NOOTROPIC PEPTIDES FOR TREATING LYSOSOMAL STORAGE DISEASES
20240043473 ยท 2024-02-08
Inventors
Cpc classification
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
International classification
Abstract
Provided are compositions and methods for treating progressive neurological childhood symptoms and conditions associated with lysosomal storage disorders (LSD) such as neurological mucopolysaccharidoses. The compositions may include nootropic peptides such as Semax, which can be N-terminally acetylated and/or C-terminally amidated. The peptides can be effectively delivered by intranasal administration into the brain parenchyma, where they exert a neuroprotective and anti-inflammatory effect and delay or restore neuropathophysiological defects such as neuropsychiatric problems, developmental delays, mental retardation and dementia.
Claims
1. A method for treating a neuropathophysiological condition in a patient in need thereof, comprising administering to the patient an effective amount of an agent that increases the biological activity of brain-derived neurotrophic factor (BDNF).
2. The method of claim 1, wherein the patient suffers from a lysosomal storage disorder (LSD).
3. The method of claim 1, wherein the LSD is selected from the group consisting of a lipid storage disorder, a mucopolysaccharidosis, a glycoprotein storage disorder, and a mucolipidosis.
4. The method of claim 3, wherein the LSD is the mucopolysaccharidosis (MPS).
5. The method of claim 4, wherein the mucopolysaccharidosis (MPS) is selected from the group consisting of MPS I, MPS II, MPS III, MPS VII, and MPS IX.
6. The method of claim 5, wherein the MPS is MPS IIIA, MPS IIIB, MPS IIIC, or MPS IIID.
7. The method of claim 1, wherein the neuropathophysiological condition is selected from the group consisting of dementia, aggressive behavior, hyperactivity, seizure, deafness and loss of vision.
8. The method of claim 1, wherein the agent is selected from the group consisting of nootropic peptides, Acetyl L-Carnitine (ALCAR), Alpha-GPC, Alpha-Lipoic Acid (ALA), Aniracetam, Ashwagandha, Artichoke Extract (Luteolin), Bacopa Monnieri, Berberine, Black Seed Oil, Cacao, Caffeine, Cat's Claw, CBD Oil, Choline, Choline Bitartrate, Choline Citrate, Citicoline, CDP-Choline, Centrophenoxine, Coconut & MCT Oil, Coluracetam, CoQ10 & Ubiquinol, Creatine, DHA (Omega 3), DHEA, DMAE, 5-HTP, Forskolin (Coleus root), GABA, Ginkgo Biloba, Ginseng, Gotu Kola, Glycine, Holy Basil (Tulsi), Huperzine-A, Iodine, Kava Kava, Kratom, Lion's Mane, L- Carnosine, L-Dopa (Mucuna Pruriens), Lemon Balm, L-Glutamine, Lithium Orotate, L-Theanine, Maca, Magnesium, Medicinal Mushrooms, Methylene Blue, Melatonin, N-Acetyl L-Cysteine, N-Acetyl L-Tyrosine, NADH, Nefiracetam, Nicotine, Noopept, Oat Straw, Oxiracetam, Phenibut, Phenylpiracetam, Picamilon, Pine Bark Extract, Piperine, Piracetam, Rhodiola Rosea, Phenylalanine, Phenylethylamine (PEA), Phosphatidylcholine (PC), Phosphatidylserine (PS), PQQ, Pramiracetam, Pterostilbene, Quercetin, Resveratrol, Rosemary, Saffron, SAM-e, St John's wort, Sulbutiamine, Taurine, Tryptophan, Turmeric, Tyrosine, Uridine Monophosphate, Valerian, Vinpocetine, Vitamin B1 (Thiamine), Vitamin B3 (Niacin), Vitamin B5 (Pantothenic Acid), Vitamin B6 (Pyridoxine), Vitamin B8 (Inositol), Vitamin B9 (Folate), Vitamin B12 (Cobalamin), Vitamin D, and Zinc.
9. The method of claim 8, wherein the agent is a peptide that comprises the amino acid sequence of MEHFPGP (SEQ ID NO:1) or an analog thereof.
10. The method of claim 9, wherein the analog comprises an amino acid sequence selected from the group consisting of MGHFPGP (SEQ ID NO:3), MEHFXPGP (SEQ ID NO:4), MGHFXPGP (SEQ ID NO:5), MEHFPAP (SEQ ID NO:6), MEHFXPAP (SEQ ID NO:7), and MGHFXPAP (SEQ ID NO:8), wherein X represents any amino acid residue.
11. The method of claim 9, wherein the peptide is N-terminally acetylated.
12. The method of claim 9, wherein the peptide is C-terminally amidated.
13. The method of claim 9, wherein the peptide is 20 amino acid residues or fewer in length.
14. The method of claim 1, wherein the administering is intranasal.
15. A method for treating a neurological mucopolysaccharidosis (MPS) in a patient in need thereof, comprising intranasal administration to the patient an effective amount of a peptide that comprises an amino acid sequence selected from the group consisting of MEHFPGP (SEQ ID NO:1), MGHFPGP (SEQ ID NO:3), MEHFXPGP (SEQ ID NO:4), MGHFXPGP (SEQ ID NO:5), MEHFPAP (SEQ ID NO:6), MEHFXPAP (SEQ ID NO:7), and MGHFXPAP (SEQ IDNO:8), wherein X represents any amino acid residue.
16. The method of claim 15, wherein the patient has decreased biological activity or physiological level of brain-derived neurotrophic factor (BDNF) as compared to a healthy subject.
17. The method of claim 15, wherein the patient has decreased synaptic transmission or decreased physiological level of SYN1, PSD95, VGLUT1, Gephyrin, or VGAT.
18. The method of claim 15, further comprising monitoring the treatment by checking the level of BDNF in the patient.
19. The method of claim 15, wherein the patient suffers from MPS III.
20-26. (canceled)
27. An isolated peptide that comprises an amino acid sequence selected from the group consisting of MEHFPGP (SEQ ID NO:1), MGHFPGP (SEQ ID NO:3), MEHFXPGP (SEQ ID NO:4), MGHFXPGP (SEQ ID NO:5), MEHFPAP (SEQ ID NO:6), MEHFXPAP (SEQ ID NO:7), and MGHFXPAP (SEQ ID NO:8), wherein X represents any amino acid residue, wherein the peptide is N-terminal acetylated and/or C-terminal amidated.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0015]
[0016]
[0017] mice.
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
DETAILED DESCRIPTION
Definitions
[0036] It is to be noted that the term a or an entity refers to one or more of that entity; for example, an antibody, is understood to represent one or more antibodies. As such, the terms a (or an), one or more, and at least one can be used interchangeably herein.
[0037] As used herein, the term peptide or polypeptide is intended to encompass a singular polypeptide as well as plural polypeptides, and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds). The term polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product. Thus, peptides, dipeptides, tripeptides, oligopeptides, protein, amino acid chain, or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of polypeptide, and the term polypeptide may be used instead of, or interchangeably with any of these terms. The term polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide may be derived from a natural biological source or produced by recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis.
[0038] Homology or identity or similarity refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An unrelated or non-homologous sequence shares less than 40% identity, though preferably less than 25% identity, with one of the sequences of the present disclosure.
[0039] The term an equivalent nucleic acid or polynucleotide refers to a nucleic acid having a nucleotide sequence having a certain degree of homology, or sequence identity, with the nucleotide sequence of the nucleic acid or complement thereof. A homolog of a double stranded nucleic acid is intended to include nucleic acids having a nucleotide sequence which has a certain degree of homology with or with the complement thereof. In one aspect, homologs of nucleic acids are capable of hybridizing to the nucleic acid or complement thereof. Likewise, an equivalent polypeptide refers to a polypeptide having a certain degree of homology, or sequence identity, with the amino acid sequence of a reference polypeptide. In some aspects, the sequence identity is at least about 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%. In some aspects, the equivalent polypeptide or polynucleotide has one, two, three, four or five addition, deletion, substitution and their combinations thereof as compared to the reference polypeptide or polynucleotide. In some aspects, the equivalent sequence retains the activity (e.g., epitope-binding) or structure (e.g., salt-bridge) of the reference sequence.
[0040] As used herein, the terms treat or treatment refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of cancer. Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable. Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment. Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
[0041] By subject or individual or animal or patient or mammal, is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include humans, domestic animals, farm animals, and zoo, sport, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
[0042] As used herein, phrases such as to a patient in need of treatment or a subject in need of treatment includes subjects, such as mammalian subjects, that would benefit from administration of an antibody or composition of the present disclosure used, e.g., for detection, for a diagnostic procedure and/or for treatment.
Treatment for Lysosomal Storage Disorders (LSD)
[0043] It is discovered herein that the expression of BDNF (Brain Derived Neurotrophic Factor) was significantly reduced in two animal (mouse) models of Mucopolysaccharidosis BIC (MPS IIIC or Sanfilippo disease C). More specifically, it was observed that the levels of the mature BNDF were decreased. Likewise, BDNF levels also decreased in cultured human iPSC (induced pluripotent cells)-derived neurons of MPS IIIA and MPS IIIC patients
[0044] Treatment with AVP6 (N-terminally acetylated Semax, a nootropic peptide having the amino acid sequence of MEHFPGP (SEQ ID NO:1)) was able to restore the expression of BDNF in mouse brain and in MPS IIIC mouse and MPS IIIC and MPS IIIA human cultured neurons. Meanwhile, AVP6 also rescued reduced levels of Synapsin 1, PSD-95 and VGLUT1 levels in mouse brains and neuronal cultures. As shown in the examples, these synaptic markers (including Synapsin 1, Synaptophysin, PSD-59, VGLUT1, Gephyrin, VGAT) are deficient in the mouse models of MPS IIIC and cultured human iPSC (induced pluripotent cells)-derived neurons of MPS IIIA and MPS IIIC patients.
[0045] Treatment with AVP6 also increased the life-span of MPS BIC mice and reduced neuronal pathology, including astrogliosis, microgliosis, levels of inflammatory cytokines in the brain at 5 and 10-11 months of age as well as splenomegaly at 10-11 months of age.
[0046] Also important, at the behavioural level, AVP6 treatment reduced anxiety and fear deficit and hyperactivity, and improved working (short-term and spatial) memory. Such benefits of the AVP6, it is contemplated, are also applicable to other lysosomal storage disorders (LSD) which are associated with similar neuropathophysiological conditions. In addition, agents besides AVP6, more broadly referred to as nootropic agents, are believed to be effective as well.
[0047] In accordance with one embodiment of the present disclosure, therefore, provided is a method for treating a neuropathophysiological condition in a patient in need thereof, comprising administering to the patient an effective amount of an agent that increases synaptic transmission.
[0048] In another embodiment, the present disclosure provides a method for treating a neuropathophysiological condition in a patient in need thereof, comprising administering to the patient an effective amount of an agent that increases the biological activity of brain-derived neurotrophic factor (BDNF).
[0049] Examples of agents that can increase synaptic transmission or the biological activity (expression or activity) of BDNF include nootropic agents. Nootropic agents are agents that can improve cognitive function, particularly executive functions, memory, creativity, or motivation, in individuals.
[0050] An example group of nootropic agents are CNS stimulants, such as amphetamine, methylphenidate, eugeroics (armodafinil and modafinil), caffeine, and nicotine. Another example group include racetams, such as fasoracetam, nebracetam, nefiracetam, levetiracetam or other members of the racetam family of compounds including pharmaceutically acceptable salts and solvates thereof.
[0051] Yet another group of nootropic agents are cholinergics, such as citicoline, choline bitartrate, and alpha-GPC (L-Alpha glycerylphosphorylcholine). Other examples include tolcapone, levodopa, atomoxetine, desipramine, nicergoline and ISRIB (integrated stress response inhibitor, or trans-N,N-(Cyclohexane-1,4-diyl)bis(2-(4-chlorophenoxy)acetamide)).
[0052] Still, further examples include Acetyl L-Carnitine (ALCAR), Alpha-GPC, Alpha-Lipoic Acid (ALA), Aniracetam, Ashwagandha, Artichoke Extract (Luteolin), Bacopa Monnieri, Berberine, Black Seed Oil, Cacao, Caffeine, Cat's Claw, CBD Oil, Choline, Choline Bitartrate, Choline Citrate, Citicoline (see CDP-Choline), CDP-Choline, Centrophenoxine. Coconut & MCT Oil, Coluracetam, CoQ10 & Ubiquinol, Creatine, DHA (Omega 3). DHEA, DMAE, 5-HTP, Forskolin (Coleus root), GAB A, Ginkgo Biloba, Ginseng, Gotu Kola, Glycine, Holy Basil (Tulsi), Huperzine-A, Iodine, Kava Kava, Kratom, Lion's Mane, L-Carnosine, L-Dopa (Mucuna Pruriens), Lemon Balm, L-Glutamine, Lithium Orotate, L-Theanine, Maca, Magnesium, Medicinal Mushrooms, Methylene Blue, Melatonin, N-Acetyl L-Cysteine, N-Acetyl L-Tyrosine, NADH, Nefiracetam, Nicotine, Noopept, Oat Straw, Oxiracetam, Phenibut, Phenylpiracetam, Picamilon, Pine Bark Extract (Pycnogenol), Piperine, Piracetam, Rhodiola Rosea, Phenylalanine, Phenylethylamine (PEA), Phosphatidylcholine (PC), Phosphatidylserine (PS), PQQ, Pramiracetam, Pterostilbene, Quercetin, Resveratrol, Rosemary, Saffron, SAM-e, St John's wort, Sulbutiamine, Taurine, Tryptophan, Turmeric, Tyrosine, Uridine Monophosphate, Valerian, Vinpocetine, Vitamin B1 (Thiamine), Vitamin B3 (Niacin), Vitamin B5 (Pantothenic Acid), Vitamin B6 (Pyridoxine), Vitamin B8 (Inositol), Vitamin B9 (Folate), Vitamin B12 (Cobalamin), Vitamin D, and Zinc.
[0053] Yet other examples of nootropic peptides are AVP6 and its analogs. AVP6 is N-terminally acetylated Semax. Semax is a drug used for a broad range of conditions but predominantly for its purported nootropic, neuroprotective, and neurorestorative properties. In animals, Semax rapidly elevates the levels and expression of brain-derived neurotrophic factor (BDNF) and its signaling receptor TrkB in the hippocampus, and rapidly activates serotonergic and dopaminergic brain systems.
[0054] Semax is a synthetic analogue of adrenocorticotropic hormone 4-10 hexapeptide (ACTH.sub.(4-10)), consisting of an ACTH fragment, ACTH.sub.(4-7) and the C-terminal tripeptide Pro-Gly-Pro, (ACTH.sub.(4-7)PGP; MEHFPGP (SEQ ID NO: 1)). ACTH (NP_000930.1) includes three ACTH domains (underlined in Table 1 below).
TABLE-US-00001 TABLE1 HumanACTHSequence(SEQIDNO:2) 1MPRSCCSRSGALLLALLLQASMEVRGWCLE SSQCQDLITESNLLECIRACKPDLSAETPM 61FPGNGDEQPLTENPRKYVMGHERWDRFGRR NSSSSGSSGAGQKREDVSAGEDCGPLPEGG 121PEPRSDGAKPGPREGKRSYSMEHFRWGKPV GKKRRPVKVYPNGAEDESAEAFPLEFKREL 181TGQRLREGDGPDGPADDGAGAQADLEHSLL VAAEKKDEGPYRMEHFRWGSPPKDKRYGGE 241MTSEKSQTPLVTLFKNAIIKNAYKKGE
[0055] The core residues within these ACTH domains are MGHF (residues 79-82 of SEQ ID NO:2) and MEHF (residues 141-144 or 223-226 of SEQ ID NO:2). Semax is a fusion between one of these strings (MEHF, residues 141-144 or 223-226 of SEQ ID NO:2) with PGP. An example analog of Semax can use the other core sequence (MGHF, residues 79-82 of SEQ ID NO:2) as well. In some embodiment, one, two or three amino acid residues may be inserted before PGP. In some embodiments, the PGP tripeptide may be replaced by PAP where A is analogous to G.
[0056] Accordingly, Semax has the following example analogs. In some embodiments, the Semax or the analog is N-terminally acetylated which is herein shown to increase the stability of the peptide. In some embodiments, the Semax or the analog is C-terminally amydated which is herein shown to increase the stability of the peptide.
TABLE-US-00002 TABLE2 SemaxAnalogs Analogs SEQIDNO: MGHFPGP 3 MEHFXPGP 4 MGHFXPGP 5 MEHFPAP 6 MEHFXPAP 7 MGHFXPAP 8 X: any amino acid residue
[0057] Additional analogs can also be created and tested. In one embodiment, the analog includes one, two or three addition, deletion, substitution or the combinations thereof from SEQ ID NO:1.
[0058] A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a nonessential amino acid residue in an immunoglobulin polypeptide is preferably replaced with another amino acid residue from the same side chain family. In another embodiment, a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
[0059] Non-limiting examples of conservative amino acid substitutions are provided in the table below, where a similarity score of 0 or higher indicates conservative substitution between the two amino acids.
TABLE-US-00003 TABLE 3 Amino Acid Similarity Matrix C G P S A T D E N Q H K R V M I L F Y W W 8 7 6 2 6 5 7 7 4 5 3 3 2 6 4 5 2 0 0 17 Y 0 5 5 3 3 3 4 4 2 4 0 4 5 2 2 1 1 7 10 F 4 5 5 3 4 3 6 5 4 5 2 5 4 1 0 1 2 9 L 6 4 3 3 2 2 4 3 3 2 2 3 3 2 4 2 6 I 2 3 2 1 1 0 2 2 2 2 2 2 2 4 2 5 M 5 3 2 2 1 1 3 2 0 1 2 0 0 2 6 V 2 1 1 1 0 0 2 2 2 2 2 2 2 4 R 4 3 0 0 2 1 1 1 0 1 2 3 6 K 5 2 1 0 1 0 0 0 1 1 0 5 H 3 2 0 1 1 1 1 1 2 3 6 Q 5 1 0 1 0 1 2 2 1 4 N 4 0 1 1 0 0 2 1 2 E 5 0 1 0 0 0 3 4 D 5 1 1 0 0 0 4 T 2 0 0 1 1 3 A 2 1 1 1 2 S 0 1 1 1 P 3 1 6 G 3 5 C 12
TABLE-US-00004 TABLE 4 Conservative Amino Acid Substitutions For Amino Acid Substitution With Alanine D-Ala, Gly, Aib, -Ala, L-Cys, D-Cys Arginine D-Arg, Lys, D-Lys, Orn D-Orn Asparagine D-Asn, Asp, D-Asp, Glu, D-Glu Gln, D-Gln Aspartic Acid D-Asp, D-Asn, Asn, Glu, D-Glu, Gln, D-Gln Cysteine D-Cys, S-Me-Cys, Met, D-Met, Thr, D-Thr, L-Ser, D-Ser Glutamine D-Gln, Asn, D-Asn, Glu, D-Glu, Asp, D-Asp Glutamic Acid D-Glu, D-Asp, Asp, Asn, D-Asn, Gln, D-Gln Glycine Ala, D-Ala, Pro, D-Pro, Aib, -Ala Isoleucine D-Ile, Val, D-Val, Leu, D-Leu, Met, D-Met Leucine Val, D-Val, Met, D-Met, D-Ile, D-Leu, Ile Lysine D-Lys, Arg, D-Arg, Orn, D-Orn Methionine D-Met, S-Me-Cys, Ile, D-Ile, Leu, D-Leu, Val, D-Val Phenylalanine D-Phe, Tyr, D-Tyr, His, D-His, Trp, D-Trp Proline D-Pro Serine D-Ser, Thr, D-Thr, allo-Thr, L-Cys, D-Cys Threonine D-Thr, Ser, D-Ser, allo-Thr, Met, D-Met, Val, D-Val Tyrosine D-Tyr, Phe, D-Phe, His, D-His, Trp, D-Trp Valine D-Val, Leu, D-Leu, Ile, D-Ile, Met, D-Met
[0060] In some embodiments, the peptide has a length that is not longer than 50, 40, 30, 20, 15, 10, 9, 8, or 7 amino acid residues.
[0061] The agents here are able to increase the expression and/or activity of BDNF in patients where the BDNF activity/expression is reduced. In some embodiments, the patient has a lysosomal storage disease (LSD).
[0062] Lysosomal storage diseases (LSDs) are a group of about 50 rare inherited metabolic disorders that result from defects in lysosomal function. Lysosomes cytoplasmic organdies containing hydrolytic enzymes that digest large molecules and pass the fragments onto other parts of the cell for recycling. This process requires several critical enzymes. Most of these disorders are autosomal recessively inherited such as Niemann-Pick disease, type C, but a few are X-linked recessively inherited, such as Fabry disease and Hunter syndrome (MPS II).
[0063] The LSDs are generally classified by the nature of the primary stored material involved, and can be broadly broken into the following, (A) Lipid storage disorders, including sphingolipidoses, including Gaucher's and Niemann-Pick diseases, gangliosidosis (including Tay-Sachs disease, and leukodystrophies; (B) Mucopolysaccharidoses, including Hunter syndrome and Hurler and Sanfilippo diseases; (C) Glycoprotein storage disorders; and (D) Mucolipidoses.
[0064] More specifically, example LSDs include sphingolipidoses, ceramidase, galactosialidosis, gangliosidoses, glucocerebroside, sphingomyelinase, sulfatidosis, mucopolysaccharidoses, mucolipidosis, lipidoses, oligosaccharide, lysosomal transport diseases, glycogen storage diseases, and cholesteryl ester storage disease.
[0065] In some embodiments, the LSD is mucopolysaccharidoses. Mucopolysaccharidoses (MPS) are caused by the absence or malfunctioning of lysosomal enzymes needed to break down glycosaminoglycans (GAGs). These long chains of sugar carbohydrates occur within the cells that help build bone, cartilage, tendons, corneas, skin and connective tissue. Seven distinct clinical types and numerous subtypes of the MPS have been identified. Examples include MPS I. MPS II, MPS III, MPS IV, MPS VT, MPS VII, and MPS TX.
[0066] MPS III, also known as Sanfilippo syndrome, is marked by severe neurological symptoms. These include progressive dementia, aggressive behavior, hyperactivity, seizures, some deafness and loss of vision, and an inability to sleep for more than a few hours at a time. This disorder tends to have three main stages. During the first stage, early mental and motor skill development may be somewhat delayed. Affected children show a marked decline in learning between ages 2 and 6, followed by eventual loss of language skills and loss of some or all hearing. Some children may never learn to speak. In the syndrome's second stage, aggressive behavior, hyperactivity, profound dementia, and irregular sleep may make children difficult to manage, particularly those who retain normal physical strength. In the syndrome's last stage, children become increasingly unsteady on their feet and most are unable to walk by age 10.
[0067] Thickened skin and mild changes in facial features, bone, and skeletal structures become noticeable with age. Growth in height usually stops by age 10. Other problems may include narrowing of the airway passage in the throat and enlargement of the tonsils and adenoids, making it difficult to eat or swallow. Recurring respiratory infections are common.
[0068] There are four distinct types of Sanfilippo syndrome, each caused by alteration of a different enzyme needed to completely break down the heparan sulfate sugar chain. Sanfilippo A is the most severe of the MPS III disorders and is caused by the missing or altered enzyme heparan N-sulfatase. Sanfilippo B is caused by the missing or deficient enzyme alpha-N-acetylglucosaminidase. Sanfilippo C results from the missing or altered enzyme acetyl-CoAlpha-glucosaminide acetyltransferase. Sanfilippo D is caused by the missing or deficient enzyme N-acetylglucosamine 6-sulfatase.
[0069] In some embodiments, the patient being treated has a neuropathophysiological condition such as dementia, aggressive behavior, hyperactivity, seizure, deafness or loss of vision.
[0070] In some embodiments, the patient may be identified as having decreased synaptic transmission or decreased levels of synaptic protein markers VGLUT1 (vesicular glutamate transporter 1), PSD-95 (postsynaptic density protein 95), VGAT (vesicular GABA transporter), SYN1 (Synapsin I), or Gephyrin. In some embodiments, the patient may be identified as having increased microgliosis, astrogliosis and ncuroinflammation. In some embodiments, the patient may be identified as having decreased activity or level of BDNF as compared to a reference healthy subject. In some embodiments, the treatment may be monitored by checking the activity level of BDNF in the patient, wherein increased BDNF indicates improvement of the disease.
[0071] In particular embodiments, the present disclosure provides a method for treating a mucopolysaccharidosis (MPS) III in a patient in need thereof, comprising intranasal administration to the patient an effective amount of a peptide that comprises the amino acid sequence of MEHFPGP (SEQ ID NO:1), or an analog thereof. Example analogs include MGHFPGP (SEQ ID NO:3), MEHFXPGP (SEQ ID NO:4). MGHFXPGP (SEQ ID NO:5), MEHFPAP (SEQ ID NO:6), MEHFXPAP (SEQ ID NO:7), and MGHFXPAP (SEQ ID NO:8), wherein X represents any amino acid residue. In some embodiments, the patient suffers from MPS IIIC.
[0072] In some embodiments, modified nootropic peptides are provided. For any of the peptides disclosed herein, it can be N-terminal acetylated and/or C-terminal amidated. Examples include N-terminal acetylated and/or C-terminal amidated MEHFPGP (SEQ ID NO:1), MGHFPGP (SEQ ID NO:3), MEHFXPGP (SEQ ID NO:4), MGHFXPGP (SEQ ID NO:5), MEHFPAP (SEQ ID NO:6), MEHFXPAP (SEQ ID NO:7), or MGHFXPAP (SEQ ID NO:8), wherein X represents any amino acid residue.
Formulations
[0073] The present disclosure also provides pharmaceutical compositions suitable for intranasal administration. Upon intranasal administration, the agent may be retained in the submucous space of the nose, cross the arachnoid membrane, and enter into the central nervous system via the olfactory pathways. In some embodiments, a transport moiety complex is included to facilitate transport of the agent to the CNS, thereby improving response time and minimizing exposure of peripheral tissues to the active agents.
[0074] To increase the contact time and targeting to the olfactory nerves, formulation of a pharmaceutically active agent-transport moiety with a biocompatible adhesive or a delivery device can be prepared. The formulation may be in the form of a cream, liquid, spray, powder, or suppository which can be administered intranasally using a suitable applicator. Processes for preparing pharmaceuticals in these vehicles can be found throughout the literature. The formulation can be applied using any convenient method or device such as a spray device, metered dose applicator for cream, suppository suitable for intranasal insertion, and the like.
[0075] The formulation can also include a bioadhesive agent, for example, a mucoadhesive agent. The mucoadhesive agent permits a close and extended contact of the composition, or the drug released from said composition, with mucosal surface by promoting adherence of said composition or drug to the mucosa. The mucoadhesive agent is preferably a polymeric compound, such as preferably, a cellulose derivative but it may be also a natural gum, alginate, pectin, or such similar polymer. A preferred cellulose derivative is hydroxypropyl methylcellulose, commercially available from Dow Chemical Co. The mucoadhesive agent can be present in from about 5 to about 25%, by weight, preferably in from about 10 to about 15% and most preferably about 10%.
[0076] Bioadhesive microparticles or nanoparticles can constitute still another component of the intranasal formulations suitable for use in the present disclosure. The bioadhesive particles include derivatives of cellulose such as hydroxypropyl cellulose and polyacrylic acid and can provide sustained release of the pharmaceutically active agents for an extended period of time (possibly days) once they are placed in the appropriate formulation. A formulation comprising bioadhesive particles can provide a multi-phase liquid or semi-solid preparation which does not seep from the nose. The microparticles or nanoparticles cling to the nasal epithelium and can release the drug over extended period of time, for example, for several hours or more.
[0077] The biocompatible adhesives can include viscosity enhancers such as methylcellulose, sodium carboxymethylcellulose, chitosan, carbopol 934P and Pluronic 127. Thermogelling agents such as ethyl(hydroxyethyl) cellulose and Pluronic 127 can also be used to advantage. Thermogelling agents are liquid at room temperature and below, but at physiological temperatures (e.g., 32-37 C.), the viscosity of the solution increases such that the solution becomes a gel.
[0078] Pharmaceutical compositions may be formulated in combination with any suitable pharmaceutical vehicle, excipient or carrier that would commonly be used in this art, such as saline, dextrose, water, glycerol, ethanol, other therapeutic compounds, and combinations thereof. As one skilled in this art would recognize, the particular vehicle, excipient or carrier used will vary depending on the patient and the patient's condition, and a variety of modes of administration would be suitable for the compositions of the invention, as would be recognized by one of ordinary skill in this art.
[0079] Suitable nontoxic pharmaceutically acceptable excipients for use in the compositions of the present invention will be apparent to those skilled in the art of pharmaceutical formulations and examples are described in REMINGTON: The Science and Practice of Pharmacy, 20th Edition, A. R. Gennaro, ed., (2000).
[0080] In a specific embodiment, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. Further, a pharmaceutically acceptable carrier will generally be a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type.
[0081] The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents such as acetates, citrates or phosphates. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; and agents for the adjustment of tonicity such as sodium chloride or dextrose are also envisioned. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in Remington's Pharmaceutical Sciences by E. W. Martin, incorporated herein by reference. Such compositions will contain a therapeutically effective amount of the antigen-binding polypeptide, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration. The parental preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
[0082] In an embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0083] The compounds of the disclosure can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
EXAMPLES
Example 1. Preliminary Study in Mouse MPSIIIC Models
[0084] This example developed and studied a mouse model of Mucopolysaccharidosis IIIC (MPSIIIC or Sanfilippo disease C) specifically a knockout strain Hgsnat-Geo and a knock-in strain Hgsnat.sup.P304L (Hgsnat.sup.P311L) expressing mouse HGSNAT enzyme with an analog of human missense mutation Pro311Leu. The result demonstrated that the pathophysiological mechanism of the disease involves both neurodegeneration and functional pathological changes in the CNS affecting synaptogenesis, synaptic transmission, neuroinflammation, learning and memory deficits. Mice also have some pathologies of peripheral tissues including splenomegaly. It also demonstrated that these pathologies were reversed by treating MPSIIIC mice with a peptide AVP6 (an acetylated Semax, a nootropic peptide having the amino acid sequence of MEHFPGP (SEQ ID NO:1); the N-terminal M is acetylated which is shown to increase the activity and stability of the peptide in preliminary studies).
[0085] Restoration of synaptic deficits: MPSIIIC mice in comparison with wild-type (WT) control mice demonstrate deficits in synaptic transmission in the CA1 neurons of the hippocampus, a brain region implicated in the formation and storage of memory. As shown in
[0086] Restoration of deficits in neurotrophic molecules: Neurotrophic molecules such as BDNF (Brain Derived Neurotrophic Factor) are important for neuronal development and neuroplasticity mechanisms of memory. In MPSIIC mice, it was observed that the levels of the pro form of BDNF (proBDNF) were increased while the levels of the mature BNDF were decreased. In contrast, upon acute (24 h) or chronic short-term (10 days) intranasal administration of AVP6, mature BDNF levels in MPSIIIC mice were found to be significantly increased (
[0087] Restoration of neurobehavioral deficits: MPSIIIC patients suffer from progressive cognitive decline and other neurobehavioural deficits eventually leading to dementia. Similarly, the MPSIIIC mice exhibited a significantly reduced discrimination index in the Novel Object Recognition task, a behavioral test that evaluates working memory in rodent models of neurological disorders. The task relies on the natural inclination of rodents to explore a novel object than a familiar one. Therefore, failure to discriminate the old object from the new one reflects a reduced learning or recognition memory. Importantly, intranasal administration of AVP6 for 10 days significantly recovered memory deficits in these animals (
Example 2. Preclinical Studies
[0088] This example shows the results of preclinical studies of evaluating the neurorestorative properties of AVP6 in mouse models of MPS IIIC Hgsnat-Geo and Hgsnat.sup.P304L, which closely mimic the pathological course of the disease in humans.
[0089] I. Effect of AVP6 on Synaptic Neurotransmission
A. Miniature Synaptic Events
[0090] Models and developmental time points: Hippocampal slices from Hgsnat-Geo and Hgsnat.sup.P304L mice; P14-20 and P45-60.
[0091] Method: Whole cell voltage clamp electrophysiology recordings (miniature synaptic currents) were conducted on CA1 pyramidal neurons in acute hippocampal slices.
[0092] Results: [0093] i. At P14-20, miniature excitatory post synaptic current (mEPSC) frequency and amplitude was reduced in Hgsnat.sup.Geo mice compared to WT animals. Hgsnat.sup.P311L mice also displayed reduced mEPSC amplitude and frequency as compared to WT controls (
[0099] This example demonstrates that excitatory (glutamatergic) synaptic neurotransmission and inhibitory neurotransmission was impaired in Hgsnat.sup.Geo and Hgsnat.sup.P311L mice at both P14-20 and P45-60. AVP6 rescued deficits in glutamatergic neurotransmission at both ages in both the animal models.
B. Evoked Synaptic Events
[0100] Model and Developmental time points: Hippocampal slices from Hgsnat.sup.Geo and Hgsnat.sup.P311L mice; P14-20.
[0101] Method: Synaptic currents (composite glutamatergic EPSCs, AMPA EPSCs and NMDA EPSCs) were evoked by stimulating Schaffer collaterals and recordings were conducted from the hippocampus CA1 pyramidal cells in hippocampal slices from Hgsnat.sup.Geo and Hgsnat.sup.P311L mice. Paired pulse stimulation protocol with increasing stimulus intervals was used to identify the locus of deficit.
[0102] Results: [0103] i. At P14-20, evoked AMPA and NMDA currents were found to elicit significantly reduced amplitudes in both Hgsnat.sup.Geo and Hgsnat.sup.P311L mice as compared to WT animals upon the same intensity of stimulation (
[0109] This example shows that both AMPA and NMDA currents were reduced in Hgsnat.sup.P311L and Hgsnat.sup.Geo mice but AMPA deficits were predominant. Changes in paired pulse ratio suggest that the deficits have presynaptic origin.
[0110] AVP6 at 10 M rescued AMPA current deficits but not NMDA current deficits in Hgsnat.sup.P311L mice. AVP6 at 10 M rescued presynaptic deficits at lower IPI but not at higher IPI. Increased 50 M doses of AVP6 rescued presynaptic deficits at longer IPI range but exerted some cytotoxicity.
[0111] Together, these data show that AVP6 rescues excitatory synaptic transmission by acting at presynaptic AMPA receptors.
[0112] 2. Effect of AVP on Synaptic Morphology and Synaptic Proteins In Vitro:
[0113] Model and Developmental time points: Primary hippocampal neuronal cultures established from E16 embryos of Hgsnat.sup.P311L mice.
[0114] Method: The hippocampal neurons were cultured until DIV (Day In Vitro) 21 and 50% of media was changed every 3 days. AVP6 at a final concentration of 10 M was added to the media when plating and during every media change. At DIV21 neurons were fixed and analysed by immunohistochemistry using markers of dendrites (MAP), axons (neurofilament protein, NF-H), and synaptic transmission (PSD95 and BDNF). Synaptic spine architecture and additional protein synaptic markers (Vglut/PSD95 and VAMP) will be studied.
[0115] Results: [0116] i. In Hgsnat.sup.P311L neuronal cultures, the number of BDNF-positive punctae was reduced as compared to WT neurons (
[0120] This example shows that primary neuronal cultures from Hgsna.sup.P311L mice showed drastic reduction of BDNF, a neurotrophic factor expressed in hippocampus, cortex and other areas implicated in learning and memory and implicated in neuronal survival, growth and differentiation, as well as in formation of new synapses during memory processes. Treatment with 10 M AVP6 rescued the BDNF deficit.
[0121] Synapsin 1, a neuronal phosphoprotein that coats synaptic vesicles and is known to modulate neurotransmitter release, was reduced in cultured Hgsnat.sup.P311L neurons. AVP6 treatment rescued Synapsin 1 deficit as well, consistent with reported above AVP-mediated induction of miniature and evoked excitatory currents at the presynaptic side.
[0122] 3. Behavioural Effects of Acute and Short-Term AVP6 Administration In Vivo.
Acute Behavioural Studies
[0123] Hyperactivity and reduced anxiety. Model and Developmental time points: Hgsnat.sup.P311L mice; 4-month and 6-month-old.
[0124] Method: Open field test that explores behaviour of animals in open area. Rodents normally avoid the center of the arena (anxiety reflex) and spend certain time immobile (freezing reflex). AVP6 solution in saline was administered intranasally at 50 g/kg (5 l/nostril) to the animals 17 h before the experiment.
[0125] Results: [0126] i. Hgsnat.sup.P311L mice at 4 months and 6 months show significantly increased hyperactivity (increase in total distance traveled) and reduced anxiety (increased time spent in the center of the arena and increased distance traveled in the center of the arena) as compared to WT animals (
[0129] This example shows that single intranasal administration of AVP6 in a dose of 50 g/kg 17 h before the experiment rescued hyperactivity and reduced anxiety in Hgsnat.sup.P311L mice at the age of 4 months and 6 months.
Reduced Fear
[0130] Model and Developmental time points: Hgsnat.sup.Geo (4 months, 6 months and 8 months), Hgsnat.sup.P311L mice (4 months and 6 months).
[0131] Method: Elevated plus maze that measures a natural fear of heights reflex of animals. AVP6 was administered intranasally at 50 g/kg (5 l/nostril) to the animals 17 h before the experiment.
[0132] Results: [0133] i. Hgsnat.sup.P311L mice at 4 months show significantly reduced fear (increase in the time spent in open arms and increase in the number of open arm entries) as compared to WT animals (
[0136] The phenotype of reduced fear in Hgsnat.sup.Geo mice was present at 6 months. In Hgsnat.sup.P311L mice it was present at 4 months and is lost at 6 months, suggesting a more rapidly progressing and severe phenotype for this model as compared to Hgsnat.sup.Geo mice.
[0137] Single intranasal administration of AVP6 in a dose of 50 g/kg rescued reduced fear at 4 months in Hgsnat.sup.P311L mice.
[0138] 4. Behavioural Effects of Short-Term AVP6 Administration In Vivo.
Working Memory
[0139] Model and Developmental time points: Hgsnat.sup.Geo mice; 4-month-old.
[0140] Method: Novel object recognition test that studies working memory of mice by measuring their ability to discriminate a familiar from a novel object. AVP6 was administered intranasally at a daily dose 50 g/kg (5 l/nostril) for 10 consecutive days before the experimental day.
[0141] Results: [0142] i. Hgsnat.sup.Geo mice at 4 months show significantly reduced discrimination and recognition indexes as compared to WT animals (
[0144] This example shows that short term treatment regimen with AVP6 (10 days at 50 g/kg) rescued working memory deficit in Hgsnat.sup.Geo mice at 4 months.
[0145] 5. Effect of AVP6 on BDNF Regulation In Vivo:
Model and Developmental Time Points: Hgsnat.SUP.Geo .(4 Months)
[0146] Method: AVP6 was administered intranasally at 50 g/kg (5 l/nostril) for 10 consecutive days. After sacrifice, changes in the levels of BDNF, a protein involved in long-term synaptic potentiation and memory consolidation, in the dissected hippocampi of mice were analyzed by Western blots.
[0147] Results: Hgsnat.sup.Geo mice at 4 months show reduced levels of mature BDNF in hippocampus as compared to WT animals. 10-day intranasal treatment with AVP6 at a daily dose of 50 s/kg increases BDNF levels (
[0148] AVP6 at 50 g/kg partially restored reduced BDNF levels in Hgsnat.sup.Geo mice at 4 months consistent with the ability of the drug to rescue deficit in a working memory. This example also shows that BDNF can be used as one of predictive biomarkers for AVP6 efficacy studies.
[0149] 6. Generation and Characterization of iPSCs from Skin Fibroblasts of MPS MC Patients (3 Lines) and Healthy Controls (2 Lines):
[0150] This example attempted to carry out immunohistochemical characterization for pluripotency markers (TRA1-60. SOX2), HGSNAT activity and mutations, karyotyping, and immunohistochemical characterization of iPSC in vitro differentiation to the three germ layers (ectoderm, mesoderm, endoderm).
[0151] Immunohistochemical analysis confirmed all cell lines are positive for pluripotency markers TRA1-60 and SOX2 (
[0152] Specific HGSNAT activity in iPSC derived from skin fibroblasts of three MPSIIIC patients was significantly reduced as compared with healthy control (
[0153] The following deleterious variants in the HGSNAT gene have been identified in the MPSIIIC patients: [0154] i. MPS IIIC 1A: compound heterozygous for c.234+5G>A (exon 2-intron 2 boundary) and c.1411G>A; p.E471K [0155] ii. MPSIIIC 1B: compound heterozygous for c.118+1G>A (g.43140615 G>A) (intron 1) and c.1622C>T (g. 43197848 C>T); p.S541L in exon 17 [0156] iii. MPS IIIC 1C: homozygous for c234+1G>A present in cis with benign c.710C>A/g. 43170661 C>A variant in Exon 7 resulting in p.P237Q change.
[0157] Immunohistochemical Characterization of iPSC Differentiation In Vitro to the Three Germ Layers (Ectoderm, Mesoderm, Endoderm).
[0158] In-vitro differentiation of iPSCs into ectoderm cells positive for Nestin and Pax6 protein markers is shown in
[0159] In conclusion, at the synaptic level, the above data show that bath application of AVP6 rescues deficits in glutamatergic neurotransmission in acute hippocampal slices of both Hgsnat.sup.Geo and Hgsnat.sup.P311L mice. AVP6 acts on excitatory neurotransmission processes and does not ameliorate deficits in inhibitory neurotransmission processes. AVP6 preferentially rescues deficits in AMPA currents, likely through presynaptic mechanisms by increasing synaptic vesicle release from the readily releasable pool. AVP6 rescues reduced levels of BDNF in hippocampal neuronal cultures from Hgsnat.sup.P311L mice. AVP6 also rescues reduced levels of Synapsin 1 in neuronal cultures from Hgsnat.sup.P311L mice, consistent with the hypothesis that the drug restores levels of proteins involved in neurotransmitter release.
[0160] At the behavioural level, single acute 50 g/kg dose of AVP6 (but not lower or higher doses of 10 g/kg or 500 g/kg) rescues anxiety and fear deficit and hyperactivity at both 4 and 6 months in Hgsnat.sup.P311L mice. 10-day treatment with AVP6 at 50 g/kg rescues impairment of working memory in Hgsnat.sup.Geo mice.
[0161] At the molecular level, ten-day treatment with AVP6 at 50 g/kg increases levels of BDNF in Hgsnat.sup.Geo mice. BDNF can be used as a predictive biomarker in AVP6 efficacy studies.
[0162] Further, iPSCs have been successfully engineered from skin fibroblasts of 3 MPSIIIC patients and one healthy control. Pluripotency of iPSCs have been confirmed by their ability to differentiate in vitro into three major germ layers. HGSNAT enzyme activity levels in the MPSIIIC iPSC lines are significantly reduced as compared with the control line.
Example 3. AVP6 Delays Neurological Manifestations in MPS III by Rescuing Glutamatergic Neurotransmission Defects, Increasing Synaptogenesis, Reducing Neuroinflammation and Preventing Neuronal Death
[0163] The instant inventors developed a MPS IIIC murine model, Hgsnat.sup.Geo (a functional knockout of the Hgsnat locus in C57Bl/6N mice), which characterized the pathophysiology of the disease of MPS III in human patients. The results show that accumulation of HS in microglia in MPS IIIC brain triggers a cascade of downstream pathogenic reactions in neurons leading, eventually, to their death.
[0164] The previous examples characterized a new and more severe knock-in mouse model of MPS IIIC matching more aggressive early-onset clinical phenotype of MPS IIIC patients. These mice (Hgsnat.sup.P304L) are homozygous for an analog of pathogenic human mutation Pro311Leu. Compared to the Hgsnat.sup.Geo mice, Hgsnat.sup.P304L mice of similar age have increased HS levels, lysosomal storage and neuroinflammation. Hgsnat.sup.P304L mice also have an earlier onset of memory impairment and hyperactivity, and their survival is reduced by about 20-weeks.
[0165] The data demonstrate drastically reduced synaptic activity in the pyramidal CA1 hippocampal neurons in both Hgsnat.sup.Geo and Hgsnat.sup.P304L mouse models of MPS IIIC. The defects are observed for both excitatory (mEPSCs) and inhibitory (mIPSCs) miniature synaptic currents already at P (postnatal day) 45-60, 2-3 months before the development of other neuronal pathologies. These data are supported by the marked reduction in the VGLUT1/PSD-95 puncta in hippocampal neurons of MPS IIIC mice, together, suggesting overall synaptic deficits that aggravate with age. Moreover, density of dendritic synaptic spines (which typically receive input from excitatory synapses) of pyramidal CA1 hippocampal neurons is reduced already at P10 and never reaches levels observed in WT mice. Drastically reduced levels of synaptic vesicles in the terminals and smaller areas of postsynaptic densities were also found in pyramidal CA1 hippocampal neurons at 3 and 6 months. These changes affect mainly excitatory circuits.
[0166] PSD-95 (the protein which is highly enriched at excitatory postsynaptic sites) is the most severely reduced biomarker, not only in the mouse model but also in all studied post-mortem cortical tissues of neurological MPS patients. Other reduced biomarkers are synaptic vesicle protein Syn1, VGLUT1, and BDNF, a neurotrophic factor expressed in hippocampus, cortex and other areas implicated in learning and memory. BDNF promotes neuronal survival, growth and differentiation, as well as formation of new synapses during memory processes. Together, these experiments demonstrate that lysosomal storage in CA1 hippocampal pyramidal neurons of MPS IIIC mice results in appearance of early and drastic synaptic defects.
[0167] This example demonstrates that in brain slices from MPS IIIC mouse models AVP6 reduced amplitude and frequency of miniature excitatory postsynaptic currents and evoked excitatory postsynaptic currents in pyramidal CA1 neurons. AVP6 also reversed the decrease in synaptic protein levels in cultured MPS IIIC mouse hippocampal neurons and in iPSC-derived cortical neurons of human MPS III A and MPS IIIC patients. Furthermore, daily intranasal administration of this peptide reduced hyperactivity and rescued defects in working and spatial memory in MPS IIIC mice at 4 months and 6-7 months and delays progression of brain pathology.
Materials and Methods
Murine Models
[0168] Approval for animal experimentation was granted by the Animal Care and Use Committee of the Ste-Justine Hospital Research Center. Mice were housed in an enriched environment with continuous access to food and water, under constant temperature and humidity, on a 12 h light/dark cycle. Mice were kept on a normal chow diet (5% fat, 57% carbohydrate). Hgsnat.sup.P304L knock-in C57Bl/6J mouse strain generated at McGill Integrated Core for Animal Modeling (MICAM) used CRISPR/Cas9 technology, targeting exon 9 of the Mus musculus heparan sulfate acetyl-CoA: alpha-glucosaminide N-acetyltransferase (Hgsnat) gene.
Enzyme Activity Assays
[0169] The specific enzymatic activities of HGSNAT, -hexosaminidase, and -galactosidase were assayed essentially as follows. Tissues extracted from mice or pellets of cultured cells were snap-frozen in liquid nitrogen before storage at 80 C. Fifty mg samples were homogenized in 250 l of H.sub.2O using a sonic homogenizer (Artek Systems Corporation). For HGSNAT assays, 5 l aliquots of the homogenates were combined with 5 l of McIlvain Buffer (pH 5.5), 5 l of 3 mM 4-methylumbelliferyl--D-glucosaminide (Moscerdam), 5 l of 5 mM acetyl-coenzyme A and 5 l of H.sub.2O. The reaction was incubated for 3 h at 37 C. stopped with 975 l of 0.4 M glycine buffer (pH 10.4), and fluorescence was measured using a ClarioStar plate reader (BMG Labtech). Blank samples were incubated without the homogenates which were added after the glycine buffer.
[0170] The activity of -hexosaminidase was measured by combining 2.5 l of 10 diluted homogenate (2.5 ng of protein) with 15 l of 0.1 M sodium acetate buffer (pH 4.2), and 12.5 l of 3 mM 4-methylumbelliferyl N-acetyl--D-glucosaminide (Sigma-Aldrich) followed by incubation for 30 min at 37 C. The reaction was stopped 0.4 M glycine buffer (pH 10.4) and fluorescence was measured as above.
[0171] The activity of acidic -galactosidase was measured by adding 12.5 l of 0.4 M sodium acetate, 0.2 M NaCl (pH 4.2) and 12.5 l of 1.5 mM 4-methylumbelliferyl -D-galactoside (Sigma-Aldrich) to 10 l of 10 diluted homogenate (1 ng of protein). After 15-min incubation at 37 C., the reaction was stopped with 0.4 M glycine buffer (pH 10.4) and fluorescence was measured as above.
Behavioral Analysis
[0172] The spontaneous alternation behavior, spatial working memory and exploratory activity of mice were evaluated using a white Y-maze as follows. The maze consisted of three identical white Plexiglas arms (401020 cm, 120 apart) under dim lighting conditions. Each mouse was placed at the end of one arm, facing the center, and allowed to explore the maze for 8 min. All experiments were performed at the same time of the day and by the same investigator to avoid circadian and handling bias. Sessions were video-recorded and arm entries were scored by a trained observer, unaware of the mouse genotype or treatment. Successful alternation was defined as consecutive entries into a new arm before returning to the two previously visited arms.
[0173] Alternation was calculated as: [number of alternations/total number of arm entries2]100.
[0174] Novel object recognition test was used for assessing short-term recognition memory. Mice were placed individually in a 443320 cm (lengthwidthheight) testing chamber with white Plexiglas walls for 10 min habituation period and returned to their home cage. The next day, mice were placed in the testing chamber for 10 min with two identical objects (red plastic towers, 31.54.5 cm), returned to the home cages, and 1 hour later, placed back into the testing chamber in the presence of one of the original objects and one novel object (a blue plastic base, 4.54.52 cm) for 10 min. After each mouse, the test arena as well as the plastic objects were cleaned with 70% ethanol to avoid olfactory cue bias. The discrimination index (DI) was calculated as the difference of the exploration time between the novel and old object divided by total exploration time. A preference for the novel object was defined as a DI significantly higher than 0. Mice who showed a side preference, noted as a DI of 0.20 during familiarization period, and those who had a total exploration times lower than 3 seconds were excluded from analysis.
[0175] The open-field test was performed as previously described. Briefly, mice were habituated in the experimental room for 45 mins before the commencement of the test. Each mouse was then gently placed in the center of the open-field arena and allowed to explore for 20 min. The mouse was removed and transferred to its home cage after the test, and the arena was cleaned with 70% ethanol before the commencement of the next test. Analysis of the behavioral activity was done using the Smart video tracking software (v3.0, Panlab Harvard Apparatus), and total distance traveled and percent of time spent in the center zone were measured for hyperactivity and anxiety assessment, respectively.
[0176] The elevated plus-maze test was performed as follows. Each mouse was placed in the center of the elevated plus maze and allowed to freely explore undisturbed for 10 min. After each testing, the mouse was returned to the home cage and the arena was cleaned with 70% ethanol before the commencement of the next test. Analysis of the behavioral activity (percentage of time spent in the center zone, closed arms, and open arms; as well as the number of open arm entries) was done by the Smart v3.0 software.
Transmission Electron Microscopy
[0177] At 3 and 6 months, three mice from each group were anesthetized with sodium pentobarbital (50 mg/kg BW) and perfused with PBS, followed by 2.5% glutaraldehyde in 0.2 M phosphate buffer (pH 7.2). The brains were extracted and post-fixed in the same fixative for 24 h at 4 C. The hippocampi were dissected, mounted on glass slides, stained with toluidine blue and examined on a Leica DMS light microscope to select the CA1 region of the hippocampus for electron microscopy. The blocks were further embedded in Epon, and 100 nm ultrathin sections were cut with an Ultracut E ultramicrotome, mounted on 200-mesh copper grids, stained with uranyl acetate (Electron Microscopy Sciences) and lead citrate, and examined on a FEI Tccnai 12 transmission electron microscope. For quantification, the micrographs were taken with 13,000 and 30,000 magnification.
Mouse Primary Neuronal Cultures
[0178] Primary hippocampal neurons were cultured from the brains of embryo at gestational day 16 (E16). The hippocampi were isolated and treated with 2.5% trypsin solution (Sigma-Aldrich, T4674) for 15 min at 37 C. The cells were washed 3 times with Hank's Balanced Salt Solution (HBSS, Gibco, 14025-092) and mechanically dissociated by pipetting, using glass Pasteur pipettes with 3 different opening sizes (3, 2 and 1 mm). Then, they were counted with the viability dye trypan blue (ThermoFisher Scientific, 15250061), using a hemocytometer, and resuspended in Neurohasal media (Gibco, 21103-049) containing L-glutamine, B27, N2, penicillin and streptomycin. The cells were plated at a density of 60,000 cells per well, respectively, in a 12-well plate on coverslips previously coated with Poly-L-Lysine (Sigma Aldrich, P9155). Cells were cultured for 21 days, and 50% of media was changed every three days.
iPSC-Derived Neuronal Cultures.
[0179] Generation of iPSC lines MPS III patient fibroblast lines were obtained from the Coriell Institute for Medical Research (NJ, USA), or from the hospitals were the patients were diagnosed/followed with the informed consent of patient's families. The fibroblasts were propagated in Dulbecco's Modified Eagle Medium (DMEM, ThermoFisher) with 10% fetal bovine serum (FBS) and 1% Antibiotic-Antimycotic (15240062, ThermoFisher) and tested for mycoplasma. The cells were further reprogrammed into iPSCs at the CHUSJ iPSC Platform using a non-integrating CytoTune-Sendai viral reprograming kit (A16517, Thermo Fisher Scientific, MA, USA) according to the manufacture's protocol. Two colonies for each iPSC line were used for further proliferation, iPSCs were expanded and maintained on six-well plates coated with Matrigel mTeSR Plus medium at 37 C., in 5% CO.sub.2/5% O.sub.2 atmosphere following the medium manufacturer's protocol. At 60-80% confluency the cells were passaged using the dissociation agent Accutase and plated in mTeSR Plus medium containing 10 M RI (Y27632 ROCK inhibitor, Selleckchem). The following day, the medium was replaced by fresh mTeSR Plus medium without RI.
[0180] Induction of cortical NPC and cortical neurons iPSCs were differentiated into cortical forebrain committed neural precursor cells (NPCs) by dual SMAD inhibition by passaging iPSCs over to poly-L-ornithine (PO)/laminin coated dishes. NPC induction was performed in a monolayer with the cortical neuronal induction media with FGF-8 used instead of FGFb-2. Eighty percent of media was changed every 2 days. After induction for 3 weeks the cells were analyzed by ICH for the presence of neuronal markers PAX6, and TUBB3, confirmation of disease-specific enzymatic deficiencies and lysosomal storage phenotype (increased size of LAMP2+ puncta by ICH).
[0181] Neuronal Differentiation NPCs were differentiated into cortical neurons as follows. First, NPCs were passage into PO/laminin coated plates in a 1/1 mixture of DMEMF-12/neurobasal (NB) media containing B27, N2, NEAA, BDNF, GDNF, Laminin, dbCAMP, Compound E and TGF-B3 containing 2 M RI. The following day, media was changed for a 100% NB media with containing the above components. Neurons were then cultured for up to 4 weeks until fully differentiated, in the presence or absence of 10 M AVP6.
Whole Cell Recordings in Acute Hippocampal Slices.
[0182] Acute hippocampal slices were prepared as follows. Briefly, animals were anaesthetized deeply with isoflurane and decapitated. The brain was dissected carefully and transferred rapidly into an ice-cold (0-4 C.) solution containing the following (in mM): 250 sucrose, 2 KCl, 1.25 NaH.sub.2PO.sub.4, 26 NaHCO.sub.3, 7 MgSO.sub.4, 0.5 CaCl.sub.2 and 10 glucose, pH 7.4. The solution was oxygenated continuously with 95% O.sub.2 and 5% CO.sub.2, 330-340 mOsm/L. Transverse hippocampal slices (thickness, 300 m) were cut using a vibratome (VT1000S; Leica Microsystems), transferred to a bath at room temperature (23 C.) with standard ACSF at pH 7.4 containing the following (in mM): 126 NaCl, 3 KCl, 1 NaH.sub.2PO.sup.4, 25 NaHCO.sub.3, 2 MgSO.sub.4, 2 CaCl.sub.2), 10 glucose, continuously saturated with 95% 02 and 5% CO.sub.2 and allowed to recover for 1 h. During the experiments, slices were transferred to the recording chamber at physiological temperature (30-33 C.) continuously perfused with standard ACSF, as described above, at 2 ml/min. Pyramidal CA1 neurons from the hippocampus were identified visually using a 40 water immersion objective. Whole-cell patch-clamp recordings were obtained from single cells in voltage- or current-clamp mode and only 1 cell per slice was recorded to enable post-hoc identification and immunohistochemical processing. Recording pipettes (4-6 M) were filled with a K-gluconate based solution for voltage-clamp recordings (in mM): 130 K-gluconate, 10 KCl, 5 diNa-phosphocreatine. 10 HEPES, 2.5 MgCl.sub.2, 0.5CaCl.sub.2,1 EGTA, 3 ATP-Tris, 0.4 GTP-Li, 0.3% biocytin, pH 7.2-7.4, 280-290 mOsm/L.
[0183] After obtaining whole cell configuration, passive membrane properties were monitored for 5 min and current clamp recordings were done to measure action potential characteristics. Slices were then perfused with 0.5 M TTX (to isolate miniature events) for 3 mins before commencing voltage clamp recordings. Cells were voltage clamped at 70 mV for mEPSCs recording and then held at 0 mV (calculated from the reversal potential of Cl) for mIPSCs recording. Data acquisition (filtered at 2-3 kHz and digitized at 15 kHz; Digidata 1440A, Molecular Devices, CA, USA) was performed using the Axopatch 200B amplifier and the Clampex 10.6 software (Molecular Devices). Both mEPSCs and mIPSCs were recorded for 7 min and a running template on a stable baseline (minimum of 30 events) was used for the analysis of miniature events on MiniAnalysis. Clampfit 10.2 software was used for analysis of action potential characteristics and other passive membrane properties.
[0184] For some experiments, to verify that all mEPSCs are blocked, slices were perfused with 5 M DNQX (6,7-dinitroquinoxaline-2,3-dione) and 50 M AP5 in addition to the TTX while recording mEPSCs at 70 mV after addition of ci-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) and N-methyl-D-aspartate receptor (NMDAR) blockers. Similarly, for some experiments, slices were perfused with 100 M BMI (bicuculline methiodide) and 50 M AP5 in addition to the TTX in the ACSF to verify that all mIPSCS are blocked at 0 mV.
Real-Time qPCR.
[0185] RNA was isolated from snap-frozen brain, kidney and liver tissues using the TRIzol reagent (Invitrogen) and reverse-transcribed using the iScript Reverse Transcription Supermix (Bio RAD #1708840) according to the manufacturer's protocol, qPCR was performed using a LightCycler 96 Instrument (Roche) and SsoFast EvaGreen Supermix with Low ROX (Bio RAD #1725211) according to the manufacturer's protocol. RLP32 mRNA was used as a reference control.
Immunohistochemistry
[0186] Mouse brains were collected from animals perfused with 4% PFA in PBS and post-fixed in 4% PFA in PBS overnight. Brains were cryopreserved in 30% sucrose for 2 days at 4 C., embedded in Tissue-Tek OCT Compound and stored at 80 C. Brains were cut in 40 m-thick sections and stored in cryopreservation buffer (0.05 M sodium phosphate buffer pH 7.4, 15% sucrose, 40% ethylene glycol) at 20 C. pending immunohistochemistry. Mouse brain sections were washed 3 times with PBS and permeabilized/blocked by incubating in 5% bovine serum albumin (BSA), 0.3% Triton X-100 in PBS for 1 h at room temperature. Incubation with primary antibodies, diluted in 1% BSA, 0.3% Triton X-100 in PBS, was performed overnight at 4 C. The antibodies used in the study and their working concentrations are shown in Table 1:
[0187] The mouse brain sections were washed 3 times with PBS and counterstained with Alexa Fluor-labeled secondary antibodies (dilution 1:400) for 2 h at room temperature. After washing 3 times with PBS, the mouse brain sections were treated with TrueBlack Lipofuscin Autofluorescence Quencher (Biotium, 23007, dilution 1:10) for 1 min, and then again washed 3 times with PBS. The slides were mounted with Prolong Gold Antifade mounting reagent with DAPI (Invitrogen, P36935) and analyzed using Leica DM 5500 Q upright confocal microscope (10, 40, and 63 oil objective, N.A. 1.4). Images were processed and quantified using ImageJ 1.50i software (National Institutes of Health. Bethesda, MD, USA) in a blinded fashion. Panels were assembled with Adobe Photoshop.
Immunocytochemistry
[0188] Cultured mouse neurons at day in vitro (DIV) 21 or iPSC-derived neurons at D1V21 and DIV28 were fixed in 4% paraformaldehyde and 4% sucrose solution in PBS, pH 7.4, for 20 min. The cells were permeabilized with 0.1% Triton-X100 in PBS for 5 min, and non-specific binding sites were blocked with 5% BSA (Wisent) in PBS for 2 h and then, incubated overnight at 4 C. with primary antibodies in 1% BSA in PBS (see Table 1 for the source of antibodies and their dilutions). On the following day, neurons were washed 3 times with 1% BSA in PBS and labeled with Alexa Fluor 488- or Alexa Fluor-555-conjugated goat anti-rabbit or Alexa Fluor 633-anti-mouse IgG (1:1000, all from Thermo Fisher Scientific) for one hour at room temperature. Coverslips were washed 3 times again in PBS and mounted on slides using ProLong Gold mounting medium, containing 4,6-dianiidino-2-phenylindole (DAPI; Invitrogen, Cat #P36935), and analyzed by a Leica SP8-DSL or Leica TCS SPE confocal microscopes (63 glycerol immersion objectives, N.A. 1.4). Images were processed with Leica Application Suite X (LAS-X) software or Photoshop 2021 (Adobe) and quantified using Fiji-ImageJ 1.50i software (National Institutes of Health, Bethesda, MD, USA). Analysis of images was performed with summation of 9-10 z-stacks separated by 0.5 m. Soma or axon areas were defined by TUBB3, NEUN, or NF-M staining and, within this area, the appropriate markers were measured establishing a threshold. To obtain LAMP2+ area per neuron, NEUN was used as reference area of the neuron and the image was measured for LAMP2+ puncta while removing background threshold. Quantification was blinded and performed in at least 3 different experiments.
Western Blot
[0189] The cerebral cortical tissues were homogenized in five volumes of RIPA lysis buffer (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 1% NP-40, 0.25% sodium deoxycholate, 0.1% SDS, 2 mM EDTA, 1 mM PMSF), containing protease and phosphate inhibitor cocktails (Sigma, cat#4693132001 and 4906837001), using a Dounce homogenizer. The homogenates were kept on ice for 30 min and centrifuged at 13,000 g at 4 C. for 25 min. The supernatant was centrifuged again at 13,000 g for 15 min, the protein concentration in resulting lysates was measured, and 20 g of protein from each sample was separated by SDS-PAGE on 4-20% precast polyacrylamide gel (Bio-Rad, 4561096). Western blot analyses were performed according to standard protocols using Anti-BDNF and -tubulin (1:2000, mouse, DSHB) antibodies. Equal protein loading was confirmed by Ponceau S staining and normalized for tubulin immunoreactive band. Detected bands were quantified using ImageJ 1.50i software (National Institutes of Health, Bethesda, MD, USA).
Analysis of Glycosaminoglycans by LC-MS/MS
[0190] Analysis of brain glycans was conducted as follows. Briefly, 30-50 mg of mouse brain tissues were homogenized in ice-cold acetone and centrifuged at 12,000g for 30 mM at 4 C. The pellets were dried, resuspended in 0.5 N NaOH and incubated for 2 h at 50 C. Then the pH of the samples was neutralized with 1 N HCl, and NaCl was added to the reaction mix in a final concentration of 3 M. After centrifugation at 10,000g for 5 mM at room temperature, the supernatants were collected and acidified using 1 N HCl. Following another centrifugation at 10,000g for 5 min at room temperature, the supernatants were collected and neutralized with 1 N NaOH to a pH of 7.0. The samples were diluted at a ratio of 1:2 with 1.3% potassium acetate in absolute ethanol and centrifuged at 12,000g and 4 C. for 30 min. The pellets were washed with cold 80% ethanol, dried at room temperature, and dissolved in 50 mM Tris-HCl buffer. The samples were further filtered using AcroPrep Advance 96-Well Filter Plates with Ultrafiltration Omega 10 K membrane filters (PALL Corporation, USA) and digested with chondroitinase B, heparitinase, and keratanase II, overnight at 37 C. The samples were analysed by mass spectrometry using a 6460 Triple Quad instrument (Agilent technologies) using Hypercarb columns.
AVP6 Treatment
[0191] Starting from 3 weeks of age, WT C57B16 and homozygous Hgsnat.sup.P304L male and female mice were randomly divided in treatment and control groups (6-13 mice/sex/genotype/treatment; see Table I). The control group was daily administered with saline (5 L to each nostril), while for the treatment group, saline was supplemented with 125 g of AVP6/mL, which would result in a dose of approximately 50 g/kg BW/day. The peptide formulation was prepared once, aliquoted and kept frozen at 80 C. until use. At 4 months, all mice were studied by EPM, OF, YM and NOR behavioral tests. Administration of the drug or saline was continued through the days on which the assays were conducted. Then approximately at 5 months 4-5 mice in each group were sacrificed. Their blood plasma was collected, and their tissues were either snap-frozen or fixed and cryopreserved to analyze CNS pathology as described above. For the remaining mice, treatment was continued and their behaviour was studied again at the age of 6 months using OF. NOR and YM tests. Starting from the age of 8 months, Hgsnat.sup.P304L treated and untreated mice were daily studied for the signs of urinary retention. When such signs were detected, the mice were studied by ERG and sacrificed within 1-2 days. Finally, the remaining treated and untreated WT mice were studied by ERG and sacrificed at the end of the study, approximately at 10 months of age.
Statistical Analysis
[0192] Statistical analyses were performed using Prism GraphPad 9.0.0. software (GraphPad Software San Diego, CA). The normality for all data was checked using the D'Agostino & Pearson omnibus normality test. Significance of the difference was determined using t-test (normal distribution) or Mann-Whitney test, when comparing two groups. One-way ANOVA test followed by Tukey's multiple comparison test (normal distribution) or Kruskal-Wallis test followed by Dunn's multiple comparisons test were used when comparing more than two groups. Two-way ANOVA followed by Bonferroni post hoc test was used for two-factor analysis. A P-value of 0.05 or less was considered significant.
Results
1. AVP6 Restores Glutamatergic Synaptic Transmission in MPS IIIC Mice
[0193] This example tested AVP6's effect on synaptic signaling in acute hippocampal slices of MPS IIIC (both Hgsnat.sup.Geo and Hgsnat.sup.P304L) mice. To characterize synaptic neurotransmission, we performed whole-cell patch-clamp recordings on acute slices from Hgsnat.sup.P304L, Hgsnat-Geo and WT mice at P14-20 and P45-60. At both timepoints the amplitudes of miniature excitatory postsynaptic currents mEPSC were significantly reduced in Hgsnat-Geo and Hgsnat.sup.P304L mice as compared with WT mice (
[0194] Importantly, for both Hgsnat-Geo and Hgsnat.sup.P304L mice, there was an age-dependent (P14-20 vs P45-60) significant decrease in mEPSC amplitudes and a trend for decrease of mEPSC frequencies (
[0195] We further studied evoked glutamatergic EPSCs in CA1 pyramidal neurons at P14-20 by stimulating Schaffer Collateral afferents. Upon administering the same intensity of stimulation, both Hgsnat-Geo and Hgsnat.sup.P304L mice elicited smaller AMPA and NMDA currents (reflected as significantly reduced AMPA: NMDA ratio) as compared with age-matched WT mice (
[0196] We tested whether bath application of 10 M AVP6 would increase EPSC, evoked by stimulating Schaffer collaterals in Hgsnat.sup.P304L mice, and found that the drug partially recovered deficits in AMPA currents but not in NMDA currents. AVP6 also partially rescued deficits in the paired pulse stimulation in both Hgsnat-Geo and Hgsnat.sup.P304L mice with IPI in the range of 100-300 ms, but not at 400 and 500 ms (
2. AVP6 Increases Reduced Levels of Synaptic Protein Markers in Cultured Neurons from MPS IIIC Mice and in iPSC-Derived Cultured Cortical Neurons of Human MPS IIIA and MPS IIIC Patients
[0197] Earlier examples demonstrated that synaptic marker, SYN1+ puncta, and the markers of the glutamatergic synapse, VGLUT1+ puncta in juxtaposition with PSD-95+ puncta, were reduced in cultured hippocampal neurons from Hgsnat-Geo mice. The same markers, as well as the markers of the inhibitory synapse VGAT+ puncta in juxtaposition with Gephyrin+ puncta, were also reduced in cultured hippocampal neurons from Hgsnat.sup.P304L mice. In order to test whether AVP6 is capable of restoring these deficits, we established embryonic cultures of hippocampal neurons from Hgsnat.sup.P304L mice. AVP6 at a final concentration of 10 M was added to the culture media when the neurons were plated and, further, every 3 days when 50% of the media was changed. At 21 days in vitro (DIV2), neurons were fixed and analyzed by immunohistochemistry using markers of dendrites (MAP2), axons (medium chain of neurofilament protein, NF-M), and synapse (SYN1, VGLUT, and PSD-95). We also analyzed the levels of BDNF to test if this protein was deficient in the hippocampal neurons from Hgsnat.sup.P304L mice and whether it was increased by the treatment with AVP6 peptide. The numbers of puncta positive for the above markers were counted in 20 m-long segments of a dendrite or an axon, 30 m away from the neuronal soma.
[0198] Our results indicate that primary neuronal cultures from Hgsnat.sup.P304L mice show drastic reduction of BDNF and SYN1, while the treatment with AVP6 rescues deficit of both proteins (
[0199] To test whether the effect of the peptide can be recapitulated in neurons of human MPS IIIC patients and patients with other subtypes of MPS III, we have generated iPSC lines from available skin fibroblast lines received from cell depositories or obtained with consent of families. The fibroblasts were reprogrammed using the Sendai virus manufactured by Life Technologies. All iPSCs lines had a normal karyotype, were positive for pluripotency markers TRA-1-60 and SOX2, and demonstrated ability to differentiate in vitro into the three germ layer cells (Nestin+/PAX6+ ectoderm, SMA+ mesoderm and SOX17 (CXCR4)+ endoderm).
[0200] After confirmation of the primary enzymatic defect (HGHS for MPS IIIA, NAGLU for MPS IIIB, HGSNAT for MPS IIIC and GNA for MPS IIID), the iPSCs were differentiated into forebrain committed neural precursor cells (NPC) by dual SMAD inhibition. NPC were induced in neuronal induction media (DMEM/F12) for 3 weeks and analyzed by immunocytochemistry to confirm expression of the neuronal markers, NeuN, axonal -tubulin III (clone TUJ1) and SYN1. Increased size of LAMP2+ puncta and high levels of total -hexosaminidase activity were detected in the NPC lines from MPS IIIC patients as compared with cells from healthy controls suggesting the lysosomal storage phenotype and increased lysosomal biogenesis. As for iPSC, primary HGHS, NAGLU, HGSNAT or GNA deficiency in generated NPC lines was confirmed by measuring enzyme activity in cell homogenates.
[0201] Subsequently, NPC were differentiated into the cortical neurons by culturing in 1/1 mixture of DMEMF-12/neurobasal (NB) media containing B27, N2, NEAA, BDNF, GDNF, Laminin, dbCAMP, Compound E and TGF-B3. Neurons were further cultured for 4 weeks until they were fully differentiated, fixed and stained for SYN1, VGLUT1, PSD-95, BDNF, and LAMP2. Similarly to NPC, iPSC-derived neurons of MPS III patients showed a significant increase in LAMP2 staining indicating lysosomal storage and increased lysosomal biogenesis.
[0202] Importantly, MPS III iPSC derived neurons showed significantly reduced levels of BDNF+, VGLUT1+ and PSD-95+ puncta suggesting that deficiency of protein markers of glutamatergic synapse observed in cultured neurons from Hgsnat.sup.P304L mice, is recapitulated in human MPS IIIA and MPS IIIC cells (
[0203] Altogether, our data demonstrate that AVP6 rescues reduced levels of the protein markers of the glutamatergic synapse in cultured neurons. Together with the ability of the peptide to induce miniature and evoked excitatory currents at the presynaptic side, these results suggest that the drug rescues glutamatergic synaptic deficits in MPS III neurons in vitro and ex vivo.
3. Short-Term Treatment with AVP6 Partially Rescues Neurobehavioral Manifestations and Increases Hippocampal BDNF Levels in Symptomatic MPS IIIC Mice
[0204] We further tested if AVP6 can rescue neurobehavioral deficits associated with synaptic dysfunction in MPS IIIC mice. The early phase of the disease in both Hgsnat-Geo and Hgsnat.sup.P304L mice manifests with reduced anxiety and hyperactivity. Specifically, in an Open Field (OF) test at both 4 months and 6 months, Hgsnat.sup.P304L mice show a significant increase in a total distance traveled, increased time spent at the center of the arena and increased distance traveled in the center of the arena as compared with the WT animals. Earlier examples demonstrated that AVP6 is readily targeted to the brain and exerts the maximal effect on memory and learning within 24 hours after intranasal administration at a dose of 50 g/kg BW in mice and rats. Thus, 4 and 6-month old Hgsnat.sup.P311L and WT mice were studied by OFT 17 hours after intranasal administration of the peptide in a single dose of 50 g/kg BW (5 l of 125 mg/ml peptide solution in saline per each nostril). Control groups were treated with the same volume of saline.
[0205] We found that in Hgsnat.sup.P311L mice of both ages, treated with AVP6, the total traveled distance was reduced and the distance traveled in the center/time spend in the center increased as compared with untreated mice indicating that the treatment partially reversed the behavioral deficits (
[0206] The ability of the peptide to improve the memory deficits was tested in the 4-months-old Hgsnat-Geo mice using the Novel Object Recognition (NOR) test that studies working memory of mice by measuring their ability to discriminate a familiar object a novel one. AVP6 was administered intranasally at a daily dose of 50 g/kg for ten consecutive days before the experimental day. As before, the control groups of Hgsnat-Geo and WT animals were treated with saline. We found that saline-treated Hgsnat-Geo mice showed significantly reduced values of a discrimination index and a recognition index suggesting their reduced ability to recognize the familiar object (
[0207] At the same time, a single dose of AVP6 17 hours before the test, did not improve behaviour of Hgsnat-Geo mice in NOR test (data not shown) indicating that long-term administration of the peptide is required to rescue memory deficit.
3. Chronic Treatment with AVP6 Delays Neurobehavioral Manifestations and Development of Pathological CNS Changes in the Hgstzat.sup.P304L Mice
[0208] Encouraged by the results of preliminary studies indicating that intranasal administration of AVP6 can induce brain levels of mature BDNF and partially rescue neurobehavioral deficits in the mouse models of MPS IIIC we conducted a preclinical efficacy study to test whether chronic administration of the peptide can delay clinical and pathological manifestations of the disease. The study was conducted in the Hgsnat.sup.P304L strain that shows more aggressive course of the disease as compared with Hgsnat-Geo mice.
[0209] We have selected the invasive intranasal administration, which is potentially ideal for clinical application, as the primary delivery route. Peptide pharmaco-kinetics was determined by evaluation of AVP6 levels in CNS, blood and peripheral tissues at different time points (1-48 h) after intranasal delivery in the WT mice. The entire mouse brain was cut in four sections, rostral to caudal and assessed for biodistribution of AVP6 by targeted LC-MS/MS using parallel reaction monitoring. For quantification, samples were spiked with isotopically labeled (Phe U-.sup.13C.sub.9; U-.sup.15N) AVP6 peptide as an internal standard. Peptide levels were also measured in peripheral (liver, kidney, spleen) tissues and in blood to provide insights into peptide biodistribution and degradation rates. These experiments demonstrated that 1 h after intranasal administration (10 l of 50 mM AVP6) the concentration of the peptide in the brain (2.8-0.9 fmol/g) is much higher than in plasma or visceral organs and exceeds the concentration estimated to be effective for restoring the neurotransmission (
[0210] WT, and Hgsnat.sup.P304L mice were randomly assigned to the treatment and control groups. The cohort size (18 mice/sex/treatment) was calculated based on mean variability of replicates in previous behavioral tests in Hgsnat.sup.P304L mice to detect a 40% difference between means (power=0.8). Treatment was started at weaning (P21) which corresponds to neurodevelopmental human age of 3 years, the time of disease onset for majority of Sanfilippo patients. Since most patients are diagnosed post-symptomatically, this age would most likely become the treatment starting point for the most of patients. Although Hgsnat.sup.P304L mice at P21 do not show behavioral alterations, their CA1 pyramidal neurons show synaptic deficits at the electrophysiological level and significantly reduced density of dendritic spines at this age. To test if chronic administration of the peptide results in major metabolic changes, the mouse body weight was measured weekly. No difference in body weight and body weight gain was detected between the treated and untreated Hgsnat.sup.P304L or WT mice.
[0211] Since phenotypic differences between WT and Hgsnat.sup.P304L mice are already pronounced at 16 weeks, mice were treated between 6 and 16 weeks, at which point their behavior was assessed as before by OF (anxiety, fear and hyperactivity), EPM (anxiety, fear), YM and NOR (memory) tests.
[0212] When analyzed by OF test at 4 months, both male and female Hgsnat.sup.P304L mice treated with saline showed significantly increased hyperactivity (increase in the total distance traveled) and reduced anxiety (increased time spent in the center of the arena) as compared to the WT animals (
[0213] In similar fashion, female or male Hgsnat.sup.P304L mice, treated with saline at 4 months, showed significantly reduced fear when studied by EPM test (increase in the number of open arm entries and increased time spent in the open arms) as compared to the WT animals (
[0214] Both male and female Hgsnat.sup.P304L mice, treated daily with AVP6, showed no difference from their WT counterparts in the number of open arm entries and the percentage of time spent in the open arena. As before, there was no sex specific effect in any of the parameters assayed in the elevated plus maze test and no effect of the drug was detected in the WT mice.
[0215] The short-term and spatial memory of mice was studied by NOR and YM tests. As before, female and male Hgsnat.sup.P304L mice treated with saline, showed a significant reduction in discrimination and recognition indexes, suggesting a short memory deficit, while both male and female Hgsnat.sup.P304L mice treated with AVP6, were similar to the WT mice (
[0216] After completion of the behavioural analysis at 4 months, 50% of mice in each group were sacrificed for analysis of CNS pathology and biochemical testing. To study the effect of the treatment on synaptic architecture, we have stained the brain sections for presynaptic (VGLUT1) and postsynaptic (PSD-95, BDNF) markers and quantified their levels in the CA1 area of hippocampi and in layers 3-4 of somatosensory cortex. Our data (
[0217] Unexpectedly, we also observed that the abundance of GFAP+ astrocytes and CD68+ activated microglia were reduced in both brain areas of AVP6-treated Hgsnat.sup.P304L mice as compared with saline-treated Hgsnat.sup.P304L mice, suggesting that the drug partially blocked the neuroimmune response (
4. Chronic Treatment with AVP6 Prolongs Survival and Ameliorates CNS and Peripheral Tissue Pathology in the Hgsnat.sup.P304L Mice at the Terminal Stage of the Disease
[0218] About 50% of mice in all cohorts were continued to be treated with AVP6 or saline for assessment of the peptide effect on the behavioural abnormalities at 6 months of age and survival. Since we did not have enough number of animals to evaluate the effect of the treatment for each sex separately, the behaviour of male and female mice in the peptide-treated and saline-treated groups was analyzed separately and compared. If no difference was observed between sexes in the same group, the results were pooled. The OF test, conducted at 6 months, revealed that reduced anxiety (significantly increased percentage of time spent in the center of the arena) and hyperactivity (increased total distance traveled in the arena) were significantly reduced in Hgsnat.sup.P304L mice treated with AVP6 as compared with the Hgsnat.sup.P304L mice treated with saline (
[0219] Unlike human MPS III patients, Hgsnat.sup.P304L mice at the age of approximately 8 months develop urinary retention resulting in abdominal distension and requiring humane euthanasia. The mechanism underlying this phenotype, observed also in other murine models of neurological MPS, is not completely clear, but it was proposed to be associated with GAG storage and infiltration of immune cells in the epithelium of the urinary tract and bladder. Previously we determined the average survival age of Hgsnat.sup.P304L mice as 42 weeks. To test whether the AVP6 treatment delayed development of this phenotype, mice in both treatment and vehicle groups were examined for the signs of urinary retention on a daily basis, starting from the age of 7 months, and immediately sacrificed, when abdominal distension was detected. The WT mice in the treatment and vehicle groups were sacrificed one week after the sacrifice of the last treated Hgsnat.sup.P304L mouse. We found that the AVP6-treated Hgsnat.sup.P304L, in general, showed a longer survival with the average life span of 49 weeks, which is 8 weeks longer that the survival of saline-treated group (
[0220] The terminal CNS pathology was studied using the same set of biomarkers as at 4 months, either by IHC (astrocytosis, microgliosis, synaptic markers SYN1, PSD-95, GLUT1, BDNF) or by biochemical (total -hexosaminidase activity, expression levels of inflammatory cytokines) assays.
[0221] As at the age of 4 months AVP6-treated Hgsbat.sup.P304L mice at the age of sacrifice (10-11 months) showed a significantly increased levels of synaptic protein markers as compared with saline-treated Hgsnat.sup.P304L mice. However, the effect was different for pre- and post-synaptic proteins. While levels of post-synaptic proteins, PSD-95 and BDNF, were completely recovered and similar to those in the WT mice, the levels of presynaptic proteins, GLUT1 and SYN1, either increased in the AVP6-treated as compared with saline-treated Hgsnat.sup.P304L mice, or remained significantly lower than those in WT animals (
[0222] Total -hexosaminidase activity measured in brain homogenates although showed a trend for reduction in AVP6-treated as compared with saline-treated Hgsnat.sup.P304L mice remained significantly increased as compared with treated or untreated WT mice as was the LAMP2 levels in the brain sections suggesting that treatment does not ameliorate levels of lysosomal storage at the terminal timepoint.
[0223] The results of our study demonstrate that AVP6 can ameliorate pathological signs in animal and cellular models of mucopolysaccharidosis IIIA and IIIC.
[0224] At the Cellular and Synaptic Levels:
[0225] The treatment of cultured primary hippocampal neurons of Hgsnat.sup.P304L mice with 10 M AVP6 added to the culture media rescues reduced levels of synaptic markers VGLUT1, SYN1, PSD-95 and BDNF.
[0226] The treatment of cultured iPSC-derived cortical neurons from MPS IIIA and MPS IIIC patients by 10 M AVP6 added to the culture media rescues reduced levels of synaptic markers VGLUT1, SYN1, PSD-95 and BDNF, demonstrating that the drug acts on human cells affected with different subtypes of the disease.
[0227] Bath application of AVP6 rescues deficits in glutamalergic neurotransmission in acute hippocampal slices of Hgsnat.sup.Geo and Hgsnat.sup.P304L MPS IIIC mice at both P14-20 and P45-60. The peptide preferentially rescues deficits in AMPA currents.
[0228] At the behavioral level:
[0229] Single intranasal administration of AVP6 to 4-month-old and 6-month-old MPS IIIC Hgsnat.sup.P304L mice at a dose of 50 g/kg BW rescues reduced anxiety and hyperactivity in OF and EPM tests 17 hours after the treatment. Single intranasal administration of AVP6 to Hgsnat-Geo MPS IIIC mice at a dose of 50 g/kg BW also rescues reduced anxiety in EPM test 17 hours after the treatment.
[0230] Ten-day intranasal administration of AVP6 to 4-month-old Hgsnat-Geo MPS IIIC mice at a dose of 50 g/kg BW rescues impairment of short-term memory in NOR test.
[0231] Chronic treatment of Hgsnat.sup.P304L mice with AVP6 at a dose of 50 g/kg BW/day rescues reduced anxiety and hyperactivity in OF and EPM tests at 4 and 6 months.
[0232] Chronic treatment of Hgsnat.sup.P304L mice with AVP6 in a dose of 50 vg/kg BW/day rescues deficits in spatial and short-term memory in YM and NOR tests at 4 months and partially rescues deficits in spatial and short-term memory in spatial and short-term memory in YM and NOR tests at 6 months.
[0233] At the pathophysiological level:
[0234] Chronic treatment with AVP6 at a dose of 50 g/kg BW/day rescues reduced BDNF levels in hippocampal and cortical pyramidal neurons of Hgsnat.sup.P304L mice at the age of 5 months and partially rescues them at the age of 8-9 months coinciding with the improvements of memory deficits observed at 4 months and 6 months.
[0235] Chronic treatment with AVP6 at a dose of 50 lag/kg BW/day rescues reduced levels of synaptic proteins SYN1, VGLUT1 and PSD-95 in hippocampal and cortical pyramidal neurons of Hgsnat.sup.P304L mice and the age of 5 months and partially rescues them at the age of 8-9 months.
[0236] Chronic treatment with AVP6 at a dose of 50 g/kg BW/day normalizes astrocytosis and microgliosis in Hgsnat.sup.P304L mice at the age of 5 months and reduces it at the age of 10-11 months, demonstrating, also, that the drug has anti-inflammatory action.
[0237] Chronic treatment with AVP6 at a dose of 50 g/kg BW/day delays the onset of lethal urinary retention by approximately 8 weeks and reduces splenomegaly in Hgsnat.sup.P304L mice, demonstrating that the drug also exerts an anti-inflammatory effect in peripheral tissues.
[0238] Together, these data demonstrate that AVP6 delays neurological manifestations in MPS IIIC by rescuing glutamatergic neurotransmission and synaptogenesis defects. They also demonstrate that the drug delays immunoinflammatory response in CNS and peripheral tissues and increases longevity.
[0239] The present disclosure is not to be limited in scope by the specific embodiments described which are intended as single illustrations of individual aspects of the disclosure, and any compositions or methods which are functionally equivalent are within the scope of this disclosure. It will be apparent to those skilled in the art that various modifications and variations can be made in the methods and compositions of the present disclosure without departing from the spirit or scope of the disclosure. Thus, it is intended that the present disclosure cover the modifications and variations of this disclosure provided they come within the scope of the appended claims and their equivalents.
[0240] All publications and patent applications mentioned in this specification are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.