosidase, the production of inflammatory mediators, or an adverse event (e.g., as defined by the Clinical Data Interchange Standards Consortium Study Data Tabulation Model standard terminology v. 3.1.1); and (b) a maintenance regimen comprising repeated administration of a maintenance dose that is equal to or less than the highest dose tolerated by the patient (e.g., equal or less than 3 mg/kg). In some embodiments, the patient is monitored for a period of time after administration of a dose of ASM (e.g., 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, weekly, or up until the next dose) for one or more adverse side effects. In certain embodiments, the maintenance dose that is administered may be adjusted during the course of treatment of the patient. In some embodiments, the highest maintenance dose administered to the patient is the highest dose tolerated by the patient.

(34) In certain embodiments, the initial dose ranges from 0.025 to 0.275 mg/kg, e.g., 0.03 mg/kg to 0.5 mg/kg, 0.01 to 0.5 mg/kg, or 0.1 mg/kg to 1 mg/kg, of ASM (e.g., olipudase alfa). In particular embodiments, the initial dose is 0.03 mg/kg or 0.1 mg/kg. For example, the initial dose for a pediatric patient may be 0.03 mg/kg; and the initial dose for an adult patient may be 0.1 mg/kg. In some embodiments, the initial dose for a pediatric or adult patient may be 0.1 mg/kg.

(35) In certain embodiments, the patients will be given the same dose of olipudase alfa at least twice before escalation to a next higher dose. In some embodiments, the successively higher doses are administered one, two, three or four weeks after the previous dose. In some specific embodiments, the successively higher doses are each administered two weeks after the previous dose. In particular embodiments, the successively higher dose is 0.05-1.0 mg/kg, 0.1-3.0 mg/kg, or 0.5-2.0 mg/kg higher than the previous dose, e.g., approximately 0.07 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, or 1 mg/kg higher than the previous dose.

(36) In some embodiments, the highest therapeutically effective dose tolerated by a patient is 1 mg/kg to 2.5 mg/kg, 2 mg/kg to 3 mg/kg, 3 mg/kg to 5 mg/kg. In some embodiments, the highest therapeutically effective dose tolerated by a patient is 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, or 5 mg/kg. In certain embodiments, the highest dose tolerated by the patient is 1 mg/kg to 3 mg/kg, e.g., 1 mg/kg to 2.5 mg/kg. In some embodiments, the highest dose is administered to the human patient as the highest maintenance dose. In certain embodiments, the highest maintenance dose is in the amount of, e.g., 0.3 mg/kg, 0.6 mg/kg, 1 mg/kg, 2 mg/kg or 3 mg/kg. In particular embodiments, the highest maintenance dose is 3 mg/kg. Subsequent maintenance doses may be administered in the same amount or less than the highest maintenance dose. In some embodiments, the maintenance doses are 0.3-3 mg/kg.

(37) In some embodiments, the dose escalation regimen may entail administering the ASM in a plurality of doses in the order of, for example, 0.1 mg/kg, 0.3 mg/kg, 0.3 mg/kg, 0.6 mg/kg, 0.6 mg/kg, 1.0 mg/kg, 2.0 mg/kg, and 3.0 mg/kg (highest maintenance dose), where the successive doses are each administered two weeks after the previous dose. In other embodiments, the dose escalation regimen may entail administering the ASM in a plurality of doses in the order of, for example, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 0.3 mg/kg, 0.6 mg/kg, 0.6 mg/kg, 1.0 mg/kg, 2.0 mg/kg, and 3.0 mg/kg (highest maintenance dose), where the successive doses are each administered two weeks after the previous dose.

(38) In certain embodiments, a dose of an ASM as described herein is administered every week, every 2 weeks, every 3 weeks, or every 4 weeks to a patient. In particular embodiments, the doses are administered at an interval of every two weeks, through, e.g., intravenous injection.

(39) In some embodiments, the methods of the invention involve administration of the ASM doses over a period of 6 to 30 months, e.g., over a period of no more than 6 months, 7 months, 8 months, 9 months, 10 months, 11 months, 12 months, 13 months, 14 months, 15 months, 16 months, 17 months, 18 months, 19 months, 20 months, 21 months, 22 months, 23 months, 24 months, 25 months, 26 months, 27 months, 28 months, 29 months, or 30 months, for the targeted bone condition(s) to improve. In certain embodiments, the ASM doses are administered over a period of no more than 30 months.

(40) In additional embodiments, the methods of the invention involve dosing protocols and/or routes of administration as described in, e.g., WO 2011/025996, the disclosure of which is herein incorporated by reference in its entirety.

(41) In particular embodiments, the dose escalation regimen used to treat adult or pediatric ASMD patients may be, e.g., as shown in the table below:

(42) TABLE-US-00004 TABLE 1 Dose Escalation Schedule Treatment Dose of olipudase week alfa (mg/kg) 0 0.1 2 0.3 4 0.3 6 0.6 8 0.6 10 1.0 12 2.0 14 3.0 16 3.0

(43) In further particular embodiments, the dose escalation regimen used to treat pediatric ASMD patients may be, e.g., as shown in the table below:

(44) TABLE-US-00005 TABLE 2 Dose Escalation Schedule for Pediatric Patients Treatment Dose of olipudase week alfa (mg/kg) 0 0.03 2 0.1 4 0.3 6 0.3 8 0.6 10 0.6 12 1.0 14 2.0 16 3.0

(45) In some embodiments, the pediatric patient populations include ASMD adolescent cohort (ages 12 to <18 years), ASMD child cohort (ages 6 to <12 years) and infant/early child cohort (birth to <6 years).

(46) Articles of Manufacture and Kits

(47) The present invention also provides articles of manufacture and kits comprising an ASM as described herein. In some embodiments, the articles and kits are suitable for treating a patient as described herein, e.g., a patient with ASMD. For example, the articles and kits may be suitable for treating an abnormal bone condition described herein in a patient with ASMD. In some embodiments, the pharmaceutically active ingredients in the articles and kits are prepared for administration at doses described herein, and are formulated for administration by methods described herein.

(48) Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Exemplary methods and materials are described herein, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention. In case of conflict, the present specification, including definitions, will control. Generally, nomenclature used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics, analytical chemistry, synthetic organic chemistry, medicinal and pharmaceutical chemistry, and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. Enzymatic reactions and purification techniques are performed according to manufacturer's specifications, as commonly accomplished in the art or as described herein. All publications and other references mentioned herein are incorporated by reference in their entirety. Although a number of documents are cited herein, this citation does not constitute an admission that any of these documents forms part of the common general knowledge in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Throughout this specification and embodiments, the words have and comprise, or variations such as has, having, comprises, or comprising, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers.

(49) In order that this invention may be better understood, the following examples are set forth. These examples are for purposes of illustration only and are not to be construed as limiting the scope of the invention in any manner.

EXAMPLE

Example 1: Long-Term Study to Assess the Safety and Efficacy of Olipudase Alfa in Patients with ASMD

(50) Patients and Study Design

(51) The objective of the study is to obtain information on the safety and efficacy of olipudase alfa in patients with ASMD following long-term administration. This ongoing, open-label, long-term study (LTS) (NCT02004704; EudraCT Number: 2013-000051-40) follows 5 adult patients with chronic ASMD who previously participated in the Phase 1b study (Wasserstein et al. Mol Genet Metab 116(1-2):88-97 (2015)). Data were analyzed for all patients after 30 months of treatment. The Institutional Review Board or Ethics Committee at each site approved the protocol and all patients provided written informed consent. The study was conducted according to Good Clinical Practice and in accordance with the principles of the Declaration of Helsinki.

(52) Eligibility criteria for the Phase 1b study were previously described. Id. Patients completing the Phase 1b study with an acceptable safety profile were eligible to continue in the LTS and continued at the same olipudase alfa dose they were receiving at the end of the Phase 1b study.

(53) Outcome Measures and Analyses

(54) Safety assessments included standard hematologic and chemistry panels and continuous AE monitoring, including infusion associated reactions (IARs) as previously described in McGovern et al. Genet Med 18(1):34-40 (2015) and Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015). Sphingomyelin and catabolite plasma ceramide were assessed by liquid chromatography-tandem mass spectrometry (LC/MS/MS). Bone condition biomarkers also included chitotriosidase (serum) and lyso-sphingomyelin [dried blood spot (DBS)] determined by LC/MS/MS. Development of anti-drug antibodies was assessed as previously described in McGovern et al., 2015, supra, and Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015).

(55) Quantitative measurements of spleen and liver volumes were determined from abdominal MRI and organ volumes were expressed as multiples of normal (MN). Percent predicted, hemoglobin-adjusted, diffusing capacity of the lung for carbon monoxide (DLco) was calculated using standardized formulas (Crapo and Morris Am Rev Respir Dis 123(2):185-189 (1981), Macintyre et al. Eur Respir J 26(4):720-735 (2005)). High-resolution computed tomography (HRCT) assessed infiltrative lung disease. Lung field HRCT images were scored subjectively for ground glass appearance (GG), interstitial lung disease (ILD), and reticulonodular density (RND) from 0 (no disease) to 3 (severe disease) as previously described in McGovern et al., 2015, supra, and Wasserstein et al., 2015, supra.

(56) Fasting plasma lipid profiles, including measurement of total cholesterol (TC), low density lipoprotein (LDL-C), high density lipoprotein (HDL-C), and triglycerides, were measured throughout the study. Non-HDL levels were calculated post-hoc as the difference between total cholesterol and HDL-cholesterol levels (Jacobson et al., J Clin. Lipidol. 9(2):129-169 (2015)).

(57) Bone marrow burden (BMB) was determined from MRIs of lumbar spine and both femurs, where image quantification indicated the degree of bone marrow infiltration by lipid-loaded cells (Robertson et al, AIR. Am. J. Roentgenol. 188(6):1521-1528 (2007)). Bone mineral density (BMD) was determined from dual-energy X-ray absorptiometry (DXA) bone scan images of lumbar spine and both femurs and determination of T- and Z-scores (WHO JAMA 285(6):785-795 (2001)). BMD was assessed using the guidance provided by the International Society for Clinical Densitometry (ISCD 2015).

(58) Patient reported outcomes using 11 point scales from 0 (absence) to 10 (worst) included the validated Brief Fatigue Inventory (BFI) (Mendoza et al., Cancer 85(5):1186-1196 (1999)); and Brief Pain Inventory-Short Form (BPI-SF) questionnaires to assess interference with daily activities at baseline and periodically throughout treatment (Cleeland C., Acta Paediatr. Suppl. 91(439):43-47 (2002)).

(59) Statistical Methods

(60) Descriptive statistics were provided for categorical and continuous variables, change from baseline and percent change from baseline were calculated for organ volumes and DLco, and differences determined by paired t-test and the Wilcoxon-Mann-Whitney test.

(61) Patients and Exposure

(62) All five adult patients (3 male and 2 female Caucasian patients) who completed the Phase 1b study continued treatment in the LTS. At baseline, all patients had splenomegaly (range 7.4 to 16.1 MN), hepatomegaly (range 1.2 to 2.2 MN), impaired gas exchange (range 43 to 80% of predicted DLco), and a pro-atherogenic lipid profile. Patient characteristics have been previously published (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015)) and are summarized in Table 3. The majority of patients (4/5) remained at the 3 mg/kg olipudase alfa target dose through 30 months of treatment. For Patient 2, dose was reduced to 2 mg/kg for 6 months (months 12-18) and then to 1 mg/kg (months 18-current) due to AEs which are described below.

(63) TABLE-US-00006 TABLE 3 Patient Demographics and Baseline Characteristics (Wasserstein et al., 2015) Patient ID 1 2. 1 4 5 Male Female Female Male Male Mean (SD) ASMD Symptom onset age 2 1 6 0 12 4.2 (4.9) (yeam) ASMD Diagnosis age (years) 2 2 12 8 12 7.2 (5.0) Age at first olipadase alfa 31 32 47 28 22 32.6 (9.4) infusion (years) Spleen Volume (MN).sup.a 14.49 17.92 7.41 16.07 7.96 12.77 (4.81) Liver Volume (MN).sup.a 2.23 2.20 1.21 1.76 1.29 1.74 (0.48) DL.sub.co (% predicted).sup.b 43.7 48.0 77.0 43.0 80.0 58.3 (18.5) TC (mmol/L).sup.c 4.70 3.83 5.26 4.66 3.63 4.42 (0.67) HDL-C(mmol/L).sup.d 0.32 0.36 0.96 0.31 0.57 0.50 (0.28) Non-HDL (mmol/L).sup.d 4.38 3.47 4.30 4.35 3.06 3.91 (0.61) LDL-C (mmol/L).sup.f 3.36 2.59 3.32 2.69 2.25 2.85 (0.49) VLDL-C (mmol/L).sup.g 0.88 0.88 0.98 1.66 0.80 1.04 (0.35) Triglycerides (mmol/L).sup.h 2.20 1.55 1.14 4.35 1.38 2.12 (1.31) ASM = acid sphingomyelinase; ASMD = acid sphingomyelinase deficiency; C = cholesterol; DL.sub.co = lung diffusion of carbon monoxide; HDL = high-density lipoprotein; LDL = low-density lipoprotein; MN = mulitples of normal; SD = standard deviation; TC = total cholesterol; VLDL = very low-density lipoprotein. .sup.aMN, multiples of normal calculated assuming normal spleen volume (L) is 0.2% body weight (kg), and normal liver volume (L) is 2.5% body weight (kg) .sup.bNormal DL.sub.co > 80%; Mildly reduced > 60% to 80%; Moderately reduced 40-60%; Severely reduced < 40% .sup.cTotal cholesterol normal range; US < 5.18 mmol/L; UK 0-3.9 mmol/L .sup.dHDL normal range; US male > 0.777; US female > 0.9065 mmol/L; UK > 1.2 mmol/L .sup.ecalculated as the difference between TC and HDL-C (Jacobsen et al. 2015) .sup.fLDL normal range: US < 3.3411 mmol/L; UK 0-2 mmol/L .sup.gVLDL normal range: US < 0.518 mmol/L; UK 0.09-0.71 mmol/L .sup.hTriglycerides normal range: <1.7 mmol/L
Safety

(64) There were no deaths, serious or severe events, or discontinuations during 30 months of treatment. All patients had at least 1 AE, and almost all (826/838, 98.5%) were mild in intensity. Among 443 AEs considered related to treatment, 96 (21.7%) were considered IARs (including headache, nausea, abdominal pain, arthralgia, musculoskeletal pain and myalgia). Six moderate AEs considered IARs occurred during the Phase 1b study (first 6 months) and have been previously reported (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015)). From 6-30 months in the LTS, 5 moderate AEs considered IARs included abdominal pain, hepatic pain, nausea, muscle spasm, and sensory disturbance in Patient 2. There were no hypersensitivity reactions, acute phase reactions, or cytokine release syndrome. No patient developed IgG antibodies to olipudase alfa. There were no clinically significant adverse changes in vital signs, hematology, or cardiac safety parameters.

(65) Levels of inflammatory markers IL-6, IL-8, and hsCRP stable at the end of the Phase 1b study (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015)) remained stable for all patients except Patient 2, who had fluctuations in hsCRP (1.10 to 33.3 mg/mL; normal range 0-5) from month 6 to month 30. Plasma ceramide levels for all patients (FIG. 1A) remained within normal limits (1.8-6.5 g/mL).

(66) Liver function enzyme levels remained within normal ranges for all patients until month 30 when Patient 4 had transient elevations in ALT (1.4 normal) and AST (2.9 normal), without corresponding AEs, and with subsequent normal levels. Total bilirubin and GGT levels remained similar to or below baseline levels for all patients. Iron levels fluctuated over time, but remained within or close to normal ranges.

(67) During Phase 1b dose escalation, Patient 2 experienced IARs leading to repeat of the 2 mg/kg dose (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015)). The patient subsequently received the target dose of 3 mg/kg through the Phase 1b trial and during the first 6 months of the LTS, at which time the patient reported mild AEs 7-10 days after most infusions including nausea, headache, fatigue, achiness, intermittent abdominal pain, and occasional fever (38.3 to 40.0 C.). Episodes lasted 3 days and were completely resolved by the next infusion. Olipudase alfa was decreased (2 mg/kg for 6 months, then to the current dose of 1 mg/kg). Decreasing the dose did not change the timing, frequency, or types of events reported.

(68) Efficacy

(69) Spleen and Liver Volumes

(70) Spleen and liver volumes decreased in all patients relative to baseline (FIG. 2A). Mean spleen volumes decreased from 12.8 multiples of normal (MN) at baseline to 6.7 MN at 30 months, a 47.3% decrease from baseline (p<0.0001). Mean liver volumes decreased from 1.7 MN at baseline to 1.07 MN at 30 months, a 35.6% decrease from baseline (p=0.006).

(71) Infiltrative Lung Disease

(72) Percent predicted DLco increased in all patients relative to baseline values (FIG. 2B) and improved from a mean of 53.2% (moderate) at baseline to 67.1% at 30 months (mild). The greatest changes occurred in the three patients with the lowest % predicted DLco values at baseline (<40%, in the severe range). FIG. 2B also shows assessment of infiltrative lung disease with mean scores for components at baseline, 6 months, 18 months, and 30 months. The data show progressive decreases in all parameters, particularly in GG appearance and RND, which almost completely resolved.

(73) Fasting Lipid Parameters

(74) Fasting lipid profiles are shown in FIGS. 4A-4D. By 30 months, triglycerides decreased by 42.99% (p=0.02), total cholesterol by 12.7% (p=0.04), LDL-C by 22.8% (p=0.007), and HDL-C increased by 137.6% (p=0.01). Non-HDL cholesterol level (total cholesterol minus HDL-C), was >3.37 mmol/L (>130 mg/dL) in 4/5 patients at baseline (mean 3.91 mmol/L) and was <3.37 mmol/L in all patients at 30 months (mean 2.66 mmol/L).

(75) Biomarker Assessment

(76) Mean lyso-sphingomyelin levels in DBS were 5 times above the upper limit of normal (ULN=69 g/L) at baseline and decreased to near-normal levels that remained stable from 6 through 30 months (FIG. 1B).

(77) Pre-infusion serum chitotriosidase levels steadily decreased by 72.3% from 735 nmol/hr/mL at baseline to 221 nmol/hr/mL at 30 months (p=0.0007), approaching the upper limit of normal chitotriosidase range (<181 nmol/hr/mL) (FIG. 1C). Data were not adjusted to account for two patients heterozygous for a common 24-bp duplication which reduces serum chitotriosidase activity.

(78) Hematology

(79) Most patients maintained platelet counts just below normal or within the low-normal range. Patient 1 had values (57-102109/L) below low-normal (150109/L) throughout the study. Mean platelet count changes from baseline (increases) fluctuated over time [between 5.9% (month 27) and 25.7% (month 9)], and was 20.6% at 30 months. Hemoglobin levels remained similar to baseline levels (mean changes from baseline ranged from 6.1% at week 12 to 6.9% at month 24) and were within normal levels for all patients (data not shown).

(80) Bone Density

(81) At baseline, mean spinal T-scores were in the osteopenic range (between 1.0 and 2.5) at 1.481.14, while Z-scores indicated normal BMD (1.361.26) within 1 standard deviation of the low BMD cutoff (2.0). Both T- and Z-scores improved at 30 months (0.941.03 and 0.781.11, respectively). Patient 2 (female, 32 year old at baseline) had a baseline spinal T-score (3.06) in the osteoporotic range that improved at 18 (2.48) and 30 months (2.65) to values on the osteopenia/osteoporosis border. Two patients with T-scores in the osteopenic range at baseline (Patient 1, male 31 years old at baseline, 1.31 and Patient 4, male, 28 years old at baseline, 2.14) had scores in the normal range at 30 months (0.76 and 0.82, respectively). Results for individual Z-scores over time were similar.

(82) Mean femur T- and Z-scores were in the normal range at baseline (0.381.35 and 0.271.46, respectively) and at 30 months (0.281.27 and 0.131.4, respectively). Patient 2 had a baseline femur T-score in the osteopenic range (2.23) and a Z-score indicating low BMD (2.18); both improved slightly (1.89 and 1.82, respectively) at 30 months.

(83) Bone Marrow Burden

(84) Mean categorical scores for BMB were similar at baseline (6.22.5) and 30 months (5.61.1). Patient 2 had the highest total BMB score of 10 at baseline, which improved by 3 points (score of 7) at 18 and 30 months. T1- and T2-weighted femur and spine images for Patient 2 at baseline and after 30 months of olipudase alfa treatment are shown in FIGS. 3A and 3B. Hypointensity of the proximal epiphysis bone marrow observed at baseline was reduced following 30 months of treatment. In spine, diffuse infiltration of the bone marrow and hyperintense signal intensity of presacral fat observed at baseline was unchanged and improved, respectively, after 30 months of treatment.

(85) Patient Reported Outcomes

(86) Mean BFISD fatigue scores were 3.042.29 at baseline and 2.443.44 at 30 months. Mean BPISD pain severity scores were 3.452.77 at baseline and 2.902.70 at 30 months, and mean BPISD pain interference scores were 2.031.58 at baseline and 3.293.51 at 30 months. Most of the individual BFI and BPI pain severity scores were in the mild (0-3) or moderate (4-6) categories at all time points. Exceptions were Patient 5, whose BPI pain was severe (7-10) at both baseline (6.8) and 30 months (7). BPI pain interference scores increased for Patients 2 (2 at baseline, 8.1 at 30 months) and 3 (1.9 at baseline, 5.3 at 30 months). Fatigue reported by Patient 2 was moderate (5.8) at baseline and severe (8.3) at 30 months.

(87) This study demonstrates that treatment for 30 months with olipudase alfa, the first etiology-specific treatment in development for ASMD, is well-tolerated and associated with life-transforming sustained improvements in relevant disease clinical measures. The 30 months safety profile was similar to the Phase 1b study profile (Wasserstein et al., Mol. Genet. Metab. 116(1-2):88-97 (2015)). There were no hypersensitivity reactions and no anti-drug antibodies were detected. No cytokine release syndrome has been observed in any patient exposed to olipudase alfa to date. Since IARs were not immunologic reactions, they are likely related to release of biologically active sphingomyelin metabolites, principally ceramide, which is a signaling intermediary in cytokine release, inflammation, and apoptosis (Spiegel et al., Curr. Opin. Cell Biol. 8(2):159-167 (1996); Gulbins et al., J. Mol. Med. 82(6):357-363 (2004)). During the first six months of treatment, olipudase alfa doses elicited transient increases in plasma ceramide levels that generally peaked at 48 hour post-infusion (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97 (2015)). Both pre- and post-infusion ceramide levels steadily decreased with each successive olipudase alfa infusion, plateauing after 3 months of treatment, and remaining stable through 30 months.

(88) Clinical improvements were sustained throughout 30 months. Statistically significant improvements in liver and spleen volumes (mean percent decreases in liver volume of 31.2% and spleen of 39.3%) are comparable to responses of other lysosomal storage disorders to ERT. In Gaucher disease, the therapeutic goal for spleen volume is a 30% to 50% decrease during the first year of treatment, and for liver volume a 20% to 30% decrease within the first 2 years of treatment (Pastores et al., Semin Hematol 41 (Supple 5):4-14 (2004)).

(89) Patients with chronic visceral or chronic neurovisceral ASMD demonstrate worsening of infiltrative lung disease with age (Wasserstein et al., Pediatrics 114(6):e672-677 (2004)). Over 30 months of treatment there was a 35% increase from baseline in lung diffusing capacity, with prominent changes in the 3 patients with the lowest DLCO at baseline. Improvements in lung disease scores observed during the first 6 months of treatment (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97(2015)) continued during the subsequent 2 years of treatment, such that some parameters (e.g., GG appearance and RND) had normalized.

(90) Atherogenic lipid profiles typically worsen with age in patients with chronic ASMD (Wasserstein et al., Pediatrics 114(6):e672-677(2004)), and lipid abnormalities may be associated with early coronary artery disease (McGovern et al., J. Pediatr. 145(1):77-81(2004)). At baseline, patients were at mild-to-moderate risk for cardiovascular disease based on lipid profiles (Wasserstein et al. Mol. Genet. Metab. 116(1-2):88-97(2015)), and profiles improved over 30 months of treatment. Non-HDL cholesterol level is considered a good predictor of cardiovascular risk in many patient populations, and a desirable level is <3.37 mmol/L (<130 mg/dL) (Jacobson et al., J. Clin. Lipidol. 9(2):129-169 (2015)). All but one patient had non-HDL levels above 3.37 mmol/L before ERT, and at 30 months total cholesterol and HDL levels improved for all patients with non-HDL below the 3.37 mmol/L cutoff.

(91) Skeletal complications are also prominent features of chronic ASMD. Improvements in BMD were noted in some patients, particularly in the spine, demonstrating that olipudase alfa has a beneficial effect on BMD in adults with ASMD. In other lipid storage disorders with low BMD such as Gaucher disease, ERT in combination with antiresorptive therapy can improve osteopenia (Wenstrup et al., Blood 104(5):1253-1257 (2004)), although response of bone disease to ERT alone is slow in adult patients (Wenstrup et al J. Bone Miner. Res. 22(1):119-126 (2007)). However, bisphosphonates may not be appropriate in patients with ASMD due to inhibition of ASM activity (Arenz Cell Physiol. Biochem. 26(1):1-8 (2010)). No study patient was receiving bisphosphonate therapy. Results from this study indicate that osteopenia will be improved with olipudase alfa alone.

(92) Other clinical measures showed improvements or stability during ERT. Platelet counts and hemoglobin levels remained stable. Moderate levels of BMB were measured at baseline and after 30 months of olipudase alfa treatment, with improvements noted in some patients. Patients had mild to moderate levels of pain and fatigue at baseline that remained stable at 30 months for most patients. Worsening of patient reported outcomes for Patient 3 was not associated with AEs. Patient 2 reported worsening of fatigue and pain with AEs characterized by flu-like symptoms after one year of ERT. This patient has atypical lupus erythematosus and it is uncertain whether this contributed to fatigue and pain, AEs and inflammatory cytokine fluctuations. Decreasing olipudase alfa to 1 mg/kg/week in this patient has had no impact on AE incidence, fatigue or pain. At the lower olipudase alfa dose (12 months of exposure), the patient continues to have clinical benefit including reduced spleen and liver volumes as well as improvement in percent predicted DLco, sustained clearance of infiltrative HRCT parameters, and stabilization of biomarkers.

(93) Chitotriosidase, a well-known biomarker for therapeutic monitoring during ERT in Gaucher disease (Guo et al., J. Inherit. Metab. Dis. 18(6):717-722 (1995)), and a marker of chronic inflammatory diseases, steadily decreased during olipudase alfa treatment (Boot et al., Clin Chim Acta 411(1-2):31-36 (2010)). Lyso-sphingomyelin, the deacylated form of sphingomyelin, decreased in DBS, suggesting utility as a biomarker for monitoring ERT outcomes reflected by steady decreases as patients undergo debulking of sphingomyelin, followed by stability during long-term treatment. Lyso-sphingomyelin is elevated approximately 5-fold in DBS from patients with chronic visceral ASMD (Chuang Mol. Genet. Metab. 111(2):209-211 (2014)).

(94) This open-label extension study of olipudase alfa demonstrates that treatment with olipudase alfa for 30 months was well-tolerated and clinically effective.