Anti-SARS-CoV-2-Spike Glycoprotein Antibodies and Antigen-Binding Fragments
20240043504 · 2024-02-08
Inventors
- Alina Baum (Pleasantville, NY, US)
- Benjamin Fulton (New York, NY, US)
- Christos Kyratsous (Irvington, NY, US)
- George D. Yancopoulos (Yorktown Heights, NY)
Cpc classification
C07K16/1003
CHEMISTRY; METALLURGY
C07K2317/94
CHEMISTRY; METALLURGY
A61K2039/507
HUMAN NECESSITIES
C07K2317/732
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure provides antibodies and antigen-binding fragments thereof that bind specifically to a coronavirus spike protein and methods of using such antibodies and fragments for treating or preventing viral infections (e.g., coronavirus infections).
Claims
1. A method for selecting a plurality of antibodies or antigen-binding fragments thereof for use in treating a viral infection, comprising: a) determining a first frequency of escape mutants resulting from a first antibody or antigen-binding fragment thereof alone; b) determining a second frequency of escape mutants resulting from a second antibody or antigen-binding fragment thereof alone; c) determining a third frequency of escape mutants resulting from a combination of said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof; and d) selecting said combination for use in treating said viral infection if said third frequency is lower than said first frequency and said second frequency; wherein said first antibody or antigen-binding fragment thereof binds to a first epitope of a viral surface protein and said second antibody or antigen-binding fragment thereof binds to a second epitope of a viral surface protein, and further wherein said first epitope and said second epitope are non-overlapping.
2. The method of claim 1, wherein said viral infection is a coronavirus infection.
3. The method of claim 2, wherein said coronavirus is SARS-CoV-2.
4. The method of claim 3, wherein said escape mutant is a mutant in a SARS-CoV-2 surface protein.
5. The method of claim 4, wherein said surface protein is spike protein.
6. The method of claim 5, wherein the frequency of SARS-CoV-2 spike protein escape mutants is measured by: a) contacting a population of cells with said first antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a first frequency of SARS-CoV-2 spike protein mutations; b) contacting a comparable population of cells with said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a second frequency of SARS-CoV-2 spike protein mutations; c) contacting a comparable population of cells with said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a third frequency of SARS-CoV-2 spike protein mutations; and d) comparing said first frequency, said second frequency, and said third frequency.
7. The method of claim 1, wherein said first epitope and said second epitope are selected from the group consisting of: a) amino acids 432-452 of SEQ ID NO: 832; b) amino acids 471-486 of SEQ ID NO: 832; and c) amino acids 491-515 of SEQ ID NO: 832.
8. The method of claim 1, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are selected from the antibodies or antigen-binding fragments of Table 1.
9. The method of claim 1, wherein said first antibody and said second antibody are selected from among two of the following groups: a) mAb10987, mAb10922, mAb10936, and mAb10934; b) mAb10989, mAb10977, and mAb10933; c) mAb10920; d) mAb10954, mAb10986, and mAb10964; and e) mAb10984.
10. The method of claim 1, wherein said first antibody and said second antibody are selected from the group consisting of: mAb10987, mAb10934, mAb10989, and mAb10933.
11. A method of treating a viral infection in a subject, comprising administering a first antibody or antigen-binding fragment thereof and a second antibody or antigen-binding fragment thereof to said subject, wherein: a) said first antibody or antigen-binding fragment thereof binds to a first epitope of a SARS-CoV-2 spike protein and said second antibody or antigen-binding fragment thereof binds to a second epitope of said SARS-CoV-2 spike protein; b) said first epitope and said second epitope are different; and c) administration of said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof results in a reduced frequency of SARS-CoV-2 spike protein escape mutants as compared to administration of said first antibody or antigen-binding fragment thereof alone or said second antibody or antigen-binding fragment thereof alone.
12. The method of claim 11, wherein said frequency of SARS-CoV-2 spike protein escape mutants is measured by: a) contacting a population of cells with said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a first frequency of SARS-CoV-2 spike protein mutations; b) contacting a comparable population of cells with said first antibody or antigen-binding fragment thereof alone or said second antibody or antigen-binding fragment thereof alone, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a second frequency of SARS-CoV-2 spike protein mutations; and c) comparing said first frequency and said second frequency.
13. The method of claim 11, wherein said first epitope and said second epitope are non-overlapping.
14. The method of claim 11, wherein said first epitope and said second epitope are selected from the group consisting of: a) amino acids 432-452 of SEQ ID NO: 832; b) amino acids 471-486 of SEQ ID NO: 832; and c) amino acids 491-515 of SEQ ID NO: 832.
15. The method of claim 11, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are selected from the antibodies or antigen-binding fragments of Table 1.
16. The method of claim 11, wherein said first antibody and said second antibody are selected from among two of the following groups: a) mAb10987, mAb10922, mAb10936, and mAb10934; b) mAb10989, mAb10977, and mAb10933; C) mAb10920; d) mAb10954, mAb10986, and mAb10964, and e) mAb10984.
17. The method of claim 11, wherein said first antibody and said second antibody are selected from the group consisting of: mAb10987, mAb10934, mAb10989, and mAb10933.
18. The method of claim 11, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are administered concurrently.
19. The method of claim 11, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are administered sequentially.
20. The method of claim 11, wherein said subject is infected with SARS-CoV-2.
21. The method of claim 11, wherein said subject has COVID-19.
22. A method of treating a viral infection in a subject, comprising administering a first antibody or antigen-binding fragment thereof and a second antibody or antigen-binding fragment thereof to said subject, wherein: a) said first antibody or antigen-binding fragment thereof binds to a first epitope of a SARS-CoV-2 spike protein and said second antibody or antigen-binding fragment thereof binds to a second epitope of said SARS-CoV-2 spike protein; b) said first epitope and said second epitope are non-overlapping; and c) administration of said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof results in a reduced frequency of SARS-CoV-2 spike protein escape mutants as compared to administration of a combination of antibodies that bind to overlapping epitopes of said SARS-CoV-2 spike protein.
23. The method of claim 22, wherein said frequency of SARS-CoV-2 spike protein escape mutants is measured by: a) contacting a population of cells with said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a first frequency of SARS-CoV-2 spike protein mutations; b) contacting a comparable population of cells with said combination of antibodies that binds to overlapping epitopes of said SARS-CoV-2 spike protein, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a second frequency of SARS-CoV-2 spike protein mutations; and c) comparing said first frequency and said second frequency.
24. The method of claim 22, wherein said first epitope and said second epitope are selected from the group consisting of: a) amino acids 432-452 of SEQ ID NO: 832; b) amino acids 471-486 of SEQ ID NO: 832; and c) amino acids 491-515 of SEQ ID NO: 832.
25. The method of claim 22, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are selected from the antibodies or antigen-binding fragments of Table 1.
26. The method of claim 22, wherein said first antibody and said second antibody are selected from among two of the following groups: a) mAb10987, mAb10922, mAb10936, and mAb10934; b) mAb10989, mAb10977, and mAb10933; c) mAb10920; d) mAb10954, mAb10986, and mAb10964; and e) mAb10984.
27. The method of claim 22, wherein said first antibody and said second antibody are selected from the group consisting of: mAb10987, mAb10934, mAb10989, and mAb10933.
28. The method of claim 22, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are administered concurrently.
29. The method of claim 22, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are administered sequentially.
30. The method of claim 22, wherein said subject is infected with SARS-CoV-2.
31. The method of claim 22, wherein said subject has COVID-19.
32. A method for controlling the proliferation of viral escape mutants, the method comprising administering to a subject a first antibody or antigen-binding fragment thereof and a second antibody or antigen-binding fragment thereof, wherein said first antibody or antigen binding fragment thereof and said second antibody or antigen-binding fragment thereof both bind to a viral surface protein, wherein said first antibody or antigen binding fragment thereof and said second antibody or antigen-binding fragment thereof do not compete with one another for binding to said viral surface protein, and further wherein said subject is infected with a virus expressing said viral surface protein.
33. The method of claim 32, wherein said virus is a coronavirus.
34. The method of claim 33, wherein said coronavirus is SARS-CoV-2 and said viral surface protein is spike protein.
35. The method of claim 32, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are selected from the antibodies or antigen-binding fragments of Table 1.
36. The method of claim 32, wherein said first antibody and said second antibody are selected from among two of the following groups: a) mAb10987, mAb10922, mAb10936, and mAb10934; b) mAb10989, mAb10977, and mAb10933; c) mAb10920; d) mAb10954, mAb10986, and mAb10964; and e) mAb10984.
37. The method of claim 32, wherein said first antibody and said second antibody are selected from the group consisting of: mAb10987, mAb10934, mAb10989, and mAb10933.
38. A pharmaceutical composition comprising a first antibody or antigen-binding fragment thereof and a second antibody or antigen-binding fragment thereof, wherein: a) said first antibody or antigen-binding fragment thereof binds to a first epitope of a SARS-CoV-2 spike protein and said second antibody or antigen-binding fragment thereof binds to a second epitope of said SARS-CoV-2 spike protein; b) said first epitope and said second epitope are different; and c) said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof result in a reduced frequency of SARS-CoV-2 spike protein escape mutants as compared to said first antibody or antigen-binding fragment thereof alone or said second antibody or antigen-binding fragment thereof alone.
39. The pharmaceutical composition of claim 38, wherein said frequency of SARS-CoV-2 spike protein escape mutants is measured by: a) contacting a population of cells with said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a first frequency of SARS-CoV-2 spike protein mutations; b) contacting a comparable population of cells with said first antibody or antigen-binding fragment thereof alone or said second antibody or antigen-binding fragment thereof alone, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a second frequency of SARS-CoV-2 spike protein mutations; and c) comparing said first frequency and said second frequency.
40. The pharmaceutical composition of claim 38, wherein said first epitope and said second epitope are non-overlapping.
41. The pharmaceutical composition of claim 38, wherein said first epitope and said second epitope are selected from the group consisting of: a) amino acids 432-452 of SEQ ID NO: 832; b) amino acids 471-486 of SEQ ID NO: 832; and c) amino acids 491-515 of SEQ ID NO: 832.
42. The pharmaceutical composition of claim 38, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are selected from the antibodies or antigen-binding fragments of Table 1.
43. The pharmaceutical composition of claim 38, wherein said first antibody and said second antibody are selected from among two of the following groups: a) in Ab 10987, mAb10922, mAb10936, and mAb10934; b) mAb10989, mAb10977, and mAb10933; c) mAb10920; d) mAb10954, mAb10986, and mAb10964; and e) mAb10984.
44. The pharmaceutical composition of claim 38, wherein said first antibody and said second antibody are selected from the group consisting of: mAb10987, mAb10934, mAb10989, and mAb10933.
45. The pharmaceutical composition of claim 38, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are administered concurrently to a subject.
46. The pharmaceutical composition of claim 38, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are administered sequentially to a subject.
47. The pharmaceutical composition of claim 38, further comprising a pharmaceutically acceptable carrier.
48. A composition comprising: a) a first antibody, or antigen-binding fragment thereof, that binds a SARS-CoV-2 spike protein comprising the amino acid sequence set forth in SEQ ID NO: 832, wherein said isolated antibody or antigen-binding fragment comprises three heavy chain complementarity determining regions (CDRs) (A-HCDR1, A-HCDR2 and A-HCDR3) contained within a heavy chain variable region (A-HCVR) comprising the amino acid sequence set forth in SEQ ID NO: 202, and three light chain CDRs (A-LCDR1, A-LCDR2 and A-LCDR3) contained within a light chain variable region (A-LCVR) comprising the amino acid sequence set forth in SEQ ID NO: 210; b) a second antibody, or antigen-binding fragment thereof, that binds a SARS-CoV-2 spike protein comprising the amino acid sequence set forth in SEQ ID NO: 832, wherein said isolated antibody or antigen-binding fragment thereof comprises three heavy chain CDRs (B-HCDR1, B-HCDR2 and B-HCDR3) contained within a heavy chain variable region (B-HCVR) comprising the amino acid sequence set forth in SEQ ID NO: 640, and three light chain CDRs (B-LCDR1, B-LCDR2 and B-LCDR3) contained within a light chain variable region (B-LCVR) comprising the amino acid sequence set forth in SEQ ID NO: 646; and c) a third antibody, or antigen-binding fragment thereof, that binds a SARS-CoV-2 spike protein comprising the amino acid sequence set forth in SEQ ID NO: 832, wherein said isolated antibody or antigen-binding fragment thereof comprises three heavy chain CDRs (C-HCDR1, C-HCDR2 and C-HCDR3) contained within a heavy chain variable region (C-HCVR) comprising the amino acid sequence set forth in SEQ ID NO: 608, and three light chain CDRs (C-LCDR1, C-LCDR2 and C-LCDR3) contained within a light chain variable region (C-LCVR) comprising the amino acid sequence set forth in SEQ ID NO: 614.
49. The composition of claim 48, wherein A-HCDR1 comprises the amino acid sequence set forth in SEQ ID NO: 204, A-HCDR2 comprises the amino acid sequence set forth in SEQ ID NO: 206, A-HCDR3 comprises the amino acid sequence set forth in SEQ ID NO: 208, A-LCDR1 comprises the amino acid sequence set forth in SEQ ID NO: 212, A-LCDR2 comprises the amino acid sequence set forth in SEQ ID NO: 55, and A-LCDR3 comprises the amino acid sequence set forth in SEQ ID NO: 214.
50. The composition of claim 49, wherein A-HCVR comprises the amino acid sequence set forth in SEQ ID NO: 202.
51. The composition of claim 49, wherein A-LCVR comprises the amino acid sequence set forth in SEQ ID NO: 210.
52. The composition of claim 49, wherein A-HCVR comprises the amino acid sequence set forth in SEQ ID NO: 202 and A-LCVR comprises the amino acid sequence set forth in SEQ ID NO: 210.
53. The composition of claim 48, wherein B-HCDR1 comprises the amino acid sequence set forth in SEQ ID NO: 642, B-HCDR2 comprises the amino acid sequence set forth in SEQ ID NO: 499, B-HCDR3 comprises the amino acid sequence set forth in SEQ ID NO: 644, B-LCDR1 comprises the amino acid sequence set forth in SEQ ID NO: 648, B-LCDR2 comprises the amino acid sequence set forth in SEQ ID NO: 650, and B-LCDR3 comprises the amino acid sequence set forth in SEQ ID NO: 652.
54. The composition of claim 53, wherein B-HCVR comprises the amino acid sequence set forth in SEQ ID NO: 640.
55. The composition of claim 53, wherein B-LCVR comprises the amino acid sequence set forth in SEQ ID NO: 646.
56. The composition of claim 53, wherein B-HCVR comprises the amino acid sequence set forth in SEQ ID NO: 640 and B-LCVR comprises the amino acid sequence set forth in SEQ ID NO: 646.
57. The composition of claim 48, wherein C-HCDR1 comprises the amino acid sequence set forth in SEQ ID NO: 169, C-HCDR2 comprises the amino acid sequence set forth in SEQ ID NO: 610, C-HCDR3 comprises the amino acid sequence set forth in SEQ ID NO: 612, C-LCDR1 comprises the amino acid sequence set forth in SEQ ID NO: 616, C-LCDR2 comprises the amino acid sequence set forth in SEQ ID NO: 584, and C-LCDR3 comprises the amino acid sequence set forth in SEQ ID NO: 618.
58. The composition of claim 57, wherein C-HCVR comprises the amino acid sequence set forth in SEQ ID NO: 608.
59. The composition of claim 57, wherein C-LCVR comprises the amino acid sequence set forth in SEQ ID NO: 614.
60. The composition of claim 57, wherein C-HCVR comprises the amino acid sequence set forth in SEQ ID NO: 608 and C-LCVR comprises the amino acid sequence set forth in SEQ ID NO: 614.
61. A pharmaceutical composition comprising method a plurality of antibodies or antigen-binding fragments thereof for use in treating a viral infection, wherein said antibodies or antigen-binding fragments thereof are selected by: a) determining a first frequency of escape mutants resulting from a first antibody or antigen-binding fragment thereof alone; b) determining a second frequency of escape mutants resulting from a second antibody or antigen-binding fragment thereof alone; c) determining a third frequency of escape mutants resulting from a combination of said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof; and d) selecting said combination for use in treating said viral infection if said third frequency is lower than said first frequency and said second frequency; wherein said first antibody or antigen-binding fragment thereof binds to a first epitope of a viral surface protein and said second antibody or antigen-binding fragment thereof binds to a second epitope of a viral surface protein, and further wherein said first epitope and said second epitope are selected from the group consisting of: a) amino acids 432-452 of SEQ ID NO: 832; b) amino acids 471-486 of SEQ ID NO: 832; and c) amino acids 491-515 of SEQ ID NO: 832.
62. The method of claim 61, wherein said viral infection is a coronavirus infection.
63. The method of claim 62, wherein said coronavirus is SARS-CoV-2.
64. The method of claim 63, wherein said escape mutant is a mutant in a SARS-CoV-2 surface protein.
65. The method claim 64, wherein said surface protein is spike protein.
66. The method of claim 65, wherein the frequency of SARS-CoV-2 spike protein escape mutants is measured by: a) contacting a population of cells with said first antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a first frequency of SARS-CoV-2 spike protein mutations; b) contacting a comparable population of cells with said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a second frequency of SARS-CoV-2 spike protein mutations; c) contacting a comparable population of cells with said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof, and with a virus expressing said SARS-CoV-2 spike protein, sequencing nucleic acids from said population of cells, and determining a third frequency of SARS-CoV-2 spike protein mutations; and d) comparing said first frequency, said second frequency, and said third frequency.
67. The method of claim 61, wherein said first epitope and said second epitope are selected from the group consisting of: a) amino acids 432-452 of SEQ ID NO: 832; b) amino acids 471-486 of SEQ ID NO: 832; and c) amino acids 491-515 of SEQ ID NO: 832.
68. The method of claim 61, wherein said first antibody or antigen-binding fragment thereof and said second antibody or antigen-binding fragment thereof are selected from the antibodies or antigen-binding fragments of Table 1.
69. The method of claim 61, wherein said first antibody and said second antibody are selected from among two of the following groups: a) mAb10987, mAb10922, mAb10936, and mAb10934; b) mAb10989, mAb10977, and mAb10933; c) mAb10920; d) mAb10954, mAb10986, and mAb10964; and e) mAb10984.
70. The method of claim 61, wherein said first antibody and said second antibody are selected from the group consisting of: mAb10987, mAb10934, mAb10989, and mAb10933.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
DETAILED DESCRIPTION OF THE INVENTION
[0087] Before the present methods are described, it is to be understood that this invention is not limited to particular methods, and experimental conditions described, as such methods and conditions may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.
[0088] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, preferred methods and materials are now described. All publications mentioned herein are incorporated herein by reference in their entirety.
[0089] The term coronavirus or CoV refers to any virus of the coronavirus family, including but not limited to SARS-CoV-2, MERS-CoV, and SARS-CoV. SARS-CoV-2 refers to the newly-emerged coronavirus which was identified as the cause of a serious outbreak starting in Wuhan, China, and which is rapidly spreading to other areas of the globe. SARS-CoV-2 has also been known as 2019-nCoV and Wuhan coronavirus. It binds via the viral spike protein to human host cell receptor angiotensin-converting enzyme 2 (ACE2). The spike protein also binds to and is cleaved by TMPRSS2, which activates the spike protein for membrane fusion of the virus.
[0090] The term CoV-S, also called S or S protein refers to the spike protein of a coronavirus, and can refer to specific S proteins such as SARS-CoV-2-S, MERS-CoV S, and SARS-CoV S. The SARS-CoV-2-Spike protein is a 1273 amino acid type I membrane glycoprotein which assembles into trimers that constitute the spikes or peplomers on the surface of the enveloped coronavirus particle. The protein has two essential functions, host receptor binding and membrane fusion, which are attributed to the N-terminal (S1) and C-terminal (S2) halves of the S protein. CoV-S binds to its cognate receptor via a receptor binding domain (RBD) present in the S1 subunit. The amino acid sequence of full-length SARS-CoV-2 spike protein is exemplified by the amino acid sequence provided in SEQ ID NO: 832. The term CoV-S includes protein variants of CoV spike protein isolated from different CoV isolates as well as recombinant CoV spike protein or a fragment thereof. The term also encompasses CoV spike protein or a fragment thereof coupled to, for example, a histidine tag, mouse or human Fc, or a signal sequence such as ROR1.
[0091] The term coronavirus infection or CoV infection, as used herein, refers to infection with a coronavirus such as SARS-CoV-2, MERS-CoV, or SARS-CoV. The term includes coronavirus respiratory tract infections, often in the lower respiratory tract. Symptoms can include high fever, dry cough, shortness of breath, pneumonia, gastro-intestinal symptoms such as diarrhea, organ failure (kidney failure and renal dysfunction), septic shock, and death in severe cases.
Viruses
[0092] The present invention includes methods for treating or preventing a viral infection in a subject. The term virus includes any virus whose infection in the body of a subject is treatable or preventable by administration of an anti-CoV-S antibody or antigen-binding fragment thereof (e.g., wherein infectivity of the virus is at least partially dependent on CoV-S). In an embodiment of the invention, a virus is any virus that expresses spike protein (e.g., CoV-S). The term virus also includes a CoV-S-dependent respiratory virus which is a virus that infects the respiratory tissue of a subject (e.g., upper and/or lower respiratory tract, trachea, bronchi, lungs) and is treatable or preventable by administration of an anti-CoV-S antibody or antigen-binding fragment thereof. For example, in an embodiment of the invention, virus includes coronavirus, SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2), SARS-CoV (severe acute respiratory syndrome coronavirus), and MERS-CoV (Middle East respiratory syndrome (MERS) coronavirus). Coronaviruses can include the genera of alphacoronaviruses, betacoronaviruses, gammacoronaviruses, and deltacoronaviruses. In some embodiments, the antibodies or antigen-binding fragments provided herein can bind to and/or neutralize an alphacoronavirus, a betacoronavirus, a gammacoronavirus, and/or a deltacoronavirus. In certain embodiments, this binding and/or neutralization can be specific for a particular genus of coronavirus or for a particular subgroup of a genus. Viral infection refers to the invasion and multiplication of a virus in the body of a subject.
[0093] Coronavirus virions are spherical with diameters of approximately 125 nm. The most prominent feature of coronaviruses is the club-shape spike projections emanating from the surface of the virion. These spikes are a defining feature of the virion and give them the appearance of a solar corona, prompting the name, coronaviruses. Within the envelope of the virion is the nucleocapsid. Coronaviruses have helically symmetrical nucleocapsids, which is uncommon among positive-sense RNA viruses, but far more common for negative-sense RNA viruses. SARS-CoV-2, MERS-CoV, and SARS-CoV belong to the coronavirus family. The initial attachment of the virion to the host cell is initiated by interactions between the S protein and its receptor. The sites of receptor binding domains (RBD) within the S1 region of a coronavirus S protein vary depending on the virus, with some having the RBD at the C-terminus of S1. The S-protein/receptor interaction is the primary determinant for a coronavirus to infect a host species and also governs the tissue tropism of the virus. Many coronaviruses utilize peptidases as their cellular receptor. Following receptor binding, the virus must next gain access to the host cell cytosol. This is generally accomplished by acid-dependent proteolytic cleavage of S protein by a cathepsin, TMPRRS2 or another protease, followed by fusion of the viral and cellular membranes.
Anti-CoV-S Antibodies and Antigen-Binding Fragments
[0094] The present invention provides antigen-binding proteins, such as antibodies and antigen-binding fragments thereof, that specifically bind to CoV spike protein or an antigenic fragment thereof.
[0095] The term antibody, as used herein, refers to immunoglobulin molecules comprising four polypeptide chains, two heavy chains (HCs) and two light chains (LCs) inter-connected by disulfide bonds (i.e., full antibody molecules), as well as multimers thereof (e.g. IgM). Exemplary antibodies include, for example, those listed in Table 1. Each heavy chain comprises a heavy chain variable region (HCVR or V.sub.H) and a heavy chain constant region (comprised of domains C.sub.H1, C.sub.H2 and C.sub.H3). Each light chain is comprised of a light chain variable region (LCVR or V.sub.L) and a light chain constant region (C.sub.L). The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). Each V.sub.H and V.sub.L comprises three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Heavy chain CDRs can also be referred to as HCDRs or CDR-Hs, and numbered as described above (e.g., HCDR1, HCDR2, and HCDR3 or CDR-H1, CDR-H2, and CDR-H3). Likewise, light chain CDRs can be referred to as LCDRs or CDR-Ls, and numbered LCDR1, LCDR2, and LCDR3, or CDR-L1, CDR-L2, and CDR-L3. In certain embodiments of the invention, the FRs of the antibody (or antigen binding fragment thereof) are identical to the human germline sequences, or are naturally or artificially modified. Exemplary human germline sequences include, but are not limited to, VH3-66 and Vk1-33. Thus, the present disclosure provides anti-CoV-S antibodies or antigen-binding fragments thereof (e.g., anti-SARS-CoV-2-S antibodies or antigen-binding fragments thereof) comprising HCDR and LCDR sequences of Table 1 within a VH3-66 or Vk1-33 variable heavy chain region. Monoclonal antibodies herein can be designated by mAb followed by a number (e.g., mAb10933) or by REGN then a number (e.g., REGN10933). It is to be understood that mAb and REGN can be used interchangeable (e.g., mAb10933 is the same antibody as REGN10933).
[0096] Typically, the variable domains of both the heavy and light immunoglobulin chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR). In general, from N-terminal to C-terminal, both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4. In an embodiment of the invention, the assignment of amino acids to each domain is in accordance with the definitions of Sequences of Proteins of Immunological Interest, Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5.sup.th ed.; NIH Publ. No. 91-3242 (1991); Kabat (1978) Adv. Prot. Chem. 32:1-75; Kabat, et al., (1977) J. Biol. Chem. 252:6609-6616; Chothia, et al., (1987) J Mol. Biol. 196:901-917 or Chothia, et al., (1989) Nature 342:878-883.
[0097] The present invention includes monoclonal anti-CoV-S antigen-binding proteins, e.g., antibodies and antigen-binding fragments thereof, as well as monoclonal compositions comprising a plurality of isolated monoclonal antigen-binding proteins. The term monoclonal antibody, as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts. A plurality of such monoclonal antibodies and fragments in a composition refers to a concentration of identical (i.e., as discussed above, in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts) antibodies and fragments which is above that which would normally occur in nature, e.g., in the blood of a host organism such as a mouse or a human.
[0098] In an embodiment of the invention, an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment comprises a heavy chain constant domain, e.g., of the type IgA (e.g., IgA1 or IgA2), IgD, IgE, IgG (e.g., IgG1, IgG2, IgG3 and IgG4) or IgM. In an embodiment of the invention, an antigen-binding protein, e.g., antibody or antigen-binding fragment comprises a light chain constant domain, e.g., of the type kappa or lambda.
[0099] The term human antigen-binding protein, such as an antibody, as used herein, includes antibodies having variable and constant regions derived from human germline immunoglobulin sequences whether in a human cell or grafted into a non-human cell, e.g., a mouse cell. See e.g., U.S. Pat. Nos. 8,502,018, 6,596,541 or 5,789,215. The human mAbs of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo), for example in the CDRs and, in particular, CDR3. However, the term human antibody, as used herein, is not intended to include mAbs in which CDR sequences derived from the germline of another mammalian species (e.g., mouse) have been grafted onto human FR sequences. The term includes antibodies recombinantly produced in a non-human mammal or in cells of a non-human mammal. The term is not intended to include antibodies isolated from or generated in a human subject. See below.
[0100] The present invention includes anti-CoV-S chimeric antigen-binding proteins, e.g., antibodies and antigen-binding fragments thereof, and methods of use thereof. As used herein, a chimeric antibody is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species. (U.S. Pat. No. 4,816,567; and Morrison et al., (1984) Proc. Natl. Acad. Sci. USA 81: 6851-6855).
[0101] The term recombinant antigen-binding proteins, such as antibodies or antigen-binding fragments thereof, refers to such molecules created, expressed, isolated or obtained by technologies or methods known in the art as recombinant DNA technology which include, e.g., DNA splicing and transgenic expression. The term includes antibodies expressed in a non-human mammal (including transgenic non-human mammals, e.g., transgenic mice), or a cell (e.g., CHO cells) expression system or isolated from a recombinant combinatorial human antibody library. In some embodiments, a recombinant antibody shares a sequence with an antibody isolated from an organism (e.g., a mouse or a human), but has been expressed via recombinant DNA technology. Such antibodies may have post-translational modifications (e.g., glycosylation) that differ from the antibody as isolated from the organism.
[0102] In some embodiments, the antibodies disclosed herein lack fucose in its constant region glycosylation. Methods of measuring fucose in an antibody composition have been described in the art, e.g., U.S. Pat. No. 8,409,838 (Regeneron Pharmaceuticals), incorporated herein by reference. In some embodiments, fucose is undetectable in a composition comprising a population of antibody molecules. In some embodiments, an antibody lacking fucose has enhanced ADCC activity.
[0103] In some embodiments, antibodies that lack fucose can be produced using cell lines that are deficient in their ability to fucosylate proteins, i.e., the ability to fucosylate proteins is reduced or eliminated. Fucosylation of glycans requires synthesis of GDP-fucose via the de novo pathway or the salvage pathway, both of which involve sequential function of several enzymes, leading to addition of a fucose molecule to the first N-acetylglucosamine (GlcNAc) moiety of the reducing end of a glycan. The two key enzymes of the de novo pathway responsible for production of GDP-fucose are GDP-D-mannose-4,6-dehydratase (GMD) and GDP-keto-6-deoxymannose-3,5-epimerase,4-reductase (FX). In the absence of fucose, these two de novo pathway enzymes (GMD and FX) convert mannose and/or glucose to GDP-fucose which is then transported into the Golgi complex where nine fucosyl-transferases (FUT1-9) act in concert to fucosylate the first GlcNAc molecule of a glycan. In the presence of fucose, however, the salvage pathway enzymes, fucose-kinase and GDP-fucose pyrophosphorylase, convert fucose into GDP-fucose.
[0104] Cell lines that are deficient in their ability to fucosylate proteins have been described in the art. In some embodiments, a cell line deficient in its ability to fucosylate proteins is a mammalian cell line (e.g., CHO cell lines, such as CHO K1, DXB-11 CHO, Veggie-CHO) comprising a mutation or genetic modification in one or more of endogenous FUT1 to 9 genes resulting in a lack of one or more functional fucosyl-transferases. In some embodiments, the mammalian cell line comprises a mutation in an endogenous FUT8 gene (e.g., a FUT8 knock-out cell line in which the FUT8 gene has been disrupted resulting in a lack of a functional a1,6-fucosyltransferase in the cell line, as described in U.S. Pat. No. 7,214,775 (Kyowa Hakko Kogyo Co., Ltd.) and U.S. Pat. No. 7,737,725 (Kyowa Hakko Kirin Co., Ltd), incorporated herein by reference. In some embodiments, the mammalian cell line comprises a mutation or genetic modification in an endogenous GMD gene resulting in a lack of a functional GMD in the cell line, e.g., a GMD knock-out cell line in which the GMD gene has been disrupted, described in e.g., U.S. Pat. No. 7,737,725 (Kyowa Hakko Kirin Co., Ltd), incorporated herein by reference. In some embodiments, the mammalian cell line comprises a mutation or genetic modification in an endogenous Fx gene resulting in a lack of a functional Fx protein. In some embodiments, the mammalian cell line is an Fx knock-out cell line in which the endogenous Fx gene has been disrupted (see, e.g., U.S. Pat. No. 7,737,725 (Kyowa Hakko Kirin Co., Ltd), incorporated herein by reference). In some embodiments, the mammalian cell line comprises a mutation in an endogenous Fx mutation that confers temperature sensitive phenotypes (as described in, e.g., U.S. Pat. No. 8,409,838 (Regeneron Pharmaceuticals), incorporated herein by reference). In some embodiments, the mammalian cell line deficient in its ability to fucosylate proteins is a cell line that has been selected based on resistance to certain lectins, e.g., the Lens culinaris lectin. See, e.g., U.S. Pat. No. 8,409,838 (Regeneron Pharmaceuticals), incorporated herein by reference.
[0105] Recombinant anti-CoV-S antigen-binding proteins, e.g., antibodies and antigen-binding fragments, disclosed herein may also be produced in an E. coli/T7 expression system. In this embodiment, nucleic acids encoding the anti-CoV-S antibody immunoglobulin molecules of the invention (e.g., as found in Table 1) may be inserted into a pET-based plasmid and expressed in the E. coli/T7 system. For example, the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E. coli such as BL21 or BL21DE3) comprising expressing T7 RNA polymerase in the cell which also includes a polynucleotide encoding an immunoglobulin chain that is operably linked to a T7 promoter. For example, in an embodiment of the invention, a bacterial host cell, such as an E. coli, includes a polynucleotide encoding the T7 RNA polymerase gene operably linked to a lac promoter and expression of the polymerase and the chain is induced by incubation of the host cell with IPTG (isopropyl-beta-D-thiogalactopyranoside). See U.S. Pat. Nos. 4,952,496 and 5,693,489 or Studier & Moffatt, Use of bacteriophage T7 RNA polymerase to direct selective high-level expression of cloned genes, J. Mol. Biol. 1986 May 5; 189(1): 113-30.
[0106] There are several methods by which to produce recombinant antibodies which are known in the art. One example of a method for recombinant production of antibodies is disclosed in U.S. Pat. No. 4,816,567.
[0107] Transformation can be by any known method for introducing polynucleotides (e.g., DNA or RNA, including mRNA) into a host cell. Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, lipid nanoparticle technology, biolistic injection and direct microinjection of the DNA into nuclei. In addition, nucleic acid molecules may be introduced into mammalian cells by viral vectors such as lentivirus or adeno-associated virus. Methods of transforming cells are well known in the art. See, for example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and 4,959,455. In some embodiments, an antibody or antigen-binding fragment thereof of the present disclosure can be introduced to a subject in nucleic acid form (e.g, DNA or RNA, including mRNA), such that the subject's own cells produce the antibody. The present disclosure further provides modifications to nucleotide sequences encoding the anti-CoV-S antibodies described herein that result in increased antibody expression, increased antibody stability, increased nucleic acid (e.g., mRNA) stability, or improved affinity or specificity of the antibodies for the CoV spike protein.
[0108] Thus, the present invention includes recombinant methods for making an anti-CoV-S antigen-binding protein, such as an antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising (i) introducing one or more polynucleotides (e.g., including the nucleotide sequence of any one or more of the sequences of Table 2) encoding light and/or heavy immunoglobulin chains, or CDRs, of the antigen-binding protein, e.g., of Table 1, for example, wherein the polynucleotide is in a vector; and/or integrated into a host cell chromosome and/or is operably linked to a promoter; (ii) culturing the host cell (e.g., CHO or Pichia or Pichia pastoris) under condition favorable to expression of the polynucleotide and, (iii) optionally, isolating the antigen-binding protein, (e.g., antibody or fragment) or chain from the host cell and/or medium in which the host cell is grown. For example, a polynucleotide can be integrated into a host cell chromosome through targeted insertion with a vector such as adeno-associated virus (AAV), e.g., after cleavage of the chromosome using a gene editing system (e.g., CRISPR (for example, CRISPR-Cas9), TALEN, megaTAL, zinc finger, or Argonaute). Targeted insertions can take place, for example, at host cell loci such as an albumin or immunoglobulin genomic locus. Alternatively, insertion can be at a random locus, e.g., using a vector such as lentivirus. When making an antigen-binding protein (e.g., antibody or antigen-binding fragment) comprising more than one immunoglobulin chain, e.g., an antibody that comprises two heavy immunoglobulin chains and two light immunoglobulin chains, co-expression of the chains in a single host cell leads to association of the chains, e.g., in the cell or on the cell surface or outside the cell if such chains are secreted, so as to form the antigen-binding protein (e.g., antibody or antigen-binding fragment). The methods include those wherein only a heavy immunoglobulin chain or only a light immunoglobulin chain (e.g., any of those discussed herein including mature fragments and/or variable domains thereof) is expressed. Such chains are useful, for example, as intermediates in the expression of an antibody or antigen-binding fragment that includes such a chain. For example, the present invention also includes anti-CoV-S antigen-binding proteins, such as antibodies and antigen-binding fragments thereof, comprising a heavy chain immunoglobulin (or variable domain thereof or comprising the CDRs thereof) encoded by a polynucleotide comprising a nucleotide sequence set forth in Table 2 and a light chain immunoglobulin (or variable domain thereof or comprising the CDRs thereof) encoded by a nucleotide sequence set forth in Table 2 which are the product of such production methods, and, optionally, the purification methods set forth herein. For example, in some embodiments, the product of the method is an anti-CoV-S antigen-binding protein which is an antibody or fragment comprising an HCVR comprising an amino acid sequence set forth in Table 1 and an LCVR comprising an amino acid sequence set forth in Table 1, wherein the HCVR and LCVR sequences are selected from a single antibody listed in Table 1. In some embodiments, the product of the method is an anti-CoV-S antigen-binding protein which is an antibody or fragment comprising HCDR1, HCDR2, and HCDR3 comprising amino acid sequences set forth in Table 1 and LCDR1, LCDR2, and LCDR3 comprising amino acid sequences set forth in Table 1, wherein the six CDR sequences are selected from a single antibody listed in Table 1. In some embodiments, the product of the method is an anti-CoV-S antigen-binding protein which is an antibody or fragment comprising a heavy chain comprising an HC amino acid sequence set forth in Table 1 and a light chain comprising an LC amino acid sequence set forth in Table 1.
[0109] Eukaryotic and prokaryotic host cells, including mammalian cells, may be used as hosts for expression of an anti-CoV-S antigen-binding protein. Such host cells are well known in the art and many are available from the American Type Culture Collection (ATCC). These host cells include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines. Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells. Other cell lines that may be used are insect cell lines (e.g., Spodoptera frugiperda or Trichoplusia ni), amphibian cells, bacterial cells, plant cells and fungal cells. Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium sp., Fusarium gramineum, Fusarium venenatum, Physcomitrella patens and Neurospora crassa. The present invention includes an isolated host cell (e.g., a CHO cell) comprising an antigen-binding protein, such as those of Table 1; or a polynucleotide encoding such a polypeptide thereof.
[0110] The term specifically binds refers to those antigen-binding proteins (e.g., mAbs) having a binding affinity to an antigen, such as a CoV-S protein (e.g., SARS-CoV-2-S), expressed as K.sub.D, of at least about 10.sup.8 M, as measured by real-time, label free bio-layer interferometry assay, for example, at 25 C. or 37 C., e.g., an Octet HTX biosensor, or by surface plasmon resonance, e.g., BIACORE, or by solution-affinity ELISA. The present invention includes antigen-binding proteins that specifically bind to a CoV-S protein.
[0111] The terms antigen-binding portion or antigen-binding fragment of an antibody or antigen-binding protein, and the like, as used herein, include any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex. Non-limiting examples of antigen-binding fragments include: (i) Fab fragments; (ii) F(ab).sub.2 fragments; (iii) Fd fragments; (iv) Fv fragments; (v) single-chain Fv (scFv) molecules; (vi) dAb fragments; and (vii) minimal recognition units consisting of the amino acid residues that mimic the hypervariable region of an antibody (e.g., an isolated complementarity determining region (CDR) such as a CDR3 peptide), or a constrained FR3-CDR3-FR4 peptide. Other engineered molecules, such as domain-specific antibodies, single domain antibodies, domain-deleted antibodies, chimeric antibodies, CDR-grafted antibodies, diabodies, triabodies, tetrabodies, minibodies, nanobodies (e.g., as defined in WO08/020079 or WO09/138519) (e.g., monovalent nanobodies, bivalent nanobodies, etc.), small modular immunopharmaceuticals (SMIPs), and shark variable IgNAR domains, are also encompassed within the expression antigen-binding fragment, as used herein. In an embodiment of the invention, the antigen-binding fragment comprises three or more CDRs of an antibody of Table 1 (e.g., CDR-H1, CDR-H2 and CDR-H3; or CDR-L1, CDR-L2 and CDR-L3).
[0112] An antigen-binding fragment of an antibody will, in an embodiment of the invention, comprise at least one variable domain. The variable domain may be of any size or amino acid composition and will generally comprise at least one CDR, which is adjacent to or in frame with one or more framework sequences. In antigen-binding fragments having a V.sub.H domain associated with a V.sub.L domain, the V.sub.H and V.sub.L domains may be situated relative to one another in any suitable arrangement. For example, the variable region may be dimeric and contain V.sub.H-V.sub.H, V.sub.H-V.sub.L or V.sub.L-V.sub.L dimers. Alternatively, the antigen-binding fragment of an antibody may contain a monomeric V.sub.H or V.sub.L domain.
[0113] In certain embodiments, an antigen-binding fragment of an antibody may contain at least one variable domain covalently linked to at least one constant domain. Non-limiting, exemplary configurations of variable and constant domains that may be found within an antigen-binding fragment of an antibody of the present invention include: (i) V.sub.H-C.sub.H1; (ii) V.sub.H-C.sub.H2; (iii) V.sub.H-C.sub.H3; (iv) V.sub.H-C.sub.H1-C.sub.H2; (v) V.sub.H-C.sub.H1-C.sub.H2-C.sub.H3; (vi) V.sub.H-C.sub.H2-C.sub.H3; (vii) V.sub.H-C.sub.L; (viii) V.sub.L-C.sub.H1; (ix) V.sub.L-C.sub.H2; (x) V.sub.L-C.sub.H3; (xi) V.sub.L-C.sub.H1-C.sub.H2; (xii) V.sub.L-C.sub.H1-C.sub.H2-C.sub.H3; (xiii) V.sub.L-C.sub.H2-C.sub.H3; and (xiv) V.sub.L-C.sub.L. In any configuration of variable and constant domains, including any of the exemplary configurations listed above, the variable and constant domains may be either directly linked to one another or may be linked by a full or partial hinge or linker region. A hinge region may consist of at least 2 (e.g., 5, 10, 15, 20, 40, 60 or more) amino acids, which result in a flexible or semi-flexible linkage between adjacent variable and/or constant domains in a single polypeptide molecule. Moreover, an antigen-binding fragment of an antibody of the present invention may comprise a homo-dimer or hetero-dimer (or other multimer) of any of the variable and constant domain configurations listed above in non-covalent association with one another and/or with one or more monomeric V.sub.H or V.sub.L domain (e.g., by disulfide bond(s)).
[0114] Antigen-binding proteins (e.g., antibodies and antigen-binding fragments) may be mono-specific or multi-specific (e.g., bi-specific). Multispecific antigen-binding proteins are discussed further herein.
[0115] In specific embodiments, antibody or antibody fragments of the invention may be conjugated to a moiety such a ligand or a therapeutic moiety (immunoconjugate), such as an anti-viral drug, a second anti-influenza antibody, or any other therapeutic moiety useful for treating a viral infection, e.g., influenza viral infection. See below.
[0116] The present invention also provides a complex comprising an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment, discussed herein complexed with CoV-S polypeptide or an antigenic fragment thereof and/or with a secondary antibody or antigen-binding fragment thereof (e.g., detectably labeled secondary antibody) that binds specifically to the anti-CoV-S antibody or fragment. In an embodiment of the invention, the antibody or fragment is in vitro (e.g., is immobilized to a solid substrate) or is in the body of a subject. In an embodiment of the invention, the CoV-S is in vitro (e.g., is immobilized to a solid substrate) or is on the surface of a virus or is in the body of a subject. Immobilized anti-CoV-S antibodies and antigen-binding fragments thereof which are covalently linked to an insoluble matrix material (e.g., glass or polysaccharide such as agarose or sepharose, e.g., a bead or other particle thereof) are also part of the present invention; optionally, wherein the immobilized antibody is complexed with CoV-S or antigenic fragment thereof or a secondary antibody or fragment thereof.
[0117] Isolated antigen-binding proteins, antibodies or antigen-binding fragments thereof, polypeptides, polynucleotides and vectors, are at least partially free of other biological molecules from the cells or cell culture from which they are produced. Such biological molecules include nucleic acids, proteins, other antibodies or antigen-binding fragments, lipids, carbohydrates, or other material such as cellular debris and growth medium. An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof. Generally, the term isolated is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments.
[0118] The term epitope refers to an antigenic determinant (e.g., a CoV-S polypeptide) that interacts with a specific antigen-binding site of an antigen-binding protein, e.g., a variable region of an antibody molecule, known as a paratope. A single antigen may have more than one epitope. Thus, different antibodies may bind to different areas on an antigen and may have different biological effects. The term epitope also refers to a site on an antigen to which B and/or T cells respond. It also refers to a region of an antigen that is bound by an antibody. Epitopes may be defined as structural or functional. Functional epitopes are generally a subset of the structural epitopes and have those residues that directly contribute to the affinity of the interaction. Epitopes may be linear or conformational, that is, composed of non-linear amino acids. In certain embodiments, epitopes may include determinants that are chemically active surface groupings of molecules such as amino acids, sugar side chains, phosphoryl groups, or sulfonyl groups, and, in certain embodiments, may have specific three-dimensional structural characteristics, and/or specific charge characteristics.
[0119] Methods for determining the epitope of an antigen-binding protein, e.g., antibody or fragment or polypeptide, include alanine scanning mutational analysis, peptide blot analysis (Reineke (2004) Methods Mol. Biol. 248: 443-63), peptide cleavage analysis, crystallographic studies and NMR analysis. In addition, methods such as epitope excision, epitope extraction and chemical modification of antigens can be employed (Tomer (2000) Prot. Sci. 9: 487-496). Another method that can be used to identify the amino acids within a polypeptide with which an antigen-binding protein (e.g., antibody or fragment or polypeptide) (e.g., coversin) interacts is hydrogen/deuterium exchange detected by mass spectrometry. In general terms, the hydrogen/deuterium exchange method involves deuterium-labeling the protein of interest, followed by binding the antigen-binding protein, e.g., antibody or fragment or polypeptide, to the deuterium-labeled protein. Next, the CoV-S protein/antigen-binding protein complex is transferred to water and exchangeable protons within amino acids that are protected by the antibody complex undergo deuterium-to-hydrogen back-exchange at a slower rate than exchangeable protons within amino acids that are not part of the interface. As a result, amino acids that form part of the protein/antigen-binding protein interface may retain deuterium and therefore exhibit relatively higher mass compared to amino acids not included in the interface. After dissociation of the antigen-binding protein (e.g., antibody or fragment or polypeptide), the target protein is subjected to protease cleavage and mass spectrometry analysis, thereby revealing the deuterium-labeled residues which correspond to the specific amino acids with which the antigen-binding protein interacts. See, e.g., Ehring (1999) Analytical Biochemistry 267: 252-259; Engen and Smith (2001) Anal. Chem. 73: 256A-265A.
[0120] The term competes as used herein, refers to an antigen-binding protein (e.g., antibody or antigen-binding fragment thereof) that binds to an antigen (e.g., CoV-S) and inhibits or blocks the binding of another antigen-binding protein (e.g., antibody or antigen-binding fragment thereof) to the antigen. The term also includes competition between two antigen-binding proteins e.g., antibodies, in both orientations, i.e., a first antibody that binds and blocks binding of second antibody and vice versa. In certain embodiments, the first antigen-binding protein (e.g., antibody) and second antigen-binding protein (e.g., antibody) may bind to the same epitope. Alternatively, the first and second antigen-binding proteins (e.g., antibodies) may bind to different, but, for example, overlapping epitopes, wherein binding of one inhibits or blocks the binding of the second antibody, e.g., via steric hindrance. Competition between antigen-binding proteins (e.g., antibodies) may be measured by methods known in the art, for example, by a real-time, label-free bio-layer interferometry assay. Epitope mapping (e.g., via alanine scanning or hydrogen-deuterium exchange (HDX)) can be used to determine whether two or more antibodies are non-competing (e.g., on a spike protein receptor binding domain (RBD) monomer), competing for the same epitope, or competing but with diverse micro-epitopes (e.g., identified through HDX). In an embodiment of the invention, competition between a first and second anti-CoV-S antigen-binding protein (e.g., antibody) is determined by measuring the ability of an immobilized first anti-CoV-S antigen-binding protein (e.g., antibody) (not initially complexed with CoV-S protein) to bind to soluble CoV-S protein complexed with a second anti-CoV-S antigen-binding protein (e.g., antibody). A reduction in the ability of the first anti-CoV-S antigen-binding protein (e.g., antibody) to bind to the complexed CoV-S protein, relative to uncomplexed CoV-S protein, indicates that the first and second anti-CoV-S antigen-binding proteins (e.g., antibodies) compete. The degree of competition can be expressed as a percentage of the reduction in binding. Such competition can be measured using a real time, label-free bio-layer interferometry assay, e.g., on an Octet RED384 biosensor (Pall ForteBio Corp.), ELISA (enzyme-linked immunosorbent assays) or SPR (surface plasmon resonance).
[0121] Binding competition between anti-CoV-S antigen-binding proteins (e.g., monoclonal antibodies (mAbs)) can be determined using a real time, label-free bio-layer interferometry assay on an Octet RED384 biosensor (Pall ForteBio Corp.). For example, to determine competition between two anti-CoV-S monoclonal antibodies, the anti-CoV-S mAb can be first captured onto anti-hFc antibody coated Octet biosensor tips (Pall ForteBio Corp., #18-5060) by submerging the tips into a solution of anti-CoV-S mAb (subsequently referred to as mAb1). As a positive-control for blocking, the antibody captured biosensor tips can then be saturated with a known blocking isotype control mAb (subsequently referred to as blocking mAb) by dipping into a solution of blocking mAb. To determine if mAb2 competes with mAb1, the biosensor tips can then be subsequently dipped into a co-complexed solution of CoV-S polypeptide and a second anti-CoV-S mAb (subsequently referred to as mAb2), that had been pre-incubated for a period of time and binding of mAb1 to the CoV-S polypeptide can be determined. The biosensor tips can be washed in buffer in between every step of the experiment. The real-time binding response can be monitored during the course of the experiment and the binding response at the end of every step can be recorded.
[0122] For example, in an embodiment of the invention, the competition assay is conducted at 25 C. and pH about 7, e.g., 7.4, e.g., in the presence of buffer, salt, surfactant and a non-specific protein (e.g., bovine serum albumin).
[0123] Typically, an antibody or antigen-binding fragment of the invention which is modified in some way retains the ability to specifically bind to CoV-S, e.g., retains at least 10% of its CoV-S binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis. Preferably, an antibody or antigen-binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the CoV-S binding affinity as the parental antibody. It is also intended that an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as conservative variants or function conserved variants of the antibody) that do not substantially alter its biologic activity.
[0124] A variant of a polypeptide, such as an immunoglobulin chain (e.g., mAb8021 V.sub.H, V.sub.L, HC, or LC, mAb8028 V.sub.H, V.sub.L, HC, or LC, or mAb8029 V.sub.H, V.sub.L, HC, or LC), refers to a polypeptide comprising an amino acid sequence that is at least about 70-99.9% (e.g., 70, 72, 74, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.5, 99.9%) identical or similar to a referenced amino acid sequence that is set forth herein (e.g., SEQ ID NO: 2, 10, 18, 20, 22, 30, 38, 40, 42, 50, 58, or 60); when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment).
[0125] A variant of a polynucleotide refers to a polynucleotide comprising a nucleotide sequence that is at least about 70-99.9% (e.g., at least about 70, 72, 74, 75, 76, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.5, or 99.9%) identical to a referenced nucleotide sequence that is set forth herein (e.g., SEQ ID NO: 1, 9, 17, 19, 21, 29, 37, 39, 41, 49, 57, or 59); when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g., expect threshold: 10; word size: 28; max matches in a query range: 0; match/mismatch scores: 1, 2; gap costs: linear).
[0126] Anti-CoV-S antigen-binding proteins, e.g., antibodies and antigen-binding fragments thereof of the present invention, in an embodiment of the invention, include a heavy chain immunoglobulin variable region having at least 70% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater) amino acid sequence identity to the HCVR amino acid sequences set forth in Table 1; and/or a light chain immunoglobulin variable region having at least 70% (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater) amino acid sequence identity to the LCVR amino acid sequences set forth in Table 1.
[0127] In addition, a variant anti-CoV-S antigen-binding protein may include a polypeptide comprising an amino acid sequence that is set forth herein except for one or more (e.g., 1, 2, 3, 4, 6, 7, 8, 9 or 10) mutations such as, for example, missense mutations (e.g., conservative substitutions), non-sense mutations, deletions, or insertions. For example, the present invention includes antigen-binding proteins which include an immunoglobulin light chain variant comprising an LCVR amino acid sequence set forth in Table 1 but having one or more of such mutations and/or an immunoglobulin heavy chain variant comprising an HCVR amino acid sequence set forth in Table 1 but having one or more of such mutations. In an embodiment of the invention, a variant anti-CoV-S antigen-binding protein includes an immunoglobulin light chain variant comprising CDR-L1, CDR-L2 and CDR-L3 wherein one or more (e.g., 1 or 2 or 3) of such CDRs has one or more of such mutations (e.g., conservative substitutions) and/or an immunoglobulin heavy chain variant comprising CDR-H1, CDR-H2 and CDR-H3 wherein one or more (e.g., 1 or 2 or 3) of such CDRs has one or more of such mutations (e.g., conservative substitutions). Substitutions can be in a CDR, framework, or constant region.
[0128] The invention further provides variant anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments thereof, comprising one or more variant CDRs (e.g., any one or more of CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and/or CDR-H3) that are set forth herein with at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9% sequence identity or similarity to, e.g., the heavy chain and light chain CDRs of Table 1.
[0129] Embodiments of the present invention also include variant antigen-binding proteins, e.g., anti-CoV-S antibodies and antigen-binding fragments thereof, that comprise immunoglobulin V.sub.Hs and V.sub.Ls; or HCs and LCs, which comprise an amino acid sequence having 70% or more (e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or greater) overall amino acid sequence identity or similarity to the amino acid sequences of the corresponding V.sub.Hs, V.sub.Ls, HCs or LCs specifically set forth herein, but wherein the CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2 and CDR-H3 of such immunoglobulins are not variants and comprise CDR amino acid sequence set forth in Table 1. Thus, in such embodiments, the CDRs within variant antigen-binding proteins are not, themselves, variants.
[0130] Conservatively modified variant anti-CoV-S antibodies and antigen-binding fragments thereof are also part of the present invention. A conservatively modified variant or a conservative substitution refers to a variant wherein there is one or more substitutions of amino acids in a polypeptide with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.). Such changes can frequently be made without significantly disrupting the biological activity of the antibody or fragment. Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene, The Benjamin/Cummings Pub. Co., p. 224 (4.sup.th Ed.)). In addition, substitutions of structurally or functionally similar amino acids are less likely to significantly disrupt biological activity.
[0131] Examples of groups of amino acids that have side chains with similar chemical properties include 1) aliphatic side chains: glycine, alanine, valine, leucine and isoleucine; 2) aliphatic-hydroxyl side chains: serine and threonine; 3) amide-containing side chains: asparagine and glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and tryptophan; 5) basic side chains: lysine, arginine, and histidine; 6) acidic side chains: aspartate and glutamate, and 7) sulfur-containing side chains: cysteine and methionine. Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine-valine, glutamate-aspartate, and asparagine-glutamine. Alternatively, a conservative replacement is any change having a positive value in the PAM250 log-likelihood matrix disclosed in Gonnet et al. (1992) Science 256: 1443 45.
[0132] Function-conservative variants of the anti-CoV-S antibodies and antigen-binding fragments thereof are also part of the present invention. Any of the variants of the anti-CoV-S antibodies and antigen-binding fragments thereof (as discussed herein) may be function-conservative variants. Such function-conservative variants may, in some cases, also be characterized as conservatively modified variants. Function-conservative variants, as used herein, refers to variants of the anti-CoV-S antibodies or antigen-binding fragments thereof in which one or more amino acid residues have been changed without significantly altering one or more functional properties of the antibody or fragment. In an embodiment of the invention, a function-conservative variant anti-CoV-S antibody or antigen-binding fragment thereof of the present invention comprises a variant amino acid sequence and exhibits one or more of the following functional properties: [0133] Inhibits growth of coronavirus (e.g., SARS-CoV-2, SARS-CoV, and/or MERS-CoV) in ACE2- and/or TMPRSS2-expressing cells (e.g., Calu-3 cells); [0134] Does not significantly bind to MDCK/Tet-on cells which do not express ACE2 and/or TMPRSS2; [0135] Limits spread of coronavirus infection (e.g., by SARS-CoV-2, SARS-CoV, and/or MERS-CoV) of cells, e.g., Calu-3, in vitro; and/or [0136] Protects a mouse engineered to express the human TMPRSS2 and/or ACE2 protein from death caused by coronavirus infection (e.g., SARS-CoV-2, SARS-CoV, or MERS-CoV), for example, wherein the mice are infected with an otherwise lethal dose of the virus, optionally when combined with a second therapeutic agent. [0137] Protects a mouse engineered to express the human TMPRSS2 and/or ACE2 protein from weight loss caused by coronavirus infection (e.g., SARS-CoV-2, SARS-CoV, or MERS-CoV), for example, wherein the mice are infected with a dose of the virus that would otherwise cause weight loss, optionally when combined with a second therapeutic agent.
[0138] A neutralizing or antagonist anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment, refers to a molecule that inhibits an activity of CoV-S to any detectable degree, e.g., inhibits the ability of CoV-S to bind to a receptor such as ACE2, to be cleaved by a protease such as TMPRSS2, or to mediate viral entry into a host cell or viral reproduction in a host cell.
[0139] Table 1 refers to antigen-binding proteins, such as antibodies and antigen-binding fragments thereof, that comprise the heavy chain or V.sub.H (or a variant thereof) and light chain or V.sub.L (or a variant thereof) as set forth below; or that comprise a V.sub.H that comprises the CDRs thereof (CDR-H1 (or a variant thereof), CDR-H2 (or a variant thereof) and CDR-H3 (or a variant thereof)) and a V.sub.L that comprises the CDRs thereof (CDR-L1 (or a variant thereof), CDR-L2 (or a variant thereof) and CDR-L3 (or a variant thereof)), e.g., wherein the immunoglobulin chains, variable regions and/or CDRs comprise the specific amino acid sequences described below.
[0140] The antibodies described herein also include embodiments wherein the V.sub.H is fused to a wild-type IgG4 (e.g., wherein residue 108 is S) or to IgG4 variants (e.g., wherein residue 108 is P).
[0141] Antibodies and antigen-binding fragments of the present invention comprise immunoglobulin chains including the amino acid sequences set forth herein as well as cellular and in vitro post-translational modifications to the antibody. For example, the present invention includes antibodies and antigen-binding fragments thereof that specifically bind to CoV-S comprising heavy and/or light chain amino acid sequences set forth herein (e.g., CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and/or CDR-L3) as well as antibodies and fragments wherein one or more amino acid residues is glycosylated, one or more Asn residues is deamidated, one or more residues (e.g., Met, Trp and/or His) is oxidized, the N-terminal Gln is pyroglutamate (pyroE) and/or the C-terminal Lysine is missing.
[0142] The amino acid and nucleotide sequences of exemplary anti-SARS-CoV-2-Spike protein (SARS-CoV-2-S) antibodies are shown below:
TABLE-US-00001 Antibody Component Designation Part Sequence SEQIDNO mAb10933 AminoAcids HCVR QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYM 202 SWIRQAPGKGLEWVSYITYSGSTIYYADSVKGRF TISRDNAKSSLYLQMNSLRAEDTAVYYCARDRGT TMVPFDYWGQGTLVTVSS HCDR1 GFTFSDYY 204 HCDR2 ITYSGSTI 206 HCDR3 ARDRGTTMVPFDY 208 LCVR DIQMTQSPSSLSASVGDRVTITCQASQDITNYLN 210 WYQQKPGKAPKLLIYAASNLETGVPSRFSGSGSG TDFTFTISGLQPEDIATYYCQQYDNLPLTFGGGT KVEIK LCDR1 QDITNY 212 LCDR2 AAS 55 LCDR3 QQYDNLPLT 214 HC QVQLVESGGGLVKPGGSLRLSCAASGFTFSDYYM 216 SWIRQAPGKGLEWVSYITYSGSTIYYADSVKGRF TISRDNAKSSLYLQMNSLRAEDTAVYYCARDRGT TMVPFDYWGQGTLVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK LC DIQMTQSPSSLSASVGDRVTITCQASQDITNYLN 218 WYQQKPGKAPKLLIYAASNLETGVPSRFSGSGSG TDFTFTISGLQPEDIATYYCQQYDNLPLTFGGGT KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC NucleicAcids HCVR CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGG 201 TCAAGCCTGGAGGGTCCCTGAGACTCTCCTGTGC AGCCTCTGGATTCACCTTCAGTGACTACTACATG AGCTGGATCCGCCAGGCTCCAGGGAAGGGGCTGG AGTGGGTTTCATACATTACTTATAGTGGTAGTAC CATATACTACGCAGACTCTGTGAAGGGCCGATTC ACCATCTCCAGGGACAACGCCAAGAGCTCACTGT ATCTGCAAATGAACAGCCTGAGAGCCGAGGACAC GGCCGTGTATTACTGTGCGAGAGATCGCGGTACA ACTATGGTCCCCTTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA HCDR1 GGATTCACCTTCAGTGACTACTAC 203 HCDR2 ATTACTTATAGTGGTAGTACCATA 205 HCDR3 GCGAGAGATCGCGGTACAACTATGGTCCCCTTTG 207 ACTAC LCVR GACATCCAGATGACCCAGTCTCCATCCTCCCTGT 209 CTGCATCTGTAGGAGACAGAGTCACCATCACTTG CCAGGCGAGTCAGGACATTACCAACTATTTAAAT TGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGC TCCTGATCTACGCTGCATCCAATTTGGAAACAGG GGTCCCATCAAGGTTCAGTGGAAGTGGATCTGGG ACAGATTTTACTTTCACCATCAGCGGCCTGCAGC CTGAAGATATTGCAACATATTACTGTCAACAGTA TGATAATCTCCCTCTCACTTTCGGCGGAGGGACC AAGGTGGAGATCAAA LCDR1 CAGGACATTACCAACTAT 211 LCDR2 GCTGCATCC 54 LCDR3 CAACAGTATGATAATCTCCCTCTCACT 213 HC CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGG 215 TCAAGCCTGGAGGGTCCCTGAGACTCTCCTGTGC AGCCTCTGGATTCACCTTCAGTGACTACTACATG AGCTGGATCCGCCAGGCTCCAGGGAAGGGGCTGG AGTGGGTTTCATACATTACTTATAGTGGTAGTAC CATATACTACGCAGACTCTGTGAAGGGCCGATTC ACCATCTCCAGGGACAACGCCAAGAGCTCACTGT ATCTGCAAATGAACAGCCTGAGAGCCGAGGACAC GGCCGTGTATTACTGTGCGAGAGATCGCGGTACA ACTATGGTCCCCTTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCAGCCTCCACCAAGGG CCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAG AGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCC TGGTCAAGGACTACTTCCCCGAACCGGTGACGGT GTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTG CACACCTTCCCGGCTGTCCTACAGTCCTCAGGAC TCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTC CAGCAGCTTGGGCACCCAGACCTACATCTGCAAC GTGAATCACAAGCCCAGCAACACCAAGGTGGACA AGAAAGTTGAGCCCAAATCTTGTGACAAAACTCA CACATGCCCACCGTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAAC CCAAGGACACCCTCATGATCTCCCGGACCCCTGA GGTCACATGCGTGGTGGTGGACGTGAGCCACGAA GACCCTGAGGTCAAGTTCAACTGGTACGTGGACG GCGTGGAGGTGCATAATGCCAAGACAAAGCCGCG GGAGGAGCAGTACAACAGCACGTACCGTGTGGTC AGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAA AGCCCTCCCAGCCCCCATCGAGAAAACCATCTCC AAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGT ACACCCTGCCCCCATCCCGGGATGAGCTGACCAA GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGC TTCTATCCCAGCGACATCGCCGTGGAGTGGGAGA GCAATGGGCAGCCGGAGAACAACTACAAGACCAC GCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTC CTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACGCAGAAG TCCCTCTCCCTGTCTCCGGGTAAATGA LC GACATCCAGATGACCCAGTCTCCATCCTCCCTGT 217 CTGCATCTGTAGGAGACAGAGTCACCATCACTTG CCAGGCGAGTCAGGACATTACCAACTATTTAAAT TGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGC TCCTGATCTACGCTGCATCCAATTTGGAAACAGG GGTCCCATCAAGGTTCAGTGGAAGTGGATCTGGG ACAGATTTTACTTTCACCATCAGCGGCCTGCAGC CTGAAGATATTGCAACATATTACTGTCAACAGTA TGATAATCTCCCTCTCACTTTCGGCGGAGGGACC AAGGTGGAGATCAAACGAACTGTGGCTGCACCAT CTGTCTTCATCTTCCCGCCATCTGATGAGCAGTT GAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGT GGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC AGCACCTACAGCCTCAGCAGCACCCTGACGCTGA GCAAAGCAGACTACGAGAAACACAAAGTCTACGC CTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCC GTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG mAb10934 AminoAcids HCVR EVQLVESGGGLVKPGGSLRLSCAASGITFSNAWM 220 SWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKG RFTISRDDSKNTLYLQMNSLKTEDTAVYYCTTAR WDWYFDLWGRGTLVTVSS HCDR1 GITFSNAW 222 HCDR2 IKSKTDGGTT 224 HCDR3 TTARWDWYFDL 226 LCVR DIQMTQSPSSLSASVGDRVTITCQASQDIWNYIN 228 WYQQKPGKAPKLLIYDASNLKTGVPSRFSGSGSG TDFTFTISSLQPEDIATYYCQQHDDLPPTFGQGT KVEIK LCDR1 QDIWNY 230 LCDR2 DAS 194 LCDR3 QQHDDLPPT 232 HC EVQLVESGGGLVKPGGSLRLSCAASGITFSNAWM 234 SWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKG RFTISRDDSKNTLYLQMNSLKTEDTAVYYCTTAR WDWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK LC DIQMTQSPSSLSASVGDRVTITCQASQDIWNYIN 236 WYQQKPGKAPKLLIYDASNLKTGVPSRFSGSGSG TDFTFTISSLQPEDIATYYCQQHDDLPPTFGQGT KVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL NNFYPREAKVQWKVDNALQSGNSQESVTEQDSKD STYSLSSTLTLSKADYEKHKVYACEVTHQGLSSP VTKSFNRGEC NucleicAcids HCVR GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGG 219 TAAAGCCTGGGGGGTCCCTTAGACTCTCCTGTGC AGCCTCTGGAATCACTTTCAGTAACGCCTGGATG AGTTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGG AGTGGGTTGGCCGTATTAAAAGCAAAACTGATGG TGGGACAACAGACTACGCCGCACCCGTGAAAGGC AGATTCACCATCTCAAGAGATGATTCAAAAAACA CGCTGTATCTACAAATGAACAGCCTGAAAACCGA GGACACAGCCGTGTATTACTGTACCACAGCGAGG TGGGACTGGTACTTCGATCTCTGGGGCCGTGGCA CCCTGGTCACTGTCTCCTCA HCDR1 GGAATCACTTTCAGTAACGCCTGG 221 HCDR2 ATTAAAAGCAAAACTGATGGTGGGACAACA 223 HCDR3 ACCACAGCGAGGTGGGACTGGTACTTCGATCTC 225 LCVR GACATCCAGATGACCCAGTCTCCATCCTCCCTGT 227 CTGCATCTGTAGGAGACAGAGTCACCATCACTTG CCAGGCGAGTCAGGACATTTGGAATTATATAAAT TGGTATCAGCAGAAACCAGGGAAGGCCCCTAAGC TCCTGATCTACGATGCATCCAATTTGAAAACAGG GGTCCCATCAAGGTTCAGTGGAAGTGGATCTGGG ACAGATTTTACTTTCACCATCAGCAGCCTGCAGC CTGAAGATATTGCAACATATTACTGTCAACAGCA TGATGATCTCCCTCCGACCTTCGGCCAAGGGACC AAGGTGGAAATCAAA LCDR1 CAGGACATTTGGAATTAT 229 LCDR2 GATGCATCC 193 LCDR3 CAACAGCATGATGATCTCCCTCCGACC 231 HC GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGG 233 TAAAGCCTGGGGGGTCCCTTAGACTCTCCTGTGC AGCCTCTGGAATCACTTTCAGTAACGCCTGGATG AGTTGGGTCCGCCAGGCTCCAGGGAAGGGGCTGG AGTGGGTTGGCCGTATTAAAAGCAAAACTGATGG TGGGACAACAGACTACGCCGCACCCGTGAAAGGC AGATTCACCATCTCAAGAGATGATTCAAAAAACA CGCTGTATCTACAAATGAACAGCCTGAAAACCGA GGACACAGCCGTGTATTACTGTACCACAGCGAGG TGGGACTGGTACTTCGATCTCTGGGGCCGTGGCA CCCTGGTCACTGTCTCCTCAGCCTCCACCAAGGG CCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAG AGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCC TGGTCAAGGACTACTTCCCCGAACCGGTGACGGT GTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTG CACACCTTCCCGGCTGTCCTACAGTCCTCAGGAC TCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTC CAGCAGCTTGGGCACCCAGACCTACATCTGCAAC GTGAATCACAAGCCCAGCAACACCAAGGTGGACA AGAAAGTTGAGCCCAAATCTTGTGACAAAACTCA CACATGCCCACCGTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAAC CCAAGGACACCCTCATGATCTCCCGGACCCCTGA GGTCACATGCGTGGTGGTGGACGTGAGCCACGAA GACCCTGAGGTCAAGTTCAACTGGTACGTGGACG GCGTGGAGGTGCATAATGCCAAGACAAAGCCGCG GGAGGAGCAGTACAACAGCACGTACCGTGTGGTC AGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAA AGCCCTCCCAGCCCCCATCGAGAAAACCATCTCC AAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGT ACACCCTGCCCCCATCCCGGGATGAGCTGACCAA GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGC TTCTATCCCAGCGACATCGCCGTGGAGTGGGAGA GCAATGGGCAGCCGGAGAACAACTACAAGACCAC GCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTC CTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACGCAGAAG TCCCTCTCCCTGTCTCCGGGTAAATGA LC GACATCCAGATGACCCAGTCTCCATCCTCCCTGT 235 CTGCATCTGTAGGAGACAGAGTCACCATCACTTG CCAGGCGAGTCAGGACATTTGGAATTATATAAAT TGGTATCAGCAGAAACCAGGGAAGGCCCCTAAGC TCCTGATCTACGATGCATCCAATTTGAAAACAGG GGTCCCATCAAGGTTCAGTGGAAGTGGATCTGGG ACAGATTTTACTTTCACCATCAGCAGCCTGCAGC CTGAAGATATTGCAACATATTACTGTCAACAGCA TGATGATCTCCCTCCGACCTTCGGCCAAGGGACC AAGGTGGAAATCAAACGAACTGTGGCTGCACCAT CTGTCTTCATCTTCCCGCCATCTGATGAGCAGTT GAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTG AATAACTTCTATCCCAGAGAGGCCAAAGTACAGT GGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGAC AGCACCTACAGCCTCAGCAGCACCCTGACGCTGA GCAAAGCAGACTACGAGAAACACAAAGTCTACGC CTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCC GTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG mAb10987 AminoAcids HCVR QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAM 640 YWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRF TISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDY GDYLLVYWGQGTLVTVSS HCDR1 GFTFSNYA 642 HCDR2 ISYDGSNK 499 HCDR3 ASGSDYGDYLLVY 644 LCVR QSALTQPASVSGSPGQSITISCTGTSSDVGGYNY 646 VSWYQQHPGKAPKLMIYDVSKRPSGVSNRFSGSK SGNTASLTISGLQSEDEADYYCNSLTSISTWVFG GGTKLTVL LCDR1 SSDVGGYNY 648 LCDR2 DVS 650 LCDR3 NSLTSISTWV 652 HC QVQLVESGGGVVQPGRSLRLSCAASGFTFSNYAM 654 YWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRF TISRDNSKNTLYLQMNSLRTEDTAVYYCASGSDY GDYLLVYWGQGTLVTVSSASTKGPSVFPLAPSSK STSGGTAALGCLVKDYFPEPVTVSWNSGALTSGV HTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICN VNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK LC QSALTQPASVSGSPGQSITISCTGTSSDVGGYNY 656 VSWYQQHPGKAPKLMIYDVSKRPSGVSNRFSGSK SGNTASLTISGLQSEDEADYYCNSLTSISTWVFG GGTKLTVLGQPKAAPSVTLFPPSSEELQANKATL VCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS NucleicAcids HCVR CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGG 639 TCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGC AGCCTCTGGATTCACCTTCAGTAACTATGCTATG TACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGG AGTGGGTGGCAGTTATATCATATGATGGAAGTAA TAAATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCAGAGACAATTCCAAGAACACGCTGT ATCTGCAAATGAACAGCCTGAGAACTGAGGACAC GGCTGTGTATTACTGTGCGAGTGGCTCCGACTAC GGTGACTACTTATTGGTTTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA HCDR1 GGATTCACCTTCAGTAACTATGCT 641 HCDR2 ATATCATATGATGGAAGTAATAAA 498 HCDR3 GCGAGTGGCTCCGACTACGGTGACTACTTATTGG 643 TTTAC LCVR CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTG 645 GGTCTCCTGGACAGTCGATCACCATCTCCTGCAC TGGAACCAGCAGTGACGTTGGTGGTTATAACTAT GTCTCCTGGTACCAACAACACCCAGGCAAAGCCC CCAAACTCATGATTTATGATGTCAGTAAGCGGCC CTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAG TCTGGCAACACGGCCTCCCTGACCATCTCTGGGC TCCAGTCTGAGGACGAGGCTGATTATTACTGCAA CTCTTTGACAAGCATCAGCACTTGGGTGTTCGGC GGAGGGACCAAGCTGACCGTCCTA LCDR1 AGCAGTGACGTTGGTGGTTATAACTAT 647 LCDR2 GATGTCAGT 649 LCDR3 AACTCTTTGACAAGCATCAGCACTTGGGTG 651 HC CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGG 653 TCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGC AGCCTCTGGATTCACCTTCAGTAACTATGCTATG TACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGG AGTGGGTGGCAGTTATATCATATGATGGAAGTAA TAAATACTATGCAGACTCCGTGAAGGGCCGATTC ACCATCTCCAGAGACAATTCCAAGAACACGCTGT ATCTGCAAATGAACAGCCTGAGAACTGAGGACAC GGCTGTGTATTACTGTGCGAGTGGCTCCGACTAC GGTGACTACTTATTGGTTTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCAGCCTCCACCAAGGG CCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAG AGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCC TGGTCAAGGACTACTTCCCCGAACCGGTGACGGT GTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTG CACACCTTCCCGGCTGTCCTACAGTCCTCAGGAC TCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTC CAGCAGCTTGGGCACCCAGACCTACATCTGCAAC GTGAATCACAAGCCCAGCAACACCAAGGTGGACA AGAAAGTTGAGCCCAAATCTTGTGACAAAACTCA CACATGCCCACCGTGCCCAGCACCTGAACTCCTG GGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAAC CCAAGGACACCCTCATGATCTCCCGGACCCCTGA GGTCACATGCGTGGTGGTGGACGTGAGCCACGAA GACCCTGAGGTCAAGTTCAACTGGTACGTGGACG GCGTGGAGGTGCATAATGCCAAGACAAAGCCGCG GGAGGAGCAGTACAACAGCACGTACCGTGTGGTC AGCGTCCTCACCGTCCTGCACCAGGACTGGCTGA ATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAA AGCCCTCCCAGCCCCCATCGAGAAAACCATCTCC AAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGT ACACCCTGCCCCCATCCCGGGATGAGCTGACCAA GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGC TTCTATCCCAGCGACATCGCCGTGGAGTGGGAGA GCAATGGGCAGCCGGAGAACAACTACAAGACCAC GCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTC CTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACGCAGAAG TCCCTCTCCCTGTCTCCGGGTAAATGA LC CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTG 655 GGTCTCCTGGACAGTCGATCACCATCTCCTGCAC TGGAACCAGCAGTGACGTTGGTGGTTATAACTAT GTCTCCTGGTACCAACAACACCCAGGCAAAGCCC CCAAACTCATGATTTATGATGTCAGTAAGCGGCC CTCAGGGGTTTCTAATCGCTTCTCTGGCTCCAAG TCTGGCAACACGGCCTCCCTGACCATCTCTGGGC TCCAGTCTGAGGACGAGGCTGATTATTACTGCAA CTCTTTGACAAGCATCAGCACTTGGGTGTTCGGC GGAGGGACCAAGCTGACCGTCCTAGGCCAGCCCA AGGCCGCCCCCTCCGTGACCCTGTTCCCCCCCTC CTCCGAGGAGCTGCAGGCCAACAAGGCCACCCTG GTGTGCCTGATCTCCGACTTCTACCCCGGCGCCG TGACCGTGGCCTGGAAGGCCGACTCCTCCCCCGT GAAGGCCGGCGTGGAGACCACCACCCCCTCCAAG CAGTCCAACAACAAGTACGCCGCCTCCTCCTACC TGTCCCTGACCCCCGAGCAGTGGAAGTCCCACCG GTCCTACTCCTGCCAGGTGACCCACGAGGGCTCC ACCGTGGAGAAGACCGTGGCCCCCACCGAGTGCT CCTGA mAb10989 AminoAcids HCVR QVQLVQSGAEVKKPGASVKVSCKASGYIFTGYYM 678 HWVRQAPGQGLEWMGWINPNSGGANYAQKFQGRV TLTRDTSITTVYMELSRLRFDDTAVYYCARGSRY DWNQNNWFDPWGQGTLVTVSS HCDR1 GYIFTGYY 680 HCDR2 INPNSGGA 682 HCDR3 ARGSRYDWNQNNWFDP 684 LCVR QSALTQPASVSGSPGQSITISCTGTSSDVGTYNY 686 VSWYQQHPGKAPKLMIFDVSNRPSGVSDRFSGSK SGNTASLTISGLQAEDEADYYCSSFTTSSTVVFG GGTKLTVL LCDR1 SSDVGTYNY 688 LCDR2 DVS 650 LCDR3 SSFTTSSTVV 690 HC QVQLVQSGAEVKKPGASVKVSCKASGYIFTGYYM 692 HWVRQAPGQGLEWMGWINPNSGGANYAQKFQGRV TLTRDTSITTVYMELSRLRFDDTAVYYCARGSRY DWNQNNWFDPWGQGTLVTVSSASTKGPSVFPLAP SSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT SGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTY ICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHY TQKSLSLSPGK LC QSALTQPASVSGSPGQSITISCTGTSSDVGTYNY 694 VSWYQQHPGKAPKLMIFDVSNRPSGVSDRFSGSK SGNTASLTISGLQAEDEADYYCSSFTTSSTVVFG GGTKLTVLGQPKAAPSVTLFPPSSEELQANKATL VCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGS TVEKTVAPTECS NucleicAcids HCVR CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGA 677 AGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAA GGCTTCTGGATACATCTTCACCGGCTACTATATG CACTGGGTGCGACAGGCCCCTGGACAGGGGCTTG AGTGGATGGGATGGATCAACCCTAACAGTGGTGG CGCAAACTATGCACAGAAGTTTCAGGGCAGGGTC ACCCTGACCAGGGACACGTCCATCACCACAGTCT ACATGGAACTGAGCAGGCTGAGATTTGACGACAC GGCCGTGTATTACTGTGCGAGAGGATCCCGGTAT GACTGGAACCAGAACAACTGGTTCGACCCCTGGG GCCAGGGAACCCTGGTCACCGTCTCCTCA HCDR1 GGATACATCTTCACCGGCTACTAT 679 HCDR2 ATCAACCCTAACAGTGGTGGCGCA 681 HCDR3 GCGAGAGGATCCCGGTATGACTGGAACCAGAACA 683 ACTGGTTCGACCCC LCVR CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTG 685 GGTCTCCTGGACAGTCGATCACCATCTCCTGCAC TGGAACCAGCAGTGACGTTGGTACTTATAACTAT GTCTCCTGGTACCAACAACACCCAGGCAAAGCCC CCAAACTCATGATTTTTGATGTCAGTAATCGGCC CTCAGGGGTTTCTGATCGCTTCTCTGGCTCCAAG TCTGGCAACACGGCCTCCCTGACCATCTCTGGGC TCCAGGCTGAGGACGAGGCTGATTATTACTGCAG CTCATTTACAACCAGCAGCACTGTGGTTTTCGGC GGAGGGACCAAGCTGACCGTCCTA LCDR1 AGCAGTGACGTTGGTACTTATAACTAT 687 LCDR2 GATGTCAGT 649 LCDR3 AGCTCATTTACAACCAGCAGCACTGTGGTT 689 HC CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGA 691 AGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAA GGCTTCTGGATACATCTTCACCGGCTACTATATG CACTGGGTGCGACAGGCCCCTGGACAGGGGCTTG AGTGGATGGGATGGATCAACCCTAACAGTGGTGG CGCAAACTATGCACAGAAGTTTCAGGGCAGGGTC ACCCTGACCAGGGACACGTCCATCACCACAGTCT ACATGGAACTGAGCAGGCTGAGATTTGACGACAC GGCCGTGTATTACTGTGCGAGAGGATCCCGGTAT GACTGGAACCAGAACAACTGGTTCGACCCCTGGG GCCAGGGAACCCTGGTCACCGTCTCCTCAGCCTC CACCAAGGGCCCATCGGTCTTCCCCCTGGCACCC TCCTCCAAGAGCACCTCTGGGGGCACAGCGGCCC TGGGCTGCCTGGTCAAGGACTACTTCCCCGAACC GGTGACGGTGTCGTGGAACTCAGGCGCCCTGACC AGCGGCGTGCACACCTTCCCGGCTGTCCTACAGT CCTCAGGACTCTACTCCCTCAGCAGCGTGGTGAC CGTGCCCTCCAGCAGCTTGGGCACCCAGACCTAC ATCTGCAACGTGAATCACAAGCCCAGCAACACCA AGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGA CAAAACTCACACATGCCCACCGTGCCCAGCACCT GAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCC CCCCAAAACCCAAGGACACCCTCATGATCTCCCG GACCCCTGAGGTCACATGCGTGGTGGTGGACGTG AGCCACGAAGACCCTGAGGTCAAGTTCAACTGGT ACGTGGACGGCGTGGAGGTGCATAATGCCAAGAC AAAGCCGCGGGAGGAGCAGTACAACAGCACGTAC CGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGG ACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGT CTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAA ACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAAC CACAGGTGTACACCCTGCCCCCATCCCGGGATGA GCTGACCAAGAACCAGGTCAGCCTGACCTGCCTG GTCAAAGGCTTCTATCCCAGCGACATCGCCGTGG AGTGGGAGAGCAATGGGCAGCCGGAGAACAACTA CAAGACCACGCCTCCCGTGCTGGACTCCGACGGC TCCTTCTTCCTCTACAGCAAGCTCACCGTGGACA AGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATG CTCCGTGATGCATGAGGCTCTGCACAACCACTAC ACGCAGAAGTCCCTCTCCCTGTCTCCGGGTAAAT GA LC CAGTCTGCCCTGACTCAGCCTGCCTCCGTGTCTG 693 GGTCTCCTGGACAGTCGATCACCATCTCCTGCAC TGGAACCAGCAGTGACGTTGGTACTTATAACTAT GTCTCCTGGTACCAACAACACCCAGGCAAAGCCC CCAAACTCATGATTTTTGATGTCAGTAATCGGCC CTCAGGGGTTTCTGATCGCTTCTCTGGCTCCAAG TCTGGCAACACGGCCTCCCTGACCATCTCTGGGC TCCAGGCTGAGGACGAGGCTGATTATTACTGCAG CTCATTTACAACCAGCAGCACTGTGGTTTTCGGC GGAGGGACCAAGCTGACCGTCCTAGGCCAGCCCA AGGCCGCCCCCTCCGTGACCCTGTTCCCCCCCTC CTCCGAGGAGCTGCAGGCCAACAAGGCCACCCTG GTGTGCCTGATCTCCGACTTCTACCCCGGCGCCG TGACCGTGGCCTGGAAGGCCGACTCCTCCCCCGT GAAGGCCGGCGTGGAGACCACCACCCCCTCCAAG CAGTCCAACAACAAGTACGCCGCCTCCTCCTACC TGTCCCTGACCCCCGAGCAGTGGAAGTCCCACCG GTCCTACTCCTGCCAGGTGACCCACGAGGGCTCC ACCGTGGAGAAGACCGTGGCCCCCACCGAGTGCT CCTGA
Administration of Antibodies
[0143] The present invention provides methods for administering an anti-CoV-S antigen-binding protein of the present invention, e.g., those of Table 1, comprising introducing the antigen-binding protein into the body of a subject (e.g., a human). For example, the method comprises piercing the body of the subject with a needle of a syringe and injecting the antigen-binding protein into the body of the subject, e.g., into the vein, artery, tumor, muscular tissue or subcutis of the subject.
[0144] The present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising an anti-CoV-S antigen-binding protein of the present invention, e.g., those of Table 1.
[0145] The present invention also provides an injection device comprising one or more antigen-binding proteins (e.g., antibody or antigen-binding fragment) that bind specifically to CoV-S, e.g., those of Table 1, or a pharmaceutical composition thereof. The injection device may be packaged into a kit. An injection device is a device that introduces a substance into the body of a subject via a parenteral route, e.g., intramuscular, subcutaneous or intravenous. For example, an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., comprising the antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore. In an embodiment of the invention, an injection device that comprises an antigen-binding protein, e.g., an antibody or antigen-binding fragment thereof, from a combination of the present invention, or a pharmaceutical composition thereof is an intravenous (IV) injection device. Such a device can include the antigen-binding protein or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline) introduced into the body of the subject through the cannula or trocar/needle. The antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula. The IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line). In an embodiment of the invention, an injection device is an autoinjector; a jet injector or an external infusion pump. A jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a subject's body. External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a subject's body in controlled amounts. External infusion pumps may be powered electrically or mechanically. Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery. In a peristaltic pump, a set of rollers pinches down on a length of flexible tubing, pushing fluid forward. In a multi-channel pump, fluids can be delivered from multiple reservoirs at multiple rates.
Preparation of Human Antibodies
[0146] Methods for generating human antibodies in transgenic mice are known in the art. Any such known methods can be used in the context of the present invention to make human antibodies that specifically bind to CoV-S. An immunogen comprising any one of the following can be used to generate antibodies to CoV-S. In certain embodiments of the invention, the antibodies of the invention are obtained from mice immunized with a full length, native CoV-S, or with a live attenuated or inactivated virus, or with DNA encoding the protein or fragment thereof. Alternatively, the CoV-S protein or a fragment thereof may be produced using standard biochemical techniques and modified and used as immunogen. In one embodiment of the invention, the immunogen is a recombinantly produced CoV-S protein or fragment thereof. In certain embodiments of the invention, the immunogen may be a CoV-S polypeptide vaccine. In certain embodiments, one or more booster injections may be administered. In certain embodiments, the immunogen may be a recombinant CoV-S polypeptide expressed in E. coli or in any other eukaryotic or mammalian cells such as Chinese hamster ovary (CHO) cells.
[0147] Using VELOCIMMUNE technology (see, for example, U.S. Pat. No. 6,596,541, Regeneron Pharmaceuticals, VELOCIMMUNE) or any other known method for generating monoclonal antibodies, high affinity chimeric antibodies to CoV-S can be initially isolated having a human variable region and a mouse constant region. The VELOCIMMUNE technology involves generation of a transgenic mouse having a genome comprising human heavy and light chain variable regions operably linked to endogenous mouse constant region loci such that the mouse produces an antibody comprising a human variable region and a mouse constant region in response to antigenic stimulation. The DNA encoding the variable regions of the heavy and light chains of the antibody are isolated and operably linked to DNA encoding the human heavy and light chain constant regions. The DNA is then expressed in a cell capable of expressing the fully human antibody.
[0148] Generally, a VELOCIMMUNE mouse is challenged with the antigen of interest, and lymphatic cells (such as B-cells) are recovered from the mice that express antibodies. The lymphatic cells may be fused with a myeloma cell line to prepare immortal hybridoma cell lines, and such hybridoma cell lines are screened and selected to identify hybridoma cell lines that produce antibodies specific to the antigen of interest. DNA encoding the variable regions of the heavy chain and light chain may be isolated and linked to desirable isotypic constant regions of the heavy chain and light chain. Such an antibody protein may be produced in a cell, such as a CHO cell. Alternatively, DNA encoding the antigen-specific chimeric antibodies or the variable domains of the light and heavy chains may be isolated directly from antigen-specific lymphocytes.
[0149] Initially, high affinity chimeric antibodies are isolated having a human variable region and a mouse constant region. As in the experimental section below, the antibodies are characterized and selected for desirable characteristics, including affinity, selectivity, epitope, etc. The mouse constant regions are replaced with a desired human constant region to generate the fully human antibody of the invention, for example wild-type or modified IgG1 or IgG4. While the constant region selected may vary according to specific use, high affinity antigen-binding and target specificity characteristics reside in the variable region.
Anti-Coronavirus Spike Protein Antibodies Comprising Fc Variants
[0150] According to certain embodiments of the present invention, anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments, are provided comprising an Fc domain comprising one or more mutations, which, for example, enhance or diminish antibody binding to the FcRn receptor, e.g., at acidic pH as compared to neutral pH. For example, the present invention includes anti-CoV-S antibodies comprising a mutation in the C.sub.H2 or a C.sub.H3 region of the Fc domain, wherein the mutation(s) increases the affinity of the Fc domain to FcRn in an acidic environment (e.g., in an endosome where pH ranges from about 5.5 to about 6.0). Such mutations may result in an increase in serum half-life of the antibody when administered to an animal. Non-limiting examples of such Fc modifications include, e.g., a modification at position 250 (e.g., E or Q); 250 and 428 (e.g., L or F); 252 (e.g., L/Y/F/W or T), 254 (e.g., S or T), and 256 (e.g., S/R/Q/E/D or T); or a modification at position 428 and/or 433 (e.g., H/L/R/S/P/Q or K) and/or 434 (e.g., A, W, H, F or Y [N434A, N434W, N434H, N434F or N434Y]); or a modification at position 250 and/or 428; or a modification at position 307 or 308 (e.g., 308F, V308F), and 434. In one embodiment, the modification comprises a 428L (e.g., M428L) and 434S (e.g., N434S) modification; a 428L, 259I (e.g., V259I), and 308F (e.g., V308F) modification; a 433K (e.g., H433K) and a 434 (e.g., 434Y) modification; a 252, 254, and 256 (e.g., 252Y, 254T, and 256E) modification; a 250Q and 428L modification (e.g., T250Q and M428L); and a 307 and/or 308 modification (e.g., 308F or 308P). In yet another embodiment, the modification comprises a 265A (e.g., D265A) and/or a 297A (e.g., N297A) modification.
[0151] For example, the present invention includes anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments, comprising an Fc domain comprising one or more pairs or groups of mutations selected from the group consisting of: 250Q and 248L (e.g., T250Q and M248L); 252Y, 254T and 256E (e.g., M252Y, S254T and T256E); 428L and 434S (e.g., M428L and N434S); 257I and 311I (e.g., P257I and Q311I); 257I and 434H (e.g., P257I and N434H); 376V and 434H (e.g., D376V and N434H); 307A, 380A and 434A (e.g., T307A, E380A and N434A); and 433K and 434F (e.g., H433K and N434F).
[0152] Anti-CoV-S antigen-binding proteins, e.g., antibodies and antigen-binding fragments thereof, that comprise a V.sub.H and/or V.sub.L as set forth herein comprising any possible combinations of the foregoing Fc domain mutations, are contemplated within the scope of the present invention.
[0153] The present invention also includes anti-CoV-S antigen-binding proteins, antibodies or antigen-binding fragments, comprising a V.sub.H set forth herein and a chimeric heavy chain constant (C.sub.H) region, wherein the chimeric C.sub.H region comprises segments derived from the C.sub.H regions of more than one immunoglobulin isotype. For example, the antibodies of the invention may comprise a chimeric C.sub.H region comprising part or all of a C.sub.H2 domain derived from a human IgG1, human IgG2 or human IgG4 molecule, combined with part or all of a C.sub.H3 domain derived from a human IgG1, human IgG2 or human IgG4 molecule. According to certain embodiments, the antibodies of the invention comprise a chimeric C.sub.H region having a chimeric hinge region. For example, a chimeric hinge may comprise an upper hinge amino acid sequence (amino acid residues from positions 216 to 227 according to EU numbering) derived from a human IgG1, a human IgG2 or a human IgG4 hinge region, combined with a lower hinge sequence (amino acid residues from positions 228 to 236 according to EU numbering) derived from a human IgG1, a human IgG2 or a human IgG4 hinge region. According to certain embodiments, the chimeric hinge region comprises amino acid residues derived from a human IgG1 or a human IgG4 upper hinge and amino acid residues derived from a human IgG2 lower hinge. An antibody comprising a chimeric C.sub.H region as described herein may, in certain embodiments, exhibit modified Fc effector functions without adversely affecting the therapeutic or pharmacokinetic properties of the antibody. (See, e.g., WO2014/022540).
Immunoconjugates
[0154] The invention encompasses an anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments, conjugated to another moiety, e.g., a therapeutic moiety (an immunoconjugate), such as a toxoid or an anti-viral drug to treat influenza virus infection. In an embodiment of the invention, an anti-CoV-S antibody or fragment is conjugated to any of the further therapeutic agents set forth herein. As used herein, the term immunoconjugate refers to an antigen-binding protein, e.g., an antibody or antigen-binding fragment, which is chemically or biologically linked to a radioactive agent, a cytokine, an interferon, a target or reporter moiety, an enzyme, a peptide or protein or a therapeutic agent. The antigen-binding protein may be linked to the radioactive agent, cytokine, interferon, target or reporter moiety, enzyme, peptide or therapeutic agent at any location along the molecule so long as it is able to bind its target (CoV-S). Examples of immunoconjugates include antibody-drug conjugates and antibody-toxin fusion proteins. In one embodiment of the invention, the agent may be a second, different antibody that binds specifically to CoV-S. The type of therapeutic moiety that may be conjugated to the anti-CoV-S antigen-binding protein (e.g., antibody or fragment) will take into account the condition to be treated and the desired therapeutic effect to be achieved. See, e.g., Arnon et al., Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy, Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Hellstrom et al., Antibodies For Drug Delivery, Controlled Drug Delivery (2.sup.nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review, Monoclonal Antibodies 1984: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy, Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates, Immunol. Rev., 62: 119-58 (1982).
Multi-Specific Antibodies
[0155] The present invention includes anti-CoV-S antigen-binding proteins, e.g., antibodies and antigen-binding fragments thereof, as well as methods of use thereof and methods of making such antigen-binding proteins. The term anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments, includes multispecific (e.g., bispecific or biparatopic) molecules that include at least one first antigen-binding domain that specifically binds to CoV-S (e.g., an antigen-binding domain from an antibody of Table 1) and at least one second antigen-binding domain that binds to a different antigen or to an epitope in CoV-S which is different from that of the first antigen-binding domain. In some embodiments, the first antigen-binding domain and the second antigen-binding domain are both selected from the antigen-binding domains of Table 1. In an embodiment of the invention, the first and second epitopes overlap. In another embodiment of the invention, the first and second epitopes do not overlap. For example, in an embodiment of the invention, a multispecific antibody is a bispecific IgG antibody (e.g., IgG1 or IgG4) that includes a first antigen-binding domain that binds specifically to CoV-S including the heavy and light immunoglobulin chain of an antibody of Table 1, and a second antigen-binding domain that binds specifically to a different epitope of CoV-S. In some embodiments, a bispecific IgG antibody (e.g., IgG1 or IgG4) includes a first antigen-binding domain that binds specifically to CoV-S and a second binding domain that binds to a host cell protein, e.g., ACE2 or TMPRSS2.
[0156] The antibodies of Table 1 include multispecific molecules, e.g., antibodies or antigen-binding fragments, that include the CDR-Hs and CDR-Ls, V.sub.H and V.sub.L, or HC and LC of those antibodies, respectively (including variants thereof as set forth herein).
[0157] In an embodiment of the invention, an antigen-binding domain that binds specifically to CoV-S, which may be included in a multispecific molecule, comprises: [0158] (1) [0159] (i) a heavy chain variable domain sequence that comprises CDR-H1, CDR-H2, and CDR-H3 amino acid sequences set forth in Table 1, and [0160] (ii) a light chain variable domain sequence that comprises CDR-L1, CDR-L2, and CDR-L3 amino acid sequences set forth in Table 1; [0161] or, [0162] (2) [0163] (i) a heavy chain variable domain sequence comprising an amino acid sequence set forth in Table 1, and [0164] (ii) a light chain variable domain sequence comprising an amino acid sequence set forth in Table 1; [0165] or, [0166] (3) [0167] (i) a heavy chain immunoglobulin sequence comprising an amino acid sequence set forth in Table 1, and [0168] (ii) a light chain immunoglobulin sequence comprising an amino acid sequence set forth in Table 1.
[0169] In an embodiment of the invention, the multispecific antibody or fragment includes more than two different binding specificities (e.g., a trispecific molecule), for example, one or more additional antigen-binding domains which are the same or different from the first and/or second antigen-binding domain.
[0170] In one embodiment of the invention, a bispecific antigen-binding fragment comprises a first scFv (e.g., comprising V.sub.H and V.sub.L sequences of Table 1) having binding specificity for a first epitope (e.g., CoV-S) and a second scFv having binding specificity for a second, different epitope. For example, in an embodiment of the invention, the first and second scFv are tethered with a linker, e.g., a peptide linker (e.g., a GS linker such as (GGGGS).sub.n (SEQ ID NO: 834) wherein n is, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10). Other bispecific antigen-binding fragments include an F(ab).sub.2 of a bispecific IgG antibody which comprises the heavy and light chain CDRs of Table 1 and of another antibody that binds to a different epitope.
Therapeutic Methods
[0171] The present invention provides methods for treating or preventing viral infection (e.g., coronavirus infection) by administering a therapeutically effective amount of anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment, (e.g., of Table 1) to a subject (e.g., a human) in need of such treatment or prevention.
[0172] Coronavirus infection may be treated or prevented, in a subject, by administering an anti-CoV-S antigen-binding protein of the present invention to a subject.
[0173] An effective or therapeutically effective dose of anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment (e.g., of Table 1), for treating or preventing a viral infection refers to the amount of the antibody or fragment sufficient to alleviate one or more signs and/or symptoms of the infection in the treated subject, whether by inducing the regression or elimination of such signs and/or symptoms or by inhibiting the progression of such signs and/or symptoms. The dose amount may vary depending upon the age and the size of a subject to be administered, target disease, conditions, route of administration, and the like. In an embodiment of the invention, an effective or therapeutically effective dose of antibody or antigen-binding fragment thereof of the present invention, for treating or preventing viral infection, e.g., in an adult human subject, is about 0.01 to about 200 mg/kg, e.g., up to about 150 mg/kg. In an embodiment of the invention, the dosage is up to about 10.8 or 11 grams (e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or 11 grams). Depending on the severity of the infection, the frequency and the duration of the treatment can be adjusted. In certain embodiments, the antigen-binding protein of the present invention can be administered at an initial dose, followed by one or more secondary doses. In certain embodiments, the initial dose may be followed by administration of a second or a plurality of subsequent doses of antibody or antigen-binding fragment thereof in an amount that can be approximately the same or less than that of the initial dose, wherein the subsequent doses are separated by at least 1 day to 3 days; at least one week, at least 2 weeks; at least 3 weeks; at least 4 weeks; at least 5 weeks; at least 6 weeks; at least 7 weeks; at least 8 weeks; at least 9 weeks; at least 10 weeks; at least 12 weeks; or at least 14 weeks.
[0174] As used herein, the term subject refers to a mammal (e.g., rat, mouse, cat, dog, cow, pig, sheep, horse, goat, rabbit), preferably a human, for example, in need of prevention and/or treatment of a disease or disorder such as viral infection or cancer. The subject may have a viral infection, e.g., an influenza infection, or be predisposed to developing an infection. Subjects predisposed to developing an infection, or subjects who may be at elevated risk for contracting an infection (e.g., of coronavirus or influenza virus), include subjects with compromised immune systems because of autoimmune disease, subjects receiving immunosuppressive therapy (for example, following organ transplant), subjects afflicted with human immunodeficiency syndrome (HIV) or acquired immune deficiency syndrome (AIDS), subjects with forms of anemia that deplete or destroy white blood cells, subjects receiving radiation or chemotherapy, or subjects afflicted with an inflammatory disorder. Additionally, subjects of very young (e.g., 5 years of age or younger) or old age (e.g., 65 years of age or older) are at increased risk. Moreover, a subject may be at risk of contracting a viral infection due to proximity to an outbreak of the disease, e.g. subject resides in a densely-populated city or in close proximity to subjects having confirmed or suspected infections of a virus, or choice of employment, e.g. hospital worker, pharmaceutical researcher, traveler to infected area, or frequent flier.
[0175] Treat or treating means to administer an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment of the present invention (e.g., of Table 1), to a subject having one or more signs or symptoms of a disease or infection, e.g., viral infection, for which the antigen-binding protein is effective when administered to the subject at an effective or therapeutically effective amount or dose (as discussed herein).
[0176] The present invention also encompasses prophylactically administering an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof of the present invention (e.g., of Table 1), to a subject who is at risk of viral infection so as to prevent such infection. Passive antibody-based immunoprophylaxis has proven an effective strategy for preventing subject from viral infection. See e.g., Berry et al., Passive broad-spectrum influenza immunoprophylaxis. Influenza Res Treat. 2014; 2014:267594. Epub 2014 Sep. 22; and Jianqiang et al., Passive immune neutralization strategies for prevention and control of influenza A infections, Immunotherapy. 2012 February; 4(2): 175-186; Prabhu et al., Antivir Ther. 2009; 14(7):911-21, Prophylactic and therapeutic efficacy of a chimeric monoclonal antibody specific for H5 hemagglutinin against lethal H5N1 influenza. Prevent or preventing means to administer an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment of the present invention (e.g., of Table 1), to a subject to inhibit the manifestation of a disease or infection (e.g., viral infection) in the body of a subject, for which the antigen-binding protein is effective when administered to the subject at an effective or therapeutically effective amount or dose (as discussed herein).
[0177] In an embodiment of the invention, a sign or symptom of a viral infection in a subject is survival or proliferation of virus in the body of the subject, e.g., as determined by viral titer assay (e.g., coronavirus propagation in embryonated chicken eggs or coronavirus spike protein assay). Other signs and symptoms of viral infection are discussed herein.
[0178] As noted above, in some embodiments the subject may be a non-human animal, and the antigen-binding proteins (e.g., antibodies and antigen-binding fragments) discussed herein may be used in a veterinary context to treat and/or prevent disease in the non-human animals (e.g., cats, dogs, pigs, cows, horses, goats, rabbits, sheep, and the like).
[0179] The present invention provides a method for treating or preventing viral infection (e.g., coronavirus infection) or for inducing the regression or elimination or inhibiting the progression of at least one sign or symptom of viral infection such as: [0180] fever or feeling feverish/chills; [0181] cough; [0182] sore throat; [0183] runny or stuffy nose; [0184] sneezing; [0185] muscle or body aches; [0186] headaches; [0187] fatigue (tiredness); [0188] vomiting; [0189] diarrhea; [0190] respiratory tract infection; [0191] chest discomfort; [0192] shortness of breath; [0193] bronchitis; and/or [0194] pneumonia,
which sign or symptom is secondary to viral infection, in a subject in need thereof (e.g., a human), by administering a therapeutically effective amount of anti-CoV-S antigen-binding protein (e.g., of Table 1) to the subject, for example, by injection of the protein into the body of the subject.
Combinations and Pharmaceutical Compositions
[0195] To prepare pharmaceutical compositions of the anti-CoV-S antigen-binding proteins, e.g., antibodies and antigen-binding fragments thereof (e.g., of Table 1), antigen-binding protein is admixed with a pharmaceutically acceptable carrier or excipient. See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary, Mack Publishing Company, Easton, Pa. (1984); Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics, McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy, Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al. (eds.) (1993) Pharmaceutical Dosage Forms: Parenteral Medications, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Tablets, Marcel Dekker, NY; Lieberman, et al. (eds.) (1990) Pharmaceutical Dosage Forms: Disperse Systems, Marcel Dekker, NY; Weiner and Kotkoskie (2000) Excipient Toxicity and Safety, Marcel Dekker, Inc., New York, N.Y. In an embodiment of the invention, the pharmaceutical composition is sterile. Such compositions are part of the present invention.
[0196] The scope of the present invention includes desiccated, e.g., freeze-dried, compositions comprising an anti-CoV-S antigen-binding proteins, e.g., antibody or antigen-binding fragment thereof (e.g., of Table 1), or a pharmaceutical composition thereof that includes a pharmaceutically acceptable carrier but substantially lacks water.
[0197] In a further embodiment of the invention, a further therapeutic agent that is administered to a subject in association with an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof (e.g., of Table 1), disclosed herein is administered to the subject in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57.sup.th edition (Nov. 1, 2002)).
[0198] The mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal or intra-arterial.
[0199] The present invention provides methods for administering an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof (e.g., of Table 1), comprising introducing the protein into the body of a subject. For example, the method comprises piercing the body of the subject with a needle of a syringe and injecting the antigen-binding protein into the body of the subject, e.g., into the vein, artery, tumor, muscular tissue or subcutis of the subject.
[0200] The present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments thereof (e.g., of Table 1), polypeptides (e.g., an HC, LC, V.sub.H or V.sub.L of Table 1) or polynucleotides (e.g., of Table 2) or vectors set forth herein or a pharmaceutical composition thereof comprising a pharmaceutically acceptable carrier.
[0201] In an embodiment of the present disclosure, an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof of the present invention (e.g., of Table 1), is administered in association with one or more further therapeutic agents. A further therapeutic agent includes, but is not limited to: an anti-inflammatory agent, an antimalarial agent, a second antibody or antigen-binding fragment thereof that specifically binds TMPRSS2, and a second antibody or antigen-binding fragment thereof that specifically binds to CoV-S. In some embodiments, an antimalarial agent is chloroquine or hydroxychloroquine. In some embodiments, an anti-inflammatory agent is an antibody such as sarilumab, tocilizumab, or gimsilumab. In some embodiments, the further therapeutic agent is a second antibody or antigen-binding fragment disclosed herein, e.g., of Table 1. In certain embodiments, one, t three, four, or more antibodies, or antigen-binding fragments thereof, of Table 1 can be administered in combination (e.g., concurrently or sequentially). In certain embodiments, the two, three, four, or more antibodies bind to non-overlapping, or partially overlapping, epitopes of the spike protein, e.g., in the receptor binding domain of the spike protein. Various methods are known in the art for determining whether two or more antibodies have non-overlapping or partially overlapping epitopes such as, for example, a cross-competition assay. Particular combinations of antibodies of Table 1 are listed below (each number representing a specific combination, e.g., mAb0989 and mAb10987 is Combination 1, mAb10989 and mAb10934 is Combination 2, and so on). In some embodiments, a combination of antibodies can be selected from among those binding to different epitope clusters. For example, certain antibodies described herein belong to epitope clusters as follows: Cluster 1, mAb10987, mAb10922, mAb10936, and mAb10934; Cluster 2, mAb10989, mAb10977, and mAb10933; Cluster 3, mAb10920; Cluster 4, mAb10954, mAb10986, and mAb10964; and Cluster 5, mAb10984. Thus, a combination of two antibodies can be selected from, for example, Cluster 1 and Cluster 2, Cluster 1 and Cluster 3, Cluster 1 and Cluster 4, Cluster 1 and Cluster 5, Cluster 2 and Cluster 3, Cluster 2 and Cluster 4, Cluster 2 and Cluster 5, Cluster 3 and Cluster 4, Cluster 3 and Cluster and Cluster 4 and Cluster 5. In certain embodiments, three antibodies can be administered in combination (e.g., concurrently or sequentially). For example, such combinations can be selected from the group consisting of mAb10987 and mAb10933 plus any one of the following antibodies: mAb10913, mAb10915, mAb10916, mAb10917, mAb10918, mAb10920, mAb10921, mAb10922, mAb10923, mAb10924, mAb10925, mAb10926, mAb10927, mAb10928, mAb10929, mAb10930, mAb10931, mAb10932, mAb10934, mAb10935, mAb10936, mAb10937, mAb10940, mAb10938, mAb10939, mAb10941, mAb10942, mAb10943, mAb10944, mAb10945 mAb10946, mAb10947, mAb10948, mAb10949, mAb10951, mAb10950, mAb10954, mAb10955, mAb10956, mAb10957, mAb10958, mAb10959, mAb10960, mAb10961, mAb10964, mAb10965, mAb10966, mAb10967, mAb10969, mAb10970, mAb10971, mAb10973, mAb10974, mAb10975, mAb10976, mAb10977, mAb10978, mAb10979, mAb10980, mAb10981, mAb10982, mAb10983, mAb10984, mAb10985, mAb10986, mAb10988, mAb10989, mAb10990, mAb10991, mAb10992, mAb10993, mAb10994, mAb10995, mAb10996, mAb10997, mAb10998, mAb10999, mAb11000, mAb11001, mAb11002, mAb11003, mAb10914, mAb11004, mAb11005, mAb11006, mAb11007, mAb11008, mAb11009, mAb11010, and mAb11011. In some embodiments, the combination is mAb10933, mAb10987, and mAb10985. None of mAb10933, mAb10987 and mAb10985 were observed to cross-compete with one another. In some embodiments, an antibody that specifically binds TMPRSS2 is H1H7017N, as described in International Patent Pub. No. WO/2019/147831.
TABLE-US-00002 mAb10989 mAb10987 mAb10934 mAb10933 mAb10920 mAb10922 mAb10989 X 1 2 3 4 5 mAb10987 12 X 13 14 15 16 mAb10934 23 24 X 25 26 27 mAb10933 34 35 36 X 37 38 mAb10920 45 46 47 48 X 49 mAb10922 56 57 58 59 60 X mAb10936 67 68 69 70 71 72 mAb10954 78 79 80 81 82 83 mAb10964 89 90 91 92 93 94 mAb10977 100 101 102 103 104 105 mAb10984 111 112 113 114 115 116 mAb10986 122 123 124 125 126 127 mAb10936 mAb10954 mAb10964 mAb10977 mAb10984 mAb10986 mAb10989 6 7 8 9 10 11 mAb10987 17 18 19 20 21 22 mAb10934 28 29 30 31 32 33 mAb10933 39 40 41 42 43 44 mAb10920 50 51 52 53 54 55 mAb10922 61 62 63 64 65 66 mAb10936 X 73 74 75 76 77 mAb10954 84 X 85 86 87 88 mAb10964 95 96 X 97 98 99 mAb10977 106 107 108 X 109 110 mAb10984 117 118 119 120 X 121 mAb10986 128 129 130 131 132 X
[0202] Because RNA viruses can accumulate mutations over time, a significant concern for any direct antiviral therapeutic is the potential for selection of treatment-induced escape mutants. Strategies to safeguard against escape of antibody therapeutics include selection of a conserved binding epitope or inclusion of multiple antibodies with non-overlapping epitopes. However, the occurrence of escape mutants, and their position, is unpredictable. For example, mutations need not occur at an antibody binding site to be escape mutants. While some informed analysis can be made regarding epitope conservation based on sequence and structural analysis, the possibility of escape still exists under strong selection pressure. Moreover, merely selecting non-overlapping epitopes for treatments with combinations of antibodies may not be sufficient to prevent escape. Rather, the skilled worker will appreciate that a combination of antibodies will be more effective when the antibodies bind to epitopes where a single mutation would be unlikely to disrupt the binding of both antibodies. Because escape mutations can occur outside of the epitope region, and a single mutation has the potential to disrupt binding of one or both antibodies, antibody combinations should be tested for their ability to prevent escape, rather than solely selecting antibodies that bind to non-overlapping epitopes. This further underscores the unpredictability of whether antibodies binding two non-overlapping epitopes would prevent escape, or even whether the antibodies would need to bind non-overlapping epitopes to prevent escape.
[0203] Indeed, escape studies performed with anti-influenza HA stem binding antibodies have shown that escape mutants can arise despite high conservation of the stem epitope between diverse influenza subtypes, with some escape mutations arising outside of the antibody epitope region. Furthermore, evaluation of antibodies that demonstrate broad neutralization across multiple species of coronaviruses, and thus may be targeting more conserved residues, shows that neutralization potency of these antibodies is orders of magnitude lower than that of the potent neutralizing antibodies specific for SARS-CoV-2 described herein. Neutralization potency is thought to be the key mechanism of action of anti-SARS-CoV-2 spike antibodies and may prove to be an important driver of clinical efficacy. A clinical candidate selection criterion for broad potency that includes functional assessment against naturally circulating sequence variants and inclusion of multiple antibodies with non-overlapping epitopes may provide enhanced protection against loss of efficacy. Accordingly, in some embodiments of the present disclosure, a combination of potent neutralizing, non-competing, anti-SARS-CoV-2 spike glycoprotein antibodies, as discussed herein, that can deliver optimal antiviral potency while minimizing odds of virus escape, represents an antibody cocktail based therapeutic for treatment and prevention of COVID-19. In particular, escape against multiple non-competing antibodies (e.g., mAb10987 and mAb10933) requires simultaneous selection of two distinct amino acid mutations that allow the virus to maintain replication fitness, a significantly less likely possibility than selection of a single mutation.
[0204] In some embodiments, the further therapeutic agent is an anti-viral drug and/or a vaccine. As used herein, the term anti-viral drug refers to any anti-infective drug or therapy used to treat, prevent, or ameliorate a viral infection in a subject. The term anti-viral drug includes, but is not limited to a cationic steroid antimicrobial, leupeptin, aprotinin, ribavirin, or interferon-alpha2b. Methods for treating or preventing virus (e.g., coronavirus) infection in a subject in need of said treatment or prevention by administering an antibody or antigen-binding fragment of Table 1 in association with a further therapeutic agent are part of the present invention.
[0205] For example, in an embodiment of the invention, the further therapeutic agent is a vaccine, e.g., a coronavirus vaccine. In an embodiment of the invention, a vaccine is an inactivated/killed virus vaccine, a live attenuated virus vaccine or a virus subunit vaccine.
[0206] For example, in an embodiment of the invention, the further therapeutic agent is:
##STR00001## ##STR00002##
[0207] In an embodiment of the invention, the anti-viral drug is an antibody or antigen-binding fragment that binds specifically to coronavirus, e.g., SARS-CoV-2, SARS-CoV, or MERS-CoV. Exemplary anti-CoV-S antibodies include, but are not limited to: H4sH15188P; H1H15188P; H1H15211P; H1H15177P; H4sH15211P; H1H15260P2; H1H15259P2; H1H15203P; H4sH15260P2; H4sH15231P2; H1H15237P2; H1H15208P; H1H15228P2; H1H15233P2; H1H15264P2; H1H15231P2; H1H15253P2; H1H15215P; and H1H15249P2, as set forth in International patent application publication no. WO/2015/179535, or an antigen-binding fragment thereof, e.g., wherein the antibody or fragment comprises a light chain immunoglobulin that includes CDR-L1, CDR-L2 and CDR-L3 (e.g., the V.sub.L or light chain thereof); and a heavy chain that includes CDR-H1, CDR-H2 and CDR-H3 (e.g., the V.sub.H or heavy chain thereof) of any of the foregoing anti-CoV-S antibodies.
[0208] In a certain embodiment of the invention, the further therapeutic agent is not aprotinin, leupeptin, a cationic steroid antimicrobial, an influenza vaccine (e.g., killed, live, attenuated whole virus or subunit vaccine), or an antibody against influenza virus (e.g., an anti-hemagglutinin antibody).
[0209] The term in association with indicates that the components, an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof of the present invention, along with another agent, can be formulated into a single composition, e.g., for simultaneous delivery, or formulated separately into two or more compositions (e.g., a kit). Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at intervals over a given period of time. Moreover, the separate components may be administered to a subject by the same or by a different route (e.g., wherein an anti-CoV-S antibody or antigen-binding fragment thereof.
Kits
[0210] Further provided are kits comprising one or more components that include, but are not limited to, an anti-CoV-S antigen-binding protein, e.g., an antibody or antigen-binding fragment as discussed herein (e.g., of Table 1), in association with one or more additional components including, but not limited to, a further therapeutic agent, as discussed herein. The antigen-binding protein and/or the further therapeutic agent can be formulated as a single composition or separately in two or more compositions, e.g., with a pharmaceutically acceptable carrier, in a pharmaceutical composition.
[0211] In one embodiment of the invention, the kit includes an anti-CoV-S antigen-binding protein, e.g., an antibody or antigen-binding fragment thereof of the invention (e.g., of Table 1), or a pharmaceutical composition thereof in one container (e.g., in a sterile glass or plastic vial) and a further therapeutic agent in another container (e.g., in a sterile glass or plastic vial).
[0212] In another embodiment, the kit comprises a combination of the invention, including an anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof of the invention (e.g., of Table 1), or pharmaceutical composition thereof in combination with one or more further therapeutic agents formulated together, optionally, in a pharmaceutical composition, in a single, common container.
[0213] If the kit includes a pharmaceutical composition for parenteral administration to a subject, the kit can include a device (e.g., an injection device) for performing such administration. For example, the kit can include one or more hypodermic needles or other injection devices as discussed above containing the anti-CoV-S antigen-binding protein, e.g., antibody or antigen-binding fragment thereof of the present invention (e.g., of Table 1).
[0214] The kit can include a package insert including information concerning the pharmaceutical compositions and dosage forms in the kit. Generally, such information aids patients and physicians in using the enclosed pharmaceutical compositions and dosage forms effectively and safely. For example, the following information regarding a combination of the invention may be supplied in the insert: pharmacokinetics, pharmacodynamics, clinical studies, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, proper dosage and administration, how supplied, proper storage conditions, references, manufacturer/distributor information and patent information.
Diagnostic Uses of the Antibodies
[0215] The anti-CoV-S antigen-binding proteins, e.g., antibodies or antigen-binding fragments thereof of the present invention (e.g., of Table 1), may be used to detect and/or measure CoV-S in a sample. Exemplary assays for CoV-S may include, e.g., contacting a sample with an anti-CoV-S antigen-binding protein of the invention, wherein the anti-CoV-S antigen-binding protein is labeled with a detectable label or reporter molecule or used as a capture ligand to selectively isolate CoV-S from samples. The presence of an anti-CoV-S antigen-binding protein complexed with CoV-S indicates the presence of CoV-S in the sample. Alternatively, an unlabeled anti-CoV-S antibody can be used in combination with a secondary antibody which is itself detectably labeled. The detectable label or reporter molecule can be a radioisotope, such as .sup.3H, .sup.14C, .sup.32P, .sup.35S, or .sup.125I; a fluorescent or chemiluminescent moiety such as fluorescein isothiocyanate, or rhodamine; or an enzyme such as alkaline phosphatase, -galactosidase, horseradish peroxidase, or luciferase. Specific exemplary assays that can be used to detect or measure CoV-S in a sample include neutralization assays, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (MA), and fluorescence-activated cell sorting (FACS). Thus, the present invention includes a method for detecting the presence of spike protein polypeptide in a sample comprising contacting the sample with an anti-CoV-S antigen-binding protein and detecting the presence of a CoV-S/anti-CoV-S antigen-binding protein wherein the presence of the complex indicates the presence of CoV-S.
[0216] An anti-CoV-S antigen-binding protein of the invention (e.g., of Table 1) may be used in a Western blot or immune-protein blot procedure for detecting the presence of CoV-S or a fragment thereof in a sample. Such a procedure forms part of the present invention and includes the steps of e.g.: [0217] (1) providing a membrane or other solid substrate comprising a sample to be tested for the presence of CoV-S, e.g., optionally including the step of transferring proteins from a sample to be tested for the presence of CoV-S (e.g., from a PAGE or SDS-PAGE electrophoretic separation of the proteins in the sample) onto a membrane or other solid substrate using a method known in the art (e.g., semi-dry blotting or tank blotting); and contacting the membrane or other solid substrate to be tested for the presence of CoV-S or a fragment thereof with an anti-CoV-S antigen-binding protein of the invention.
[0218] Such a membrane may take the form, for example, of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of CoV-S in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel). Before contacting the membrane with the anti-CoV-S antigen-binding protein, the membrane is optionally blocked, e.g., with non-fat dry milk or the like so as to bind non-specific protein binding sites on the membrane. [0219] (2) washing the membrane one or more times to remove unbound anti-CoV-S antigen-binding protein and other unbound substances; and [0220] (3) detecting the bound anti-CoV-S antigen-binding protein.
[0221] Detection of the bound antigen-binding protein indicates that the CoV-S protein is present on the membrane or substrate and in the sample. Detection of the bound antigen-binding protein may be by binding the antigen-binding protein with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody label.
[0222] The anti-CoV-S antigen-binding proteins (e.g., antibodies and antigen-binding fragments (e.g., of Table 1)) disclosed herein may also be used for immunohistochemistry. Such a method forms part of the present invention and comprises, e.g., [0223] (1) contacting tissue to be tested for the presence of CoV-S protein with an anti-CoV-S antigen-binding protein of the invention; and [0224] (2) detecting the antigen-binding protein on or in the tissue.
[0225] If the antigen-binding protein itself is detectably labeled, it can be detected directly. Alternatively, the antigen-binding protein may be bound by a detectably labeled secondary antibody wherein the label is then detected.
EXAMPLES
[0226] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the methods and compositions of the invention and are not intended to limit the scope of what the inventors regard as their invention. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is average molecular weight, temperature is in degrees Centigrade, room temperature is about and pressure is at or near atmospheric.
Example 1: Generation of Human Antibodies to SARS-CoV-2 Spike Protein (SARS-CoV-2-S)
[0227] Human antibodies to SARS-CoV-2-Spike protein (SARS-CoV-2-S) were generated in a VELOCIMMUNE mouse comprising DNA encoding human immunoglobulin heavy and kappa light chain variable regions or human immunoglobulin heavy and lambda light chain variable regions. Each mouse was immunized with a vector expressing the SARS-CoV-2-S receptor binding domain (RBD) (amino acids 1-1273 of NCBI accession number (MN908947.3), SEQ ID NO: 832), followed by a booster with a SARS-CoV-2-S vector or a SARS-CoV-2-S protein. The antibody immune response was monitored by a SARS-CoV-2-S-specific immunoassay. When a desired immune response was achieved, lymphocytes were harvested and fused with mouse myeloma cells to preserve their viability and form hybridoma cell lines. The hybridoma cell lines were screened and selected to identify cell lines that produce SARS-CoV-2-S-specific antibodies. Anti-SARS-CoV-2-S antibodies were also isolated directly from antigen-positive mouse B cells without fusion to myeloma cells, as described in U.S. Pat. No. 7,582,298, herein specifically incorporated by reference in its entirety. Using this method, fully human anti-SARS-CoV-2-S antibodies (i.e., antibodies possessing human variable domains and human constant domains) were obtained.
[0228] Antibodies were also isolated from human blood samples. Whole blood was received from patients 3-4 weeks after a laboratory-confirmed PCR positive test for SARS-CoV-2 and symptomatic COVID-19 disease. Red blood cells were lysed in ACK lysis buffer (Life Technologies), and peripheral blood mononuclear cells (PBMCs) were isolated by a Ficoll gradient. From the PBMCs, single B cells that bind the SARS-CoV-2 spike protein were isolated by fluorescent-activated cell sorting (FACS). Isolated B cells were single-well plated and mixed with antibody light and heavy variable region-specific PCR primers. cDNAs for each single B cell were synthesized via a reverse transcriptase (RT) reaction. Each resulting RT product was then split and transferred into two corresponding wells for subsequent antibody heavy and light chain PCRs. One set of the resulting RT products was first amplified by PCR using a 5 degenerate primer specific for antibody heavy variable region leader sequence or a 5 degenerate primer specific for antibody light chain variable region leader sequence and a 3 primer specific for antibody constant region, to form an amplicon. The amplicons were then amplified again by PCR using a 5 degenerate primer specific for antibody heavy variable region framework 1 or a degenerate primer specific for antibody light chain variable region framework 1 and a 3 primer specific for antibody constant region, to generate amplicons for cloning. The antibody heavy chain and light chain derived PCR products were cloned into expression vectors containing heavy constant region and light constant region, respectively. The expression vectors expressing full-length heavy and light chain pairs were transfected into CHO cells to produce antibody proteins for testing.
[0229] The biological properties of exemplary antibodies generated in accordance with the methods of this Example are described in detail in the Examples set forth below.
Example 2: Heavy and Light Chain Variable Region Amino Acid and Nucleotide Sequences
[0230] Table 1 sets forth the amino acid sequence identifiers of the heavy and light chain variable regions and CDRs, as well as the heavy chain and light chain sequences, of exemplary anti-SARS-CoV-2-S antibodies. The corresponding nucleic acid sequence identifiers are set forth in Table 2.
TABLE-US-00003 TABLE 1 Amino Acid Sequence Identifiers SEQ ID NOs Antibody HCDR LCDR LCDR Designation HCVR HCDR 1 2 HCDR 3 LCVR LCDR 1 2 3 HC LC mAb10913 2 4 6 8 10 12 14 16 18 20 mAb10915 22 24 26 28 30 32 34 36 38 40 mAb10916 2 4 6 8 10 12 14 16 42 20 mAb10917 44 46 26 49 51 53 55 57 59 61 mAb10918 22 24 26 28 30 32 34 36 63 40 mAb10920 65 67 69 71 73 75 55 77 79 81 mAb10921 83 85 26 87 89 91 55 93 95 97 mAb10922 99 101 103 105 107 109 111 113 115 117 mAb10923 119 121 123 125 127 129 55 131 133 135 mAb10924 137 139 141 143 145 147 149 151 153 155 mAb10925 65 67 69 71 73 75 55 77 157 81 mAb10926 83 85 26 87 89 91 55 93 159 97 mAb10927 99 101 103 105 107 109 111 113 161 117 mAb10928 119 121 123 125 127 129 55 131 163 135 mAb10929 137 139 141 143 145 147 149 151 165 155 mAb10930 167 169 171 173 175 129 55 177 179 181 mAb10931 167 169 171 173 175 129 55 177 183 181 mAb10932 185 187 26 189 191 75 194 196 198 200 mAb10933 202 204 206 208 210 212 55 214 216 218 mAb10934 220 222 224 226 228 230 194 232 234 236 mAb10935 238 24 26 240 242 244 194 246 248 250 mAb10936 252 254 256 258 260 129 55 262 264 266 mAb10937 268 270 272 274 276 129 55 278 280 282 mAb10940 284 169 286 288 290 292 294 296 298 300 mAb10938 302 24 26 304 306 308 194 310 312 314 mAb10939 316 187 319 321 323 325 55 327 329 331 mAb10941 333 85 26 336 338 340 294 296 342 344 mAb10942 185 187 26 189 191 75 194 196 346 200 mAb10943 202 204 206 208 210 212 55 214 348 218 mAb10944 220 222 224 226 228 230 194 232 350 236 mAb10945 238 24 26 240 242 244 194 246 352 250 mAb10946 252 254 256 258 260 129 55 262 354 266 mAb10947 268 270 272 274 276 129 55 278 356 282 mAb10948 302 24 26 304 306 308 194 310 358 314 mAb10949 316 187 319 321 323 325 55 327 360 331 mAb10951 333 85 26 336 338 340 294 296 362 344 mAb10950 284 169 286 288 290 292 294 296 364 300 mAb10954 366 85 26 370 372 244 194 375 377 379 mAb10955 381 383 26 385 387 389 194 310 392 394 mAb10956 396 187 26 399 401 389 194 403 405 407 mAb10957 409 411 26 414 416 53 55 418 420 422 mAb10958 366 85 26 370 372 244 194 375 424 379 mAb10959 381 383 26 385 387 389 194 310 426 394 mAb10960 396 187 26 399 401 389 194 403 428 407 mAb10961 409 41. 26 414 416 53 55 418 430 422 mAb10964 432 434 436 438 440 442 55 445 447 449 mAb10965 451 453 26 455 457 459 34 462 464 466 mAb10966 468 187 26 470 472 389 194 474 476 478 mAb10967 480 24 483 485 487 389 194 489 491 493 mAb10969 495 497 499 501 503 389 194 214 506 508 mAb10970 510 24 26 512 514 516 194 518 520 522 mAb10971 524 411 26 528 530 532 55 534 536 538 mAb10973 432 434 436 438 440 442 55 445 540 449 mAb10974 451 453 26 455 457 459 34 462 542 466 mAb10975 468 187 26 470 472 389 194 474 544 478 mAb10976 480 24 483 485 487 389 194 489 546 493 mAb10977 548 550 552 554 556 558 294 560 562 564 mAb10978 495 497 499 501 503 389 194 214 566 508 mAb10979 510 24 26 512 514 516 194 518 568 522 mAb10980 524 411 26 528 530 532 55 534 570 538 mAb10981 548 550 552 554 556 558 294 560 572 564 mAb10982 574 187 576 578 580 582 584 586 588 590 mAb10983 574 187 576 578 580 582 584 586 592 590 mAb10984 594 596 26 598 600 12 14 602 604 606 mAb10985 608 169 610 612 614 616 584 618 620 622 mAb10986 624 626 26 628 630 582 632 634 636 638 mAb10987 640 642 499 644 646 648 650 652 654 656 mAb10988 658 660 662 664 666 668 670 672 674 676 mAb10989 678 680 682 684 686 688 650 690 692 694 mAb10990 594 596 26 598 600 12 14 602 696 606 mAb10991 608 169 610 612 614 616 584 618 698 622 mAb10992 624 626 26 628 630 582 632 634 700 638 mAb10993 640 642 499 644 646 648 650 652 702 656 mAb10994 658 660 662 664 666 668 670 672 704 676 mAb10995 678 680 682 684 686 688 650 690 706 694 mAb10996 708 24 26 711 713 129 55 715 717 719 mAb10997 708 24 26 71. 713 129 55 715 721 719 mAb10998 723 187 26 725 727 129 55 729 731 733 mAb10999 723 187 26 725 727 129 55 729 735 733 mAb11000 737 24 26 739 741 743 55 745 747 749 mAb11001 737 24 26 739 741 743 55 745 751 749 mAb11002 753 24 26 755 713 129 55 715 757 719 mAb11003 753 24 26 755 713 129 55 715 759 719 mAb10914 44 46 26 49 51 53 55 57 762 61 mAb11004 764 766 499 768 770 91 55 772 774 776 mAb11005 764 766 499 768 770 91 55 772 778 776 mAb11006 780 782 26 784 786 53 55 788 790 792 mAb11007 780 782 26 784 786 53 55 788 794 792 mAb11008 796 24 26 798 800 53 55 802 804 806 mAb11009 796 24 26 798 800 53 55 802 808 806 mAb11010 810 812 814 816 818 129 820 822 824 826 mAb11011 810 812 814 816 818 129 820 822 828 826
TABLE-US-00004 TABLE 2 Nucleic Acid Sequence Identifiers SEQ ID NOs Antibody HCDR LCDR LCDR Designation HCVR HCDR 1 2 HCDR 3 LCVR LCDR 1 2 3 HC LC mAb10913 1 3 5 7 9 11 13 15 17 19 mAb10915 21 23 25 27 29 31 33 35 37 39 mAb10916 1 3 5 7 9 11 13 15 41 19 mAb10917 43 45 47 48 50 52 54 56 58 60 mAb10918 21 23 25 27 29 31 33 35 62 39 mAb10920 64 66 68 70 72 74 54 76 78 80 mAb10921 82 84 47 86 88 90 54 92 94 96 mAb10922 98 100 102 104 106 108 110 112 114 116 mAb10923 118 120 122 124 126 128 54 130 132 134 mAb10924 136 138 140 142 144 146 148 150 152 154 mAb10925 64 66 68 70 72 74 54 76 156 80 mAb10926 82 84 47 86 88 90 54 92 158 96 mAb10927 98 100 102 104 106 108 110 112 160 116 mAb10928 118 120 122 124 126 128 54 130 162 134 mAb10929 136 138 140 142 144 146 148 150 164 154 mAb10930 166 168 170 172 174 128 54 176 178 180 mAb10931 166 168 170 172 174 128 54 176 182 180 mAb10932 184 186 47 188 190 192 193 195 197 199 mAb10933 201 203 205 207 209 211 54 213 215 217 mAb10934 219 221 223 225 227 229 193 231 233 235 mAb10935 237 23 47 239 241 243 193 245 247 249 mAb10936 251 253 255 257 259 128 54 261 263 265 mAb10937 267 269 271 273 275 128 54 277 279 281 mAb10940 283 168 285 287 289 291 293 295 297 299 mAb10938 301 23 47 303 305 307 193 309 311 313 mAb10939 315 317 318 320 322 324 54 326 328 330 mAb10941 332 334 47 335 337 339 293 295 341 343 mAb10942 184 186 47 188 190 192 193 195 345 199 mAb10943 201 203 205 207 209 211 54 213 347 217 mAb10944 219 221 223 225 227 229 193 231 349 235 mAb10945 237 23 47 239 241 243 193 245 351 249 mAb10946 251 253 255 257 259 128 54 261 353 265 mAb10947 267 269 271 273 275 128 54 277 355 281 mAb10948 301 23 47 303 305 307 193 309 357 313 mAb10949 315 317 318 320 322 324 54 326 359 330 mAb10951 332 334 47 335 337 339 293 295 361 343 mAb10950 283 168 285 287 289 291 293 295 363 299 mAb10954 365 367 368 369 371 373 193 374 376 378 mAb10955 380 382 47 384 386 388 193 390 391 393 mAb10956 395 397 47 398 400 388 193 402 404 406 mAb10957 408 410 412 413 415 52 54 417 419 421 mAb10958 365 367 368 369 371 373 193 374 423 378 mAb10959 380 382 47 384 386 388 193 390 425 393 mAb10960 395 397 47 398 400 388 193 402 427 406 mAb10961 408 410 412 413 415 52 54 417 429 421 mAb10964 431 433 435 437 439 441 443 444 446 448 mAb10965 450 452 47 454 456 458 460 461 463 465 mAb10966 467 397 412 469 471 388 193 473 475 477 mAb10967 479 481 482 484 486 388 193 488 490 492 mAb10969 494 496 498 500 502 388 193 504 505 507 mAb10970 509 481 412 511 513 515 193 517 519 521 mAb10971 523 525 526 527 529 531 54 533 535 537 mAb10973 431 433 435 437 439 441 443 444 539 448 mAb10974 450 452 47 454 456 458 460 461 541 465 mAb10975 467 397 412 469 471 388 193 473 543 477 mAb10976 479 481 482 484 486 388 193 488 545 492 mAb10977 547 549 551 553 555 557 293 559 561 563 mAb10978 494 496 498 500 502 388 193 504 565 507 mAb10979 509 481 412 511 513 515 193 517 567 521 mAb10980 523 525 526 527 529 531 54 533 569 537 mAb10981 547 549 551 553 555 557 293 559 571 563 mAb10982 573 186 575 577 579 581 583 585 587 589 mAb10983 573 186 575 577 579 581 583 585 591 589 mAb10984 593 595 47 597 599 11 13 601 603 605 mAb10985 607 168 609 611 613 615 583 617 619 621 mAb10986 623 625 47 627 629 581 631 633 635 637 mAb10987 639 641 498 643 645 647 649 651 653 655 mAb10988 657 659 661 663 665 667 669 671 673 675 mAb10989 677 679 681 683 685 687 649 689 691 693 mAb10990 593 595 47 597 599 11 13 601 695 605 mAb10991 607 168 609 611 613 615 583 617 697 621 mAb10992 623 625 47 627 629 581 631 633 699 637 mAb10993 639 641 498 643 645 647 649 651 701 655 mAb10994 657 659 661 663 665 667 669 671 703 675 mAb10995 677 679 681 683 685 687 649 689 705 693 mAb10996 707 709 47 710 712 128 54 714 716 718 mAb10997 707 709 47 710 712 128 54 714 720 718 mAb10998 722 186 47 724 726 128 54 728 730 732 mAb10999 722 186 47 724 726 128 54 728 734 732 mAb11000 736 23 47 738 740 742 54 744 746 748 mAb11001 736 23 47 738 740 742 54 744 750 748 mAb11002 752 23 47 754 712 128 54 714 756 718 mAb11003 752 23 47 754 712 128 54 714 758 718 mAb10914 760 45 47 48 50 52 54 56 761 60 mAb11004 763 765 498 767 769 90 54 771 773 775 mAb11005 763 765 498 767 769 90 54 771 777 775 mAb11006 779 781 47 783 785 52 54 787 789 791 mAb11007 779 781 47 783 785 52 54 787 793 791 mAb11008 795 709 47 797 799 52 54 801 803 805 mAb11009 795 709 47 797 799 52 54 801 807 805 mAb11010 809 811 813 815 817 128 819 821 823 825 mAb11011 809 811 813 815 817 128 819 821 827 825
[0231] Antibodies disclosed herein have fully human variable regions but can have mouse constant regions (e.g., a mouse IgG1 Fc or a mouse IgG2 Fc (a or b isotype)) or human constant regions (e.g., a human IgG1 Fc or a human IgG4 Fc). As will be appreciated by a person of ordinary skill in the art, an antibody having a particular Fc isotype can be converted to an antibody with a different Fc isotype (e.g., an antibody with a mouse IgG1 Fc can be converted to an antibody with a human IgG4, etc.), but in any event, the variable domains (including the CDRs)which are indicated by the numerical identifiers shown in Tables 1 and 2 will remain the same, and the binding properties to antigen are expected to be identical or substantially similar regardless of the nature of the constant domain.
[0232] The variable regions of antibodies derived from VELOCIMMUNE mice and from human samples were sequenced by Next Generation Sequencing and the repertoire for heavy and light chain pairs was identified (
[0233] As described above, the antibodies were obtained from hybridomas generated from VELOCIMMUNE mice, by direct isolation from antigen-positive VELOCIMMUNE mouse B cells, or by direct isolation from antigen-positive human B cells. A summary of these sources is shown in Table 3.
TABLE-US-00005 TABLE 3 Antibody sources Antibody Isolation mAb10913 mouse B cells mAb10915 mouse B cells mAb10916 mouse B cells mAb10917 mouse B cells mAb10918 mouse B cells mAb10920 mouse B cells mAb10921 mouse B cells mAb10922 mouse B cells mAb10923 mouse B cells mAb10924 mouse B cells mAb10925 mouse B cells mAb10926 mouse B cells mAb10927 mouse B cells mAb10928 mouse B cells mAb10929 mouse B cells mAb10930 mouse B cells mAb10931 mouse B cells mAb10932 mouse B cells mAb10933 mouse B cells mAb10934 mouse B cells mAb10935 mouse B cells mAb10936 mouse B cells mAb10937 mouse B cells mAb10940 mouse B cells mAb10938 mouse B cells mAb10939 mouse B cells mAb10941 mouse B cells mAb10942 mouse B cells mAb10943 mouse B cells mAb10944 mouse B cells mAb10945 mouse B cells mAb10946 mouse B cells mAb10947 mouse B cells mAb10948 mouse B cells mAb10949 mouse B cells mAb10951 mouse B cells mAb10950 mouse B cells mAb10954 human B cells mAb10955 human B cells mAb10956 human B cells mAb10957 human B cells mAb10958 human B cells mAb10959 human B cells mAb10960 human B cells mAb10961 human B cells mAb10964 human B cells mAb10965 human B cells mAb10966 human B cells mAb10967 human B cells mAb10969 human B cells mAb10970 human B cells mAb10971 human B cells mAb10973 human B cells mAb10974 human B cells mAb10975 human B cells mAb10976 human B cells mAb10977 human B cells mAb10978 human B cells mAb10979 human B cells mAb10980 human B cells mAb10981 human B cells mAb10982 mouse B cells mAb10983 mouse B cells mAb10984 human B cells mAb10985 human B cells mAb10986 human B cells mAb10987 human B cells mAb10988 human B cells mAb10989 human B cells mAb10990 human B cells mAb10991 human B cells mAb10992 human B cells mAb10993 human B cells mAb10994 human B cells mAb10995 human B cells mAb10996 hybridoma mAb10997 hybridoma mAb10998 hybridoma mAb10999 hybridoma mAb11000 hybridoma mAb11001 hybridoma mAb11002 hybridoma mAb11003 hybridoma mAb10914 mouse B cells mAb11004 hybridoma mAb11005 hybridoma mAb11006 hybridoma mAb11007 hybridoma mAb11008 hybridoma mAb11009 hybridoma mAb11010 hybridoma mAb11011 hybridoma
Example 3: Characterization of Hybridoma Supernatants by Binding ELISA
[0234] An ELISA binding assay was performed to identify antibody supernatants that bound to the SARS-CoV-2-Spike protein receptor binding domain (RBD). A protein composed of the RBD of SARS-CoV-2 (amino acids 319-541) expressed with a 6 histidine tag and two myc epitope tags at the C-terminus (SARS-CoV-2-S-RBD-mmH; see also NCBI Accession Number MN908947.3) was coated at 1 g/ml on a 96-well plate in PBS buffer overnight at 4 C. Nonspecific binding sites were subsequently blocked using a 0.5% (w/v) solution of BSA in PBS. Antibody supernatants or media alone were diluted 1:40 or 1:50 in the PSA+0.5% BSA blocking buffer and transferred to the washed microtiter plates. After one hour of incubation at room temperature, the wells were washed, and plate-bound supernatant was detected with either goat-anti-human IgG antibody conjugated with horseradish peroxidase (HRP) (Jackson Immunoresearch), or anti-mouse IgG antibody conjugated with horseradish peroxidase (HRP) (Jackson Immunoresearch). The plates were then developed using TMB substrate solution (BD Biosciences) according to manufacturer's recommendation and absorbance at 450 nm was measured on a Victor X5 plate reader.
[0235] The ability of anti-SARS-CoV-2-S antibodies to bind the receptor binding domain of SARS-CoV-2-S(SARS-CoV-2-S-RBD) was assessed, as described above, using a binding ELISA with the SARS-CoV-2-S-RBD-mmH protein coated on a microplate. Single point antibody supernatant binding to SARS-COV-2-S-RBD-mmH coated on 96-well microtiter plates was detected with an HRP conjugated anti-hFc or anti-mFc antibody.
[0236] The binding results of three trials are summarized in Table 4. The SARS-CoV-2 binding signals (absorbance 450 nm) are indicated, with the media only background provided as a negative reference per experiment. A sample marked IC (Inconclusive) had an experimental anomaly to the plate and is therefore reported without a value. As shown in comparison to the media only control, the supernatants tested showed substantial binding to the SARS-CoV-2-S-RBD.
TABLE-US-00006 TABLE 4 Supernatant binding to SARS-COV-2 spike protein receptor binding domain Binding Signal Supernatant Detection (absorbance Supernatant Dilution Antibody at 450 nm) mAb10913 1:50 a-hFc 2.752 mAb10914 1:50 a-hFc 2.857 mAb10915 1:50 a-hFc 2.76 mAb10932 1:50 a-hFc 2.718 mAb10933 1:50 a-hFc 2.762 mAb10934 1:50 a-hFc 2.688 mAb10935 1:50 a-hFc 2.676 mAb10936 1:50 a-hFc 2.644 mAb10937 1:50 a-hFc 2.664 mAb10920 1:50 a-hFc 2.683 mAb10921 1:50 a-hFc 2.633 mAb10922 1:50 a-hFc 2.595 mAb10923 1:50 a-hFc 2.353 mAb10924 1:50 a-hFc 2.269 mAb10930 1:50 a-hFc 2.451 mAb10938 1:50 a-hFc 2.536 mAb10939 1:50 a-hFc 2.516 mAb10940 1:50 a-hFc 2.77 mAb10941 1:50 a-hFc IC mAb10982 1:50 a-hFc 2.537 mAb10984 1:50 a-hFc 0.716 mAb10985 1:50 a-hFc 2.35 mAb10986 1:50 a-hFc 2.331 mAb10987 1:50 a-hFc 2.438 mAb10988 1:50 a-hFc 3.062 mAb10989 1:50 a-hFc 3.116 mAb10969 1:50 a-hFc 2.629 mAb10970 1:50 a-hFc 2.807 mAb10971 1:50 a-hFc 3.052 mAb10964 1:50 a-hFc 3.086 mAb10965 1:50 a-hFc 2.918 mAb10966 1:50 a-hFc 0.421 mAb10967 1:50 a-hFc 1.732 mAb10954 1:50 a-hFc 1.963 mAb10955 1:50 a-hFc 2.469 mAb10956 1:50 a-hFc 2.6 mAb10957 1:50 a-hFc 2.49 mAb10977 1:50 a-hFc 2.925 mAb11010 1:40 a-mFc 2.896 mAb11004 1:40 a-mFc 2.908 mAb11000 1:40 a-mFc 2.725 mAb11006 1:40 a-mFc 2.619 mAb11008 1:40 a-mFc 2.907 mAb10998 1:40 a-mFc 2.835 mAb10996 1:40 a-mFc 2.826 mAb11002 1:40 a-mFc 2.581 Media only 1:50 a-hFc 0.069 Media only 1:40 a-mFc 0.058 Media only 1:50 a-hFc 0.055
Example 4: Antibody Binding to SARS-CoV-2-S-Expressing Virus-Like Particle
[0237] To investigate the ability of a panel of anti-SARS-CoV-2-S monoclonal antibodies to bind the SARS-CoV-2 spike glycoprotein, an in vitro binding assay utilizing SARS-CoV-2 spike protein-expressing viral-like particles (VLPs) in an electrochemiluminescence based detection platform (MSD) was developed.
[0238] To transiently express the SARS-CoV-2 spike protein (NCBI Accession number MN908947.3, amino acids 16-1211; SEQ ID NO: 833), Vesicular stomatitis virus (VSV) lacking glycoprotein G (VSV delta G) was pseudotyped with SARS-CoV-2 spike protein (VSV-SARS-CoV-2-S) and generated in HEK293T cells. As a negative binding control, VSV delta G was pseudotyped with VSV G protein (VSV-G).
[0239] Experiments were carried out according to following procedure. The two types of VLPs described above were diluted in PBS, seeded into 96-well carbon electrode plates (MULTI-ARRAY high bind plate, MSD), and incubated overnight at 4 C. to allow the VLPs to adhere. Nonspecific binding sites were blocked by 2% BSA (w/v) in PBS for 1 hour at room temperature. Supernatants containing antibodies produced from SARS CoV-2-immunized mice or infected human sera, along with media-only controls which were diluted 1:10 or 1:20 in 1 PBS+0.5% BSA buffer, were added to the plate-bound particles. The plates were then incubated for 1 hour at room temperature with shaking, after which the plates were washed with 1PBS to remove the unbound antibodies using an AquaMax2000 plate washer (MDS Analytical Technologies). The plate-bound antibodies were detected with a SULFO-TAG-conjugated anti-human IgG antibody (Jackson Immunoresearch) or a SULFO-TAG-conjugated anti-mouse IgG antibody (Jackson Immunoresearch) for 1 hour at room temperature. After washes, the plates were developed with the Read Buffer (MSD) according to manufacturer's recommended procedure and the luminescent signals were recorded with a SECTOR Imager 600 (Meso Scale Development) instrument. Direct binding signals (in RLU) were captured, and a ratio of SARS-CoV-2-S-expressing VLPs to the irrelevant VLP was calculated.
[0240] The ability of the anti-SARS-CoV-2-S monoclonal antibodies to bind to SARS-CoV-2-S-expressing VLPs compared with binding to irrelevant VSV-expressing VLPs was assessed using an immunobinding assay, as described above. Single-point binding to the immobilized VLPs on 96-well High Bind plates (MSD) was performed with an antibody supernatant dilution of 1:10 or 1:20, bound for 1 hour, and detected using SULFO-TAG-conjugated anti-human IgG or anti-mouse IgG antibody. The binding signals from electrochemiluminescence were recorded on a Sector Imager 600 (MSD). RLU values were determined for the antibody binding to VLPs. Ratios were calculated comparing the SARS-CoV-2-S-expressing VLP binding signals to control VLPs.
[0241] The binding results from three experiments are summarized in Table 5. A signal observed from SARS-COV-2-S-expressing VLPs indicates binding, while comparison with negative VLPs provides a relative background. Media alone samples provide baseline signals of secondary antibody binding to samples with no supernatant. The 46 antibodies bound specifically at >4-fold higher than the media-only samples (20-35 RLU) on the SARS-CoV-2-S-expressing VLPs, with a range of binding signals from 85-13,600 RLU. The ratios of SARS-CoV-2-S-expressing VSV: VSV-VLPs (negative control) ranged from 1.1-22.7, with many having high background on VSV-VLPs. The ratio of mAb11002 of 0.9 is likely due to a low concentration of monoclonal antibody in the supernatant sample.
TABLE-US-00007 TABLE 5 SARS-COV-2-S VLP binding Ratio of VSV- Binding SARS- Signals: VSV- CoV-2-S VSV- VLP VLP SARS- Secondary Binding Binding COV-2- Supernatant Detection Signal Signal S/VSV- Supernatant Dilution Antibody (RLU) (RLU) VLP mAb10913 1:10 a-hFc 2155 3244 1.5 mAb10914 1:10 a-hFc 3885 5181 1.3 mAb10915 1:10 a-hFc 980 9022 9.2 mAb10932 1:10 a-hFc 989 10451 10.6 mAb10933 1:10 a-hFc 507 966 1.9 mAb10934 1:10 a-hFc 3876 5041 1.3 mAb10935 1:10 a-hFc 2087 3867 1.9 mAb10936 1:10 a-hFc 2325 8076 3.5 mAb10937 1:10 a-hFc 1404 1920 1.4 mAb10920 1:10 a-hFc 8366 10041 1.2 mAb10921 1:10 a-hFc 1194 5436 4.6 mAb10922 1:10 a-hFc 1473 2229 1.5 mAb10923 1:10 a-hFc 1224 1859 1.5 mAb10924 1:10 a-hFc 487 969 2 mAb10930 1:10 a-hFc 1769 3207 1.8 mAb10938 1:10 a-hFc 1232 6623 5.4 mAb10939 1:10 a-hFc 1777 5074 2.9 mAb10940 1:10 a-hFc 606 2072 3.4 mAb10941 1:10 a-hFc 673 4588 6.8 mAb10982 1:10 a-hFc 1178 2016 1.7 mAb10984 1:10 a-hFc 2486 8989 3.6 mAb10985 1:10 a-hFc 2049 3279 1.6 mAb10986 1:10 a-hFc 2044 10831 5.3 mAb10987 1:10 a-hFc 1839 2450 1.3 mAb10988 1:10 a-hFc 1832 2305 1.3 mAb10989 1:10 a-hFc 672 1999 3 mAb10969 1:10 a-hFc 3096 3313 1.1 mAb10970 1:10 a-hFc 1364 5712 4.2 mAb10971 1:10 a-hFc 1135 7266 6.4 mAb10964 1:10 a-hFc 1439 8601 6 mAb10965 1:10 a-hFc 743 1370 1.8 mAb10966 1:10 a-hFc 1428 6574 4.6 mAb10967 1:10 a-hFc 1446 9510 6.6 mAb10954 1:10 a-hFc 641 6308 9.8 mAb10955 1:10 a-hFc 932 1788 1.9 mAb10956 1:10 a-hFc 1030 1581 1.5 mAb10957 1:10 a-hFc 604 5544 9.2 mAb10977 1:10 a-hFc 4141 13600 3.3 mAb11010 1:20 a-mFc 96 363 3.8 mAb11004 1:20 a-mFc 110 406 3.7 mAb11000 1:20 a-mFc 333 592 1.8 mAb11006 1:20 a-mFc 165 3747 22.7 mAb11008 1:20 a-mFc 103 324 3.1 mAb10998 1:20 a-mFc 74 218 2.9 mAb10996 1:20 a-mFc 51 85 1.7 mAb11002 1:20 a-mFc 156 146 0.9 Media only 1:10 a-hFc 30 35 1.2 Media only 1:20 a-mFc 35 20 0.6 Media only 1:10 a-hFc 39 29 0.7
Example 5: Antibody Neutralization of VSV-SARS-CoV-2-S Pseudovirus Infectivity
[0242] To investigate the ability of a panel of anti-SARS-CoV-2-S monoclonal antibodies to neutralize SARS-CoV-2, an in vitro neutralization assay utilizing VSV-SARS-CoV-2-S pseudovirus was developed.
[0243] As described above, VSV pseudotype viruses were generated by transiently transfecting 293T cells with a plasmid encoding for SARS-CoV-2 spike protein. Cells were seeded in 15 cm plates at 1.210.sup.7 cells per plate in DMEM complete media one day prior to transfection with 15 g/plate spike protein DNA using 125 L Lipofectamine LTX, 30 L PLUS reagent, and up to 3 mL Opti-Mem. 24 hours post transfection, the cells were washed with 10 mL PBS, then infected with an MOI of 0.1 VSV.sup.G:mNeon virus in 10 mL Opti-Mem. Virus was incubated on cells for 1 hour, with gentle rocking every 10 minutes. Cells were washed 3 times with 10 mL PBS, then overlaid with 20 mL Infection media before incubation at 37 C, 5% CO.sub.2 for 24 hours. Supernatant was collected into 250 mL centrifuge tubes on ice, then centrifuged at 3000 rpm for 5 minutes to pellet any cellular debris, aliquoted on ice, then frozen to 80 C. Infectivity was tested on Vero cells prior to use in neutralization assays. This material will be referred to as VSV-SARS-CoV-2-S.
Neutralization Assay with VSV-SARS-CoV-2-S
[0244] On day 1, Vero cells were seeded at 80% confluency in T225 flasks. To seed cells, media was removed from the cells, the cells were washed with 20 mL PBS (Gibco: 20012-043), and 5 mL TrypLE was added and incubated for 5 minutes at 37 C. until the cells dislodged. 5 mL of complete DMEM was added to inactivate the trypsin, and pipetted up and down to distribute the cells. To count the resuspended cells, 20,000 Vero cells were plated in 100 prewarmed Complete DMEM per well in a 96 Well Black Polystyrene Microplate (Corning: 3904).
[0245] On day 2, VSV-SARS-CoV-2-S was thawed on ice and diluted 1:1 with infection media.
[0246] In a V-bottom 96 well plate, a dilution of each supernatant was generated in 60 ul infection media. For media (negative) controls, 60 l of diluted conditioned media was added to the wells. 60 L of diluted VSV-SARS-CoV-2-S were added to every well except the media control wells. To those wells, 60 L of infection media was added. Pseudoviruses were then incubated with supernatant dilutions for 30 minutes at room temperature. Media was removed from the Vero cell plates, 100 L of supernatant/pseudovirus mixtures were transferred to the cells, and the plate was incubated at 37 C., 5% CO.sub.2 for 24 hours. The final supernatant dilutions of 1:4 and 1:20, and for some samples 1:100, were used to assess neutralization of VSV-SARS-CoV-2-S pseudoviruses.
[0247] On day 3, after the 24 hr incubation, supernatant was removed from the cell wells and replaced with 100 L of PBS. The plates were then read on a SpectraMax i3 with MiniMax imaging cytometer.
[0248] The ability of the anti-SARS-CoV-2-S antibodies to neutralize VSV-based SARS-CoV-2-S-expressing pseudotyped virus was assessed using a neutralization fluorescence focus assay. The binding results of three assays are summarized below. The neutralization potency of antibody at each dilution is represented as a percentage compared to mock supernatant control. All antibodies demonstrated neutralization capacity, and particularly for the set of antibodies that were evaluated 1:100, those showing higher neutralization may represent more potent neutralization capacity.
TABLE-US-00008 TABLE 6 Neutralization of VLPs Neutralization Neutralization Neutralization Supernatant (1:4 dilution) (1:20 dilution) (1:100 dilution) mAb10913 99.5 95.5 69.1 mAb10914 94.2 74.8 43.6 mAb10915 96.7 74.2 29.6 mAb10932 99.8 94.6 68 mAb10933 99.8 98.9 88.4 mAb10934 99.9 99.8 98.4 mAb10935 99.6 98.5 88.8 mAb10936 99.7 99.1 92.9 mAb10937 97.5 87.7 56.3 mAb10920 99.5 95.5 69.1 mAb10921 98.2 91.4 46.1 mAb10922 99.8 99.1 88.4 mAb10923 99.5 92.9 67.7 mAb10924 98.1 85.4 55.2 mAb10930 99.1 91.1 59 mAb10938 98.1 83 54.2 mAb10939 98.6 90.5 64 mAb10940 97 89.9 66.4 mAb10941 98.9 92.9 73.8 mAb10982 97.4 83.8 44.5 mAb10984 99.8 95.1 83.4 mAb10985 99.7 88.4 63.5 mAb10986 99.7 98 86 mAb10987 99.3 97.7 94.6 mAb10988 97.6 87.6 62.2 mAb10989 100 99.8 98.2 mAb10969 97.2 91 63.7 mAb10970 99.6 96.7 82.4 mAb10971 99.5 97 73.9 mAb10964 99.7 99.7 94.1 mAb10965 98.5 87.6 68.6 mAb10966 99.5 95.5 76.2 mAb10967 98.9 91.4 69.2 mAb10954 99.8 96 70.7 mAb10955 98.8 88.6 62.7 mAb10956 97.1 84.1 61.6 mAb10957 97.6 76.4 48 mAb10977 95.5 79 47.7 mAb11010 85 54 NT mAb11004 77 40 NT mAb11000 98 82 NT mAb11006 91 54 NT mAb11008 96 77 NT mAb10998 88 59 NT mAb10996 85 58 NT mAb11002 35 1 NT *NT: not tested
Example 6: Characterization of Antibodies in an Antibody-Dependent Cell-Mediated Toxicity Surrogate Assay
[0249] The ability of antibodies targeting the spike protein of SARS-CoV-2 to interact with FcR3a, an Fc-receptor prominently expressed on natural killer (NK) cells that induces antibody dependent cell-mediated cytotoxicity (ADCC), was measured in a surrogate bioassay using reporter cells and target cells bound to antibodies. This assay used Jurkat T cells that were engineered to express the reporter gene luciferase under the control of the transcription factor NFAT (NFAT-Luc) along with the high affinity human FcR3a .sup.176Val allotype receptor (Jurkat/NFAT-Luc/hFcR3a .sup.176Val). Target cells were engineered Jurkat T cells expressing human CD20 (used as a positive control with a CD20-targeting human IgG1 antibody) and the full-length SARS-CoV-2 spike protein controlled by a doxycycline-inducible promoter. Reporter cells were incubated with target cells and engagement of FcR3a via the Fc domain of human IgG1 antibodies bound to target cells led to the activation of the transcription factor NFAT in the reporter cells and drove the expression of luciferase which was then measured via a luminescence readout.
[0250] Jurkat T cells were engineered to constitutively express full length human CD20 (amino acids M1-P297 of NCBI accession number NP_690605.1), Tet3G transactivator protein (cloned using a Takara pEF1-Tet3G Vector, Catalog #631167), as well as a doxycycline-inducible full-length SARS-CoV-2 spike protein (amino acids M1-T1273 of NCBI accession number YP_009724390.1). Engineered Jurkat/Tet3G/hCD20/SARS-CoV2 spike protein-expressing cells were sorted for high expression of the spike protein and subsequently maintained in RPMI+10% Tet-free FBS+P/S/G+500 g/ml G418+1 g/ml puromycin+250 g/ml hygromycin growth medium.
[0251] Jurkat T cells were engineered to stably express a Nuclear Factor of Activated T-cells (NFAT) luciferase reporter construct along with the high affinity human FcR3a .sup.176Val allotype receptor (amino acids M1-K254 of NCBI accession number P08637 VAR 003960). Engineered reporter cells were maintained in RPMI1640+10% FBS+P/S/G+0.5 g/ml puromycin+500 g/ml G418 growth media.
[0252] 36 hours prior to the start of the surrogate ADCC assay, 510.sup.5 target cells/ml were induced in RPMI+10% Tet-free FBS+P/S/G cell culture media containing 1 g/ml doxycycline (Sigma). A day before the experiment, reporter cells were split to a density of 7.510.sup.5 cells/ml in RPMI 1640+10% FBS+P/S/G+0.5 g/ml puromycin+500 g/ml G418 growth media.
[0253] Briefly, on the day of the experiment, the target and reporter cells were transferred into assay media (RPMI+10% Tet-free FBS+P/S/G) and added at a 3:2 ratio (310.sup.4/well target cells and 210.sup.4/well reporter cells) to 384-well white microtiter plates, followed by the addition of anti-SARS-CoV-2-S antibody supernatant of varying concentrations. A positive control (CD20 antibody with human IgG1) sample and a negative control sample containing no antibody was included on each plate to normalize detected ADCC activities of anti-SARS-CoV-2-S antibody supernatants. Plates were incubated at 37 C./5% CO.sub.2 for 5 h followed by the addition of an equal volume of ONE-Glo (Promega) reagent to lyse cells and detect luciferase activity. The emitted light was captured in Relative Light Units (RLU) on a multi-label plate reader Envision (PerkinElmer), and data was analyzed and normalized using the following equation:
[0254] The ability of anti-SARS-COV-2-S antibodies to activate FcR3a receptors was evaluated in a surrogate ADCC assay using Jurkat/NFAT-Luc/FcR3a .sup.176 Val) as reporter cells and Jurkat/hCD20/SARS-CoV2 Spike as target cells. Each antibody tested contained an IgG1 domain.
[0255] Table 7 summarizes the results, showing the raw luciferase activity and the calculated % of positive control are indicated. A range of % ADCC activity was observed indicating FcR3a activation by the antibody supernatants. All samples demonstrated some measure of surrogate ADCC activity, and 10 of the antibody supernatants demonstrated surrogate ADCC activity better than observed in positive controls.
TABLE-US-00009 TABLE 7 ADCC surrogate activity of anti-SARS-CoV-2-S antibody supernatants. ADCC ADCC Mean (Activity mAb RLU (%) mAb10913 11,480 111.9 mAb10914 21,960 265.8 mAb10915 14,280 153 mAb10932 13,020 108.8 mAb10933 9,740 68.5 mAb10934 11,680 92 mAb10935 11,540 90.4 mAb10936 15,160 133.8 mAb10937 12,340 100.1 mAb10920 15,480 137.8 mAb10921 10,080 67.7 mAb10922 9,140 56.3 mAb10923 13,340 107.1 mAb10924 7,220 33 mAb10930 8,900 53.4 mAb10938 12,960 102.5 mAb10939 9,440 59.7 mAb10940 12,520 106.2 mAb10941 10,340 77.2 mAb10982 7,900 59.4 mAb10984 6780 6.8 mAb10985 5840 2.8 mAb10986 6200 4.4 mAb10987 12020 29.4 mAb10988 7200 8.7 mAb10989 10200 21.5 mAb10969 10500 23.1 mAb10970 7640 10.6 mAb10971 7480 10 mAb10964 6380 5.1 mAb10965 6780 6.9 mAb10966 7080 10.4 mAb10967 6740 8.6 mAb10954 6940 9.8 mAb10955 6740 8.7 mAb10956 6760 8.8 mAb10957 7120 10.8 mAb10977 12980 33.8
Example 7: Anti-SARS-CoV-2-S Antibody Binding Specificity Assay
[0256] A Luminex binding assay was performed to determine the binding of anti-SARS-COV-2-S antibodies to a panel of antigens. For this assay, antigens were amine-coupled or captured by streptavidin to Luminex microspheres as follows: approximately 10 million MagPlex microspheres (Luminex Corp., MagPlex Microspheres, Cat. No. MC10000 and MC12000), were resuspended by vortexing in 500 L 0.1M NaPO.sub.4, pH 6.2 (activation buffer) and then centrifuged to remove the supernatant. Microspheres were protected from light, as they are light sensitive. The microspheres were resuspended in 160 L of activation buffer and the carboxylate groups (COOH) were activated by addition of 20 L of 50 mg/mL of N-hydroxysuccinimide (NHS, Thermo Scientific, Cat. No. 24525) followed by addition of 20 L of mg/mL 1-ethyl-3-[3-dimethylaminopropyl]carbodiimide (EDC, ThermoScientific, Cat. No. 22980) at 25 C. After 10 minutes, the pH of the reaction was reduced to 5.0 with the addition of 600 L 50 mM MES, pH 5 (coupling buffer), and the microspheres were vortexed and centrifuged to remove supernatant. The activated microspheres were immediately mixed with 500 L of 25 g/mL of the protein antigen or Streptavidin in coupling buffer and incubated for two hours at 25 C. The coupling reaction was quenched by addition of 50 L of 1M Tris-HCl, pH 8.0 and the microspheres were vortexed, centrifuged, and washed three times with 800 L of PBS 0.005% (Tween20 0.05%), to remove uncoupled proteins and other reaction components. Microspheres were resuspended in 1 mL of PBS 2% BSA 0.05% Na Azide at 10 million microspheres/mL. For Streptavidin capture of antigens, 500 L of 12.5 g/mL of biotinylated protein in PBS was added to Streptavidin-coupled microspheres and incubated for one hour at 25 C. Microspheres were vortexed, centrifuged, and washed three times with 800 L of PBS, and then blocked using 500 L 30 mM Biotin (Millipore-Sigma, Cat. No. B4501) in 0.15M Tris pH 8.0. Microspheres were incubated for 30 minutes then vortexed, centrifuged, and washed three times with 800 L of PBS. Microspheres were resuspended in 1 mL of PBS 2% BSA 0.05% Na Azide at 10 million microspheres/mL.
[0257] Microspheres for the different proteins and biotinylated proteins were mixed at 2700 beads/ml, and 75 L of microspheres were plated per well on a 96 well ProcartaPlex flat bottom plate (ThermoFisher, Cat. No: EPX-44444-000) and mixed with 25 L of individual anti-SARS-CoV-2 supernatant containing antibody. Samples and microspheres were incubated for two hours at 25 C. and then washed twice with 200 L of DPBS with 0.05% Tween 20. To detect bound antibody levels to individual microspheres, 100 L of 2.5 g/mL R-Phycoerythrin conjugated goat F(ab)2 anti-human kappa (Southern Biotech, Cat #2063-09) in blocking buffer (for antibodies with murine Fc regions) or 100 L of 1.25 g/mL R-Phycoerythrin AffiniPure F(ab).sub.2 Fragment Goat Anti-Mouse IgG, F(ab)2 Fragment Specific (Jackson Immunoresearch, Cat. No: 115-116-072) in blocking buffer (for antibodies with human Fc regions), was added and incubated for 30 minutes at 25 C. After 30 minutes, the samples were washed twice with 200 l of washing buffer and resuspended in 150 L of wash buffer. The plates were read in a Luminex FlexMap 3D (Luminex Corp.) and Luminex xPonent software version 4.3 (Luminex Corp.). The SARS-CoV-2 proteins used in the assay are as follows: [0258] RBD_(R319-F541).mmh: SEQ ID NO: 829 [0259] RBD_(R319-F541).mFc: SEQ ID NO: 830 [0260] RBD_(R319-F541).hFc): SEQ ID NO: 831
[0261] The results of the Luminex binding are shown in Table 8 and Table 9 as median fluorescence intensity (MFI) signal intensities. The results show that the 46 anti-SARS-CoV-2-S antibody supernatants bound specifically to SARS-CoV-2-S RBD proteins. These results also show that five of these antibodies cross-react with SARS Coronavirus spike RBD proteins with binding signal greater than 1000 MFI.
TABLE-US-00010 TABLE 8 Binding signal (MFI) of SARS-CoV-2 Spike RBD, SARS-CoV-2 Spike S1, SARS RBD, SARS Spike S1, MERS Spike and MERS RBD proteins to anti-SARS-CoV-2 monoclonal antibodies (with hFc) SARS-CoV-2 SARS- SARS- Bt- Bt- CoV-2 CoV-2 SARS- SARS- SARS- SARS- SARS- SARS- Spike Spike CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 SARS- Protein Protein Spike Spike Spike Spike Spike Spike CoV-2 (S1 (S1 Protein Protein Protein Protein Protein Protein Spike (RBD, Subunit, Subunit, (RBD) (RBD) (RBD) (RBD) (RBD) (RBD) Fc Tag) Fc Tag) His Tag) (R319- (R319- (R319- (R319- (R319- (R319- (Sino (Sino (Sino Super- F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. 40592- 40591- 40591- natant mmH mmH mFc mFc mFc hFc V05H) V02H) V08H) mAb10913 30709 29247 16645 33023 27452 31929 31561 18899 24931 mAb10914 31967 29650 15986 30740 25957 30464 30591 14914 21609 mAb10915 31795 30293 20062 31772 30625 32437 31267 17595 22917 mAb10932 29984 30133 17697 30640 26220 30559 29880 17627 22099 mAb10933 33356 32090 19383 34944 30110 35106 34484 21178 27509 mAb10934 33797 32649 21238 34325 33016 35841 33636 20643 27483 mAb10935 34853 32603 19328 35886 31444 35611 35037 19991 25554 mAb10936 33947 32305 21636 33740 32810 33912 33613 19487 25187 mAb10937 33866 32225 19689 34233 31501 34624 33878 19553 26404 mAb10920 34842 34440 20254 36415 31708 36828 36277 21085 28516 mAb10921 24977 23596 11307 19429 18186 22306 21766 8959 12212 mAb10922 31768 30755 18629 32355 27854 33609 31376 18287 24678 mAb10923 35208 34289 19593 37372 33555 37756 36324 22502 28855 mAb10924 29730 27987 17044 28308 26898 28744 28423 15672 20577 mAb10930 25119 25131 16563 28560 25922 28870 28744 16530 21151 mAb10938 29409 27069 17205 30533 24638 29593 29134 15431 21163 mAb10939 32196 30883 18746 33900 28857 32864 32472 18171 23928 mAb10940 35221 35290 21000 35978 30675 36507 34945 21350 25807 mAb10941 32392 31171 20428 34061 28431 33347 33232 19668 26738 mAb10982 24263 22180 12278 23296 19935 23020 23066 10847 14017 mAb10984 27854 26197 17054 28350 22479 28442 27808 15590 19245 mAb10985 30214 27854 15488 29443 24827 31054 28936 16219 20787 mAb10986 27187 25196 15921 28407 23388 27693 27693 16034 19061 mAb10987 32171 29074 16736 33115 26059 32757 31238 17465 23089 mAb10988 23858 22160 12659 26095 21793 24822 23949 12910 16208 mAb10989 17687 17286 11189 19568 16117 22435 19316 12263 14234 mAb10969 29550 27587 15391 31386 26565 31042 30950 18466 23959 mAb10970 33154 31662 20184 34739 29182 34991 34704 21047 24625 mAb10971 29355 28850 16660 28746 24602 30032 29848 16986 21579 mAb10964 31754 28907 19225 32420 27736 33074 32317 18650 24154 mAb10965 30812 26863 13707 27139 23351 29618 28034 14133 18864 mAb10966 30939 27440 17905 30363 25115 30778 29869 16403 23308 mAb10967 28453 26496 16771 29650 24263 28660 28061 15776 21869 mAb10954 30410 28281 18394 31284 24677 31768 29604 16626 21270 mAb10955 29627 28476 16785 30790 24689 31227 31054 17858 22675 mAb10956 27900 25690 12891 28349 24505 30225 28810 15013 19981 mAb10957 23411 20615 10566 18692 16725 22560 20258 8451 11989 mAb10977 16770 14605 8845 13827 12774 15216 16783 6476 9406 Binding signal (MFI) of SARS-CoV-2 Spike RBD, SARS-CoV-2 Spike S1, SARS RBD, SARS Spike S1, MERS Spike and MERS RBD proteins to anti-SARS-CoV-2 monoclonal antibodies (with hFc) MERS MERS- MERS- MERS- CoV CoV SARS MERS- CoV MERS- (NCoV/ (NCoV/ Human Human Human CoV (SARS- CoV Novel Novel SARS SARS SARS (SARS- CoV-2) (SARS- corona- corona- Corona- Corona- Corona- CoV-2) Spike CoV-2) virus) virus) virus virus virus Spike Protein Spike Spike Spike Spike Spike Spike Protein S2 Protein Protein Protein Protein Protein S1 (ECD, (aa S1 fragment S1 (Receptor (Receptor Subunit aa 726- (aa (RBD, Protein Binding Binding Protein 1-1297, 1296, 1-725, aa 367- (aa 1- Domain) Domain, (His His His His 606, His 725, His Bt- rabbit Fc His Tag) Tag) Tag) Tag) Tag) Tag) Tag) MERS .Math. MERS .Math. MERS .Math. (Sino (Sino (Sino (Sino (Sino (Sino (Sino (Sino mFc hFc hFc Super- 40150- 40150- 40150- 40069- 40070- 40069- 40071- 40069- (mAb26 (mAb26 (mAb26 natant V31B2) V08B2) V08B1) V08B) V08B) V08H) V08B1) V08B1) 63-L1) 64-L1) 64-L2) mAb10913 35 39 21 20 26 14 34 26 29 28 29 mAb10914 47 39 22 19 28 15 31 23 86 71 49 mAb10915 42 40 21 18 23 15 31 24 86 91 56 mAb10932 34 26 19 14 19 12 26 19 60 49 40 mAb10933 39 31 18 14 19 14 24 17 22 21 26 mAb10934 38 27 18 15 18 10 24 20 77 68 47 mAb10935 37 25 21 15 18 14 25 17 74 67 42 mAb10936 46 36 20 19 21 13 29 20 32 26 32 mAb10937 44 50 21 19 26 14 27 22 21 23 29 mAb10920 59 68 26 24 30 13 39 27 38 35 44 mAb10921 35 31 19 19 19 12 23 18 55 44 39 mAb10922 36 41 18 19 18 9 29 22 20 21 24 mAb10923 53 66 29 23 36 14 37 25 24 29 39 mAb10924 41 30 18 17 19 12 29 22 19 22 28 mAb10930 42 49 19 16 20 14 27 22 29 24 29 mAb10938 38 36 19 16 19 13 25 20 86 65 46 mAb10939 38 50 19 16 18 14 27 19 41 27 30 mAb10940 32 28 20 15 18 11 22 19 18 21 25 mAb10941 45 37 22 19 22 15 30 24 82 69 47 mAb10982 30 54 24 17 21 13 29 20 64 60 42 mAb10984 33 31 22 21 25 13 29 20 237 341 172 mAb10985 31537 32343 22721 18 28 14 31 22 168 195 159 mAb10986 39 38 21 15 19 14 27 20 233 286 184 mAb10987 33 27 22 15 23 15 28 23 196 235 172 mAb10988 41 67 25 17 29 14 32 25 169 181 130 mAb10989 47 73 21 16 22 11 24 19 161 206 186 mAb10969 37 34 20 16 20 11 26 19 21 22 29 mAb10970 38 25 19 14 16 15 23 17 35 23 28 mAb10971 32 31 20 15 13 13 20 19 44 29 24 mAb10964 19999 23855 5186 15 17 13 20 19 19 22 26 mAb10965 30 23 16 19 20 12 26 23 58 53 43 mAb10966 35 21 20 16 16 12 24 16 56 53 42 mAb10967 35 30 21 17 19 13 23 21 61 71 45 mAb10954 30 26 15 17 16 10 18 21 57 61 41 mAb10955 36 21 14 15 18 16 20 19 57 48 42 mAb10956 32 24 16 15 16 13 22 24 58 49 41 mAb10957 32 22 16 15 18 11 22 19 40 29 28 mAb10977 36 28 23 17 19 13 24 21 17 20 25
TABLE-US-00011 TABLE 9 Binding signal (MFI) of SARS-CoV-2 RBD, SARS-CoV-2 Spike S1, SARS RBD, SARS Spike S1, MERS SPIKE and MERS RBD proteins to anti-SARS-CoV-2-S monoclonal antibodies (with mFc) SARS-CoV-2 Bt- Bt- SARS- SARS- SARS- SARS- SARS- SARS- SARS- SARS- CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 SARS- CoV-2 CoV-2 Spike Spike Spike Spike Spike Spike CoV-2 (2019-nCoV) (2019-nCoV) Protein Protein Protein Protein Protein Protein Spike Spike Spike (RBD) (RBD) (RBD) (RBD) (RBD) (RBD) (RBD, Protein Protein (R319- (R319- (R319- (R319- (R319- (R319- Fc (S1 (S1 Subunit, F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. Tag) Subunit, Fc His mmH mmH mFc mFc mFc hFc (Sino Tag) (Sino Tag) (Sino Super- (mAb10 (mAb10 (mAb10 (mAb10 (mAb10 (mAb10 40592- 40591- 40591- natant 620-L1) 620-L2) 621-L2) 621-L1) 622-L2) 622-L1) V05H) V02H) V08H) t mAb11010 11024 12885 9349 14432 15688 8880 9628 5136 10794 mAb11004 3350 11337 4299 4583 7625 4877 6905 4482 9526 mAb11000 17802 10971 11335 23007 11593 22316 5671 9356 5415 mAb11006 5134 4744 1396 2866 3812 3985 3749 2052 1037 mAb11008 4047 3178 3047 4260 4106 2570 2311 6880 1419 mAb10998 1847 3837 2228 2230 467 1740 2005 724 717 mAb10996 9142 2906 4319 8738 5398 2084 16101 1425 6232 mAb11002 11558 10181 2197 9530 5471 9382 8461 1107 2867 Binding signal (MFI) of SARS-CoV-2 RBD, SARS-CoV-2 Spike S1, SARS RBD, SARS Spike S1, MERS SPIKE and MERS RBD proteins to anti-SARS-CoV-2-S monoclonal antibodies (with mFc) MERS MERS- MERS- MERS- CoV MERS- MERS- CoV CoV SARS (NCoV/ CoV CoV (NCoV/ (NCoV/ Human Human Human Novel (NCoV/ (NCoV/ Novel Novel SARS SARS SARS corona- Novel Novel corona- corona- Corona- Corona- Corona- virus) corona- corona- virus) virus) virus virus virus Spike virus) virus) Spike Spike Spike Spike Spike Protein Spike Spike Protein Protein Protein Protein S1 (ECD, Protein Protein fragment S1 (Receptor (Receptor Subunit aa 1- S2 (aa S1 (aa (RBD, Protein Binding Binding Protein 1297, 726-1296, 1-725, aa 367- (aa 1- Domain) Domain, (His His His His 606, His 725, His Bt- rabbit Fc His Tag) Tag) Tag) Tag) Tag) Tag) Tag) MERS. MERS. MERS. (Sino (Sino (Sino (Sino (Sino (Sino (Sino (Sino mFc hFc hFc Super- 40150- 40150- 40150- 40069- 40070- 40069- 40071- 40069- (mAb2663- (mAb2664- (mAb2664- natant V31B2) V08B2) V08B1) V08B) V08B) V08H) V08B1) V08B1) L1) L1) L2) mAb11010 18276 16793 7421 7 14 14 19 18 134 28 28 mAb11004 5524 740 33 15 20 12 26 17 228 24 25 mAb11000 39 31 18 13 19 9 27 17 384 82 49 mAb11006 615 667 339 18 17 13 15 18 156 16 24 mAb11008 120 174 31 18 16 15 20 18 45 19 32 mAb10998 29 37 16 19 18 14 24 19 48 29 32 mAb10996 1355 1279 28 13 21 14 26 18 185 132 95 mAb11002 80 56 31 10 22 13 25 18 288 52 32
Example 8: Anti-SARS-CoV-2-S Antibody Diversity Assay
[0262] A binding assay was performed to determine the binding profile of anti-SARS-COV-2-S antibodies. For this assay, antigens were amine coupled as described for the Luminex binding assay above. Briefly, approximately 9 million MagPlex microspheres for 16 different bead regions (Luminex Corp., MagPLex Microspheres, Cat. No. MagPLex MC10000 and MC12000), were resuspended by vortexing in 500 L 0.1M NaPO.sub.4, pH 6.2 and then centrifuged to remove the supernatant. The microspheres were resuspended in 160 L of activation buffer and the carboxylate groups (COOH) were activated by addition of 20 L of 50 mg/mL of N-hydroxysuccinimide (NHS, Thermo Scientific, Cat #24525) followed by addition of 20 L of 50 mg/mL of 1-ethyl-3-[3-dimethylaminopropyl]carbodiimide (EDC, ThermoScientific, Cat #22980) at 25 C. After 10 minutes, the pH of the reaction was reduced to 5.0 with the addition of 600 L of 50 mM MES, pH 5 (coupling buffer), and the microspheres were vortexed and centrifuged to remove supernatant. The activated microspheres were immediately mixed with 500 L of 20 g/mL of SARS-CoV-2 Spike Protein (RBD)(R319-F541)-mmH in coupling buffer and incubated for two hours at 25 C. The coupling reaction was quenched by addition of 50 L of 1M Tris-HCl, pH 8.0 and the microspheres were vortexed, centrifuged, and washed three times with 1000 L of PBS. Microspheres were resuspended in 250 L of PBS at 9 million microspheres/mL.
[0263] 15 out of the 16 microsphere regions with amine-coupled protein were modified for the binning assay as follows: microspheres were washed twice with PBS 5% DMSO, and 500 l of a chemical or enzyme were dissolved per manufacturing recommendations and added at 10 nM to the amine-coupled microspheres described above. This was subsequently vortexed and incubated for 2 hours at room temperature with rotation. Wash microspheres 3 times with PBS 2% BSA. Microspheres were resuspended in 1 mL of PBS at 9 million microspheres/mL.
[0264] Protein-modified and protein-unmodified (intact) microspheres were mixed at 2700 beads/ml, and 75 L of microspheres were plated per well on a 96 well ProcartaPlex 96 well flat bottom plate (ThermoFisher, Cat. No: EPX-44444-000) and mixed with 25 L of individual anti-SARS-CoV-2-S supernatant-containing antibody. Samples and microspheres were incubated for two hours at 25 C. and then washed twice with 200 L of DPBS with 0.05% Tween 20. To detect bound antibody levels to individual microspheres, 100 L of 2.5 g/mL R-Phycoerythrin conjugated goat F(ab)2 anti-human kappa (Southern Biotech, Cat #2063-09) in blocking buffer (for antibodies with hFc), or 100 L of 1.25 g/mL R-Phycoerythrin AffiniPure F(ab)2 Fragment Goat Anti-Mouse IgG, F(ab)2 Fragment Specific (Jackson Immunoresearch, Cat. No: 115-116-072) in blocking buffer (for antibodies with mFc), or 100 L of 1.25 g/mL R-Phycoerythrin Anti-His (Biolegend, Cat. No: 362603) in blocking buffer (for ACE-2 control, R&D, Cat. No. 933-ZN), was added and incubated for 30 minutes at 25 C. After 30 minutes, the samples were washed twice with 20011.1 of washing buffer and resuspended in 150 L of wash buffer. The plates were read in FlexMap 3D (Luminex Corp.) and Luminex xPonent software version 4.3 (Luminex Corp.).
[0265] The results of the Luminex binning results are shown in Table 10 as median fluorescence intensity (MFI) signal intensities. To determine clusters, data was normalized to the intact protein (unmodified microspheres) and clustered. The 46 anti-SARS-CoV-2 antibodies were classified in 9 clusters with 2 or more antibodies, and 11 antibodies were classified as single nodes. Clusters were assigned by based on these results of the hierarchical clustering and dendrogram. These results show that the 46 anti-SARS-CoV-2-S antibody supernatants had diverse binding characteristics and profiles, suggesting that the collection of antibodies bound to different epitopes on the SARS-CoV-2 spike protein.
TABLE-US-00012 TABLE 10 Binding signal (MFI) and cluster assignment of anti-SARS-CoV-2-S monoclonal antibodies to SARS-COV-2-S RBD .Math. mmH (unmodified and chemically or enzymatically modified) UN- MOD1- MOD2- MOD3- MOD4- MOD5- MOD6- MOD7- MODIFIED- SARS- SARS- SARS- SARS- SARS- SARS- SARS- SARS- CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 Spike Spike Spike Spike Spike Spike Spike Spike Protein Protein Protein Protein Protein Protein Protein Protein (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R3 319- 319- 319- 319- 319- 319- 319- CLUS- 19-F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. Sample TER mmH mmH mmH mmH mmH mmH mmH mmH Human_ACE2 1 5727 873 5119 1852 5106 202 5408 5013 (10 nM) Human_ACE2 1 10681 1447 10320 2260 9661 559 9593 8624 (100 nM) Human_ACE2 1 9269 991 8238 2185 7707 391 7859 7577 (50 nM) mAb10969 3 28551 54 24177 425 26049 3546 20577 23878 mAb10965 3 28080 38 21996 135 25727 3250 22419 24062 mAb10913 4 31694 102 28389 23270 29344 5018 28738 27854 mAb10920 4 35534 162 26783 28090 32185 7105 32942 30958 mAb10923 4 38711 153 32305 33866 36082 7540 35335 33924 mAb10930 4 29502 110 21579 21533 27843 6195 26600 25103 mAb10940 4 38871 94 34337 33453 36690 7817 36128 34544 mAb10989 4 19671 49 16697 18260 15785 3369 19568 15206 mAb11006 4 2044 30 705 3773 2553 517 2024 2503 mAb10934 5 33057 81 27716 25092 31664 6648 30801 29926 mAb10924 5 39205 118 32707 29366 36507 6378 35565 34210 mAb10939 5 33647 62 24895 26392 31390 6276 31275 29594 mAb10988 5 23009 68 15983 14842 20830 3536 20176 19499 mAb10957 5 20879 52 15728 19383 19993 3582 17727 17989 mAb10914 6 36047 143 32282 26967 34199 7162 32787 31823 mAb10915 6 36690 159 32489 26427 33545 9731 33568 31823 mAb10932 6 34024 191 28833 28557 31560 9946 31123 29765 mAb10938 6 34522 174 28465 19403 31252 8932 29225 30918 mAb10941 6 36369 140 31868 26129 33637 9455 33154 31478 mAb10984 6 25759 109 22445 20925 24747 6880 23630 23895 mAb10985 6 27394 99 24286 22986 26151 5519 25874 25023 mAb10986 6 25414 118 20868 20557 23619 6591 23066 22813 mAb10977 6 16980 54 14108 16590 15851 3505 14528 12779 mAb10933 7 35267 69 30617 5243 32665 6161 32930 31043 mAb10982 7 27505 80 20338 6650 25051 4585 24178 23770 mAb10987 7 29327 54 25311 2235 27981 4110 27095 25690 mAb10935 8 31883 81 28683 12724 30329 6457 27417 27785 mAb10970 8 32271 94 26863 22547 30537 7029 27679 28333 mAb10971 8 27415 106 23890 22184 27850 6869 25337 25164 mAb10964 8 29963 122 23580 23419 27896 7085 27483 25968 mAb10921 9 31657 91 28216 18123 30441 6821 28629 28756 mAb10966 9 29489 85 22836 19866 25736 5869 24217 26013 mAb10967 9 26784 107 20787 13760 25104 6192 21329 23434 mAb10954 9 28476 74 21915 19038 26186 5948 25299 24332 mAb10955 9 28637 39 24585 21155 27912 4141 23849 24862 mAb10996 S1 3403 20 5275 164 5562 488 3042 9125 mAb10937 S2 33561 94 24890 104 31164 5904 30327 28675 mAb10936 S3 32919 136 26818 312 31261 7856 31008 29293 mAb10922 S4 33183 102 25384 1107 31348 5822 31313 29386 mAb11002 S5 9881 16 3348 155 8615 153 9542 7562 mAb10956 S6 24562 29 21685 19337 23769 2275 19422 21961 mAb11010 S7 6388 18 4155 5441 8832 384 7444 5766 mAb11008 S8 7096 26 926 1525 2776 198 2750 1007 mAb10998 S9 2557 18 247 1336 1524 104 2937 723 mAb11004 S10 6514 18 2205 604 3566 1155 4522 2229 mAb11000 S11 16670 19 3416 12787 13493 2009 17756 12409 Binding signal (MFI) and cluster assignment of anti-SARS-COV-2-S monoclonal antibodies to SARS-COV-2-S RBD .Math. mmH (unmodified and chemically or enzymatically modified) MOD8- MOD9- MOD10- MOD11- MOD12- MOD13- MOD14- MOD15- SARS- SARS- SARS- SARS- SARS- SARS- SARS- SARS- CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 CoV-2 Spike Spike Spike Spike Spike Spike Spike Spike Protein Protein Protein Protein Protein Protein Protein Protein (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R (RBD)(R 319- 319- 319- 319- 319- 319- 319- 319- F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. F541) .Math. Sample mmH mmH mmH mmH mmH mmH mmH mmH Human_ACE2 36 4500 4091 4618 4505 5094 4743 3173 (10 nM) Human_ACE2 36 6212 7922 8440 8957 8948 7927 5370 (100 nM) Human_ACE2 35 5518 6447 7064 7233 7600 7112 4407 (50 nM) mAb10969 154 18918 24407 22409 27036 24269 23672 14196 mAb10965 110 19061 22355 21414 25635 23144 23156 14072 mAb10913 15939 28645 27110 28878 31159 28971 27784 26272 mAb10920 17228 32758 31463 31910 35144 32185 32323 29949 mAb10923 20961 34187 33809 36323 38596 35381 33338 33131 mAb10930 10235 23744 24516 26738 27958 26968 25126 23951 mAb10940 14572 35967 34704 36070 39285 35462 34922 33614 mAb10989 6136 17756 15530 16838 15137 17411 18100 15946 mAb11006 299 2442 3749 1076 4622 2818 3344 3568 mAb10934 6410 31261 30364 30709 32873 30502 28591 27785 mAb10924 6594 32856 33797 35875 38424 34647 33476 31524 mAb10939 4808 28465 29444 30699 33475 30596 29721 27129 mAb10988 2980 18329 19660 20692 21770 20130 18948 16558 mAb10957 2171 17357 19487 18596 21247 18757 17810 16081 mAb10914 5475 31226 31467 33235 35175 32626 31100 29217 mAb10915 9277 33442 31984 32902 35462 31937 32397 30009 mAb10932 9711 30122 29074 30433 33379 30283 29880 26795 mAb10938 7536 28109 30308 31264 33394 30814 30538 27751 mAb10941 7518 29802 31421 33958 35290 32925 31777 29159 mAb10984 3527 20212 22065 22318 26163 23227 22283 19349 mAb10985 6821 23642 23572 24654 27394 24677 24493 20787 mAb10986 2838 20672 21766 21720 25207 23400 22214 19694 mAb10977 4005 14193 12616 13320 16332 13632 14312 13136 mAb10933 1556 27705 29926 30801 34427 30409 30525 24367 mAb10982 1065 20361 23131 23247 26412 24027 23549 16765 mAb10987 1444 25621 25345 26335 29995 27049 26082 22871 mAb10935 2534 26151 27958 28752 30847 28522 27452 24816 mAb10970 1968 25233 27793 27610 31869 29871 26909 23775 mAb10971 1598 22587 25646 24384 27391 25761 24774 19590 mAb10964 2414 24740 25658 26439 29113 27243 26783 22405 mAb10921 941 23674 27586 27367 30969 28480 28331 21220 mAb10966 833 21800 24332 24977 27440 26554 24585 18580 mAb10967 574 19521 22352 22997 25506 22641 22836 17387 mAb10954 929 22237 24516 23457 28200 24897 24539 19717 mAb10955 1141 22191 24805 23688 27210 25575 24677 18944 mAb10996 28 8940 6336 6789 6229 5821 3484 1312 mAb10937 1231 27597 27092 29937 32116 29661 29386 20543 mAb10936 2916 29074 28775 30813 31711 29189 28522 21674 mAb10922 2248 29845 28629 30373 32931 30625 28962 23399 mAb11002 17 4144 6415 6790 8465 7688 6804 2016 mAb10956 331 16954 21282 21524 26646 21547 22767 15077 mAb11010 162 5567 6718 9557 12522 5287 5898 4915 mAb11008 60 2350 2759 2824 3301 2745 2130 2831 mAb10998 85 1611 2260 1206 2513 2186 727 1029 mAb11004 71 1465 12665 10667 5925 5531 11578 1144 mAb11000 56 14151 19230 17204 21718 17952 17117 5151
Example 9: Biacore Binding Kinetics of Anti-SARS-CoV-2-S Monoclonal Antibodies
[0266] Equilibrium dissociation constants (K.sub.D) for different SARS-CoV-2-S antibodies from primary supernatants from CHOt cells or from hybridomas were determined using a real-time surface plasmon resonance-based Biacore T200/Biacore 8K biosensor. All binding studies were performed in 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, and 0.05% v/v Surfactant Tween-20, pH 7.4 (HBS-ET) running buffer at 25 C. The Biacore CM5 sensor chip surface was first derivatized by amine coupling with either mouse anti-human Fc specific mAb or rabbit anti-mouse Fc monoclonal antibody (GE, Catalog #BR-1008-38) to capture anti-SARS-CoV-2 antibodies. Binding studies were performed on a human SARS-CoV-2 RBD extracellular domain expressed with a C-terminal myc-myc-hexahistidine tag (SARS-COV-2 RBD-MMH), SARS-CoV-2 RBD extracellular domain expressed with a C-terminal mouse IgG2a (SARS-COV-2 RBD-mFc), or SARS-CoV-2 RBD extracellular domain expressed with a C-terminal human IgG1 (SARS-COV-2 RBD-hFc). Single concentrations of SARS-COV-2 RBD-MMH, (100 nM); SARS-COV-2 RBD-mFc (50 nM), or SARS-COV-2 RBD-hFc (50 nM), prepared in HBS-ET running buffer, were injected for 1.5 minutes at a flow rate of 30 L/min while the dissociation of antibody-bound different SARS-CoV-2 RBD reagents was monitored for 2 minutes in HBS-ET running buffer. At the end of each cycle, the SARS-CoV-2 RBD antibody capture surface was regenerated using either a 10 sec injection of 20 mM phosphoric acid for the mouse anti-human Fc specific monoclonal antibody surface or a 40 sec injection of 10 mM Glycine, HCl, pH1.5 for the rabbit anti-mouse Fc specific polyclonal antibody. The association rate (k.sub.a) and dissociation rate (k.sub.d) were determined by fitting the real-time binding sensorgrams to a 1:1 binding model with mass transport limitation using BiaEvaluation software v3.1 or Biacore Insight Evaluation software v2.0. or curve-fitting software. Binding dissociation equilibrium constant (K.sub.D) and dissociative half-life (t.sub.1/2) were calculated from the kinetic rates as:
[0267] Binding kinetics parameters for different SARS-CoV-2 monoclonal antibodies binding to different anti-SARS-COV-2 RBD reagents of the invention at 25 C. are shown in Tables 11 and 12.
TABLE-US-00013 TABLE 11 Binding kinetics of SARS-COV-2 RBD-MMH binding to anti-SARS-CoV-2 monoclonal antibodies at 25 C. mAb 50 nM Capture Ag Level Bound k.sub.a k.sub.d KD t Supernatant (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10913 2010 381 4.91E+05 2.28E 4.64E 0.5 02 08 mAb10914 3169 174 3.49E+05 1.36E 3.89E 0.8 02 08 mAb10915 824 109 8.85E+04 3.18E 3.59E 36.3 04 09 mAb10932 2261 326 8.50E+04 1.26E 1.48E 92 04 09 mAb10933 1414 428 1.05E+06 4.08E 3.88E 2.8 03 09 mAb10934 2918 981 1.01E+06 4.35E 4.32E 2.7 03 09 mAb10935 3293 694 2.11E+05 3.99E 1.89E 2.9 03 08 mAb10936 2491 717 3.03E+05 8.81E 2.91E 13.1 04 09 mAb10937 1846 504 3.81E+05 5.73E 1.50E 2 03 08 mAb10920 1295 234 6.22E+05 2.20E 3.54E 0.5 02 08 mAb10921 1024 141 9.52E+04 4.99E 5.24E 23.1 04 09 mAb10922 2395 786 3.91E+05 2.00E 5.11E 5.8 03 09 mAb10923 1278 322 2.94E+05 6.04E 2.06E 1.9 03 08 mAb10924 766 166 1.97E+05 3.65E 1.85E 3.2 03 08 mAb10930 3137 328 8.90E+04 1.85E 2.08E 6.2 03 08 mAb10938 2167 180 6.60E+04 3.48E 5.28E 33.2 04 09 mAb10939 1505 241 1.69E+05 3.38E 2.00E 3.4 03 08 mAb10940 2149 698 3.34E+05 2.38E 7.15E 4.9 03 09 mAb10941 1811 288 9.85E+04 5.17E 5.25E 22.3 04 09 mAb10982 1096 188 1.32E+05 2.71E 2.06E 4.3 03 08 mAb10984 1654 387 1.55E+05 3.70E 2.39E 31.2 04 09 mAb10985 1974 749 9.41E+05 1.45E 1.54E 8 03 09 mAb10986 1560 524 3.21E+05 2.56E 7.97E 45.2 04 10 mAb10987 1242 356 4.50E+05 1.04E 2.32E 1.1 02 08 mAb10988 1227 291 1.27E+06 3.52E 2.77E 0.3 02 08 mAb10989 692 257 1.60E+06 3.14E 1.96E 3.7 03 09 mAb10969 2200 427 1.80E+05 4.71E 2.61E 2.5 03 08 mAb10970 1865 438 1.37E+05 7.99E 5.82E 14.4 04 09 mAb10971 1482 358 1.68E+05 4.49E 2.67E 25.8 04 09 mAb10964 1208 460 1.06E+06 7.56E 7.14E 15.3 04 10 mAb10965 1046 168 1.19E+05 2.73E 2.28E 4.2 03 08 mAb10966 1422 343 1.57E+05 4.40E 2.81E 26.3 04 09 mAb10967 1421 175 1.12E+05 1.08E 9.66E 106.9 04 10 mAb10954 1150 338 2.34E+05 4.05E 1.73E 28.5 04 09 mAb10955 1032 199 1.38E+05 2.69E 1.95E 4.3 03 08 mAb10956 1303 184 2.02E+05 5.31E 2.62E 2.2 03 08 mAb10957 736 163 1.34E+05 3.15E 2.35E 36.7 04 09 mAb10977 221 57 2.33E+05 7.17E 3.08E 16.1 04 09 mAb11010 1027 108 3.35E+05 1.48E 4.42E 7.8 03 09 mAb11004 1111 161 1.88E+05 3.12E 1.66E 3.7 03 08 mAb11000 381 16 1.40E+05 2.41E 1.72E 0.5 02 07 mAb11006 1118 49 8.97E+04 3.67E 4.10E 31.5 04 09 mAb11008 887 56 6.73E+04 4.00E 5.94E 2.9 03 08 mAb10998 1155 69 1.95E+05 2.28E 1.17E 0.5 02 07 mAb10996 616 28 1.53E+05 1.10E 7.18E 1.1 02 08 mAb11002 1070 8 3.21E+05 2.54E 7.93E 0.5 02 08
TABLE-US-00014 TABLE 12 Binding kinetics of SARS-COV-2 RBD-mFc or SARS-COV-2 RBD-hFc binding to anti-SARS-CoV-2-S monoclonal antibodies at 25 C. mAb 50 nM Capture Ag Level Bound k.sub.a k.sub.d KD t Supernatant (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10913 961 575 6.23E+05 1.52E 2.44E 76.1 04 10 mAb10914 1467 313 1.83E+05 1.00E 5.47E 1155* 05* 11 mAb10915 392 141 2.81E+05 1.00E 3.56E 1155* 05% 11 mAb10932 1060 372 2.42E+05 1.00E 4.13E 1155* 05* 11 mAb10933 681 465 1.23E+06 2.12E 1.73E 54.4 04 10 mAb10934 1401 949 1.41E+06 1.17E 8.32E 98.3 04 11 mAb10935 1667 830 3.83E+05 1.00E 2.61E 1155* 05* 11 mAb10936 1171 699 6.52E+05 1.00E 1.53E 1155* 05* 11 mAb10937 904 575 6.39E+05 7.28E 1.14E 158.7 05 10 mAb10920 617 357 7.02E+05 2.92E 4.16E 39.5 04 10 mAb10921 489 170 2.66E+05 1.00E 3.75E 1155* 05* 11 mAb10922 1286 828 7.19E+05 2.42E 3.36E 478.2 05 11 mAb10923 613 362 6.51E+05 2.83E 4.35E 407.7 05 11 mAb10924 465 223 3.67E+05 8.13E 2.22E 142.1 05 10 mAb10930 2156 449 2.32E+05 1.00E 4.31E 1155* 05* 11 mAb10938 1363 333 3.11E+05 1.00E 3.22E 1155* 05* 11 mAb10939 904 324 2.99E+05 1.15E 3.87E 1004.3 05 11 mAb10940 1508 893 5.61E+05 2.86E 5.09E 403.8 05 11 mAb10941 1132 371 2.60E+05 1.00E 2.15E 1155* 05* 11 mAb10982 529 236 3.10E+05 1.69E 5.44E 683.6 05 11 mAb10984 1213 573 4.02E+05 1.00E 2.49E 1155* 05* 11 mAb10985 1463 1040 1.09E+06 1.27E 1.17E 910.9 05 11 mAb10986 1168 752 6.33E+05 1.00E 1.58E 1155* 05* 11 mAb10987 902 632 8.20E+05 1.70E 2.08E 67.8 04 10 mAb10988 892 628 1.24E+06 3.46E 2.79E 33.4 04 10 mAb10989 505 378 2.07E+06 9.30E 4.50E 124.2 05 11 mAb10969 1658 738 3.05E+05 1.51E 4.96E 764 05 11 mAb10970 1370 661 3.48E+05 1.00E 2.88E 1155* 05* 11 mAb10971 1081 556 3.95E+05 1.00E 2.53E 1155* 05* 11 mAb10964 875 651 1.43E+06 1.00E 7.00E 1155* 05* 12 mAb10965 762 322 2.97E+05 1.00E 3.36E 1155* 05* 11 mAb10966 921 430 4.02E+05 1.00E 2.49E 1155* 05* 11 mAb10967 945 355 3.99E+05 1.00E 2.51E 1155* 05* 11 mAb10954 734 414 5.77E+05 1.00E 1.73E 1155* 05* 11 mAb10955 634 292 3.96E+05 2.34E 5.92E 493.6 05 11 mAb10956 842 339 3.74E+05 1.48E 3.95E 78 04 10 mAb10957 449 209 3.58E+05 1.00E 2.79E 1155* 05* 11 mAb10977 161 102 5.56E+05 1.04E 1.87E 110.9 04 10 mAb11010 1014 163 4.24E+05 1.00E 2.36E 1155* 05* 11 mAb11004 1101 241 3.46E+05 6.63E 1.91E 174.2 05 10 mAb11000 380 61 4.38E+05 1.83E 4.17E 6.3 03 09 mAb11006 1112 75 1.88E+05 1.00E 5.32E 1155* 05* 11 mAb11008 872 110 1.61E+05 1.15E 7.15E 100.4 04 10 mAb10998 1140 227 3.30E+05 5.21E 1.58E 22.2 04 09 mAb10996 629 83 2.88E+05 9.32E 3.24E 12.4 04 09 mAb11002 1068 60 2.69E+05 4.49E 1.67E 2.6 03 08 *Estimated value based on the limit of measurement of the dissociative rate constant and dissociative half-life under the experimental conditions.
Example 10: Characterization of Anti-SARS-CoV-2-S Monoclonal Antibodies by Blocking ELISA
[0268] An ELISA-based blocking assay was developed to determine the ability of anti-SARS-CoV2-S antibodies to block the binding of the SARS-CoV-2 spike protein receptor binding domain (RBD) to human angiotensin converting enzyme 2 (hACE2).
[0269] The SARS-CoV-2 protein used in the experiments was comprised of the receptor binding domain (RBD) portion of the SARS-CoV-2 spike protein (amino acids Arg319 to Phe541) expressed with the Fc portion of the human IgG1 at the c-terminus (SARS-CoV-2 RBD-hFc; see NCBI accession number MN908947.3) The human ACE2 protein used in the experiments was purchased from R&D systems and is comprised of amino acids glutamine 18 to serine 740 with a c-terminal 10-Histidine tag (hACE2-His; NCBI accession number Q9BYF1).
[0270] Experiments were carried out using the following procedure. A monoclonal anti-Penta-His antibody (Qiagen) was coated at 1 g/ml in PBS on a 96-well microtiter plate overnight at 4 C. The hACE2-His receptor was added at 0.2 g/ml in PBS and bound for 2 hours at room temperature. Nonspecific binding sites were subsequently blocked using a 0.5% (w/v) solution of BSA in PBS. In other microtiter plates, a constant amount of 10 pM or 15 pM (as indicated in Table 13) of SARS-CoV-2 RBD-hFc protein was bound with antibodies diluted 1:10 or 1:20 in PBS+0.5% BSA. These antibody-protein complexes, after a one-hour incubation, were transferred to the microtiter plate coated with hACE2-His. After 1.5 hours of incubation at RT, the wells were washed, and plate-bound SARS-CoV-2 RBD-hFc protein was detected with goat-anti-human IgG antibody conjugated with horseradish peroxidase (HRP) (Jackson). The plates were then developed using TMB substrate solution (BD Biosciences, catalog #555214) according to manufacturer's recommendation and absorbance at 450 nm was measured on a Victor X5 plate reader.
[0271] Data analysis was performed by calculating the % reduction of signal of the fixed SARS-CoV-2-S RBD-hFc concentration in the presence of the antibody vs in the absence of the antibody. In the calculation, binding signal of the sample of the constant SARS-CoV-2-S RBD-hFc without the presence of the antibody for each plate was referenced as 100% binding or 0% blocking; and the baseline signal of the sample of media only without the presence of SARS-CoV-2 RBD-hFc was referenced as 0% binding or 100% blocking.
[0272] The ability of anti-SARS-CoV-2-S antibodies to block SARS-CoV-2-S RBD from binding to human ACE2 was assessed using a blocking ELISA format. Single point test antibody supernatant blocking of either 10 pM or 15 pM SARS-CoV-2-S RBD-hFc binding to hACE2-His, which was presented on anti-His antibody coated on 96-well microtiter plates, was detected with an HRP conjugated anti-hFc antibody.
[0273] The blocking results of three assays are summarized in Table 13. The SARS-CoV-2-S binding signal (450 nm) and the G calculated % blocking are indicated. A range of blocking is observed for the test samples. For samples where an NA is indicated in columns 6 and 7, a plate-corrected value is included in columns 4 and 5, as data was consistent with a single plate switch occurring for those samples. 43 of 46 antibody supernatants blocked greater than 50% of the SARS-CoV-2-S RBD-hFc binding to plate-coated human ACE2, with 16 of them blocking >90% of the signal.
TABLE-US-00015 TABLE 13 Blocking ELISA Results Plate corrected Plate corrected SARS- SARS- SARS- SARS- CoV-2 CoV-2 CoV-2 CoV-2 RBD-hFc RBD-hFc RBD-hFc RBD-hFc Binding Binding Binding Binding to His to His to His to His SARS-CoV-2 presented presented presented presented RBD Fixed Supernatant ACE2 ACE2 % ACE2 ACE2 % Supernatant Concentration dilution (Abs 450 nm) Blocking (Abs 450 nm) Blocking mAb10913 15 pM 1:10 0.206 80.5 0.206 80.5 mAb10914 15 pM 1:10 0.326 59.1 0.326 59.1 mAb10915 15 pM 1:10 0.171 89.7 0.171 89.7 mAb10932 15 pM 1:10 0.254 57.3 0.254 57.3 mAb10933 15 pM 1:10 0.158 96.3 0.158 96.3 mAb10934 15 pM 1:10 0.209 78 0.209 78 mAb10935 15 pM 1:10 0.238 69.4 0.238 69.4 mAb10936 15 pM 1:10 0.234 70.6 0.234 70.6 mAb10937 15 pM 1:10 0.176 88.1 0.176 88.1 mAb10920 15 pM 1:10 0.601 56.5 0.601 56.5 mAb10921 15 pM 1:10 0.192 82.7 0.192 82.7 mAb10922 15 pM 1:10 0.181 86.4 0.181 86.4 mAb10923 15 pM 1:10 0.237 43.6 0.237 43.6 mAb10924 15 pM 1:10 0.175 78.2 0.175 78.2 mAb10930 15 pM 1:10 0.241 42.5 0.241 42.5 mAb10938 15 pM 1:10 0.169 87.5 0.169 87.5 mAb10939 15 pM 1:10 0.204 65.6 0.204 65.6 mAb10940 15 pM 1:10 0.152 95.2 0.152 95.2 mAb10941 15 pM 1:10 0.174 97.2 0.174 97.2 mAb10982 15 pM 1:10 0.195 83.5 0.195 83.5 mAb10984 15 pM 1:10 0.166 96.3 NA NA mAb10985 15 pM 1:10 0.162 97 NA NA mAb10986 15 pM 1:10 0.158 97.8 NA NA mAb10987 15 pM 1:10 0.243 81.8 NA NA mAb10988 15 pM 1:10 0.244 84 0.244 84 mAb10989 15 pM 1:10 0.155 101.8 0.155 101.8 mAb10969 15 pM 1:10 0.221 87.8 0.221 87.8 mAb10970 15 pM 1:10 0.164 97.7 0.164 97.7 mAb10971 15 pM 1:10 0.17 96.7 0.17 96.7 mAb10964 15 pM 1:10 0.169 96.9 0.169 96.9 mAb10965 15 pM 1:10 0.158 98.8 0.158 98.8 mAb10966 15 pM 1:10 0.157 94.2 0.157 94.2 mAb10967 15 pM 1:10 0.145 97.9 0.145 97.9 mAb10954 15 pM 1:10 0.147 97.3 0.147 97.3 mAb10955 15 pM 1:10 0.162 92.7 0.162 92.7 mAb10956 15 pM 1:10 0.189 84.5 0.189 84.5 mAb10957 15 pM 1:10 0.154 95.1 0.154 95.1 mAb10977 15 pM 1:10 0.315 71.5 0.315 71.5 mAb11010 10 pM 1:20 0.186 82.1 0.186 82.1 mAb11004 10 pM 1:20 0.211 70 0.211 70 mAb11000 10 pM 1:20 0.173 72.7 0.173 72.7 mAb11006 10 pM 1:20 0.236 58 0.236 58 mAb11008 10 pM 1:20 0.213 69.1 0.213 69.1 mAb10998 10 pM 1:20 0.185 61.6 0.185 61.6 mAb10996 10 pM 1:20 0.295 18.1 0.295 18.1 mAb11002 10 pM 1:20 0.177 79.2 0.177 79.2
Example 11: Epitope Mapping of Anti-SARS-CoV-2-S Monoclonal Antibodies to Spike Glycoprotein by Hydrogen-Deuterium Exchange Mass Spectrometry
[0274] Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) was performed to determine the amino acid residues of the SARS-CoV-2 Spike Protein Receptor Binding Domain (RBD_(amino acids R319-F541)) that interact with mAb10989, mAb10987, mAb10934, mAb10933, mAb10920, mAb10922, mAb10936, mAb10954, mAb10964, mAb10977, mAb10984, and mAb10986. A general description of the HDX-MS method is set forth in e.g., Ehring (1999) Analytical Biochemistry 267(2):252-259; and Engen and Smith (2001) Anal. Chem. 73:256A-265A.
[0275] The HDX-MS experiments were performed on an integrated HDX-MS platform, consisting of a Leaptec HDX PAL system for the deuterium labeling and quenching, a Waters Acquity I-Class (Binary Solvent Manager) for the sample digestion and loading, a Waters Acquity I-Class (Binary Solvent Manager) for the analytical gradient, and a Thermo Q Exactive HF mass spectrometer for peptide mass measurement.
[0276] The labeling solution was prepared as PBS buffer in D.sub.2O at pD 7.0 (10 mM phosphate buffer, 140 mM NaCl, and 3 mM KCl, equivalent to pH 7.4 at 25 C.). For deuterium labeling, 10 L of the RBD protein or RBD protein premixed with each one of the 12 antibodies listed above were incubated at 20 C. with 90 L of D.sub.2O labeling solution for various timepoints, in duplicate. For mAb10989, mAb10987, mAb10934, and mAb10933, the time points were 0 min (non-deuterated control), 5 min, and 10 min. For mAb10920, mAb10922, mAb10936, mAb10954, mAb10964, mAb10977, mAb10984, and mAb10986, the time points were 0 min (non-deuterated control) and 10 min. The deuteration reaction was quenched by adding 90 L of pre-chilled quench buffer (0.5 M TCEP-HCl, 4 M urea and 0.5% formic acid) to each sample for a 90 second incubation at 20 C. The quenched samples were then injected into the Leaptec HDX PAL system for online pepsin/protease XIII digestion. The digested peptides were trapped by a C18 column (2.1 mm5 mm, Waters) and separated by another C18 column (2.1 mm50 mm, Waters) at 5 C. with a 20 minute gradient (for mAb10989, mAb10987, mAb10934, and mAb10933) or a 10 minute gradient (for mAb10920, mAb10922, mAb10936, mAb10954, mAb10956, mAb10964, mAb10977, and mAb10984) from 0% to 90% of mobile phase B solution (mobile phase A solution: 0.5% formic acid and 4.5% acetonitrile in water, mobile phase B solution: 0.5% formic acid in acetonitrile). The eluted peptides were analyzed by a Thermo Q Exactive HF mass spectrometry in LC-MS/MS or LC-MS mode.
[0277] The LC-MS/MS data from the undeuterated RBD protein sample were searched against a database including amino acid sequences of the RBD protein, pepsin, protease XIII, and their reversed sequences using Byonic search engine (Protein Metrics). The search parameters were set as default using non-specific enzymatic digestion and human glycosylation as common variable modification. The list of identified peptides was then imported into HDExaminer software (version 3.1) to calculate the deuterium uptake (D-uptake) and differences in deuterium uptake percentage (% D) for all deuterated samples. Difference in deuterium uptake percentage (% D) was calculated as follows.
[0278] A total of 190 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10989 samples, representing 86.06% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 467-513 (DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVL) (SEQ ID NO: 835) of the RBD were significantly protected by mAb10989.
[0279] A total of 187 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10987 samples, representing 86.06% sequence coverage of RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 432-452 (CVIAWNSNNLDSKVGGNYNYL) (SEQ ID NO: 836) of the RBD were significantly protected by mAb10987.
[0280] A total of 188 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10934 samples, representing 86.06% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 432-452 (CVIAWNSNNLDSKVGGNYNYL) (SEQ ID NO: 836), 467-474 (DISTEIYQ) (SEQ ID NO: 837), and 480-513 (CNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVL) (SEQ ID NO: 838) of the RBD were significantly protected by mAb10934.
[0281] A total of 188 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10933 samples, representing 86.06% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 467-510 (DISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRV) (SEQ ID NO: 839) of the RBD were significantly protected by mAb10933.
[0282] A total of 75 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10920 samples, representing 83.27% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 471-486 (EIYQAGSTPCNGVEGF) (SEQ ID NO: 840), and 491-515 (PLQSYGFQPTNGVGYQPYRVVVLSF) (SEQ ID NO: 841) of the RBD were significantly protected by mAb10920.
[0283] A total of 86 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10922 samples, representing 87.25% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 432-452 (CVIAWNSNNLDSKVGGNYNYL) (SEQ ID NO: 836) of the RBD were significantly protected by mAb10922.
[0284] A total of 81 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10936 samples, representing 82.07% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 351-360 (YAWNRKRISN) (SEQ ID NO: 842), 432-452 (CVIAWNSNNLDSKVGGNYNYL) (SEQ ID NO: 836), 467-486 (DISTEIYQAGSTPCNGVEGF) (SEQ ID NO: 843), and 491-513 (PLQSYGFQPTNGVGYQPYRVVVL) (SEQ ID NO: 844) of the RBD were significantly protected by mAb10936.
[0285] A total of 84 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10954 samples, representing 87.25% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 400-422 (FVIRGDEVRQIAPGQTGKIADYN) (SEQ ID NO: 845), 453-486 (YRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF) (SEQ ID NO: 846), and 490-515 (FPLQSYGFQPTNGVGYQPYRVVVLSF) (SEQ ID NO: 847) of the RBD were significantly protected by mAb10954.
[0286] A total of 109 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10964 samples, representing 83.67% sequence coverage of RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 401-424 (VIRGDEVRQIAPGQTGKIADYNYK) (SEQ ID NO: 848), and 471-513 (EIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVL) (SEQ ID NO: 849) of the RBD were significantly protected by mAb10964.
[0287] A total of 78 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10977 samples, representing 87.25% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 351-364 (YAWNRKRISNCVAD) (SEQ ID NO: 850), and 471-486 (EIYQAGSTPCNGVEGF) (SEQ ID NO: 840) of the RBD were significantly protected by mAb10977.
[0288] A total of 88 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10984 samples, representing 87.25% sequence coverage of RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 400-422 (FVIRGDEVRQIAPGQTGKIADYN) (SEQ ID NO: 845), and 453-486 (YRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF) (SEQ ID NO: 846) of the RBD were significantly protected by mAb10984.
[0289] A total of 84 peptides from the RBD were identified from both RBD alone and RBD in complex with mAb10986 samples, representing 87.25% sequence coverage of the RBD. Any peptide that exhibited a reduction in deuterium uptake of 5% or greater (i.e., a % D value of less than 5%, such as 6%, 10%, and so on) upon mAb binding was defined as significantly protected. Peptides corresponding to amino acids 400-422 (FVIRGDEVRQIAPGQTGKIADYN) (SEQ ID NO: 845), 453-486 (YRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGF) (SEQ ID NO: 846), and 490-515 (FPLQSYGFQPTNGVGYQPYRVVVLSF) (SEQ ID NO: 847) of the RBD were significantly protected by mAb10986.
[0290] In sum, the majority of the neutralizing antibodies tested contact the RBD in a manner that overlaps the RBD residues that comprise the ACE2 interface; furthermore, the antibodies can be grouped based on their pattern of contacting the RBD surface, as shown in
TABLE-US-00016 TABLE 14 Spike protein receptor binding domain (RBD) peptides with significant protection upon formation of RBD-mAb compared to RBD alone 5 min incubation 10 min incubation RBD- RBD- RBD mAb10989 RBD mAb10989 RBD Residues D-uptake D-uptake D D-uptake D-uptake D % D 467-474 2.67 3.16 0.49 2.53 3.17 0.64 10.5 470-473 0.48 0.98 0.50 0.47 0.98 0.51 28.0 470-474 0.99 1.46 0.47 0.99 1.44 0.45 16.9 471-474 0.51 0.89 0.38 0.51 0.89 0.38 20.9 475-486 2.20 2.93 0.73 2.11 2.94 0.83 9.7 475-487 3.31 4.50 1.19 3.61 4.48 0.87 11.4 475-489 2.77 4.48 1.71 2.78 4.53 1.75 16.0 475-490 2.63 4.96 2.33 2.67 4.97 2.30 19.8 480-489 1.82 3.67 1.85 1.77 3.69 1.92 26.2 483-486 0.31 0.78 0.47 0.30 0.78 0.48 26.5 487-489 0.05 0.40 0.35 0.02 0.39 0.37 40.4 487-490 0.11 0.90 0.79 0.11 0.84 0.73 42.3 487-491 0.10 1.05 0.95 0.10 1.03 0.93 52.0 487-495 0.62 1.59 0.97 0.67 1.57 0.90 17.4 487-509 5.63 6.99 1.36 5.68 7.02 1.34 8.3 487-510 6.08 7.37 1.29 6.08 7.44 1.36 7.7 487-512 5.72 6.48 0.76 5.60 6.77 1.17 5.1 487-513 5.15 6.16 1.01 5.07 6.14 1.07 5.3 488-490 0.03 0.22 0.19 0.00 0.23 0.23 23.2 488-491 0.04 0.37 0.33 0.04 0.36 0.32 36.3
TABLE-US-00017 TABLE 15 Spike protein RBD peptides with significant protection upon formation of RBD-mAb10987 complex comparing to RBD alone 5 min incubation 10 min incubation RBD- RBD- RBD mAb10987 RBD mAb10987 RBD Residues D-uptake D-uptake D D-uptake D-uptake D % D 432-441 1.62 2.17 0.55 1.64 2.18 0.54 7.6 432-449 5.60 6.59 0.99 5.54 6.59 1.05 7.1 432-452 6.20 7.49 1.29 6.20 7.46 1.26 7.5 433-441 1.50 2.00 0.50 1.49 2.01 0.52 8.1 440-452 3.95 4.81 0.86 4.03 4.80 0.77 8.3 442-449 2.49 2.98 0.49 2.60 2.99 0.39 8.2
TABLE-US-00018 TABLE 16 RBD peptides with significant protection upon formation of RBD- mAb10934 complex comparing to RBD alone 5 min incubation 10 min incubation RBD- RBD- RBD mAb10934 RBD mAb10934 RBD Residues D-uptake D-uptake D D-uptake D-uptake D % D 432-452 5.70 7.49 1.79 5.62 7.46 1.84 10.6 433-441 1.60 2.00 0.40 1.63 2.01 0.38 6.2 434-441 2.24 2.42 0.18 2.13 2.52 0.39 5.3 440-452 3.12 4.81 1.69 3.10 4.80 1.70 17.1 442-449 2.37 2.98 0.61 2.37 2.99 0.62 11.4 442-452 2.67 4.21 1.54 2.66 4.23 1.57 19.1 443-452 2.53 3.78 1.25 2.52 3.78 1.26 17.5 444-451 1.79 2.73 0.94 1.80 2.73 0.93 17.2 444-452 1.82 3.09 1.27 1.75 3.09 1.34 20.7 445-452 1.24 2.42 1.18 1.24 2.43 1.19 22.0 467-474 2.64 3.16 0.52 2.58 3.17 0.59 10.2 470-473 0.51 0.98 0.47 0.55 0.98 0.43 25.0 470-474 1.03 1.46 0.43 1.01 1.44 0.43 16.0 471-474 0.56 0.89 0.33 0.55 0.89 0.34 18.6 480-489 3.19 3.67 0.48 3.19 3.69 0.50 6.8 487-489 0.04 0.40 0.36 0.06 0.39 0.33 38.6 487-490 0.54 0.90 0.36 0.53 0.84 0.31 18.8 487-491 0.63 1.05 0.42 0.70 1.03 0.33 20.5 487-495 0.73 1.59 0.86 0.71 1.57 0.86 16.0 487-509 5.55 6.99 1.44 5.57 7.02 1.45 8.9 487-510 5.89 7.37 1.48 6.00 7.44 1.44 8.5 487-513 4.37 6.16 1.79 4.79 6.14 1.35 7.9 488-509 4.50 5.49 0.99 4.60 5.52 0.92 6.2 488-510 5.84 6.58 0.74 5.65 6.67 1.02 5.4 490-509 5.16 6.01 0.85 5.30 6.12 0.82 5.8 490-512 5.15 6.37 1.22 5.30 6.28 0.98 6.4 490-513 4.90 6.10 1.20 5.05 6.05 1.00 6.1 503-509 1.19 1.39 0.20 1.21 1.41 0.20 5.5
TABLE-US-00019 TABLE 17 RBD peptides with significant protection upon formation of RBD-mAb10933 complex comparing to RBD alone 5 min incubation 10 min incubation RBD- RBD- RBD mAb10933 RBD mAb10933 RBD Residues D-uptake D-uptake D D-uptake D-uptake D % D 467-474 2.52 3.16 0.64 2.55 3.17 0.62 11.7 470-474 1.03 1.46 0.43 1.03 1.44 0.41 15.6 471-474 0.54 0.89 0.35 0.54 0.89 0.35 19.5 475-487 3.62 4.50 0.88 3.63 4.48 0.85 9.6 475-489 3.21 4.48 1.27 3.26 4.53 1.27 11.8 480-486 1.79 2.06 0.27 1.87 2.07 0.20 5.1 480-489 2.13 3.67 1.54 2.18 3.69 1.51 21.2 483-486 0.61 0.78 0.17 0.62 0.78 0.16 9.3 487-489 0.02 0.40 0.38 0.02 0.39 0.37 41.6 487-490 0.42 0.90 0.48 0.40 0.84 0.44 25.6 487-491 0.46 1.05 0.59 0.46 1.03 0.57 32.0 487-495 0.74 1.59 0.85 0.82 1.57 0.75 14.8 487-509 6.01 6.99 0.98 6.14 7.02 0.88 5.7 487-510 6.29 7.37 1.08 6.14 7.44 1.30 7.0 488-490 0.19 0.22 0.03 0.13 0.23 0.10 7.4 488-491 0.26 0.37 0.11 0.25 0.36 0.11 12.3
TABLE-US-00020 TABLE 18 RBD peptides with significant protection upon formation of RBD- mAb10920 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10920 RBD Residues D-uptake D-uptake D % 471-486 4.63 5.40 0.77 6.6 475-486 2.74 3.27 0.53 6.5 491-513 5.45 6.57 1.12 6.6 495-510 4.51 5.43 0.92 8.5 495-513 4.41 5.13 0.72 5.4 496-515 3.58 4.35 0.77 5.4
TABLE-US-00021 TABLE 19 RBD peptides with significant protection upon formation of RBD- mAb10922 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10922 RBD Residues D-uptake D-uptake D % 432-441 1.86 2.23 0.37 5.3 442-452 3.52 4.57 1.05 13.0
TABLE-US-00022 TABLE 20 RBD peptides with significant protection upon formation of RBD- mAb10936 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10936 RBD Residues D-uptake D-uptake D % 351-360 2.68 3.10 0.42 5.9 432-441 1.85 2.23 0.38 5.3 442-452 2.55 4.57 2.02 25.0 443-452 2.98 4.01 1.03 14.2 467-470 0.69 0.84 0.15 8.1 471-486 4.73 5.40 0.67 5.8 491-513 5.48 6.57 1.09 6.4 495-510 4.38 5.43 1.05 9.8
TABLE-US-00023 TABLE 21 RBD peptides with significant protection upon formation of RBD- mAb10954 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10954 RBD Residues D-uptake D-uptake D % 400-420 3.67 4.56 0.89 5.5 401-420 3.39 4.22 0.83 5.5 401-421 3.44 4.28 0.84 5.2 406-420 3.32 4.10 0.78 7.2 406-421 3.23 4.11 0.88 7.6 406-422 3.41 4.16 0.75 5.9 407-420 2.86 3.62 0.76 7.7 407-422 2.97 3.74 0.77 6.6 453-466 1.53 2.23 0.70 7.1 453-470 3.63 4.53 0.90 6.7 453-471 4.42 5.22 0.80 5.6 471-486 4.34 5.40 1.06 9.1 472-486 4.47 5.29 0.82 7.6 490-512 5.64 6.65 1.01 5.9 490-513 5.61 6.57 0.96 5.3 491-513 5.26 6.57 1.31 7.7 493-512 4.86 5.69 0.83 5.7 493-513 4.74 5.72 0.98 6.4 495-510 4.77 5.43 0.66 6.2 495-513 4.10 5.13 1.03 7.6 496-512 3.60 4.60 1.00 8.6 496-515 3.43 4.35 0.92 6.4
TABLE-US-00024 TABLE 22 RBD peptides with significant protection upon formation of RBD- mAb10964 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10964 RBD Residues D-uptake D-uptake D % 401-421 3.87 4.84 0.97 6.0 406-419 3.34 3.91 0.57 5.8 406-420 3.47 4.15 0.68 6.3 406-421 3.53 4.22 0.69 5.9 406-422 3.66 4.37 0.71 5.6 406-424 3.31 4.24 0.93 6.5 410-422 3.04 3.56 0.52 5.8 471-486 4.65 5.41 0.76 6.4 475-489 3.34 4.56 1.22 11.3 480-489 2.32 3.19 0.87 12.1 487-509 6.38 7.58 1.20 7.4 495-513 4.50 5.20 0.70 5.2 496-512 4.17 4.80 0.63 5.4 496-513 3.90 4.85 0.95 7.5
TABLE-US-00025 TABLE 23 RBD peptides with significant protection upon formation of RBD- mAb10977 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10977 RBD Residues D-uptake D-uptake D % 351-364 4.82 5.38 0.56 5.2 471-486 3.81 5.40 1.59 13.6 472-486 4.20 5.29 1.09 10.1
TABLE-US-00026 TABLE 24 RBD peptides with significant protection upon formation of RBD- mAb10984 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10984 RBD Residues D-uptake D-uptake D % 400-420 3.73 4.56 0.83 5.2 401-421 3.47 4.28 0.81 5.1 406-420 3.35 4.10 0.75 7.0 406-421 3.31 4.11 0.80 6.9 406-422 3.47 4.16 0.69 5.5 407-420 2.88 3.62 0.74 7.5 407-422 2.94 3.74 0.80 6.8 453-466 1.51 2.23 0.72 7.3 453-470 3.70 4.53 0.83 6.2 453-471 4.49 5.22 0.73 5.1 471-486 4.45 5.40 0.95 8.1 472-486 4.63 5.29 0.66 6.1
TABLE-US-00027 TABLE 25 RBD peptides with significant protection upon formation of RBD- mAb10986 complex comparing to RBD alone 10 min incubation RBD- RBD mAb10986 RBD Residues D-uptake D-uptake D % 400-420 3.58 4.56 0.98 6.1 400-421 3.60 4.61 1.01 5.9 401-420 3.30 4.22 0.92 6.1 401-421 3.29 4.28 0.99 6.1 401-422 3.44 4.43 0.99 5.8 406-420 3.28 4.10 0.82 7.6 406-421 3.24 4.11 0.87 7.5 406-422 3.35 4.16 0.81 6.4 407-420 2.81 3.62 0.81 8.2 407-422 2.91 3.74 0.83 7.1 453-466 1.53 2.23 0.70 7.1 453-470 3.55 4.53 0.98 7.3 453-471 4.41 5.22 0.81 5.6 471-486 4.13 5.40 1.27 10.9 490-510 5.13 6.44 1.31 8.6 490-512 5.33 6.65 1.32 7.7 490-513 5.25 6.57 1.32 7.3 491-513 4.29 6.57 2.28 13.3 493-512 4.46 5.69 1.23 8.5 493-513 4.62 5.72 1.10 7.2 495-513 3.89 5.13 1.24 9.3 496-513 3.36 4.53 1.17 9.3 496-515 3.05 4.35 1.30 9.1
Example 12: Identification of Escape Mutants Under Selection Pressure
[0291] A study was performed to determine whether selection pressure in the presence of individual anti-SARS-CoV-2 spike glycoprotein antibodies, or combinations of such antibodies, led to generation of escape mutants. Antibodies were serially diluted 1:5 starting at 100 g/mL in 500 L of Vesicular Stomatitis Virus media (DMEM high glucose media containing 3% heat-inactivated fetal bovine serum and Penicillin/-Streptomycin-L-Glutamine). A no-antibody control was included to account for any tissue culture variations that may occur. A total of 1.510.sup.6 plaque forming units (pfu) of replicative VSV-SARS-CoV-2-S virus in 50011.1 of media was added to each dilution and incubated at room temperature for 30 minutes. After the incubation, the mixture was added to 310.sup.5 Vero E6 cells and incubated for 96 hours at 37 C. with 5% CO.sub.2. Virus replication was monitored by screening for cytopathic effect. The supernatants and cellular layers were collected from wells with the highest antibody concentration with evident viral replication. The total RNA, including the viral RNA, was extracted from the cells using TRIzol (Life Technologies) following the manufacturer's protocol for next generation sequencing. For a second round of selection, 100 L of supernatant containing the virus was brought to 500 l with VSV media and passed under the same or greater antibody concentrations as before. Again, the supernatants were collected, and RNA was extracted from cells in wells with the highest antibody concentration with evident viral replication.
[0292] RNA was quantified using the Qubit RNA HS Assay Kit (ThermoFisher). 1 to 50 ng RNA was treated by FastSelect-rRNA HMR (Qiagen) to remove host rRNA, and the incubation condition for fragmentation was as follows: 85 C. for 6 minutes, 75 C. for 2 minutes, 70 C. for 2 minutes, 65 C. for 2 minutes, 60 C. for 2 minutes, 55 C. for 2 minutes, 37 C. for 5 minutes, 25 C. for 5 minutes, and hold at 4 C. Strand-specific RNA-seq libraries were prepared from the treated RNA using KAPA RNA HyperPrep Kit (Roche Sequencing). UDI with UMI Adapters (IDT) were ligated. Sixteen-cycle PCR was performed to amplify libraries. Sequencing was run on MiSeq (Illumina) by multiplexed paired-read run with 270 cycles.
[0293] Sequencing analysis was performed using Array Studio software package platform (Omicsoft). Quality of paired-end RNA Illumina reads was assessed using the raw data QC of RNA-Seq data suite. Minimum and maximum read length, total nucleotide number, and GC % were calculated. Overall quality reports were generated summarizing the quality of all reads in each sample, along with each base pair. Paired-end RNA Illumina reads were then mapped against VSV-SARS-CoV-2-S virus genome using Omicsoft Sequence Aligner (OSA) version 4. Reads were trimmed by quality score using default parameters (when the aligner encountered nucleotide in the read with a quality score of 2 or less, it trimmed the remainder of the read). OSA outputs were analyzed and annotated using Summarize Variant Data and Annotate Variant Data packages (Omicsoft). Target coverage was calculated for each sample. SNP calling was performed using samples with average target coverage greater than 500 reads. SNPs with a minimum frequency of 1% and a coverage greater than 50 were identified and annotated.
[0294] Through the use of the above methods with a replicating VSV-SARS-CoV-2-S virus, escape mutants were selected under pressure of single antibodies, as well as of antibody combinations (
[0295] To further analyze the escape mutants observed, 22,872 publicly available unique genome sequences were studied. SARS-CoV-2 complete genome sequences were downloaded from GISAID Nucleotide database (www.gisaid.org). Sequences were curated and genetic diversity of the spike-encoding gene was assessed across 7,684 high quality genome sequences using custom pipelines. In brief, Blastn was used to align the Wuhan_Hu_1 Spike nucleotide sequence (accession: MN908947) against each individual genome. Results were analyzed and the presence of the gene was validated if alignment length was greater than 95% with an identity percentage greater than 70%. Homologous spike sequences were extracted, translated and aligned to identify amino-acid changes with respect to the reference.
[0296] This analysis demonstrated the presence of polymorphisms in two of the escape amino acid residues identified in this study, at an extremely low frequency of one each. Notably, this study included evaluation of both non-competing (mAb10987+mAb10933) and competing (mAb10989+mAb10934) antibodies, but the only condition that did not result in generation of escape mutants was the non-competing antibody combination. Although this study was conducted with a surrogate virus in tissue culture cells, it is expected that similar escape under pressure occurs within the SARS-CoV-2 virus in vivo when only a single antibody is present. Escape against multiple non-competing antibodies requires simultaneous selection of two distinct amino acid mutations that allow the virus to maintain replication fitness, a significantly less likely possibility than selection of a single mutation.
[0297] Escape following treatment with the antibody cocktail (mAb10987+mAb10933) was evaluated. This antibody cocktail was designed to avoid escape through inclusion of two antibodies that bind distinct and non-overlapping regions of the RBD, and which can thus simultaneously bind and block RBD function. Attempts to grow VSV-SARS-CoV-2-S virus in the presence of this antibody cocktail did not result in the outgrowth of escape mutants (
[0298] In addition to the above cocktail, escape following treatment with additional combinations was also evaluated, this time with antibodies that completely or partially compete for binding to the RBD_(mAb10989+mAb10934 and mAb10989+mAb10987), i.e., two antibodies that bind to overlapping regions of the RBD, albeit to different degrees. Under selective pressure of these combination treatments, there was rapid generation of escape mutants resistant to one combination, but not the other (
[0299] Furthermore, the combination of mAb10933 and mAb10987 was evaluated for its ability to neutralize pseudotyped VSV expressing a SARS-CoV-2 variant known as B.1.1.7, also called the UK variant. This variant is rapidly expanding, and may have different effects than wild-type SARS-CoV-2, including more severe symptoms than the wild-type virus and potential resistance to vaccines and/or therapeutics. It is classified, in part, by the following mutations in the spike protein: HV 69-70 deletion, Y144 deletion, N501Y, A570D, P681H, T716I, S982A, and D1118H. mAb10933 and mAb10987, in combination, was shown to neutralize the virus more effectively than either antibody alone (
TABLE-US-00028 mAb10933 + mAb10933 mAb10987 mAb10987 Fold decrease in IC50 from reference Variant SARS-CoV-2 D614G UK 0.98 0.70 1.04 B.1.1.7
[0300] Further experiments were performed to evaluate whether escape occurs in the presence of a three-antibody combination (mAb10933+mAb10987+mAb10985). Complete escape rapidly occurred with each of the three individual antibodies (mAb10933: passage 2; mAb10987: passage 3; mAb10985: passage 1). However, the combination of mAb10933 and mAb10987 extended the generation of complete escape to passage 7, and when mAb10985 was added to the combination of mAb10933 and 10987, no escape was seen even after 11 passages. See
Example 13: Neutralization of SARS-CoV-2 Wild-Type and Variant Spike Proteins
[0301] To test whether anti-SARS-CoV-2 spike protein antibodies can neutralize SARS-CoV-2 variants, these antibodies were screened against a panel of VSV pseudotype viruses expressing wild-type and variant spike proteins. VSV pseudotype viruses were generated by transiently transfecting 293T cells with a plasmid encoding the SARS-CoV-2 spike protein or the same plasmid containing nucleotide variations that encode for known variants of the SARS-CoV-2 spike protein amino acid sequence. All plasmids were confirmed by Sanger sequencing. Cells were seeded in 15 cm plates at 1.210.sup.7 cells per plate in DMEM Complete Media (1000 mL DMEM, Gibco; 100 mL FBS, Gibco; 10 mL PSG, Gibco) one day prior to transfection with g/plate Spike DNA using 125 L Lipofectamine LTX, 30 L PLUS reagent, and up to 3 mL Opti-Mem. 24 hours post transfection, the cells were washed with 10 mL PBS, then infected with an MOI of 0.1 VSV.sup.G:mNeon virus in 10 mL of Opti-Mem. Virus was incubated on cells for 1 hour, with gentle rocking every 10 minutes. Cells were washed 3 times with 10 mL PBS, then overlaid with 20 mL Infection media (1000 mL DMEM, Gibco; 10 mL Sodium Pyruvate, Gibco; 7 mL BSA, Sigma; 5 mL Gentamicin, Gibco) before incubation at 37 C., 5% CO.sub.2 for 24 hours. Pseudovirus supernatant was collected into 250 mL centrifuge tubes on ice, then centrifuged at 3000 rpm for 5 minutes to pellet any cellular debris, aliquoted on ice, then frozen to 80 C. Infectivity was tested on Vero cells prior to use in neutralization assays. This material will be referred to as VSV.sup.G:mNeon/Spike pseudovirus, or VSV.sup.G:mNeon/Spike_(variant amino acid mutation) (for example, VSV.sup.G:mNeon/Spike_H49Y).
[0302] On Day 1, Vero cells were seeded to 80% confluency in T225 flasks, the cells were washed with PBS (Gibco: 20012-043), TrypLE was added to detach cells from the flask, and Complete DMEM was added to inactivate trypsin. 20,000 Vero cells were plated in in 100 L of prewarmed Complete DMEM per well in 96 Well Black Polystyrene Microplate (Corning: 3904). On Day 2, VSV.sup.G:mNeon/Spike pseudovirus was thawed on ice and diluted with Infection media. Antibodies were diluted in a U-bottom 96 well plate, generating a dilution of each antibody in 210 l Infection media at 2 assay concentration. 120 L of diluted antibodies were transferred to a fresh U-bottom plate, and media and an IgG1 control antibody were added to each plate. 120 l of diluted pseudovirus was added to every well except the media control wells. To those wells, 120 L of Infection media was added. Pseudovirus with antibodies were incubated for 30 minutes at room temperature, then media was removed from Vero cells. 100 L of antibody/pseudovirus mixture were added to the cells, and then incubated at 37 C., 5% CO.sub.2 for 24 hours. On day 3, supernatant was removed from cell wells and replaced with 100 L of PBS. Plates were read on a SpectraMax i3 with MiniMax imaging cytometer.
[0303] For replicative VSV-SARS-CoV-2-S virus neutralization assays, antibodies were diluted as described above but in VSV media (DMEM high glucose media containing 3% heat-inactivated fetal bovine serum and Penicillin/-Streptomycin-L-Glutamine). An equal volume of media containing 2000 pfu of VSV-SARS-CoV-2-S virus was mixed with the antibody dilutions and incubated for 30 minutes at room temperature. The mixture was then added onto Vero cells and incubated at 37 C., 5% CO.sub.2 for 24 hours. The cells were fixed (PBS with 2% paraformaldehyde) for 20 minutes, permeabilized (PBS with 5% fetal bovine serum and 0.1% Triton-X100) for 15 minutes and blocked (PBS with 3% bovine serum albumin) for 1 hour. Infected cells were immunostained with a rabbit anti-VSV serum (Imanis Life Sciences) and an Alexa Fluor 488 secondary antibody in PBS+3% bovine serum albumin. Fluorescent foci were quantitated using the SpectraMax i3 plate reader with MiniMax imaging cytometer.
[0304] In addition to testing neutralization capacity with replicating and non-replicating VSV-SARS-CoV-2-S viruses, antibodies also were tested with SARS-CoV-2 virus. Monoclonal antibodies and antibody combinations were serially diluted in DMEM (Quality Biological), supplemented with 10% (v/v) heat inactivated fetal bovine serum (Sigma), 1% (v/v) penicillin/streptomycin (Gemini Bio-products) and 1% (v/v) L-glutamine (2 mM final concentration, Gibco) (VeroE6 media) to a final volume of 250 L. Next, 250 L of VeroE6 media containing SARS-CoV-2 (WA-1) (1000 PFU/mL) was added to each serum dilution and to 250 L media as an untreated control. The virus-antibody mixtures were incubated for 60 min at 37 C. Following incubation, virus titers of the mixtures were determined by plaque assay. Finally, 50% plaque reduction neutralization titer (PRNT50) values (the serum dilutions at which plaque formation was reduced by 50% relative to that of the untreated control) were calculated using a 4-parameter logistic curve fit to the percent neutralization data (GraphPad Software, La Jolla, CA).
[0305] Individual monoclonal antibody half maximal inhibitory concentration (IC50) against VSV-SARS-CoV-2 spike protein (S)-expressing pseudovirus encoding the Wuhan-Hu-1 (NCBI Accession Number MN908947.3) sequence of spike protein (S-wt) were determined in Vero cells (Table 26). The majority of antibodies displayed neutralization potency in the picomolar range (pM), with some exhibiting neutralization potency in nanomolar (nM) range.
[0306] While recombinant ACE2 was able to mediate neutralization of the VSV-spike pseudoparticles, as previously reported, its potency was far inferior to that of the monoclonal antibodies, with more than 1000-fold decrease in potency seen relative to the best neutralizing mAbs (
TABLE-US-00029 TABLE 26 mAb neutralization potency (IC50 (M)) against wild-type strain of VSV-SARS-CoV-2-S pseudoparticles in Vero cells Antibody IC50 (M) mAb10934 5.44E11 mAb10936 1.11E10 mAb10987 4.06E11 mAb10924 1.36E10 mAb10935 2.21E10 mAb10913 2.31E10 mAb10939 2.36E10 mAb10937 2.62E10 mAb10920 2.64E10 mAb10941 2.78E10 mAb10923 3.29E10 mAb10915 3.40E10 mAb10932 3.58E10 mAb10921 3.74E10 mAb10914 3.94E10 mAb10940 5.43E10 mAb10989 7.23E12 mAb10938 6.65E10 mAb10922 1.21E10 mAb10930 1.07E09 mAb10954 9.22E11 mAb10955 1.19E10 mAb10933 4.28E11 mAb10956 1.28E10 mAb10957 1.76E10 mAb10964 5.70E11 mAb10965 1.42E10 mAb10966 1.00E10 mAb10967 2.43E10 mAb10970 1.26E10 mAb10971 1.55E10 mAb10977 5.15E11 mAb10982 3.69E10 mAb10984 9.73E11 mAb10985 2.57E10 mAb10986 9.91E11 mAb10988 2.98E10 mAb10969 2.27E09 mAb10996 1.13E08 mAb10998 9.51E09 mAb11002 nonneutralizing mAb11000 2.79E08 mAb11004 6.00E09 mAb11006 1.40E09 mAb11008 2.05E08 mAb11010 non-neutralizing
[0307] Amino acid variants in spike (S) protein were identified from over 7000 publicly available SARS-CoV-2 sequences, representing globally circulating isolates, and cloned into VSV pseudoparticles. Neutralization assays with variant-encoding pseudoparticles were performed to assess the impact of each variant on neutralization potency of the monoclonal antibodies. Table 27 illustrates the relative neutralization potency of monoclonal antibodies against variant encoding pseudoparticles relative to SARS-CoV-2 spike (S-wt) at a single concentration of 5 g/ml. Percent of neutralization relative to S-wt was captured for each individual antibody and variant. None of the antibodies demonstrated loss of neutralization potency at the 5 g/ml concentration with the exception of mAb10985 and the R4081 variant. These data demonstrate broad functional neutralization coverage of monoclonal antibodies against globally circulating SARS-CoV-2 spike variants.
[0308] To further interrogate the impact of the S protein variants on neutralization potency of the monoclonal antibodies, full neutralization curves were run to determine the IC50 value of the most potent neutralizing antibodies against a subset of variants localized within the receptor binding domain (RBD) of the S protein. Table 28 shows the IC50 neutralization values for each variant psuedoparticle. Intrinsic variability of up to 3-fold can be observed between pseudoparticle neutralization assays and does not indicate a change in neutralization potency. These data demonstrate that the antibodies retained their neutralization potency against a diverse panel of S protein RBD variants.
TABLE-US-00030 TABLE 27 Relative neutralization of VSV-SARS-COV-2 variants encoding S protein at 5 g/ml antibody concentration in Vero cells mAb wt H49Y S50L V341I N354D S359N V367F K378R mAb10989 100% 100% 88% 100% 100% 99% 100% 100% mAb10987 100% 100% 96% 99% 100% 99% 100% 100% mAb10933 100% 100% 96% 99% 100% 99% 100% 99% mAb10977 100% 100% 98% 100% 99% 100% 100% 100% mAb10934 100% 100% 95% 100% 100% 99% 100% 99% mAb10964 100% 100% 90% 100% 99% 99% 100% 100% mAb10954 100% 100% 92% 100% 100% 99% 100% 100% mAb10984 100% 100% 95% 100% 99% 99% 100% 99% mAb10986 100% 100% 98% 100% 99% 99% 100% 100% mAb10966 100% 100% 90% 100% 99% 99% 100% 100% mAb10936 100% 100% 96% 100% 99% 99% 100% 100% mAb10955 100% 100% 95% 99% 99% 99% 100% 100% mAb10922 100% 100% 98% 99% 99% 99% 100% 99% mAb10970 100% 100% 99% 100% 100% 100% 100% 99% mAb10956 100% 100% 96% 99% 99% 99% 100% 100% mAb10924 100% 100% 96% 100% 99% 99% 100% 99% mAb10965 100% 100% 96% 100% 99% 100% 100% 100% mAb10971 100% 100% 90% 99% 99% 99% 100% 99% mAb10957 100% 100% 91% 99% 99% 98% 100% 99% mAb10935 100% NR NR NR NR 99% NR 99% mAb10913 100% 100% 93% 100% 99% 98% 100% 99% mAb10939 100% 100% 93% 98% 99% 100% 100% 99% mAb10967 100% 100% 90% 99% 99% 98% 100% 100% mAb10985 100% 100% 96% 99% 99% 98% 100% 99% mAb10937 100% 100% 92% 99% 100% 98% 100% 99% mAb10920 100% 100% 92% 99% 99% 99% 100% 99% mAb10941 100% 99% 97% 99% 100% 99% 100% 100% mAb10988 100% 100% 99% 100% 99% 98% 100% 100% mAb10923 100% 101% 102% 97% 103% 105% 104% 103% mAb10915 100% 100% 95% 100% 99% 99% 100% 99% mAb10932 100% 100% 93% 100% 99% 99% 100% 99% mAb10982 100% 100% 94% 99% 99% 99% 100% 100% mAb R408I Q409E A435S K458R G476S Y483A Y508H H519P mAb10989 100% 101% 100% 99% 99% 100% 100% 97% 100% mAb10987 99% 100% 100% 99% 99% 99% 100% 97% 100% mAb10933 100% 99% 100% 99% 99% 100% 100% 98% 100% mAb10977 100% 100% 99% 99% 99% 99% 100% 97% 100% mAb10934 100% 100% 100% 98% 98% 99% 100% 97% 100% mAb10964 99% 100% 99% 98% 100% 99% 100% 96% 100% mAb10954 100% 100% 100% 100% 100% 100% 100% 97% 100% mAb10984 99% 100% 100% 99% 99% 100% 100% 96% 100% mAb10986 100% 100% 100% 98% 99% 100% 100% 99% 100% mAb10966 99% 100% 100% 99% 100% 99% 100% 96% 100% mAb10936 99% 100% 100% 99% 99% 99% 100% 97% 100% mAb10955 100% 100% 99% 99% 99% 99% 100% 97% 100% mAb10922 99% 100% 100% 98% 99% 99% 100% 97% 99% mAb10970 100% 101% 100% 100% 99% 99% 100% 99% 100% mAb10956 100% 100% 99% 99% 100% 99% 100% 97% 100% mAb10924 99% 100% 100% 99% 99% 99% 99% 98% 100% mAb10965 99% 100% 100% 99% 100% 99% 100% 98% 100% mAb10971 99% 100% 100% 99% 99% 99% 100% 98% 100% mAb10957 99% 100% 99% 98% 99% 99% 100% 98% 100% mAb10935 NR NR NR NR 98% NR 99% NR NR mAb10913 99% 100% 100% 99% 98% 99% 99% 97% 100% mAb10939 99% 100% 99% 98% 97% 98% 100% 96% 100% mAb10967 99% 99% 99% 98% 99% 98% 100% 97% 100% mAb10985 26% 100% 100% 99% 99% 100% 99% 97% 99% mAb10937 100% 99% 99% 99% 99% 100% 99% 98% 100% mAb10920 99% 100% 100% 99% 98% 100% 99% 98% 100% mAb10941 99% 100% 100% 98% 98% 98% 100% 96% 100% mAb10988 100% 101% 99% 99% 99% 100% 99% 98% 100% mAb10923 103% 104% 100% 100% 96% 98% 101% 97% 101% mAb10915 98% 100% 100% 98% 97% 100% 99% 97% 100% mAb10932 99% 100% 99% 99% 98% 100% 99% 98% 100% mAb10982 99% 100% 99% 98% 99% 99% 100% 98% 100%
TABLE-US-00031 TABLE 28 Neutralization IC50 (M) of VSV-SARS-COV-2-S RBD variants in Vero cells Q321S V341I A348T N354D S359N V376F K378S R408I mAb10933 6.85E11 3.37E11 4.13E11 5.89E11 2.12E11 2.40E11 3.52E11 1.98E11 mAb10934 6.84E11 7.42E11 1.42E10 9.76E11 3.04E11 3.20E11 4.65E11 2.75E11 mAb10984 2.75E10 2.49E10 2.01E10 2.64E10 1.23E10 1.53E10 1.88E10 1.35E10 mAb10986 2.06E10 1.92E10 1.03E10 2.49E10 8.91E11 1.49E10 1.54E10 6.14E11 mAb10987 5.02E11 3.38E11 2.98E11 2.68E11 2.41E11 1.78E11 2.40E11 1.71E11 mAb10989 1.46E11 1.61E11 7.33E12 1.14E11 4.30E12 1.33E11 1.21E11 1.09E11 mAb10964 5.65E11 1.13E10 3.52E11 1.93E10 6.83E11 8.92E11 6.19E11 4.96E11 mAb10954 2.32E10 2.52E10 1.84E10 2.84E10 1.09E10 1.29E10 1.65E10 9.88E11 IgG1 Isotype N/A N/A N/A N/A N/A N/A N/A N/A Control Q409E A435S K458R I472V G476S V483A Y508H H519P mAb10933 5.65E11 4.71E11 3.43E11 9.17E11 1.41E10 1.54E11 4.77E11 3.03E11 mAb10934 5.94E11 8.07E11 3.46E11 9.40E11 3.51E11 4.43E11 6.73E11 3.56E11 mAb10984 1.52E10 2.18E10 1.59E10 2.61E10 2.10E10 1.71E10 2.83E10 1.08E10 mAb10986 1.95E10 1.51E10 1.00E10 2.24E10 1.13E10 9.70E11 2.01E10 6.14E11 mAb10987 4.06E11 3.88E11 1.68E11 4.18E11 1.86E11 2.60E11 2.75E11 2.20E11 mAb10989 2.12E11 1.10E11 7.51E12 2.27E11 6.80E12 8.78E12 1.71E11 4.51E12 mAb10964 6.61E11 7.90E11 5.46E11 1.01E10 3.42E11 4.50E11 1.02E10 4.45E11 mAb10954 2.64E10 2.11E10 1.45E10 3.44E10 1.83E10 1.12E10 2.05E10 1.40E10 IgG1 Isotype N/A N/A N/A N/A N/A N/A N/A N/A Control
[0309] Non-clinical studies using serial passage of recombinant vesicular stomatitis virus (VSV) encoding SARS-CoV-2 spike protein with each of the individual antibodies in a mAb10933-mAb10987 combination identified spike protein mutants with reduced susceptibility to their respective individual antibody by greater than 15-fold (mAb10933 monotherapy identified K417E, K417R, K417N, Y453F, L455F, F486V, and Q493K substitutions in the spike protein receptor binding domain, while mAb10987 monotherapy identified substitutions K444N, K444Q, K444T, and V445A in the spike receptor binding domain). These variants were identified within a single passage and some were fixed in the virus population by the second passage. None of these variants, selected via passage in the presence of the individual antibodies, had reduced susceptibility to the REGN-COV2 two antibody cocktail. Moreover, passaging in the presence of REGN-COV2 two antibody cocktail did not identify any resistant substitutions after the same number of passages.
[0310] Genotypic and phenotypic testing can be used monitor for potential REGN-COV2-resistance-associated spike variants in clinical trials. No known resistance variants to the mAb10933 antibody were observed in 288 samples sequenced from a Phase I study among 66 patients that were analyzed. The G446V variant, which has reduced susceptibility to neutralization by mAb10987 (about 135-fold reduction in neutralization IC50) was identified in 3 out of 288 analyzed samples at >15% allele frequency: two baseline samples (one in the placebo and one the 2400 mg arms of the study, but not in subsequence samples from the same individuals) and one day 25 sample in the 8000 mg arm of the study (4 sequencing reads out of 1,292 total reads in the sample). The G446V variant remains susceptible to neutralization by the mAb10933-mAb10987 two-antibody cocktail, and no variants resistant to the mAb10933-mAb10987 two-antibody cocktail were identified in any clinical samples, either at baseline or after treatment. These results have not yet been correlated to a clinical relevance.
Example 14: Biacore Binding Kinetics of Purified Anti-SARS-CoV-2-S Monoclonal Antibodies
[0311] Equilibrium dissociation constant (K.sub.D) for different SARS-COV-2 RBD reagents binding to purified CHOt anti-SARS-COV-2 monoclonal antibodies (mAbs) were determined using a real-time surface plasmon resonance based Biacore T200/Biacore 8K biosensor. All binding studies were performed in 10 mM HEPES, 150 mM NaCl, 3 mM EDTA, and 0.05% v/v Surfactant Tween-20, pH 7.4 (HBS-ET) running buffer at 25 C. and 37 C. The Biacore CM5 sensor chip surface was first derivatized by amine coupling with either mouse anti-human Fc specific mAb (Regeneron, mAb2567) to capture anti-SARS-COV-2bmAbs. Binding studies were performed on human SARS-COV-2 RBD extracellular domain expressed with a C-terminal myc-myc-hexahistidine (SARS-COV-2 SARS-COV-2 RBD extracellular domain expressed with a C-terminal mouse IgG2a (SARS-COV-2 RBD-mFc), and SARS-CoV-2 Spike ecto foldon Trimer expressed with a C-terminal myc-myc-hexahistidine (SARS-CoV-2 Spike ECD foldon). Use of these reagents allowed for the testing of the antibodies' ability to bind monomeric, dimeric, and trimeric RBD peptides, respectively. The amino acid sequence of the SARS-COV-2 Spike ECD foldon is as follows (Spike ecto: amino acids 1-1198; Fold on trimer: amino acids 1199-1225; GS: amino acids 1226-1227; thrombin: amino acids 1228-1233; myc-myc-hexahistidine tag: 1234-1261):
TABLE-US-00032 QCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGT NGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEF QFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLRE FVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGD SSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGI YQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSA SFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGC VIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFP LQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGT GVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAV LYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGI CASYQTQTNSPGSASSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMT KTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKT PPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQ KFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRENGIGVT QNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFG AISSVLNDILSRLDPPEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSEC VLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFP REGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKE ELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYI
[0312] Different concentrations of hSARS-COV-2 RBD-MMH, (90 nM-3.33 nM, 3-fold dilution), SARS-COV-2 RBD-mFc (30 nM-1.11 nM 3-fold dilution), and SARS-CoV2 Spike ECD foldon (0.78 nM-25 nM, three-fold serial dilution) prepared in HBS-ET running buffer, were injected for 3 minutes at a flow rate of 50 L/min while the dissociation of mAb bound different SARS-COV-2 RBD reagents was monitored for 6-10 minutes in HBS-ET running buffer. At the end of each cycle, the SARS-COV-2 RBD mAb capture surface was regenerated using either 12 sec injection of 20 mM phosphoric acid for mouse anti-human Fc specific mAb surface. The association rate (k.sub.a) and dissociation rate (k.sub.d) were determined by fitting the real-time binding sensorgrams to a 1:1 binding model with mass transport limitation using BiaEvaluation software v3.1 or Biacore Insight Evaluation software v2.0. or curve-fitting software. Binding dissociation equilibrium constant (K.sub.D) and dissociative half-life (t.sub.1/2) were calculated from the kinetic rates as:
[0313] Binding kinetics parameters for different SARS-COV-2 mAbs binding to different anti-SARS-COV-2 RBD reagents of the invention at 25 C. and 37 C. are shown in Tables 29 through 34, respectively.
TABLE-US-00033 TABLE 29 Binding kinetics parameters of SARS-COV-2 RBD-MMH binding to anti-SARS-COV-2-S monoclonal antibodies at 25 C. mAb 90 nM Ag Captured mAb Capture Bound k.sub.a k.sub.d KD t (mAb#) Level (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10913 287 3 55.9 4.04E+05 2.12E02 5.26E08 0.5 mAb10914 310 2 51.1 8.81E+04 3.76E03 4.26E08 3.1 mAb10915 310 2 63.2 9.61E+04 1.08E04 1.13E09 106.9 mAb10920 307 3 73.9 4.52E+05 1.30E02 2.87E08 0.9 mAb10921 307 3 61.4 1.01E+05 4.75E04 4.71E09 24.3 mAb10922 312.2 1.7 120.2 6.14E+05 1.48E03 2.41E09 7.8 mAb10923 283 2 80.4 4.66E+05 6.17E03 1.32E08 1.9 mAb10924 319 2 94.6 2.07E+05 1.74E03 8.40E09 6.6 mAb10930 284.7 0.7 59.6 1.24E+05 3.34E03 2.70E08 3.5 mAb10932 315 3 79.4 8.99E+04 1.21E04 1.35E09 95.5 mAb10933 280 1 99.8 1.52E+06 2.78E03 1.83E09 4.2 mAb10934 280 1 103.4 4.82E+06 5.77E03 1.20E09 2.0 mAb10935 337 2 107.8 3.93E+05 4.19E03 1.07E08 2.8 mAb10936 311 2 107.3 5.45E+05 1.07E03 1.97E09 10.8 mAb10937 311 2 102.2 5.72E+05 4.76E03 8.34E09 2.4 mAb10938 338 3 61.5 7.27E+04 1.75E04 2.41E09 66.0 mAb10939 343 2 82.3 1.63E+05 2.84E03 1.74E08 4.1 mAb10940 338 3 103.5 8.01E+05 2.51E03 3.13E09 4.6 mAb10941 327 1 92.1 1.20E+05 4.12E04 3.43E09 28.0 mAb10954 286.9 3 110.5 4.04E+05 3.64E04 8.99E10 31.7 mAb10955 298.3 2.5 88.8 1.61E+05 2.12E03 1.32E08 5.4 mAb10956 293.7 0.6 86.6 2.22E+05 4.06E03 1.82E08 2.8 mAb10957 286.7 2 93.0 1.38E+05 2.53E04 1.84E09 45.7 mAb10964 259.6 1.2 99.9 1.65E+06 3.90E04 2.36E10 29.6 mAb10965 253.1 1.9 63.6 1.24E+05 2.92E03 2.35E08 4.0 mAb10966 266.6 3 97.4 2.37E+05 3.65E04 1.54E09 31.6 mAb10967 260.2 0.9 70.7 1.24E+05 6.28E05 5.08E10 183.9 mAb10969 272.2 1.3 87.1 2.45E+05 3.80E03 1.55E08 3.0 mAb10970 307.3 1.3 102.8 2.27E+05 1.10E03 4.85E09 10.5 mAb10971 263.1 1.1 89.3 2.15E+05 3.75E04 1.74E09 30.8 mAb10977 305 3 98.5 2.43E+05 2.57E04 1.06E09 44.9 mAb10982 267.8 0.5 69.3 1.23E+05 2.06E03 1.68E08 5.6 mAb10984 334 2.1 117.9 2.04E+05 4.26E04 2.09E09 27.1 mAb10985 306.9 2.1 113.4 1.44E+06 1.55E03 1.08E09 7.5 mAb10986 268.8 0.9 104.3 4.64E+05 1.49E04 3.21E10 77.5 mAb10987 270.8 1.3 78.0 5.60E+05 1.20E02 2.14E08 1.0 mAb10988 279.2 2.3 63.6 8.29E+05 2.71E02 3.27E08 0.4 mAb10989 316.7 1.6 114.3 1.86E+06 2.78E03 1.50E09 4.2 mAb10996 414.2 2.8 37.5 1.41E+05 2.28E02 1.61E07 0.5 mAb10998 212.3 1 17.7 3.54E+05 1.84E02 5.21E08 0.6 mAb11000 322.6 3.5 73.6 1.09E+06 1.14E03 1.04E09 10.1 mAb11002 291.7 2.7 13.8 1.65E+05 6.73E03 4.07E08 1.7 mAb11004 232.9 0.6 76.4 3.79E+05 3.24E03 8.54E09 3.6 mAb11006 277.2 1.1 66.9 9.67E+04 4.40E04 4.55E09 26.3 mAb11008 214.9 1.5 40.8 9.30E+04 3.27E03 3.52E08 3.5 mAb11010 221.8 1.3 76.8 1.11E+06 2.74E03 2.47E09 4.2 mAb1932 205 0.8 5.3 NB NB NB NB
TABLE-US-00034 TABLE 30 Binding kinetics parameters of SARS-COV-2 RBD-MMH binding to anti-SARS-COV-2-S monoclonal antibodies at 37 C. mAb 90 nM Ag Captured mAb Capture Bound k.sub.a k.sub.d KD t (mAb#) Level (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10913 366 6 49 5.29E+05 5.56E02 1.05E07 0.2 mAb10914 401 3 63 2.51E+05 1.58E02 6.27E08 0.7 mAb10915 401 3 93 1.57E+05 7.57E04 4.84E09 15.3 mAb10920 394 3 73 6.10E+05 3.41E02 5.60E08 0.3 mAb10921 394 3 87 1.60E+05 2.07E03 1.29E08 5.6 mAb10922 405.6 1.7 130 1.04E+06 9.27E03 8.89E09 1.2 mAb10923 355 3 84 6.15E+05 2.76E02 4.48E08 0.4 mAb10924 406 5 110 2.99E+05 6.18E03 2.07E08 1.9 mAb10930 373.9 3.5 42 2.30E+05 1.87E02 8.14E08 0.6 mAb10932 406 4 119 1.43E+05 6.55E04 4.57E09 17.6 mAb10933 368 3 124 2.37E+06 8.28E03 3.49E09 1.4 mAb10934 368 3 117 4.62E+06 2.32E02 5.02E09 0.5 mAb10935 430 5 75 4.37E+05 3.74E02 8.56E08 0.3 mAb10936 402 3 126 9.75E+05 5.51E03 5.65E09 2.1 mAb10937 402 3 107 9.68E+05 2.43E02 2.51E08 0.5 mAb10938 434 3 100 1.06E+05 1.12E03 1.05E08 10.3 mAb10939 439 5 90 2.40E+05 9.46E03 3.95E08 1.2 mAb10940 434 3 124 1.42E+06 1.23E02 8.70E09 0.9 mAb10941 418 3 134 1.97E+05 1.75E03 8.87E09 6.6 mAb10954 371.8 2 131 5.68E+05 1.35E03 2.38E09 8.6 mAb10955 384.1 6.3 81 2.85E+05 1.26E02 4.43E08 0.9 mAb10956 383 2.3 89 3.56E+05 1.30E02 3.65E08 0.9 mAb10957 322 2.1 124 2.44E+05 6.19E04 2.54E09 18.7 mAb10964 333.3 4.6 121 3.68E+06 2.08E03 5.64E10 5.6 mAb10965 326.8 1.2 67 2.23E+05 9.19E03 4.12E08 1.3 mAb10966 350.2 2.9 118 4.40E+05 1.67E03 3.79E09 6.9 mAb10967 336 2.2 108 1.91E+05 2.62E04 1.38E09 44.1 mAb10969 349.5 3 86 4.07E+05 1.59E02 3.92E08 0.7 mAb10970 393.8 3.4 104 3.33E+05 7.58E03 2.28E08 1.5 mAb10971 347 1.9 116 3.92E+05 9.79E04 2.50E09 11.8 mAb10977 341 1.4 122 4.35E+05 1.31E03 3.01E09 8.8 mAb10982 347.5 1.3 67 1.94E+05 9.42E03 4.85E08 1.2 mAb10984 422.5 0.7 144 3.28E+05 1.82E03 5.55E09 6.3 mAb10985 395.5 2.5 134 2.57E+06 4.23E03 1.65E09 2.7 mAb10986 349.3 1.5 129 8.24E+05 5.83E04 7.07E10 19.8 mAb10987 354 5.3 82 8.38E+05 2.51E02 3.00E08 0.5 mAb10988 364.4 2.6 52 9.19E+05 5.78E02 6.29E08 0.2 mAb10989 405.6 1.9 128 2.97E+06 1.16E02 3.90E09 1.0 mAb10996 524.3 2.8 43 1.06E+05 1.25E02 1.19E07 0.9 mAb10998 271.1 0.6 15 2.81E+05 7.54E03 2.68E08 1.5 mAb11000 418.2 1 87 2.89E+05 9.10E03 3.14E08 1.3 mAb11002 370.1 2.5 12 2.81E+05 7.54E03 2.68E08 1.5 mAb11004 297.8 0.4 79 1.75E+06 1.48E03 8.48E10 7.8 mAb11006 350.2 1.2 92 6.28E+05 1.48E02 2.35E08 0.8 mAb11008 289.4 2.7 38 1.42E+05 1.51E03 1.06E08 7.6 mAb11010 286.3 0.5 96 1.67E+05 1.45E02 8.71E08 0.8 mAb1932 265.3 1.4 5 NB NB NB NB
TABLE-US-00035 TABLE 31 Binding kinetics parameters of SARS-COV-2 RBD-mFc binding to anti-SARS-COV-2-S monoclonal antibodies at 25 C. mAb 30 nM Ag Captured mAb Capture Bound k.sub.a k.sub.d KD t (mAb#) Level (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10913 107 0.4 65 5.00E+06 2.77E04 5.53E11 41.7 mAb10914 116 0.8 44 2.59E+05 1.40E04 5.40E10 82.5 mAb10915 103 0.2 41 2.83E+05 9.13E06 3.23E11 1265.1 mAb10920 116 0.9 69 5.08E+06 2.55E04 5.02E11 45.3 mAb10921 104 0.2 39 2.66E+05 3.34E05 1.25E10 345.8 mAb10922 111.4 80 3.20E+06 5.64E05 1.76E11 204.8 0.8 mAb10923 110 1.0 71 3.69E+06 1.35E04 3.67E11 85.6 mAb10924 121 0.5 74 8.09E+05 7.63E05 9.43E11 151.4 mAb10930 104.2 61 9.43E+05 1.71E04 1.81E10 67.5 0.9 mAb10932 121 0.8 60 2.95E+05 2.85E05 9.67E11 405.3 mAb10933 108 0.5 72 6.16E+06 6.10E05 9.89E12 189.3 mAb10934 113 0.5 70 1.12E+07 1.56E04 1.39E11 74.0 mAb10935 128 0.8 88 1.35E+06 1.07E04 7.94E11 107.9 mAb10936 117 0.4 74 1.78E+06 5.04E05 2.83E11 229.2 mAb10937 106 0.3 67 1.78E+06 5.40E05 3.04E11 213.9 mAb10938 128 1.5 47 2.42E+05 1.69E05 7.02E11 683.4 mAb10939 127 0.8 67 7.22E+05 8.74E05 1.21E10 132.2 mAb10940 102 0.4 67 3.72E+06 4.66E05 1.25E11 247.9 mAb10941 125 0.2 68 3.70E+05 3.48E05 9.43E11 331.9 mAb10954 108.8 86 2.35E+06 4.78E05 2.03E11 241.6 1 mAb10955 109.8 76 1.20E+06 9.22E05 7.71E11 125.3 0.8 mAb10956 104.1 74 1.46E+06 1.30E04 8.87E11 88.8 0.5 mAb10957 104.7 77 1.02E+06 3.35E05 3.27E11 344.8 0.5 mAb10964 93.3 0.3 70 9.30E+06 3.69E05 3.97E12 313.0 mAb10965 94.2 0.8 63 6.94E+05 1.56E04 2.25E10 74.0 mAb10966 100.2 73 1.50E+06 3.37E05 2.24E11 342.7 0.4 mAb10967 93.3 0.2 60 6.64E+05 1.35E05 2.03E11 855.6 mAb10969 111.4 80 4.64E+05 1.00E04 2.16E10 115.5 0.8 mAb10970 113.4 85 2.19E+06 4.05E04 1.85E10 28.5 0.7 mAb10971 99 0.5 72 1.40E+06 4.09E05 2.92E11 282.4 mAb10977 109.1 73 1.82E+06 2.29E05 1.26E11 504.4 0.4 mAb10982 94.8 0.1 59 9.10E+05 8.06E05 8.86E11 143.3 mAb10984 121 0.6 89 1.39E+06 3.97E05 2.86E11 290.9 mAb10985 112.7 77 8.09E+06 8.51E05 1.05E11 135.7 0.3 mAb10986 94.2 0.5 66 2.70E+06 2.40E05 8.88E12 481.3 mAb10987 98 0.7 73 3.19E+06 4.24E04 1.33E10 27.2 mAb10988 101.6 69 4.96E+06 5.08E04 1.02E10 22.7 0.6 mAb10989 112.1 77 1.08E+07 9.63E05 8.95E12 119.9 0.4 mAb10996 104.2 61 5.62E+05 8.02E04 1.43E09 14.4 0.9 mAb10998 94.8 0.1 59 1.47E+06 3.58E03 2.44E09 3.2 mAb11000 112.7 77 1.11E+06 1.27E04 1.15E10 90.9 0.3 mAb11002 121 0.6 89 5.54E+05 2.47E03 4.46E09 4.7 mAb11004 94.2 0.5 66 6.95E+05 6.40E05 9.21E11 180.5 mAb11006 98 0.7 73 3.30E+05 5.21E05 1.58E10 221.7 mAb11008 101.6 69 3.90E+05 1.92E04 4.92E10 60.2 0.6 mAb11010 112.1 77 1.14E+06 8.99E05 7.89E11 128.5 0.4 mAb1932 97.8 0.2 3 NB NB NB NB
TABLE-US-00036 TABLE 32 Binding kinetics parameters of SARS-COV-2 RBD-mFc binding to anti-SARS-COV-2-S monoclonal antibodies at 37 C. 30 nM mAb mAb Ag Captured Capture Bound k.sub.a k.sub.d KD t (mAb#) Level (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10913 147 0.8 75 6.32E+06 1.73E03 2.74E10 6.7 mAb10914 163 1.2 70 6.91E+05 2.20E04 3.18E10 52.5 mAb10915 141 0.6 63 4.41E+05 6.89E05 1.56E10 167.6 mAb10920 155 1.1 83 6.31E+06 7.53E04 1.19E10 15.3 mAb10921 135 0.3 62 4.58E+05 1.25E04 2.73E10 92.4 mAb10922 149.1 97 4.60E+06 1.60E04 3.49E11 72.2 1 mAb10923 144 0.8 88 5.53E+06 1.85E04 3.36E11 62.4 mAb10924 160 1.1 98 1.17E+06 1.31E04 1.12E10 88.2 mAb10930 142.9 72 1.49E+06 5.97E04 3.99E10 19.3 0.4 mAb10932 164 1.5 89 4.48E+05 6.86E05 1.53E10 168.4 mAb10933 152 0.9 89 7.30E+06 7.94E05 1.09E11 145.5 mAb10934 151 0.7 87 1.36E+07 2.93E04 2.16E11 39.4 mAb10935 171 0.8 101 5.68E+06 4.94E04 8.69E11 23.4 mAb10936 161 1.0 94 3.81E+06 6.75E05 1.77E11 171.1 mAb10937 141 0.6 85 4.47E+06 5.74E05 1.29E11 201.2 mAb10938 172 1.2 76 3.78E+05 6.56E05 1.73E10 176.1 mAb10939 169 0.6 92 1.06E+06 1.65E04 1.55E10 70.0 mAb10940 136 0.6 85 5.54E+06 5.04E05 9.10E12 229.2 mAb10941 164 0.8 100 8.02E+05 8.01E05 1.00E10 144.2 mAb10954 142.4 105 3.02E+06 1.12E04 3.69E11 103.1 0.8 mAb10955 146.8 91 1.92E+06 3.88E04 2.02E10 29.8 0.7 mAb10956 136.6 91 2.17E+06 3.42E04 1.58E10 33.8 0.4 mAb10957 137.7 100 1.55E+06 7.19E05 4.63E11 160.6 1.2 mAb10964 122.5 84 1.05E+07 1.26E04 1.20E11 91.7 0.3 mAb10965 125.7 81 1.42E+06 3.38E04 2.37E10 34.2 1 mAb10966 137.3 92 2.45E+06 9.93E05 4.05E11 116.3 1.1 mAb10967 123.3 81 1.45E+06 3.33E05 2.29E11 346.8 0.9 mAb10969 149.1 97 8.11E+05 1.41E04 1.74E10 81.9 1 mAb10970 149.9 102 2.18E+06 4.20E04 1.92E10 27.5 0.6 mAb10971 136.1 90 2.37E+06 9.41E05 3.97E11 122.7 0.8 mAb10977 145.8 93 2.50E+06 1.07E04 4.28E11 107.9 0.7 mAb10982 125.5 74 1.23E+06 2.58E04 2.10E10 44.8 0.8 mAb10984 158.4 110 2.07E+06 8.36E05 4.04E11 138.2 0.7 mAb10985 151.8 87 9.36E+06 3.75E04 4.01E11 30.8 0.7 mAb10986 125 0.7 83 4.59E+06 5.79E05 1.26E11 199.5 mAb10987 131.5 87 5.04E+06 3.90E04 7.75E11 29.6 0.7 mAb10988 138.6 82 8.34E+06 7.90E04 9.47E11 14.6 0.5 mAb10989 146.1 92 1.38E+07 3.65E04 2.65E11 31.6 0.6 mAb10996 142.9 72 9.35E+05 2.47E03 2.64E09 4.7 0.4 mAb10998 125.5 74 8.79E+05 1.97E02 2.24E08 0.6 0.8 mAb11000 151.8 87 1.63E+06 2.71E04 1.66E10 42.6 0.7 mAb11002 158.4 110 5.06E+05 1.65E02 3.26E08 0.7 0.7 mAb11004 125 0.7 83 1.01E+06 1.18E04 1.17E10 97.9 mAb11006 131.5 87 3.88E+05 7.65E05 1.97E10 151.0 0.7 mAb11008 138.6 82 4.64E+05 4.05E04 8.72E10 28.5 0.5 mAb11010 146.1 92 1.59E+06 8.02E05 5.05E11 144.0 0.6 mAb1932 128 0.3 5 NB NB NB NB
TABLE-US-00037 TABLE 33 Binding kinetics parameters of SARS-COV-2 Spike ECD foldon binding to anti-SARS-COV-2-S monoclonal antibodies at 25 C. mAb 30 nM mAb Capture Ag Captured Level Bound k.sub.a k.sub.d KD t (mAb#) (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10933 54.9 0.5 34.3 1.32E+06 6.05E05 4.58E11 190.9 mAb10934 48.8 0.6 34.6 2.21E+06 1.36E04 6.14E11 84.9 mAb10987 56.3 0.4 23.7 8.92E+05 4.16E05 4.67E11 277.6 mAb10989 58.6 0.6 39.7 1.75E+06 9.19E05 5.24E11 125.7 mAb1932 41.7 0.3 0.7 NB NB NB NB
TABLE-US-00038 TABLE 34 Binding kinetics parameters of SARS-COV-2 Spike ECD foldon to anti- SARS-COV-2-S monoclonal antibodies at 37 C. mAb 30 nM mAb Capture Ag Captured Level Bound k.sub.a k.sub.d KD t (mAb#) (RU) (RU) (1/Ms) (1/s) (M) (min) mAb10933 83.7 0.8 52.8 1.90E+06 7.90E05 4.17E11 146.2 mAb10934 79.7 0.7 40.1 2.85E+06 1.06E04 3.71E11 109.0 mAb10987 82.5 0.5 46.1 1.34E+06 5.74E05 4.28E11 201.2 mAb10989 88.0 0.9 57.5 2.38E+06 9.82E05 4.12E11 117.6 mAb1932 64.4 1.5 0.6 NB NB NB NB
Example 15: Characterization of Anti-SARS-CoV-2-S mAbs in an Antibody-Dependent Cellular Cytotoxicity (ADCC) Assay
[0314] The ability of antibodies targeting the spike protein of SARS-CoV-2 to interact with FcR3a, an Fc-receptor prominently expressed on natural killer (NK) cells, and induce antibody dependent cellular cytotoxicity (ADCC), was measured using NK cells purified from 3 donors and target cells bound to antibodies. In this assay, effector cells were NK cells isolated from LeukoPaks isolated from 3 different donors. Target cells were engineered Jurkat T cells expressing human CD20 (used as a positive control with a CD20-targeting human IgG1 antibody) alone or in combination with the full-length SARS-CoV-2 spike protein. NK cells were incubated with target cells and engagement of FcR3a via the Fc domain of human IgG1 antibodies bound to target cells led to the activation of the NK cells and target cell death. Cell killing was measured by assessing dead cell protease activity which drives increased luminescence and was used as the assay readout.
[0315] Jurkat T cells were engineered to constitutively express full length human CD20 (amino acids M1-P297 of NCBI accession number NP_690605.1). Jurkat/hCD20 cells were stained for CD20 expression and maintained in RPMI+10% FBS+P/S/G+250 g/ml hygromycin growth medium. These cells, without further modification, were used as a negative control, and will be referred to as Jurkat/hCD20 cells.
[0316] The above cells were then were engineered to constitutively express full-length SARS-CoV-2 spike Protein (amino acids M1-T1273 of NCBI accession number YP_009724390.1). These cells were then sorted for high expression of the spike protein and maintained in RPMI+10% FBS+P/S/G+1 g/ml puromycin+250 g/ml hygromycin growth medium, and will be referred to as Jurkat/hCD20/SARS-CoV-2 spike cells.
[0317] NK cells were isolated from donor LeukoPaks using Stem Cell Technologies RosetteSep Human NK cell Enrichment kits following the manufacturer's protocol.
[0318] One day before the assay, the Jurkat/hCD20 and Jurkat/hCD20/SARS-CoV-2 spike cells were split to 510.sup.5 cells/ml in their respective growth media. On the day of the assay, unstimulated human NK cells were isolated from leukocyte-enriched whole blood by density gradient centrifugation using NK RosetteSep Human NK Cell Enrichment Cocktail (Stem Cell Technologies) and SepMate tubes (Stem Cell Technologies) according to the manufacturer's instructions. NK cell enrichment was confirmed with a blood cell phenotyping cocktail of fluorophore-conjugated antibodies (anti-CD56, anti-CD3, anti-CD19, and anti-CD14).
[0319] Jurkat/hCD20 or Jurkat/hCD20/SARS-CoV-2 spike cells were resuspended in assay media (RPMI supplemented with 1% BSA, 100 U/ml penicillin, 100 g/ml streptomycin, and 292 g/ml L-glutamine) and added in triplicate to opaque, white 96-well flat-bottom plates at a concentration of 510.sup.3 cells/well. Four anti-SARS-CoV-2 spike antibodies and a negative isotype-matched control antibody were titrated in a 1:4 serial dilution ranging from 191 fM to 200 nM final concentration in assay media. A no-antibody control was included in each titration (providing a background signal, e.g., for nonspecific lysis of target cells in the presence of NK cells). A positive control antibody for ADCC (anti-CD20) was titrated in a 1:4 serial dilution ranging from 9.5 fM to 10 nM final concentration. Human NK cells were diluted in assay media and added to the assay plate at a final concentration of 2.510.sup.4 cells/well. To assess spontaneous lysis, untreated Jurkat cells alone (target cells) and NK cells alone (effector cells) were incubated in separate wells. Plates were incubated at 37 C., 5% CO.sub.2 for 3.5 hours. After incubation, the plates were equilibrated to room temperature for 10 minutes, followed by the addition of CytoTox Glo reagent (Promega) to the wells for 15 minutes with shaking. The luminescence signal was measured as a readout of cytotoxicity using an ENVISION plate reader. The cytotoxic response was calculated as follows:
Cytotoxicity (%)=(Experimental SignalSBS.sub.(target cells)SBS.sub.(effector cells))/(Max signal.sub.(target cells w/digitonin)SBS.sub.(target cells))100,
where SBS represents the spontaneous background signal. From this value, background was subtracted: (Value)(Average of no-antibody control).
[0320] For EC.sub.50 determinations, % Cytotoxicity was analyzed with GraphPad Prism using a 4-parameter logistic equation over a 12-point dose response curve, including the no antibody control. The experiment was run in triplicate with 3 donors.
[0321] The EC.sub.50 values and maximum (Max) % Cytotoxicity ranges from the various donors are summarized in Table 35.
[0322] With Jurkat/hCD20/SARS-CoV-2 spike target cells, all four SARS-CoV-2 spike antibodies showed greater max percent cytotoxicity compared to IgG1 control antibody. The EC.sub.50 values of the SARS-CoV-2 spike antibodies ranged from 20.0 pM to 25.1 nM, and the Max (% Cytotoxicity) values ranged from 6.1% to 19.8%. The positive CD20 control antibody showed a range of Max (% Cytotoxicity) from 27.5 to 44.6% with EC.sub.50 values ranging from 16.9 pM to 38.6 pM across three donor NK cells.
[0323] With Jurkat/hCD20 (negative control) target cells, all four SARS-CoV-2 spike antibodies behaved similar to the negative control antibody, showing minimal activity. Whereas the positive CD20 control antibody showed a range of Max (% Cytotoxicity from 24.5 to 26.4% with EC.sub.50 values ranging from 16.3 pM to 32.9 pM across three donor NK cells.
TABLE-US-00039 TABLE 35 ADCC Activity NK Donor 1-3 Jurkat/hCD20/SARS-CoV2 Jurkat/hCD20 Spike protein EC50 (M) Max (% Cytotoxicity) EC50 (M) Max (% Cytotoxicity) Range Range Range Range mAb10933 ND 1.1 to 4.9 1.24E10 to 11.4 to 17.5 2.00E11.sup.b mAb10987 ND 1.9 to 3.1 1.12E10 to 17.1 to 19.8 3.32E10 mAb10989 ND 1.9 to 2.6 1.56E10.sup.a 8.4 to 10.6 mAb10934 ND 0 to 4.6 2.51E08 to 6.1 to 11.6 2.17E11 IgG1 Control ND 0 to 4.2 ND.sup.b 1.8 to 7.2 Anti-CD20 1.63E11 to 24.5 to 26.4 1.69E11 to 27.5 to 44.6 IgG1 3.29E11 3.86E11 EC.sub.50 and Max (% Cytotoxicity) are a range of values from 3 donors. Max (% Cytotoxicity) is the highest mean % Cytotoxicity within the tested dose range. .sup.aFor two donors, dose dependent response observed but EC50 could not be calculated (NC). .sup.bFor one donor, dose dependent response observed but EC50 could not be calculated (NC). ND = Not determined. Dose dependent response was not observed.
Example 16: Characterization of Anti-SARS-CoV-2-S mAbs in an Antibody-Dependent Cellular Phagocytosis (ADCP) Assay
[0324] The ability of antibodies targeting the spike protein of SARS-CoV-2 to induce phagocytosis of Jurkat cells engineered to express the SARS-CoV-2 full length spike protein was evaluated. Macrophages differentiated from monocytes in the presence of macrophage colony-stimulating factor (M-CSF) were used as effector cells in an antibody dependent cellular phagocytosis (ADCP) assay. An IgG1 isotype as a negative control was evaluated in parallel. Phagocytosis was assessed by measuring the number of fluorescently labeled target cells colocalizing with fluorescently labeled macrophages using an Opera Phenix High-Content Screening System.
[0325] To generate Jurkat/hCD20 target cells, Jurkat T cells were engineered to constitutively express full length human CD20 (amino acids M1-P297 of accession number NP_690605.1). Jurkat/hCD20 cells were stained for CD20 expression and maintained in RPMI+10% FBS+P/S/G+250 g/ml hygromycin growth medium. These cells were used as a negative control.
[0326] To generate Jurkat/hCD20/SARS-CoV-2 spike target cells, Jurkat/hCD20 T cells were engineered to constitutively express full-length SARS-CoV-2 spike protein (amino acids M1-T1273 of accession number YP_009724390.1). Jurkat/hCD20/SARS-CoV-2 spike cells were sorted for high expression of the spike protein and maintained in RPMI+10% FBS+P/S/G+1 g/ml puromycin+250 g/ml hygromycin growth medium.
[0327] To generate effector cells, macrophages were differentiated from monocytes in the presence of M-CSF. Frozen CD14+ monocytes (Lonza) were thawed, resuspended in assay media (RPMI 1640 supplemented with 10% FBS, 100 U/ml penicillin, 100 g/ml streptomycin, and 292 g/ml L-glutamine, NaPyr, HEPES, NEAA, and 10 M BME), supplemented with 100 ng/ml M-CSF, and plated at 5.510.sup.4 cells/well into clear-bottom, collagen-coated 96-well plates for differentiation into macrophages over 7 days. Fresh M-CSF (100 ng/ml) was added on day 4.
[0328] One day before the assay, Jurkat target cells were split to 510.sup.5 cells/ml in their respective growth media. On the day of the experiment, target cells and monocyte-derived macrophages were incubated in PBS supplemented with either CellTrace CFSE dye or CellTrace Violet dye, respectively, for 15 minutes at 37 C., 5% CO.sub.2. CFSE-labeled target cells were washed and resuspended in assay media (RPMI 1640 supplemented with 10% FBS, 100 U/ml penicillin, 100 g/ml streptomycin, and 292 g/ml L-glutamine, NaPyr, HEPES, NEAA, and 10 BME) and added in duplicate to 96-well U-bottom plates at a density of 610.sup.4 cells/well. 4 anti-SARS-CoV-2 spike and the IgG1 control antibodies were titrated in assay media in a 1:5 serial dilution ranging from 51 fM to 20 nM final concentration and added to the plates. The zero-antibody point was represented by 10 fM in GraphPad Prism.
[0329] After 15 minutes of incubation on ice the mixture of target cells, with or without titrated antibody, was then transferred to plates containing the violet-labelled macrophages and plates were incubated at 37 C., 5% CO2 for 30 minutes. Wells were washed with PBS three times, followed by addition of 4.21% formaldehyde in PBS supplemented with 2.5 uM DRAQ5.
[0330] After a 20 minute incubation, wells were washed with PBS and imaged in both the 488 nm (CFSE-labelled target cells) and 375 nm (violet-labelled macrophages) excitation channels using an Opera Phenix High-Content Screening System. Image analysis was performed in Harmony software. Image segmentation in the 375 nm excitation channel was used to identify the macrophage population. Image segmentation in the 488 nm excitation channel was used to identify the target cells. Phagocytosis was quantified by identifying the macrophage population which contained target cells within them.
[0331] Percent phagocytosis was calculated by comparing number of macrophages undergoing phagocytosis to total macrophage cell number. From this value, background was subtracted to derive % ADCP: (Value)(Average of No antibody=background phagocytosis). For EC.sub.50 determinations, % ADCP was analyzed with GraphPad Prism using a 4-parameter logistic equation over a 10-point dose response curve, including the no antibody control. Maximum (Max) % ADCP was determined as the highest mean % ADCP value measured within a tested dose range. The assay was performed in duplicate across two donors, and results for one representative donor are shown.
[0332] The EC.sub.50 values and maximum (Max) % ADCP are summarized in Table 36. When tested in Jurkat/hCD20/SARS-CoV-2 spike cells, all four anti-SARS-CoV-2 spike antibodies showed greater Max % ADCP compared to an IgG1 control antibody. The EC.sub.50 values of the anti-SARS-CoV-2 spike antibodies ranged from 2.72 pM to 6.33 pM, and Max % ADCP ranged from 40.1% to 56.7%. When tested in Jurkat/hCD20 (negative control) target cells, all four anti-SARS-CoV-2 spike antibodies behaved similarly to the negative control antibody and had minimal activity.
TABLE-US-00040 TABLE 36 ADCP activity Jurkat/hCD20/SARS-CoV-2 Spike Jurkat/hCD20 cells cells EC.sub.50 Max Max mAb# [M] (% ADCP) EC.sub.50 [M] (% ADCP) mAb10933 ND 3.67 5.79E12 53.4 mAb10987 ND 5.60 6.33E12 56.7 mAb10989 ND 3.52 4.86E12 56.0 mAb10934 ND 2.05 2.72E12 40.1 IgG1 Isotype ND 1.97 ND 10.4 Control ND: Not determined because a concentration-dependent response was not observed Max (% ADCP) is the highest mean % ADCP value within tested dose range.
Example 17: Anti-SARS-CoV-2 Antibodies Block RBD Binding to hACE2 as Determined by ELISA
[0333] An ELISA-based blocking assay was used to determine the ability of anti-SARS-CoV-2 antibodies to block the binding of the SARS-COV-2 Spike protein receptor binding domain (RBD) to its receptor, human angiotensin converting enzyme 2 (hACE2).
[0334] The SARS-CoV-2 protein used in this assay was comprised of the receptor binding domain (RBD) portion of the SARS-CoV-2 Spike protein (amino acids Arg319-Phe541) expressed with the Fc portion of the human IgG1 at the c-terminus (SARS-CoV-2 RBD-hFc) The human ACE2 protein used in the experiments was purchased from R&D Systems and was comprised of amino acids Gln18-Ser740 with a C-terminal 10-Histidine tag (hACE2-His; NCBI Accession No. Q9BYF1).
[0335] Experiments were carried out using the following procedure. A monoclonal anti-Penta-His antibody (Qiagen) was coated at 1 g/ml in PBS on a 96-well microtiter plate overnight at 4 C. The hACE2-His receptor was added at 0.2 ug/ml in PBS and bound for two hours at room temperature (RT). Nonspecific binding sites were subsequently blocked using a (w/v) solution of BSA in PBS. In other microtiter plates, a constant amount of 100 pM of SARS-CoV-2 RBD-hFc protein was bound with anti-SARS-COV-2 antibodies and an isotype IgG1 antibody control at dilutions from 0.0008 nM to 50 nM in PBS+0.5% BSA. After a one-hour incubation, the mixture solutions were transferred to the microtiter plate coated hACE2-His. After 1.5 hours of incubation at RT, the wells were washed, and plate-bound SARS-COV2 was detected with goat-anti-human IgG antibody conjugated with horseradish peroxidase (HRP) (Jackson). The plates were then developed using TMB substrate solution (BD Biosciences, #555214) according to manufacturer's recommendation and absorbance at 450 nm was measured on a Victor X5 plate reader.
[0336] Binding data were analyzed using a sigmoidal dose-response model within Prism software (GraphPad). The calculated IC50 value, defined as the concentration of antibody required to block 50% of SARS-CoV-2 RBD-hFc binding to plate-coated hACE2-His, was used as an indicator of blocking potency. Percent blocking was defined based on the background-corrected binding signal observed at the highest antibody concentration tested using this formula and reported for all tested antibodies:
[0337] Antibodies that blocked binding less than or equal to 50% at the highest concentration tested were classified as non-blockers and IC50 values were not reported for those antibodies.
[0338] The ability of anti-SARS-CoV-2 antibodies to block SARS-CoV-2 RBD binding to human ACE2 was assessed using a blocking ELISA. In this assay 100 pM SARS-COV-2 RBD-hFc was titrated with a wide range of the concentrations of the anti-SARS-CoV-2-S antibody and the inhibition of the presence of the antibody on RBD binding to hACE2-His was evaluated. The plate-bound RBD-hFc was detected with an HRP conjugated anti-hFc antibody.
[0339] The blocking IC50s and maximum blocking at the highest tested concentrations of the anti-SARS-CoV-2-S antibodies are summarized in Table 37, and the blocking curves shown in
TABLE-US-00041 TABLE 37 Blocking potency of Anti-SAR-COV-2 Antibodies on Spike RBD- hFc Binding to Immobilized Human ACE-2 Blocking 100 pM Blocking 100 pM (RBD) .Math. hFc to Assay (RBD) .Math. hFc to ACE2 % mAb Run # ACE2 IC.sub.50, M Blocking mAb10913 1 2.17E10 80 mAb10914 1 9.80E10 93 mAb10915 1 3.21E10 99 mAb10920 1 3.38E10 95 mAb10920 3 1.39E10 87 mAb10921 1 4.33E10 99 mAb10921 3 5.07E10 94 mAb10922 2 6.65E11 97 mAb10923 1 1.49E10 94 mAb10923 3 1.84E10 85 mAb10924 1 1.63E10 98 mAb10924 2 1.27E10 98 mAb10930 2 2.82E10 86 mAb10932 1 3.73E10 99 mAb10933 1 7.07E11 99 mAb10933 3 6.53E11 95 mAb10933 2 5.22E11 101 mAb10934 1 6.60E11 96 mAb10934 3 5.97E11 98 mAb10934 2 4.80E11 96 mAb10935 1 1.02E10 99 mAb10935 2 6.94E11 98 mAb10936 1 8.75E11 95 mAb10936 2 7.10E11 97 mAb10937 1 6.49E11 99 mAb10938 1 2.75E10 99 mAb10939 1 1.75E10 97 mAb10939 3 2.63E10 93 mAb10940 1 6.52E11 92 mAb10941 1 2.27E10 100 mAb10941 2 2.06E10 100 mAb10954 2 7.11E11 95 mAb10955 2 1.41E10 97 mAb10956 2 1.85E10 99 mAb10957 2 1.69E10 99 mAb10964 3 6.83E11 93 mAb10964 2 6.25E11 95 mAb10965 2 2.13E10 97 mAb10966 2 1.60E10 99 mAb10967 2 2.80E10 98 mAb10969 3 2.15E10 95 mAb10970 2 1.07E10 97 mAb10971 2 1.49E10 98 mAb10977 3 8.71E11 77 mAb10977 2 7.11E11 65 mAb10982 2 1.16E10 93 mAb10984 2 7.75E11 90 mAb10985 3 6.96E11 97 mAb10985 2 4.11E11 99 mAb10986 2 7.54E11 98 mAb10987 3 2.85E10 93 mAb10987 2 1.81E10 95 mAb10988 2 8.64E11 95 mAb10989 3 5.91E11 96 mAb10989 2 4.28E11 98 mAb10996 3 6.10E09 71 mAb10998 3 4.30E09 55 mAb11000 3 4.50E09 75 mAb11002 3 NBD 7 mAb11004 3 NBD 9 mAb11006 3 2.20E10 85 mAb11008 3 1.49E09 93 mAb11010 3 1.47E10 83 mAb193250 IgG1 1 8 Control mAb193250 IgG1 3 19 Control mAb193250 IgG1 2 15 Control Note: RBD-hFc at 100 pM was titrated with anti-SARS-COV-2-S antibodies in serial dilutions from 50 nM and bound RBD-hFc on immobilized hACE2 with a 10 histidine tag, and detected with HRP-conjugated anti-hFc antibody. NBD; no blocking detected.
Example 18: Neutralization of Cleaved SARS-CoV-2 Spike Proteins and Neutralization with Fabs
[0340] Because pseudoparticles containing the SARS-CoV-2 Spike may be pre-cleaved by furin-like proteases at the polybasic S1/S2 cleavage site during biogenesis in HEK293T cells, the impact of this cleavage on mAb neutralization potency was assessed. Spike stabilized pseudoparticles (
Example 19: Cross-Competition Between Anti-SARS-CoV-2-S mAbs
[0341] mAb10987, mAb10989, mAb10933, and mAb10934 were examined in cross-competition binding assays (
[0342] Epitope binning of the anti-SARS-CoV-2-S mAbs was conducted in a pre-mix sandwich format involving competing mAbs against one another in a pairwise combinatorial manner for binding to SARS-CoV-2 RBD-MMH protein using a ForteBio Octet HTX biolayer interferometry instrument (Molecular Devices ForteBio LLC, Fremont, CA) with running buffer of 10 mM HEPES, 150 mM NaCl, 0.05% (v/v) Tween-20, pH 7.4, 1 mg/mL BSA. Assays were performed at 30 C. with continuous agitation at 1000 rpm. After obtaining an initial baseline in running buffer 20 g/mL of anti-COVID19 mAbs was captured onto anti-human Fc (AHC) biosensor tips for 300 s. To block remaining free unsaturated binding sites on AHC biosensor tips, all sensors were exposed for 240 s to blocking solution well containing 100 g/mL irrelevant IgG1. Following this process, biosensors were immersed into wells containing pre-mix solution of 100 nM SARS CoV-2 RBD-MMH protein and 600 nM of anti-COVID19 mAb binding site of a second mAbs for 300 s. Binding response at each step was recorded and specific signal was normalized by subtracting self-blocking mAb competing control from dataset. Data analysis was performed with Octet Data Analysis HT 10.0 software using the Epitope Binning.
[0343] Comparing the cross-competition binding assays with the HDX-MS results described above provides structural insights into the mechanism by which non-competing pairs of antibodies can simultaneously bind the RBD, and can thus be ideal partners for a therapeutic antibody cocktail. mAb10987 and mAb10933 represent such a pair of antibodies. mAb10933 targets the spike-like loop region on one edge of the ACE2 interface. Within that region, the residues that show the most significant HDX protection by mAb10933 face upward, suggesting that the Fab region of mAb10933 binds the RBD from the top direction, where mAb10933 will have significant collisions with ACE2. In order to avoid competition with mAb10933, mAb10987 can only bind to the HDX-defined protected regions from the front or the lower left side (in the front view of mAb10987 in
Example 20: Structure Determination of Antibody-Bound Spike Protein
[0344] To better understand the binding of mAb10933 and mAb10987 to the spike protein RBD, structural analysis was performed via cryo-electron microscopy (cryoEM). Fab fragments of mAb10933 and mAb10987 were isolated using FabALACTICA kit (Genovis). 600 g of the mAb10933 Fab and 600 g of mAb10987 Fab were mixed with 300 g of SARS-CoV-2-S RBD and incubated on ice for 1 hour then injected into a Superdex 200 increase gel filtration column equilibrated to 50 mM Tris pH 7.5, 150 mM NaCl. Peak fractions containing the mAb10933 Fab-mAb10987 Fab-RBD complex were collected and concentrated using a 10 kDa MWCO centrifugal filter. For cryoEM grid preparation, the protein sample was diluted to 1.5 mg/mL and PMAL-C8 amphipol was added. 3.5 L of protein was deposited onto a freshly plasma cleaned UltrAufoil grid (1.2/1.3, 300 mesh). Excess solution was blotted away using filter paper and plunge frozen into liquid ethane using a Vitrobot Mark IV. The cryoEM grid was transferred to a Titan Krios (Thermo Fisher) equipped with a K3 detector (Gatan). Movies were collected using EPU (Thermo Fisher) at 105,000 magnification, corresponding to a pixel size of 0.85 . A dose rate of 15 electrons per pixel per second was used and each movie was 2 seconds, corresponding to a total dose of 40 electrons per 2.
[0345] All cryoEM data processing was carried out using cryoSPARC v2.14.2. 2,821 movies were aligned using patch motion correction and patch CTF estimation. 2,197 aligned micrographs were selected for further processing on the basis of estimated defocus values and CTF fit resolutions. An initial set of particles picked using blob picker were subjected to 2D classification to generate templates for template picking. 989,553 particles picked by template picking were subjected to multiple rounds of 2D classification to remove unbound fabs and particles containing an incomplete complex. Ab initio reconstruction with three classes generated a single class containing 61,707 particles that corresponded to the mAb10933 Fab-mAb10987 Fab-RBD complex. Heterogenous refinement of the particles in this class followed by non-uniform refinement resulted in a 3.9 resolution (FSC=0.143) map containing 48,140 particles that was used for model building. Into this map, we manually placed models of the RBD (taken from PDB code 6M17) and the two Fabs (taken from prior antibody structures, except for the lambda light chain of mAb10987 which came from PDB code 5U15). These models were then manually rebuilt using Coot and real-space refined against the map using Phenix.
[0346] Confirming the above-described data, single-particle cryoEM of the complex of SARS-CoV-2 spike RBD bound to Fab fragments of mAb10933 and mAb10987 shows that the two antibodies in this cocktail can simultaneously bind to distinct regions of the RBD (
Example 21: Protection Against the Emergence of Escape Mutants
[0347] Because rapidly emerging virus mutants are becoming the next major concern in the fight against the global pandemic, it is important that therapeutic treatments provide coverage against circulating variants and do not contribute to development of treatment emergent resistance. To this end, the sequence diversity of the spike protein was investigated and the emergence of minor virus variants was monitored in SARS-COV-2 isolates found in nature or identified from preclinical in vitro and in vivo studies and in the clinic. A combination of non-competing antibodies not only provides full coverage against circulating variants but also protects against emergence of such variants and their potential seeding into the population in a clinical setting.
[0348] Although in vitro escape studies using recombinant viruses strongly support the rationale of using non-competing antibody combinations to avoid resistance, questions remain regarding the relevance of these findings to authentic SARS-CoV-2 virus, to in vivo infection models, and most importantly, to the clinical setting. In this example, in vitro escape variants were rapidly selected against all individual clinical stage-antibodies targeting the receptor binding domain (RBD) of the spike protein, independent of the targeted epitope or its degree of conservation, but this risk was mitigated by utilizing non-competing combinations of two non-competing antibodies, and even further reduced by combining three non-competing antibodies. Escape variants were also efficiently selected in vivo upon treatment with individual antibodies, in the hamster model of infection, independent of dosage or treatment setting (prophylaxis or therapy), while the combination of mAb10933 and mAb10987 fully protects against development of such resistance. Importantly, these findings were confirmed in humans: the genetic diversity of the entire spike protein across 4,882 samples from 1,000 outpatients or hospitalized patients with confirmed COVID-19 from ongoing Phase 1-3 trials was confirmed. Analysis of baseline and post-treatment sequence diversity in placebo and patients treated with mAb10933+mAb10987 demonstrated that the non-competing antibody combination protects against selection of spike protein resistant variants.
[0349] With the recent rise in rapidly emerging variants, there was a need to test the hypothesis that a non-competing antibody combination would retain its potency as the virus evolves during spread in the human population and safeguard against selection of escape mutants following treatment. This hypothesis was tested by evaluating the potency of individual antibodies as well as the combination of mAb10933 and mAb10987 against variants of concern, such as the UK B.1.1.7, California B.1.429, and E484K containing variants including South Africa B.1.351, Brazil P.1, and multiple other lineages around the world, such as the New York B.1.526 lineage. Even in instances where one of the antibodies was impacted, the combination retained full neutralization potency, a key property through which this combination of antibodies was originally selected (
Materials and Methods
In Vitro Escape Studies and Neutralization Assays
[0350] Methods for pseudoparticle generation, neutralization assays, and escape studies have been previously described in detail above and in U.S. Pat. No. 10,787,501.
Neutralization Assays
[0351] Vesicular stomatitis virus (VSV) was pseudotyped with the SARS-CoV-2 spike protein and utilized for neutralization assays as previously described. In short, HEK293T cells (ATCC CRL-3216) were transfected with a SARS-CoV-2 spike expression plasmid encoding either wild-type (Wuhan-Hu-1) or variant spike protein. At 24 hours post transfection, the cells were then infected at an MOI of 1 with a modified VSV encoding a reporter construct in place of the native viral glycoprotein. The pseudoparticle containing supernatant was collected at 24 hours post infection and frozen at 80 C. before use. Neutralization assays were performed by infecting Vero cells (ATCC: CCL-81) with SARS-CoV-2 pseoduparticles preincubated with serial dilutions of antibody. Viral reporter signal was then read out at 24 hours post infection to determine the IC50 values for each antibody.
In Vitro Escape Studies
[0352] Escape studies were performed with recombinant VSV-spike virus. Antibodies were serially diluted 1:5 starting at 100 ug/mL. Virus replication was monitored by screening for cytopathic effect. The supernatants were collected from wells with the highest antibody concentration and evident viral replication. Total RNA was extracted from cells using TRIzol (Life Technologies) following the manufacturer's protocol for next gen sequencing. For a second round of selection, 100 uL of supernatant containing the virus was passed under the same or greater antibody concentrations as before. Again, the supernatants were collected, and RNA was extracted from cells in wells with the highest antibody concentration with evident viral replication and subjected to RNAseq analysis.
Hamster Study
[0353] A total of 80 golden hamsters, male, approximately 9 weeks of age (130-150 g) were used in the study. Animals were weighed prior to the start of the study. The animals were monitored twice daily for signs of COVID-19 disease (ruffled fur, hunched posture, responsiveness, nasal discharge, labored breathing, a.o.) during the study period. Body weights were measured once daily during the study period. Antibodies were dosed through intraperitoneal (IP) injection (0.200 ml volume). Animals were challenged with 110{circumflex over ()}4 PFU of (USA-WA1/2020 (NR-52281; BEI Resources) by administration of 0.05 ml total of viral inoculum, 0.025 ml dropwise into each nostril (mock exposed animals received the same volume of sterile PBS). Prior to treatment and virus administration, animals were sedated using inhalational isoflurane. At study end (day 7 post-challenge), animals were euthanized via inhalational CO.sub.2 and tissues samples were aseptically collected for RNAseq. Tissue samples were inactivated using Trizol Reagent (Invitrogen, Carlsbad, CA, USA). All animal studies were conducted in compliance with all relevant local, state, and federal regulations and were approved by the Texas Biomed Institutional Animal Care and Use Committee (IACUC; protocol number 1739MA).
Clinical Trial Design
Outpatient Clinical Trial
[0354] This is an ongoing adaptive, multicenter, randomized, double-blind, placebo-controlled, seamless phase 1/2/3 clinical trial in COVID-19 outpatients (clinicaltrials.gov: NCT04425629). Non-hospitalized patients >18 years of age with a SARS-CoV2-positive test result <72 hours, and symptom onset <10 days before randomization, were randomized 1:1:1 to receive placebo, 2.4 g (1.2 g each of mAb10933 (casirivimab) and mAb10987 (imdevimab)) or 8.0 g (4.0 g each of casirivimab and imdevimab). The primary virologic endpoint was the time weighted average daily change in viral load from baseline (Day 1) through Day 7. The key secondary clinical endpoint was the proportion of patients with 1 or more Covid-19 related medically-attended visit (MAV) through Day 29. For the present work, 3523 nasopharyngeal, 17 nasal and 6 saliva samples retrieved from a total of 728 patients were analyzed.
Hospitalized Patient Clinical Trial
[0355] This is an ongoing adaptive, multicenter, randomized, double-blind, placebo-controlled, seamless phase 1/2/3 clinical trial in hospitalized patients with Covid-19 (clinicaltrials.gov: NCT04426695). Hospitalized patients >18 years of age with a SARS-CoV2-positive test result <72 hours, and symptom onset <7 days before randomization, were randomized 1:1:1 to receive placebo, 2.4 g (1.2 g each of casirivimab and imdevimab) or 8.0 g (4.0 g each of casirivimab and imdevimab). The primary clinical endpoint was the incidence of death or required mechanical ventilation through Day 29. For the present work, 968 nasopharyngeal, 249 nasal and 119 saliva samples retrieved from a total of 272 patients were analyzed.
Virus RNA, RT-PCR and Sequencing
[0356] Viral RNA was extracted from hamster samples and from samples collected in the clinical trials (Viracor-Eurofins, MO, USA). For clinical samples, qualitative and quantitative measurements of viral load were determined by quantitative RT-PCR (Viracor-Eurofins, MO, USA). 10 ul of RNA combined with 25 ng Human Universal Reference RNA (Agilent) was purified by PureBeads (Roche Sequencing). cDNA synthesis was performed using SuperScript IV First-Strand Synthesis System (Thermal Fisher) following vendor's protocol. Then one half of cDNA (10 ul) was used to generate libraries using Swift Normalase Amplicon Panel (SNAP) SARS-CoV-2 Panel (Swift Biosciences) following vendor's protocol. Sequencing was run on NextSeq (Illumina) by multiplexed paired-read run with 2150 cycles. Overall quality report was generated summarizing the quality of all reads in each sample, along each base pair.
Variant Calling Analysis
[0357] Swift amplicon bulk RNA-seq reads were aligned to the SARS-COV-2 reference genome Wuhan-Hu-1 (accession: MN908947) using Minimap2 (v2.17). The alignments were sorted by read name, and primers were clipped by the complementary Swiftbiosciences primerclip software (v0.3.8) (github.com/swiftbiosciences/primerclip). Duplicate reads were removed using the Picard package (https://github.com/broadinstitute/picard) and target coverage was summarized for each sample with custom scripts. GATK HaplotypeCaller (v4.1.8) was used to perform single nucleotide polymorphism (SNP) calling. At each SNP, the frequency of viral mutations inferred from the sequencing reads were calculated from samtools (v1.9) pileup output. Variants were flagged if nucleotide positions were covered by at least 10 reads and frequency of mutated reads at these positions was at least 15%.
Variant Calling from SARS-CoV-2 Public Genomes
[0358] Variant calling from SARS-CoV-2 public genomes was performed as described in Baum et al., Science 370(6520):1110-1115 (2020). SARS-CoV-2 complete genome sequences were downloaded from GISAID Nucleotide database (https://www.gisaid.org) on Feb. 4, 2021. Sequences were curated and genetic diversity of the spike-encoding gene was assessed across high quality genome sequences using custom pipelines. In brief, Blastn was used to align the Wuhan-Hu-1 spike nucleotide sequence (accession: MN908947) against each individual genome. Results were analyzed and presence of the gene was validated if alignment length was greater than 95% with an identity percentage greater than 70%. Homologous spike protein sequences were extracted, translated and aligned to identify amino-acid changes with respect to the reference.
Results
[0359] As shown above, combination therapy with two anti-spike antibodies targeting non-overlapping epitopes of SARS-CoV-2 spike protein minimizes the likelihood of rapid viral escape observed in vitro with monotherapy. Expanding on this work using VSV-SARS-CoV-2-spike recombinant virus to monitor resistance to mAb treatment, escape studies were performed with several RBD-targeting mAbs approved under Emergency Use Authorization or in clinical trials, as a monotherapy as well as double and triple combinations. While only one to two passages led to complete virus resistance against all mAbs used as monotherapy, seven consecutive passages were needed to reach complete resistance to the REGEN-COV combination, requiring multiple simultaneous mutations impacting each antibody (
[0360] Rapid escape observed in the monotherapy setting was independent of the targeted epitope or its sequence conservation; indeed, escape variants were rapidly selected against an antibody targeting a pan-coronavirus epitope, VIR-7831 (
[0361] There are potential advantages of combining three non-competing neutralizing mAbs targeting the RBD of SARS-CoV-2 (mAb10933+mAb10987+mAb10985). The three mAbs are all able to bind simultaneously to the RBD of the spike protein in a non-overlapping fashion and the combination has similar neutralization potency as REGEN-COV (
[0362] To understand how these in vitro escape findings demonstrated that mAb combination treatments safeguard against development of drug resistance translate to a more physiological setting, virus evolution was evaluated in vivo following mAb administration as both monotherapy (mAb10987 or mAb0933) and as the REGEN-COV combination in the SARS-CoV-2 hamster challenge model. Animals were challenged with SARS-CoV-2 (USA-WA1/2020) and treated with either high or low dose (50 mg/kg or 5 mg/kg) of either mAb10987 or mAb10933 as monotherapy or with the REGEN-COV combination (50 mg/kg or 5 mg/kg) in both prophylactic and treatment settings (
[0363] To assess the emergence of drug resistance in REGEN-COV treated COVID-19 patients, the genetic diversity of 1,336 and 3,546 SARS-CoV-2 RNA samples isolated from 272 hospitalized and 728 non-hospitalized individuals, respectively, was characterized at baseline and several time points post mAb cocktail administration (
[0364] To determine whether REGEN-COV treatment contributed to selection of resistant variants in the spike protein, the frequency of minor variants in each patient from all available RT-PCR positive samples was longitudinally compared. Among all patient samples from the hospitalized group, a total of 89, 87 and 108 amino acid changes were identified in the placebo, low-dose and high dose treated groups, respectively. These mutations were evenly spread across the entire spike protein sequence (
[0365] A total of 216, 248 and 212 amino acid changes were identified among the 1,215 placebo, 1,203 low-dose and 1,128 high-dose REGEN-COV treated patient samples respectively from the non-hospitalized group, spread across the entire spike protein sequence (
[0366] To determine the functional impact of RBD variants identified at multiple time points in REGEN-COV treated patients, individual antibodies and the combination were assessed for neutralization potency against the G446V, S494P, S477N, and K537R variants (
[0367] All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g., Genbank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated to be incorporated by reference. This statement of incorporation by reference is intended by Applicants to relate to each and every individual publication, database entry (e.g., Genbank sequences or GeneID entries), patent application, or patent identified even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.
TABLE-US-00042 TABLE38 SequencesExcludedfromST.26-Formatted SequenceListing SEQIDNO: Sequence 13 gacaataat 14 DNN 33 aaggcgtct 34 KAS 54 gctgcatcc 55 AAS 110 tgggcatct 111 WAS 148 ggtgtatcc 149 GVS 193 gatgcatcc 194 DAS 293 ggtgcatcc 294 GAS 443 gctgcctcc 460 aaggcatct 583 ggtaacagc 584 GNS 631 ggtaacacc 632 GNT 649 gatgtcagt 650 DVS 669 agtaataat 670 SNN 819 actgcatcc 820 TAS