PDE5A destabilizing domains
11891634 ยท 2024-02-06
Assignee
Inventors
Cpc classification
C07K2319/20
CHEMISTRY; METALLURGY
C12Y301/04017
CHEMISTRY; METALLURGY
C12N15/1055
CHEMISTRY; METALLURGY
International classification
C12N9/00
CHEMISTRY; METALLURGY
C12N15/10
CHEMISTRY; METALLURGY
Abstract
Disclosed herein are systems, methods, and compositions for rapidly and reversibly destabilizing a target protein in vitro or in vivo, in the presence or absence of a cell-permeable, synthetic molecule or ligand.
Claims
1. A conditional protein stability system, comprising: a nucleic acid sequence encoding a fusion protein comprising a protein of interest fused in-frame to a single-protein, ligand dependent destabilizing domain wherein the ligand dependent destabilizing domain comprises SEQ ID NO: 19 (encoded by SEQ ID NO: 36); and a ligand, wherein the ligand is Sildenafil or Vardenafil, wherein upon introduction of the nucleic acid sequence to a cell, the fusion protein is expressed, and wherein degradation of the protein of interest is decreased upon administration of the ligand.
2. The conditional protein stability system of claim 1, wherein the ligand dependent destabilizing domain consists of SEQ ID NO: 19 (encoded by SEQ ID NO: 36).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
DETAILED DESCRIPTION
I. Introduction
(5) Techniques for modulating transcription of DNA and RNA expression provide powerful tools for studying specific genes and their biological function. For example, the tet/dox, and Cre/lox systems have been widely used to target gene expression at the transcriptional level (Ryding A. D. S. et al. (2001), J. Endocrinol. 171:1-14) and RNA interference provides a method to achieve post-transcriptional gene silencing Fire, A. et al. (1998) Nature 391:806-811; Medema, R. H. (2004) Biochem. J. 380:593-603; Raab, R. M. and Stephanopoulos, G. (2004) Biotechnology & Bioengineering 88:121-132).
(6) Techniques have also been developed to regulate proteins on a post-translational level. Experimental methods have been developed to regulate protein stability and function rapidly and reversibly using protein domains that are conditionally stable in cultured cell or living animals. Such methods are often controlled by the binding of a small molecule ligand (Baker, M. (2012) Nat. Methods 9, 443-447). Methods to conditionally regulate protein abundance in cells are useful to biologists to study a protein's function(s) in complex biological systems. However, methods for regulating protein function directly are limited, especially in mammalian cells. Inhibitors or activators of particular proteins have been identified, and often take the form of cell permeable small molecules. Many of these molecules have found widespread use as biological probes, often because the speed, dosage-dependence, and reversibility of their activities, which complement methods for genetically modulating (Schreiber, S. L. (2003) Chem. & Eng. News 81:51-61). However, these inhibitors or activators are often promiscuous, affecting several proteins rather than a specific protein (Davies, S. P. et al. (2000) Biochem. J. 351:95-105; Bain, J. et al. (2003) Biochem. J. 371:199-204; Godl, K. et al. (2003) Proc. Natl. Acad. Sci. U.S.A. 100:15434-15439; Tan, D. S. (2005) Nat. Chem. Biol. 1:74-84; Mayer, T. U. et al. (1999) Science, 286:971-974).
(7) A method by which specific kinases can be inhibited using a small molecule modulator has also been developed (Bishop, A. C. et al. (1998) Current Biology 8:257-266). This method involved mutating a protein of interest, typically replacing a large conserved residue in the active site with a smaller residue, such as glycine or alanine. Specificity is achieved by chemically modifying a promiscuous inhibitor to include a bulky side-chain substituent (e.g. R-group), which fills the corresponding cavity in the binding site of the modified protein of interest, while preventing the productive interactions with other kinases. While this so called bump-hole approach has been successful both in cultured cells and in mice Bishop, A. C. et al. (2000) Nature 407:395-401; Wang, H. et al. (2003) Proc. Natl. Acad. Sci. U.S.A. 100:4287-4292, Chen, X. et al. (2005) Neuron 46:13-21), it appears to be limited to ATPases and GTPases. Additional methods are required to probe the function of a wider variety of proteins.
(8) Alternative strategies to perturb protein function by exploring existing cellular processes have been devised. For example, a method has been developed for controlling protein function based on the importance of certain N-terminal residues for protein stability (Bachmair, A. et al. (1986). Science 234:179-186). Szostak and coworkers showed that a small peptide sequence could be fused to the N-terminus of a protein of interest to modulate protein stability (Park, E-C. et al. (1992) Proc. Natl. Acad. Sci. U.S.A. 89:1249-1252). Varshaysky and coworkers have further isolated a temperature sensitive peptide sequence that greatly reduced the half-life of dihydrofolate reductase (DHFR) at the non-permissive temperature (Dohmen, R. J. et al. (1994) Science 263:1273-1276). This approach has been used to study proteins in yeast (Labib, K. et al. (2000) Science 288:1643-1646; Kanemaki, M. et al. (2003) Nature 423:720-724). Furthermore, dimeric small molecules have been engineered to conditionally target fusion proteins for degradation via E3 ligase or the proteasome, itself (Janse, D. M. et al. (2004) J. Biol. Chem. 279:21415-21420). However, these systems require either a prior knowledge of the high-affinity ligands that modulate the activity of a protein of interest or they are restricted to genetically engineered yeast strains.
(9) An alternative approach for controlling protein function directly is to interfere with subcellular localization. For example, several methods have been developed to regulate protein localization using a small molecule by taking advantage of the FKBP-FRB ternary complex (Kohler, J. J. et al. (2003) Chem. Biol. 10:1303-1331; Inoue, T. et al. (2005) Nature Methods 2:415-418). Rapamycin and FK506 are potent, commercially available immunosuppressive agents, which are ligands of the FK506-binding protein (FKBP12, FKBP). Rapamycin also binds to FKBP-rapamycin-associated protein (FRAP). FRAP is also called the mammalian target of rapamycin (mTOR), rapamycin and FKBP target 1 (RAFT1), and FKBP-rapamycin-binding (FRB). Rapamycin binds to and inhibits FRAP/mTOR by interacting with its FRB domain to inhibit/delay G1 cell cycle progression in mammalian cells (see, e.g. Choi, J. et al. (1996) Science 273:239-42 and Vilella-Bach, M. et al. (1999) J. Biol. Chem. 274:4266-72. The FRB domain is required for FKBP-rapamycin-associated protein kinase activity and G1 progression. Fusions of proteins of interest can be made to either FKBP or to the FRP domain of FRAP/mTOR. Colocalization of the protein of interest is induced upon addition of rapamycin. Because rapamycin has inherent biological activity, researchers have developed a bump-hole strategy (similar to that described above), wherein rapamycin derivatives possessing large substituents at the FRB binding interface bind poorly to the wild-type FRB domain and thus the target FRAP/mTOR; binding is restored upon introduction of compensatory cavity-forming mutations in FRB. Specifically, a C20-methallyl-rapamycin derivative (MaRap) binds to a triple-mutated variant of FRB called FRB* (Liberles, S. D. et al. (1997) Proc. Natl. Acad. Sci. U.S.A. 94:7825-7830).
(10) Recently, numerous applications have been described employing light responsive protein domains. The LOV (Light-Oxygen-Voltage) domains are part of plant photoreceptor proteins and detect blue light via a flavin cofactor (Herrou, J. et al. Nat. Rev. Microbiol. 9, 713-723 (2011)). The LOV2 domain of oat phototropin 1 (AsLOV2) holds a c-terminal alpha helix that is tightly bound to the LOV core domain in dark. Exposure to light results in unfolding of the helix. The AsLOV2 domain has been used to regulate certain protein activities by the steric inhibition of an effector protein or by restricting a specific protein conformation. (Wu, Y. I. et al. (2009) Nature 461, 104-108; Lee, J. et al. (2008) Science 322, 438-442; Strickland, D., et al. (2008) Proc. Natl. Acad. Sci. USA 105, 10709-10714). These methods are suitable for the reported engineered proteins but not generally applicable to other proteins. Alternatively, engineered AsLOV2 and other photosensory domains have been used to establish light mediated protein-protein interactions (Shimizu-Sato, S., et al. (2002) Nat. Biotechnol. 20, 1041-1044; Levskaya, A., et al. (2009) Nature 461, 997-1001; Yazawa, M., et al. (2009) Nat. Biotechnol. 27, 941-945; Kennedy, M. J. et al. (2010) Nat. Methods 7, 973-975; Strickland, D. et al. (2012) Nat. Methods 9, 379-384; Wang, X., et al. (2012) Nat. Methods 9, 266-269; Polstein, L. R. et al. (2012) J. Am. Chem. Soc. 134, 16480-16483; Lungu, O. I., et al. (2012) Chem. Biol. 19, 507-517; Zhou, X. X. et al. (2012) Science 338, 810-814). Thus, translocation strategies to the cell membrane or the nucleus can allow location specific protein activity and light induced gene expression systems respectively. These technologies may be useful in some cases, but they often lack the ability to control protein levels once present in the cells, and none of the existing methods developed so far is suitable for fast and reversible regulation of protein levels. Furthermore, while the aforementioned methods for regulating protein function directly are noteworthy, a need remains for a convenient, general method for regulating protein function, particularly a method that does not require the interaction of multiple proteins. Regulation of protein stability in cells in a more spatial or temporal manner is also desirable.
(11) Building on the FRB* domain system, Banaszynski et al., developed a cell permeable ligand system of mutants of FKBP12 which are engineered to be unstable in the absence of a high affinity ligand, Shield-1 (Banaszynski et al., Cell. (2006); 126:995-1004). They termed these unstable domains, destabilizing domains (DDs). The FKBP/shield-1 tuning system has been successfully used in several studies to control target proteins. For example, Dettwier et al., fused FKBP to tune the express of NADPH P450 oxidoreductase (POR) (Dettwier et al., PLoS One, 2014, 9(11): e113540). The FKBP DD-shield system has been used in cell lines, transgenic mice, protozoan Entamoeba histolytica, the flatworm Caenorhabditis elegans, the medaka, and transgenic xenografts to investigate the activity of a protein of interest (Maynard-Smith et al., (2007), J Biol Chem. 282(34): 24866-24872; Liu et al., (2014) Int J Parasitol., 44(10):729-735; Cho et al., (2013) PLoS One., 8(8): e72393; Banaszynski et al. (2008) Nat Med, 14(10):1123-1127; Rodriguez and Wolfgang, (2011) Chem Biol., 19(3):391-398; and Froschauer et al., (2015) PLoS One, 10(7): e0131252), for iPSC reprogramming (Sui et al., (2014) Stem cell Reports., 2(5): 721-733).
(12) Other DD ligand pairs include estrogen receptor domains which can be regulated by several estrogen receptor antagonists (Miyazaki et al., (2012) J Am Chem. Soc, 134(9): 3942-3945), and fluorescent destabilizing domain (FDD) derived from bilirubin-inducible fluorescent protein, UnaG. A FDD and its cognate ligand bilirubin (BR) can induce degradation of a protein fused to the FDD (Navarro et al. (2016) ACS Chem Biol, June 6, Epub). Other known DDs and their applications in protein stability include those described in U.S. Pat. Nos. 8,173,792 and 8,530,636, the contents of which are each incorporated herein by reference in their entirety.
(13) In an orthogonal approach, the destabilizing domains of the bacterial dihydrofolate reductase (ecDHFR) were explored. (Iwamoto et al. (2010) Chem Biol., 17(9):981-988; and Tai et al. (2012), PLoS One. 7(9): e46269). Numerous inhibitors of DHFR have been developed as drugs and one such inhibitor Trimethoprim (TMP), inhibits ecDHFR much more potently than mammalian DHFR providing specificity to the interaction (Iwamoto, et al., (2010) Chem Biol. September 24; 17(9): 981-988).
(14) The present findings expand upon the technology of conditional protein stability systems by utilizing destabilizing domains derived from human PDE5A protein. The destabilization and stabilization of a protein of interest can be controlled by PDE5A derived DDs having stabilizing or destabilizing properties and their ligands e.g. Sildenafil and Vardenafil which bind to such protein domains. The presence and/or absence of the ligand can conditionally stabilize the protein of interest that is genetically fused to the protein of interest.
II. Compositions
(15) Described herein are compositions, systems and methods for modulating the stability and function of proteins rapidly and reversibly, in vitro and in vivo, through the administration of cell-permeable small molecules to cultured cells or living animals. The coding sequence for a protein of interest (POI) is genetically fused to a sequence encoding a stability-affecting protein domain capable of interacting with a small-molecule ligand, the presence, absence, or amount of which ligand modulates the stability of the fusion protein. These compositions, systems and methods are designed to provide (1) protein domains in the form of cDNA constructs that, when fused to any gene-of-interest, can be used by investigators to degrade proteins-of-interest; and (2) cell-permeable small molecules that bind to and stabilize the destabilizing domains (DD), thereby restoring the function of the protein-of-interest. A feature of the conditional system is that it is a single ligand domain system, which minimizes the number of components in the system and the complexity of the system.
(16) In some embodiments, provided are ligand-regulated conditional protein stability systems which enable the stability of a protein of interest to be modulated (i.e. manipulated or controlled), following its expression. In conditional protein stability systems described herein, stability is modulated by adding an amount of a stabilizing ligand, which binds to a fusion protein containing a destabilizing protein domain fused to a POI, thereby stabilizing the fusion protein and allowing the POI to function in the cell. As used herein, POI refers to any protein, or functional fragment or derivative, thereof, that one skilled in the art wishes to study, or for which, one desires to conditionally destabilize and regulate the degradation of the protein functional fragment or derivative thereof. Described herein are ligand regulated protein stability systems and destabilizing protein domains comprising PDE5A derived destabilizing domains. The overall architecture of the ligand regulated protein stability system is presented in
(17) In some embodiments, stability of the fusion protein is increased upon administration of the ligand. This strategy is referred to as the drug-on in that the stabilizing ligand must be present for the expression of the desired fusion protein. However, if the POI exhibits a dominant negative phenotype, the system may effectively be drug-off in that removal of the stabilizing ligand is required for the expression of the desired fusion protein. In this embodiment, addition of a stabilizing ligand results in the stabilization of the fusion protein and loss of function of the target protein. A similar situation may exist if a constitutively active variant of a protein e.g. an oncogene, was placed under the control of a ligand responsive fusion protein, wherein the addition of ligand (rather than its withdrawal) triggers the event of interest and ensures the specificity of the conditional stabilization. This may result in a decrease in the stability of the fusion protein upon administration of the ligand.
(18) Preferred destabilizing domains direct the degradation of a fusion protein in the absence of a stabilizing small molecule. Preferred destabilization domains reduce the amount of fusion protein present in a cell to less than 20%, less than 10%, less than 5%, less than 2% or even less than 1% of the amount of the fusion protein present upon the addition of the stabilizing ligand, or compared to the amount of the naturally-occurring POI (i.e. the native protein, not a fusion protein). In this context, the naturally occurring POI is deleted or disrupted in the genome of the cells or animal in which the conditional protein stability system is used or replaced by a DNA encoding the fusion protein. In this manner, the only source of the POI is the conditionally stabilized fusion protein, allowing its function to be studied in the absence of interfering wildtype/naturally-occurring protein.
(19) In some embodiments, methods for modulating protein, expression, function or level by measuring the stabilization ratio are provided. As used herein, the stabilization ratio may be defined as the ratio of expression, function or level of a protein of interest in response to the ligand to the expression, function or level of the protein of interest in the absence of the ligand specific to the destabilizing domain. In some aspects, the stabilization ratio is at least 1, such as by at least 1-10, 1-20, 1-30, 1-40, 1-50, 1-60, 1-70, 1-80, 1-90, 1-100, 20-30, 20-40, 20-50, 20-60, 20-70, 20-80, 20-90, 20-95, 20-100, 30-40, 30-50, 30-60, 30-70, 30-80, 30-90, 30-95, 30-100, 40-50, 40-60, 40-70, 40-80, 40-90, 40-95, 40-100, 50-60, 50-70, 50-80, 50-90, 50-95, 50-100, 60-70, 60-80, 60-90, 60-95, 60-100, 70-80, 70-90, 70-95, 70-100, 80-90, 80-95, 80-100, 90-95, 90-100 or 95-100.
(20) The position of the POI with respect to the DD, within the fusion protein to achieve optimal DD regulation. In some embodiments, the POI may be fused to the N terminus of the DD. In another embodiment, the POI may be fused to the C terminus of the DDs. In some embodiments, the fusion protein may include more than one POIs fused to one or more DDs.
(21) Destabilizing Domains
(22) As used herein, the term destabilizing domains (DDs), refers to protein domains that are unstable and degraded in the absence of ligand, but whose stability is rescued by binding to a high affinity cell-permeable ligand. Destabilizing domains (DDs) can be fused to a target protein of interest (POI) and can convey its destabilizing property to the protein of interest, causing protein degradation. The presence, absence or an amount of a small molecule ligand that binds to or interacts with the DD, can, upon such binding or interaction modulate the stability of the payload(s) and consequently the function of the payload. A protein domain with destabilizing property (e.g. a DD) is used in conjunction with a cell-permeable ligand to regulate any protein of interest when it is fused with the destabilizing domain. DDs render the attached protein of interest unstable in the absence of a DD-binding ligand such that the protein is rapidly degraded by the ubiquitin-proteasome system of the cell. However, when a specific small molecule ligand binds its intended DD as a ligand binding partner, the instability is reversed and protein function is restored. The conditional nature of DD stability allows a rapid and non-perturbing switch from stable protein to unstable substrate for degradation. Such a destabilization domain may or may not require the interaction of another protein for modulating stability of the POI. In some embodiments, the ligand regulated destabilizing domain merely requires exposure to a small molecule ligand, and does not require the formation of a ternary complex, as does the FKBP-rapamycin-FRB complex. An exemplary species is a single-domain, ligand dependent destabilization domain, wherein the single polypeptide comprises only a single domain (i.e. folded structure or functional unit as determined by X-ray crystallography, protease digestion, and/or computer modeling).
(23) Due to its reversibility, specificity and the fast and easy regulation on protein level, the post-transcriptional tuning system provides a useful system for gene regulation. Furthermore, the regulation may be dose-dependent, thereby altering the protein-turnover rate to transform a short-lived or no detectable protein into a protein that functions for a precisely controlled period of time (Iwamoto et al., Chem. Biol. 2010, 17: 981-988).
(24) Candidate destabilizing domain sequence identified from protein domains of known wildtype proteins (as a template) may be mutated to generate libraries of mutants based on the template candidate domain sequence. Libraries of mutants may be generated by any methods known in the art including error prone polymerase chain reaction and nucleotide analog mutagenesis. Destabilizing domains identified using random mutagenesis may be used to identify structural properties of the candidate DDs that may be required for destabilization, which may then be used to further generate libraries of mutations using site directed mutagenesis.
(25) Human PDE5A Derived DDs
(26) In some embodiments, the DDs of the present compositions and systems are derived from human PDE5A (cGMP-specific phosphodiesterase type 5A) protein. PDE5A is a cGMP selective phosphodiesterase and a member of the cyclic nucleotide phosphodiesterase family. PDE5A specifically hydrolyzes cGMP to 5GMP thereby regulating intracellular concentrations of cyclic nucleotides, a process that is important for smooth muscle relaxation in the cardiovascular system.
(27) In some embodiments, the PDE5A derived destabilizing domains may be derived from variants, and/or isoforms of PDE5A. Three isoforms of PDE5A namely, PDE5A, Isoform 1, PDE5A Isoform 2, and PDE5A Isoform 3 have been identified. These isoforms differ at their N terminal regions, and have unique first exons followed by a common sequence of 823 amino acids. Accordingly, PDE5 derived DDs may be derived from PDE5A, Isoform 1 (SEQ ID NO. 1; encoded by the nucleotide sequence of SEQ ID NO. 2); PDE5A Isoform 2 (SEQ ID NO. 3; encoded by SEQ ID NO. 61 or nucleotides 113-2614 of the nucleotide sequence of SEQ ID NO. 4) and/or PDE5A Isoform 3 (SEQ ID NO. 5; encoded by SEQ ID NO. 62 or nucleotides 95-2566 of the nucleotide sequence of SEQ ID NO. 6).
(28) All PDE5A isoforms contain a catalytic domain that is located near the C terminus of the protein and is relatively selective for cGMP as a substrate at physiological levels. The substrate binding site is also the binding site for several known PDE5 inhibitors such as Sildenafil, which have been utilized to treat cardiovascular diseases and erectile dysfunction. Towards the N terminus, 2 homologous GAF domains are located. One of the GAF domains, GAF-A contains a high affinity binding site for cGMP. Occupancy of this domain by cGMP is known to cause activation of the catalytic domain. Moreover, the affinity of this site for cGMP is increased by cGMP-dependent protein kinase-mediated phosphorylation of serine 92. In another embodiment, the PDE5A derived DD may comprise the catalytic domain of PDE5A, spanning from amino acid position 535 to position 860 of UniProt ID: O76074 (SEQ ID NO. 1), as represented in SEQ ID NO. 7 (encoded by SEQ ID NO. 8). In addition to the catalytic domain, PDE5A derived DDs may also comprise one or more GAF domains and/or the C terminal portion that extends beyond the catalytic domain. In one embodiment, the PDE5A derived DD may consist of amino acids from position 535 to position 875 of SEQ ID NO. 1. In another embodiment, the PDE5A derived DD may consist of amino acids from position 466 to 875 or position 420 to 875 of SEQ ID NO. 1.
(29) The destabilization domains described herein may also include amino acid and nucleotide substitutions that do not affect stability, including conservative, non-conservative substitutions and or polymorphisms. In one embodiment, the PDE5A derived DD may contain a polymorphism at residue 589 of SEQ ID NO. 1, wherein the DD may comprise an arginine residue instead of a glutamine residue and is denoted as Q589R. Additional polymorphisms may include glycine to aspartate substitution at residue 36 of SEQ ID NO. 1, denoted as G36D, and valine to alanine substitution at position 93 of SEQ ID NO. 1, denoted as V93A. In some embodiments, the PDE5 DD may comprise all three polymorphisms, G36D, V93A, Q589R. These polymorphisms are represented in GenBank Accession Number AB527373.1 consisting of the amino acid sequence of SEQ ID NO. 9, (encoded by SEQ ID NO. 10), wherein the annotation of amino acid position and mutation in G36D, V93A, Q589R is with respect to SEQ ID NO. 1. The catalytic domain of PDE5A with the Q589R polymorphism is represented by the amino acid sequence of SEQ ID NO. 11, encoded by the nucleotide sequence of SEQ ID NO. 12. PDE5A derived DDs with Q589R polymorphism described herein may also include amino acids 535-875 of PDE5A with Q589R polymorphism with amino acid sequence of SEQ ID NO. 13 (encoded by SEQ ID NO. 63). In some embodiments the nucleotide sequence of 535-875 of PDE5A may include a stop codon (by SEQ ID NO. 14). In some embodiments the PDE5A derived DDs may include amino acids 466-875 of PDE5A comprising the Q589R polymorphism, and with amino acid sequence of SEQ ID NO. 15 (encoded by SEQ ID NO. 64). In some embodiments, the nucleotide sequence of 466-875 of PDE5A may include a stop codon (SEQ ID NO. 16). In some embodiments, the PDE5A derived DDs may comprise amino acids 420-875 of PDE5A comprising Q589R polymorphism and with amino acid sequence of SEQ ID NO. 17 (encoded by SEQ ID NO. 65). In some embodiments, the nucleotide sequence of 420-875 of PDE5A may include a stop codon (SEQ ID NO. 18).
(30) According to the methods described herein, the inventors of the present disclosure identified several human PDE5A derived destabilizing mutations by random mutagenesis of the catalytic domain of PDE5A. The destabilization of the mutants in the absence of the binding ligand, Sildenafil was tested. Table 1 provides the PDE5A derived destabilizing mutations. The position number of the mutated amino acids listed in Table 1 is relative to the full length human PDE5A of SEQ ID NO. 1. In some embodiments, any of the PDE5A derived DDs may include a methionine at position 1 of the amino acid sequence.
(31) TABLE-US-00001 TABLE1 PDE5DDs Amino Nucleic Acid Acid Clone SEQID SEQID PDE5Amutant NO. Sequence NO. NO. Methionine,535- MEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLET 19 36 860ofPDE5A ALCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYR (Q589R,K633E, KNVAYHNWRHAFNTAQCMFAALKAGEIQNKLTDLE T712S,K852E, ILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI K795E) MEHHHFDQCLMILNSPGNQILSGLSIEEYKTSLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE REELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQEWQALAEQQ Methionine,535- MEGTRELQSLAAAVVPSAQTLKITDFSFSDFELSDLE 20 37 860ofPDE5A TALCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNY (E536G,Q589R, RKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTD C839S) LEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYC HSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKII KQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKE LFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG DRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQ LYEALTHVSEDSFPLLDGCRKNRQKWQALAEQQ Methionine,535- MEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLET 21 38 860ofPDE5A ALCTIRMFTDLNLVQSFRMKHEVLCRWILSVKKNYR (N587S,Q589R, ENVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLE K608E,N661S, ILALLIAALSHDLDHRGVSNSYIQRSEHPLAQLYCHSI D764V) MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACVLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ Methionine,535- MEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLET 22 39 860ofPDE5A ALCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYR (Q589R,L675P, KNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDL F755L) EILALLIAALSHDLDHRGVNNSYIQRSEHPLAQPYCH SIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIK QAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELL LAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDR ERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLY EALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #2 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 23 40 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK D687A,D764N, NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI S815C) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFAQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACNLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPCMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #13 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 24 41 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK Y676D,L738H) NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLDCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFEHIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #28 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 25 42 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMEHEVLCRWILSVKKNYRK K591E,N609H, HVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI D764V) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACVLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #40 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 26 43 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK D764G) NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACGLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #41 EETRELQSLAAAVVPSAQTLKITDFSLSDFELSDLETA 27 44 PDE5A(F561L, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKENYRK Q589R,K604E, NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI D724N,L797F) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATNLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKEFNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #42 DETRELQSLAAAVVPSAQTLRITDFSFSDSELSDLETA 28 45 PDE5A(E535D, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK K555R,F564S, NVAYHNWRHAFNTAQCMFAALRAGKIQNKLTDLEI Q589R,K630R, LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYRHSI C677R,N742S, MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ I799T,M816A) AILATDLALYIKRRGEFFELIRKSQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNTEPTDLMNREKKNKIPSAQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #43 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 29 46 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK N609H,Y676N, HVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI A762S) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLNCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTSCDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #69 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 30 47 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK N636S,D687A, NVAYHNWRHAFNTAQCMFAALKAGKIQSKLTDLEI D764N,S815C) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFAQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACNLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPCMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #19 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 31 48 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWVLSVKKNYR I599V,T711A, KNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDL F744L,L746S, EILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCH L804P) SIMEHHHFDQCLMILNSPGNQILSGLSIEEYKATLKIIK QAILATDLALYIKRRGEFFELIRKNQLNSEDPHQKELF LAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDR ERKELNIEPTDPMNREKKNKIPSMQVGFIDAICLQLY EALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #35 EETRELQSLAAAVVPSAQTLKITDFGFSDFELSDLETA 32 49 PDE5A(S560G, LCTIRMFTDLNLAQSFRMEHEVLCRWILSVKKNYRK V585A,N587S, NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI Q589R,K591E, LALLIAALSHDLDHRGVNNPYIQRSEHPLAQLYCHSI S663P,F840S) MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCSPLLDGCRKNRQKWQALAEQQ 535-860of #55 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 33 50 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK I648V,M816T) NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI LALLVAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSTQVGFIDAICLQLYEA LTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #8 EETRELQSLAAAVVPSAQTLKITDFSLSDLELSDLETA 34 51 PDE5A(F561L, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK F564L,Q589R, NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI D724N,S766F, LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI T802P) MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATNLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLFAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPPDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #25 EETRELRSLAAAVVPSAQTLKITDLSFSDFELSDLETA 35 52 PDE5A(Q541R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK F559L,Q589R, NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI H678R,I824T) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCRSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDATCLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #3 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 66 70 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK K633E,T712S, NVAYHNWRHAFNTAQCMFAALKAGEIQNKLTDLEI K852E,K795E) LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTSLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE REELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQEWQALAEQQ 535-860of #53 EGTRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 67 71 PDE5A(E536G, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK Q589R,C839S) NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI LALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDSFPLLDGCRKNRQKWQALAEQQ 535-860of #57 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 68 72 PDE5A(N587S, LCTIRMFTDLNLVQSFRMKHEVLCRWILSVKKNYRE Q589R,K608E, NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI N661S,D764V) LALLIAALSHDLDHRGVSNSYIQRSEHPLAQLYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFL AMLMTACVLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ 535-860of #30 EETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETA 69 73 PDE5A(Q589R, LCTIRMFTDLNLVQNFRMKHEVLCRWILSVKKNYRK L675P,F755L) NVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEI LALLIAALSHDLDHRGVNNSYIQRSEHPLAQPYCHSI MEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQ AILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELLL AMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRE RKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYE ALTHVSEDCFPLLDGCRKNRQKWQALAEQQ
(32) In some embodiments, the DDs derived from PDE5A may comprise one, two, three, four, five or more mutations to the catalytic domain of PDE5A selected from E535D, E536G, Q541R, K555R, F559L, S560G, F561L, F564L, F564S, V585A, N587S, K591E, I599V, K604E, K608E, N609H, K630R, K633E, N636S, I648V, N661S, S663P, L675P, S766F, Y676D, Y676N, C677R, H678R, D687A, T711A, T712S, D724N, L738H, N742S, F744L, L746S, F755L, A762S, D764V, D764N, D764G, K795E, L797F, I799T, L804P, T802P, S815C, M816A, M816T, I824T, C839S, F840S, and K852E.
(33) The amino acid sequences of the destabilizing domains, in some embodiments, have at least about 40%, 50 or 60% identity, further at least about 70% identity, preferably at least about 75% or 80% identity, more preferably at least about 85%, 86%, 87%, 88%, 89% or 90% identity, and further preferably at least about 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to the amino acid sequence set forth therein. Percent identity may be determined, for example, by comparing sequence information using the advanced BLAST computer program, including version Magic-BLAST 1.2.0, available from the National Institutes of Health. The BLAST program is based on the alignment method discussed in Karl and Altschul (1990) Proc. Natl. Acad. Sci USA, 87:2264-68 (the contents of which are incorporated by reference in their entirety). Accordingly, PDE5A sequence of SEQ ID NO. 1 was analyzed using BLAST and sequences that demonstrated up to 40% homology were identified. This analysis identified Phosphodiesterase 11 isoform 1, Phosphodiesterase 11 isoform 2, Phosphodiesterase 11 isoform 3 and Phosphodiesterase 11 isoform 4 which bear approximately 40% homology to PDE5A. DDs may in some instances be derived from PDE11 isoforms.
(34) In some embodiments, PDE5A derived destabilizing domains may be identified by the method of walk-through mutagenesis. The method of walk through mutagenesis consists of introducing a predetermined amino acid in to each position in a predefined region (or several different regions) of the amino acid sequence of a parent polypeptide. A PDE5A protein library is generated which contains multiple mutant PDE5A proteins, each having the predetermined amino acid in one or more positions in the region and collectively, in every position in the region. In some embodiments, predetermined regions selected for mutagenesis may include regions of PDE5A which are enriched for destabilizing mutations. In some embodiments, the predetermined region for mutagenesis may be selected from a portion of PDE5A of SEQ ID NO. 1, wherein the predetermined region spans from 531-541, position 555-564, position 587-591, position 604-609, position 630-636, position 674-678, position 762-766, position 795-797; a position 809-816 or any combination of thereof. This method allows for systematic evaluation of the role of a specific amino acid in the ligand dependent stabilization. Walk through mutagenesis methods are described in further detail in U.S. Pat. Nos. 6,649,340, 5,830,650, and 5,798,208 (the contents of which are incorporated by reference in their entirety).
(35) Amino acid substitutions utilized for methods described herein may be conservative or non-conservative substitutions. Conservative amino acid substitutions may be made in the amino acid sequences described herein to obtain derivatives of the peptides that may advantageously be utilized. Conservative amino acid substitutions, as known in the art and as referred to herein, involve substituting amino acids in a protein with amino acids having similar side chains in terms of, for example, structure, size and/or chemical properties. For example, the amino acids within each of the following groups may be interchanged with other amino acids in the same group: amino acids having aliphatic side chains, including glycine, alanine, valine, leucine and isoleucine; amino acids having acidic side chains, such as aspartic acid and glutamic acid; amino acids having acidic side chains, including glutamine and asparagine; basic amino acids, including lysine, arginine and histidine; amino acids having aromatic ring side chains, including phenylalanine, tyrosine, and tryptophan; and amino acids having sulfur containing side chains, including cysteine and methionine. Additionally, amino acids having acidic side chains, such as aspartic acid and glutamic acid, can often be substituted with amino acids having amide side chains such as asparagine and glutamine.
(36) The destabilizing domains may also be fragments of the above described destabilizing domains, including fragments containing variant amino acid sequences. Preferred fragments are unstable in the absence of a stabilizing ligand and stabilized by the presence of ligand. Such fragments are readily identified using assays described herein. Preferred fragments retain the ability to bind to a stabilizing ligand with similar efficiency to the destabilizing domains described herein or with at least 90% efficiency, or at least 80% efficiency, at least 70% or at least 50% efficiency with respect to the described destabilizing domains. Preferred destabilizing domains may be fused at the N terminus or C terminus of a POI.
(37) Ligands
(38) Stabilizing ligands for use include Sildenafil (i.e. 5-[2-ethoxy-5-(4-methylpiperazin-1-yl) sulfonylphenyl]1-1-methyl-3-propyl-4H-pyrazolo[4,3-d] pyrimidin-7-one), a commercially available PDE5A inhibitor. In some embodiments, ligands known to bind to full length or a portion of PDE5A may be utilized as stabilizing ligands. For example, stabilizing ligands may include but are not limited to known PDE5A inhibitors, including Vardenafil, Tadalafil, Avanafil, Lodenafil, Mirodenafil, Udenafil, Benzamidenafil, Dasantafil, and Beminafil. Other stabilizing ligands that may be useful include Sildenafil-derived ligands containing portions of the ligand known to mediate binding to PDE5A. Ligands may also be modified to reduce off-target binding to Phosphodiesterases and increase specific binding to PDE5A. Stabilizing ligands may also be selected through the analysis of the dependence of the stabilizing capability of the ligand on its chemical structure, through Structure Activity Relationships (SAR) studies. Any of the methods related to SAR, known in art may be utilized to identify stabilizing ligands.
(39) Proteins of Interest
(40) In some embodiments, proteins of interest may be a natural protein in an organism genome, or variants, mutants, derivatives thereof. The natural protein may be from, for example, a mammalian organism, a bacterium, and a virus. In one example, the protein of interest, or a polypeptide may be derived from human genome.
(41) In some embodiments, the proteins of interest may be selected from, but are not limited to enzymes, structural proteins, signaling proteins, regulatory proteins, transport or carrier proteins, sensory proteins, motor proteins, immune proteins, and storage proteins.
(42) Proteins of interest may also be selected from any known reporter protein, which refers to any protein capable of creating a detectable signal, in response to an input. Examples include alkaline phosphatase, -galactosidase, chloramphenicol acetyltransferase, -glucuronidase, peroxidase, (-lactamase, catalytic antibodies, bioluminescent proteins e.g. luciferase, and fluorescent proteins such as Green fluorescent protein (GFP).
III. Methods, Cells and Transduced Animals
(43) Also disclosed is method for conditionally stabilizing a protein of interest, which consists of fusing a nucleic acid encoding the protein of interest fused in-frame to a nucleic acid encoding a destabilizing domain, optionally in combination with one or more of the substitutions identified herein. In one example, the cells are transfected with nucleic acids encoding a fusion protein comprising a protein of interest fused in frame to a variant PDE5A protein. Expression of the DD fusion protein may be driven by the endogenous promoter, ideally reproducing the spatial and temporal expression patterns of the unmodified gene.
(44) The cells may be transfected, e.g. using an expression vector or transduced (i.e. infected) using a viral vector, including, but not limited to a vector derived from a retrovirus (e.g. a lentivirus), herpesvirus, pox virus, adenovirus, adeno-associated virus, or an RNA virus, such as poliovirus, flavivirus, alphavirus or the like. The exemplary viral vector is a retrovirus.
(45) The cells may be eukaryotic cells, including but not limited to cells from humans, primates, rodents, and other animals, including domesticated animals. The cells may also be from plants, insects, amphibians, and apicomplexan parasites. The cells may be in culture or in a living organism. The wild-type or naturally occurring gene or allele encoding the POI may be deleted to facilitate study of the conditionally stabilized POI.
(46) The present methods and compositions also allow the creation of transgenic animals harboring engineered alleles that direct the expression of a ligand stabilized POI. Expression of the DD fusion protein may be driven by the endogenous promoter ideally reproducing the spatial and temporal expression patterns of the unmodified gene. The ligand may be administered regularly from an early age (including in utero) to stabilize the fusion protein until the mice achieve a specified age, at which time, withdrawal of the ligand results in a rapid degradation of the fusion protein. Unlike Cre-mediated gene disruption, this method is reversible, such that simply reinitiating the administration of the ligand, allows the rapid, reversible and conditional control of protein function in a complex system.
(47) The ability to specifically and conditionally stabilize a POI in a cell will enable the study of many proteins to determine their biological function and importance in a cell. The present methods and compositions represent a significant improvement over current methods of conditional protein regulation.
IV. Definitions
(48) Approximately: As used herein, the term approximately or about, as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term approximately or about refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
(49) Associated with: As used herein, the terms associated with, conjugated, linked, attached, and tethered, when used with respect to two or more moieties, mean that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serve as linking agents, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions. An association need not be strictly through direct covalent chemical bonding. It may also suggest ionic or hydrogen bonding or a hybridization based connectivity sufficiently stable such that the associated entities remain physically associated.
(50) Conservative amino acid substitutions: As used herein, a conservative amino acid substitutions are substitutions that do not result in a significant change in the activity or tertiary structure of a selected polypeptide or protein. Such substitutions typically involve replacing a selected amino acid residue with a different residue having similar physico-chemical properties. For example, substitution of glutamine for aspartate is considered a conservative substitution since both are similarly-sized negatively-charged amino acids. Groupings of amino acids by physico-chemical properties are known to those of skill in the art.
(51) Domain: As used herein, the terms domain and region are used interchangeably herein and refer to a contiguous sequence of amino acids within a POI or destabilizing domain, typically characterized by being either conserved or variable and having a defined function, such as ligand binding, conferring stability or instability, enzymatic function, etc.
(52) Degradation: As used herein, degradation or destruction of a protein means its hydrolysis into smaller proteins or amino acids, such as by the cellular proteasome.
(53) Destabilized: As used herein, the term destable, destabilize, destabilizing region or destabilizing domain means a region or molecule that is less stable than a starting, reference, wild-type or native form of the same region or molecule.
(54) Expression: As used herein, expression of a nucleic acid sequence refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5 cap formation, and/or 3 end processing); (3) translation of an RNA into a polypeptide or protein; (4) folding of a polypeptide or protein; and (5) post-translational modification of a polypeptide or protein.
(55) Fused: As used herein, fused means arranged in-frame as part of the same contiguous sequence of amino acids in a polypeptide. Fusion can be direct such that there are no additional amino acid residues or via a linker to improve performance or add functionality.
(56) Homologous: Two amino acid sequences or two nucleotide sequences are considered homologous if they have an alignment score of >5 (in standard deviation units) using the program ALIGN with the mutation gap matrix and a gap penalty of 6 or greater (Dayhoff, M. O., in Atlas of Protein Sequence and Structure (1972) Vol. 5, National Biomedical Research Foundation, pp. 101-110, and Supplement 2 to this volume, pp. 1-10.) The two sequences (or parts thereof) are more preferably homologous if their amino acids are greater than or equal to 50%, 70%, 80%, 90%, 95%, or even 98% identical when optimally aligned using the ALIGN program mentioned above.
(57) In vitro: As used herein, the term in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
(58) In vivo: As used herein, the term in vivo refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
(59) Introduction of nucleic to cells: As used herein, introduction of nucleic to cells means transfection, transduction (infection), or transformation of nucleic acids (e.g., DNA) into cells, such that the nucleic acids may be used by the cell to express a protein of interest.
(60) Modulate: Modulate intends a lessening, an increase, or some other measurable change, e.g., in the stability or biological function of a protein.
(61) Mutant: As used herein, a mutant is a mutated protein designed or engineered to alter properties or functions relating to protein stabilization and/or ligand binding.
(62) Protein of interest (POI): As used herein, a protein of interest or POI is any protein, or functional fragment or derivative, thereof, that one skilled in the art wishes to study.
(63) Preferentially binds: As used herein, preferentially binds means to bind with greater efficiency to a subject molecule (such as a particular amino acid sequence) than another molecule. The difference in binding efficiency may be 5-fold, 10-fold, 50-fold, 100-fold, 500-fold, 1,000-fold, 10,000-fold, or more.
(64) PDE5A variant: PDE5A variant refers to a protein wherein one or more amino acid residues, are substituted for an amino acid other than the amino acid in the PDE5A (SEQ ID NO. 1). Other amino acid positions that can be substituted are indicated in the Tables and Figures.
(65) Protein: As used herein, the terms protein and polypeptide are used interchangeably and without distinction to refer to a compound made up of a chain of amino acid residues linked by peptide bonds. Unless otherwise indicated, the sequence for peptides is given in the order from the N (or amino) terminus to the C (or carboxyl) terminus. It is understood that polypeptides include a contiguous sequence of amino acid residues.
(66) Peptide: A peptide or peptide fragment is derived from a parent peptide or polypeptide if it has an amino acid sequence that is homologous to, but not identical to, the parent peptide or polypeptide, or of a conserved fragment from the parent peptide or polypeptide.
(67) Small molecule ligand: A small molecule ligand is a discrete small-molecule, well known in the pharmaceutical and material sciences, which is to be distinguished from, e.g., a polypeptide or nucleic acids, which is a polymer consisting of monomeric subunits. Small molecule ligands may be naturally-occurring or synthetic as exemplified by pharmaceutical products, laboratory reagents, and the like.
(68) Stable: As used herein stable refers to a compound or entity that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and preferably capable of formulation into an efficacious therapeutic agent.
(69) Stabilized: As used herein, the term stabilize, stabilized, stabilized region means to make or become stable. In some embodiments, stability is measured relative to an absolute value. In some embodiments, stability is measured relative to a secondary status or state or to a reference compound or entity.
(70) Variant: As used herein, a variant protein is a protein having an amino acid sequence that does not occur in nature, as exemplified by sequences in GenBank.
V. Kits of Parts
(71) The methods and compositions described herein may be packaged together with instructions for use, as in a kit of parts. Preferred kits of parts include a PDE5A variant, a stabilizing ligand, and instructions for use. The PDE5A variant may include a substitution described herein, or may include other substitutions identified using the methods decried herein. The stabilizing ligand may be as described herein or a variant or derivative that functions in a similar manner. Instructions may include the nucleotide sequences of a plasmid encoding a PDE5A variant and instructions and guidelines for inserting (i.e. cloning) a POI into the plasmid-in frame with the PDE5A variant. The instructions may also include dosing recommendations and hardware such as syringes, to deliver the fusion protein to an organism or to cells.
EXAMPLES
Example 1
PDE5A Library Generation
(72) Diversity in the PDE5A catalytic domain sequence (Q589R) (SEQ ID NO. 11) was generated using a combination of error-prone PCR and nucleotide analog mutagenesis. Primers for mutagenic PCR were designed to anneal upstream of the 5 restriction site to be used for cloning the mutagenesis products into pBMN iHcRed-tandem retroviral expression vector and to anneal downstream of the 3 restriction site. Three independent conditions were used to generate diversity. Condition set A utilized 4 ng template, 0.5 M of each oligonucleotide primer, 5 units Taq polymerase, 5 mM MgCl.sub.2, 0.2 mM MnCl.sub.2, 0.4 mM dNTPs in equal ratio, and an excess of 0.2 mM dATP and dCTP. Condition set B was identical to A, except that dGTP and dTTP were present in excess. Condition set C utilized the non-natural nucleotides 8-oxo-dGTP and dPTP to encourage nucleotide mis-incorporation. The PDE5A libraries were pooled and ligated into the pBMN iHcRed-t retroviral expression vector, affording a library containing approximately 310.sup.4 members.
Example 2
Cell Culture and Transduction
(73) The NIH3T3 cell line was cultured in DMEM supplemented with 10% heat-inactivated donor bovine serum (Invitrogen), 2 mM glutamine, 100 U/ml penicillin and 100 g/ml streptomycin.
(74) The NX ecotropic packaging cell line was transfected using standard Lipofectamine 2000 protocols. Viral supernatants were harvested 48 hours, post transfection, filtered and concentrated 10-fold using Amicon Ultra centrifugal filter device with a 100kDa cutoff. NIH 3T3 cells were incubated with concentrated retroviral supernatants supplemented with 4 g/ml polybrene for 4 hours at 37 C. Cells were washed once with PBS and cultured in growth media for 24-36 hours to allow for viral integration.
Example 3
Fluorescence-Activated Cell Sorting (FACS)
(75) The transduced NIH3T3 cells were subjected to analysis using fluorescence-activated cell sorting (FACS) to screen the libraries of PDE5A mutants. 24 hours prior to analysis, transduced NIH3T3 cells were plated at 110.sup.5 cells per well of a 12-well plate. Cells were removed from the plate using PBS and 2 mM EDTA, washed once with PBS, and resuspended in 200 L, PBS. FACS analysis was performed on instruments at the Stanford Shared FACS Facility with 10,000 events represented.
Example 4
Cell-Based Screening Assay
(76) To identify destabilizing domains that are responsive to the PDE5A ligand, Sildenafil, a cell-based screening assay was employed in which the fluorescence of green fluorescent protein derived from Aequorea coerulescens (AcGFP) served as an indicator of PDE5A stability. A library based on the PDE5A catalytic domain sequences was generated using error prone PCR and then cloned in-frame in front of AcGFP. A Moloney murine leukemia retroviral expression was used to stably integrate this library of PDE5A-AcGFP fusions into NIH-3T3 fibroblasts, and the transduced cells were subjected to three rounds of sorting using flow cytometry. In the first round, cells were treated with 10 M of PDE5A ligand, Sildenafil for 16-24 before analysis. Fluorescent cells were collected and further cultured in the absence of ligand for 60 hours. Analysis revealed that approximately 5% of the cell population exhibited decreased fluorescence levels indicating that most the sequences were either unmutated or contained mutations that did affect the stability of the fusion protein. This small population of cells exhibiting decreased fluorescence was collected and cultured once more in the presence of 10 M Sildenafil for 24 hours, at which time AcGFP-expressing cells were collected and the genomic DNA was isolated.
Example 5
Identification of C-Terminal PDE5A-Derived Destabilizing Domains
(77) A library of AcGFP-PDE5A fusions i.e., C-terminal PDE5A mutants was screened using the cell-based screening assay described previously to identify C-terminal destabilizing domains. Several clones that exhibited desired characteristics, i.e., low basal expression in the absence of ligand and high expression in the presence of ligand were selected that. Identified candidates were subjected to further characterization by FACS. Cells were split into two treatment groups and incubated with either Sildenafil (10 M) or vehicle alone for 24 hours. Cells that were mock transduced or transduced with the wild-type PDE5A construct were also included in the analysis. The stabilization ratio was calculated as the fold change in GFP intensity of the AcGFP-PDE5A construct in Sildenafil treated sample compared to vehicle alone treated sample. The results are presented in Table 2 where the C terminal PDE5A mutants are denoted as PDE5AC. Among the identified mutants, PDE5AC (#2) and PDE5AC (#41) showed stabilization ratios greater than 6 suggesting strong ligand dependent stabilization.
(78) TABLE-US-00002 TABLE 2 FACS analysis of C-terminal PDE5A mutants Mean Sildenafil Fluorescence Stabilization Clone No. (10 M) intensity ratio NIH3T3 control 345 PDE5AC Wild- 9520 0.9 type + 8797 PDE5AC (#2) 1023 6.5 + 6577 PDE5AC (#8) 1066 3.1 + 3310 PDE5AC (#13) 1076 5.8 + 6284 PDE5AC (#25) 1452 1.6 + 2340 PDE5AC (#28) 1382 4.4 + 6055 PDE5AC (#40) 1255 4.7 + 5923 PDE5AC (#41) 1000 6.1 + 6115 PDE5AC (#42) 1658 3.5 + 5861 PDE5AC (#43) 1017 5.4 + 5518 PDE5AC (#69) 1126 5.6 + 6365
(79) Identified PDE5A mutants were further validated using immunoblot analysis. NIH3T3 cells expressing AcGFP-PDE5A fusions were incubated with 10 M Sildenafil or vehicle alone for 24 hours and the stability of PDE5A mutants was evaluated at the protein level. Cell lysates obtained from transduced NIH3T3 cells were immunoblotted using the anti-XFP antibody (1:3000) at 4 C. overnight. Samples were also immunoblotted with anti-GAPDH antibody (1:10000) to ensure uniform protein loading. Samples were then incubated with secondary anti-mouse antibody (1:3000) at room temperature for 1 hour, followed by visualization using appropriate methods. Immunoblot results are presented in
(80) Identified PDE5A mutants were sequenced and sequences were compared to the wild-type sequence of human PDE5A catalytic domain to identify mutations. The mutations identified are shown in Table 3 where the C terminal PDE5A mutants are denoted as PDE5AC. The number of amino acid mutations was calculated based on the wildtype PDE5A amino acid sequence of SEQ ID NO. 1.
(81) TABLE-US-00003 TABLE 3 Sequence analysis of C-terminal PDE5A mutants No. of amino Protein acid SEQ ID Clone No. mutations Amino acid mutations NO. PDE5AC (#2) 4 Q589R, D687A, D764N, S815C 23 PDE5AC (#13) 3 Q589R, Y676D, L738H 24 PDE5AC (#28) 4 Q589R, K591E, N609H, D764V 25 PDE5AC (#40) 2 Q589R, D764G 26 PDE5AC (#41) 5 F561L, Q589R, K604E, D724N, 27 L797F PDE5AC (#42) 9 E535D, K555R, F564S, Q589R, 28 K630R, C677R, N742S, I799T, M816A PDE5AC (#43) 4 Q589R, N609H, Y676N, A762S 29 PDE5AC (#69) 5 Q589R, N636S, D687A, D764N, 30 S815C PDE5AC (#8) 5 F561L, F564L, Q589R, D724N, 34 S766F, T802P PDE5AC (#25) 5 Q541R, F559L, Q589R, H678R, 35 I824T
(82) Sequence analysis (see Table 3) revealed that residue D764 as a frequently mutated residue. D764G alone in Clone 40 induced 4.7-fold of ligand dependent stabilization, suggesting that it may be important for PDE5A protein stability. The error prone mutagenesis also introduced several silent mutations which was evident by the analysis of the nucleotide sequence.
Example 6
Optimization of C-Terminal PDE5A Mutants
(83) Identified C-terminal PDE5A mutants were further optimized to improve ligand dependent stabilization properties. Additional point mutations or linker sequences were evaluated for their effect on PDE5A mutant characteristics.
(84) D764 Mutation
(85) Residue D764 was identified as a mutational hotspot from sequence analysis. PDE5AC (#41) was engineered with either D764N or D764G mutation via site-directed mutagenesis. PDE5AC (#41) +D764N comprises the amino acid sequence of SEQ ID NO. 53 (encoded by SEQ ID NO. 54) and PDE5AC (#41) +D764G comprises the amino acid sequence of SEQ ID NO. 55 (encoded by SEQ ID NO. 56). AcGFP-PDE5A variants were evaluated for Sildenafil dependent stabilization via FACS as described previously. Results from FACS analysis are presented in Table 4 where the C terminal PDE5A mutants are denoted as PDE5AC. The stabilization ratio was calculated as the fold change in GFP intensity of the AcGFP-PDE5A construct in Sildenafil treated sample compared to vehicle alone treated sample.
(86) TABLE-US-00004 TABLE 4 Effect of D764 mutations Mean Sildenafil Fluorescence Stabilization Clone No. (10 M) intensity ratio NIH3T3 control 303 Wild-type 6992 1.0 + 7093 PDE5AC (#2) 671 5.2 + 3483 PDE5AC (#40) 917 4.6 + 4229 PDE5AC (#41) 734 6.3 + 4647 PDE5AC (#41) + 709 1.0 D764G + 730 PDE5AC (#41) + 684 1.5 D764N + 1007
(87) The results in Table 4, show that addition of D764G or D764N to PDE5AC (#41) did not improve its ligand dependent stabilization but rather abolished its responsiveness to Sildenafil as indicated by a reduction in the stabilization ration upon addition of ligand. These data show that effect of the mutations at the D764 position is dependent on the context of other mutations present on PDE5A. The combination of mutations in PDE5AC (#41), requires further optimization.
(88) Protein Tags
(89) A hemagglutinin (HA) sequence (SEQ ID NO. 74; encoded by SEQ ID NO. 75) was cloned in-frame at either the 5- or 3-ends of the PDE5A mutant sequence from PDE5AC (#41). The construct further included AcGFP (amino acids 1-239 of WT) at the N terminus (SEQ ID NO. 76, encoded by SEQ ID NO. 77) and an EF linker/EcoRI restriction site (GAATTC). The resulting fusion protein adopts either the AcGFP (1-239 of WT)-EF linker-HA-PDE5AC-stop (#41) configuration with an amino acid sequence of SEQ ID NO. 57 (encoded by SEQ ID NO. 58) or AcGFP-EF-Linker-PDE5AC (#41)-HA-stop configuration with an amino acid sequence of SEQ ID NO. 59 (encoded by SEQ ID NO. 60). The effect of the HA sequence on ligand dependent stabilization was evaluated via immunoblot analysis. The transduced NIH3T3 cells were incubated with 10 M Sildenafil or vehicle alone for 24 hours. Cell lysates obtained from transduced NIH3T3 cells were immunoblotted using either the anti-XFP antibody (1:3000) or anti-HA antibody (1:2000). As show in
Example 7
Evaluation of Extended PDE5A Variants
(90) Extended versions of human PDE5A that included residues in addition to catalytic domain (residues 535-860 of SEQ ID NO. 1) with Q589R polymorphism (SEQ ID NO. 11) were evaluated for use as C-terminal destabilizing domains. Three extended PDE5A sequences were tested that consisted of residues 535-875 of SEQ ID NO. 1 with Q589R polymorphism (SEQ ID NO. 13); residues 466-875 of SEQ ID NO. 1 with Q589R polymorphism (SEQ ID NO. 15); or residues 420-875 of SEQ ID NO. 1 with Q589R polymorphism (SEQ ID NO. 17). These PDE5A sequences were cloned to the 3 end of AcGFP and the AcGFP fusions were assessed for ligand dependent stabilization using FACS as described previously. Results of FACS analysis are presented in Table 5 where the C terminal PDE5A mutants are denoted as PDE5AC. The stabilization ratio was calculated as the fold change in GFP intensity of the AcGFP-PDE5A construct in Sildenafil treated sample compared to vehicle alone treated sample.
(91) TABLE-US-00005 TABLE 5 FACS analysis of extended PDE5A variants Mean Sildenafil Fluorescence Stabilization Construct (10 M) intensity ratio NIH3T3 control 409 PDE5AC 535-860 8431 1.0 (Q589R) + 8557 PDE5AC 535-875 6761 1.0 (Q589R) + 6462 PDE5AC 466-875 819 1.1 (Q589R) + 888 PDE5AC 420-875 620 0.9 (Q589R) + 572
(92) The extended PDE5A variants displayed reduced stability in the absence of Sildenafil compared to the PDE5A catalytic domain (535-860) (Q589R). The reduction was most substantial in PDE5AC 466-875 (Q589R) and PDE5AC 420-875 (Q589R). However, none of the extended PDE5A variants showed ligand responsive stabilization in the presence of Sildenafil. Further, PDE5AC (466-875) (Q589R) and PDE5AC (420-875) (Q589R) showed low basal expression in the absence of ligand while PDE5AC (535-860) (Q589R) and PDE5AC (535-875) (Q589R) showed high basal expression in the absence of ligand. These data show that PDE5AC (535-860) (Q589R) and PDE5AC (535-875) (Q589R) may be suitable for screening and identification of mutations that destabilize PDE5AC since they have high basal expression. This analysis may be utilized in combination with the mutagenesis analysis to identify additional destabilizing domains.
Example 8
Sildenafil Dose Dependency
(93) NIH3T3 cells expressing AcGFP-PDE5A variants were incubated with varying concentrations of Sildenafil ranging from 0.003 M to 30 M. The stability of PDE5A mutants was measured using FACS and mean fluorescence intensity (MFI) of GFP was calculated. Maximum MFI was observed at highest Sildenafil concentration. Percentage of max MFI (%) was calculated as the ratio of the MFI at a ligand concentration compared to the maximum MFI. Percentage of max MFI was plotted against the concentration of Sildenafil presented in a log scale. Titration curves of PDE5AC (#2) and PDE5AC (#41) are presented in
Example 9
Identification of N-Terminal PDE5A-Derived Destabilizing Domains
(94) A library of PDE5A-AcGFP fusions i.e., N-terminal PDE5A mutants, was screened using the cell-based screening assay described previously to identify N-terminal destabilizing domains. Several clones were selected that exhibited desired characteristics, i.e., low basal expression in the absence of ligand and high expression in the presence of ligand. Identified candidates were subjected to further characterization by FACS. Cells were split into two treatment groups and incubated with either Sildenafil (20 M) or vehicle alone for 24 hours. Cells that were mock transduced or transduced with the wild-type PDE5A construct were also included in the analysis. The results are presented in Table 6 where the N terminal PDE5A mutants are denoted as PDE5AN. The stabilization ratio was calculated as the fold change in GFP intensity of the PDE5A-AcGFP construct in Sildenafil treated sample compared to vehicle alone treated sample.
(95) TABLE-US-00006 TABLE 6 FACS analysis of N-terminal PDE5A mutants Mean Fluorescence Intensity (MFI) Vehicle Sildenafil Stabilization Construct control (20 M) Ratio 3T3 234 PDE5AN (#51) 1603 1543 0.96 PDE5AN (#64) 991 966 0.97 PDE5AN (#52) 224 219 0.98 PDE5AN (#36) 230 230 1.00 PDE5AN (#56) 1052 1054 1.00 PDE5AN (#4) 213 218 1.02 PDE5AN (#46) 217 227 1.05 PDE5AN (#28) 468 501 1.07 PDE5AN (#61) 219 235 1.07 PDE5AN (#42) 223 240 1.08 PDE5AN (#62) 210 227 1.08 PDE5AN (#17) 204 224 1.10 PDE5AN (#10) 1157 1279 1.11 PDE5AN (#14) 206 228 1.11 PDE5AN (#32) 933 1074 1.15 PDE5AN (#43) 3407 4372 1.28 PDE5AN (#18) 3199 4523 1.41 PDE5AN (#24) 1603 2290 1.43 PDE5AN (#59) 535 1051 1.96 PDE5AN (#41) 920 1877 2.04 PDE5AN (#9) 1007 2215 2.20 PDE5AN (#50) 960 2113 2.20 PDE5AN (#1) 1488 3508 2.36 PDE5AN (#35) 1476 3684 2.50 PDE5AN (#11) 1143 2875 2.52 PDE5AN (#53) 1697 4440 2.62 PDE5AN (#19) 1502 4297 2.86 PDE5AN (#55) 1257 3602 2.87 PDE5AN (#26) 712 2633 3.70 PDE5AN (#3) 839 3335 3.97 PDE5AN (#30) 1056 4713 4.46 PDE5AN (#57) 770 5851 7.60
(96) Among the analyzed mutants, PDE5AN (#57) exhibited highest stabilization ration of 7.6 indicating a strong stabilization as a result of low GFP intensity in the absence of ligand and high GFP intensity in the presence of ligand. A stabilization ratio greater than 1 was observed with all constructs except PDE5AN (#51), PDE5AN (#64), PDE5AN (#52), PDE5AN (#36), and PDE5AN (#56) indicating some level of ligand induced stabilization. Select PDE5A mutants were sequenced and sequences were compared to the wild-type sequence of human PDE5A catalytic domain to identify mutations. Sequence analysis (see Table 7) reveals point mutations different from those in the C-terminal mutants. Interestingly, a D764V mutation also was identified in PDE5AN (#57), highlighting its role in PDE5A structural stability. The number of amino acid mutations in Table 7 was calculated based on the wildtype PDE5A amino acid sequence of SEQ ID NO. 1.
(97) TABLE-US-00007 TABLE 7 Sequence analysis of N-terminal PDE5A mutants No. of amino Protein acid SEQ ID Clone No. mutations Amino acid mutations NO. PDE5AN (#3) 5 Q589R, K633E, T712S, 66 K852E, K795E PDE5AN (#53) 3 E536G, Q589R, C839S 67 PDE5AN (#57) 5 N587S, Q589R, K608E, 68 N661S, D764V PDE5AN (#30) 3 Q589R, L675P, F755L 69 PDE5AN (#19) 6 Q589R, I599V, T711A, 31 F744L, L746S, L804P PDE5AN (#35) 7 S560G, V585A, N587S, 32 Q589R, K591E, S663P, F840S PDE5AN (#55) 3 Q589R, I648V, M816T 33
Example 10
Comparison of N-Terminal and C-Terminal PDE5A-Derived Destabilizing Domains
(98) The ability of PDE5A derived DDs to destabilize a protein of interest may depend on the position whether the DD is appended to the N terminus or the C terminus of the protein of interest. Mutant #2, and mutant #41 were appended either to the N terminus or C terminus of AcGFP and analyzed using the cell-based screening assay described previously to identify destabilizing domains. Cells were split into two treatment groups and incubated with either Sildenafil (10 M) or vehicle alone for 24 hours. Cells that were mock transduced or transduced with the N terminal fused wild-type PDE5A or PDE5AN (#40) constructs were also included in the analysis. The results are presented in Table 8 where the C terminal PDE5A mutants are denoted as PDE5AC and N terminal PDE5A mutants are denoted as PDE5AN.
(99) TABLE-US-00008 TABLE 8 N-terminal Vs. C-terminal PDE5A derived DD Mean FITC-A Sildenafil Construct DMSO (10 M) 3T3 Parental cells 571 PDE5AN (#2) 1271 2298 PDE5AC (#2) 1342 5030 PDE5AN (#41) 1284 1473 PDE5AC (#41) 1443 4620 PDE5AN (WT) 7519 8012 PDE5AN (#40) 1438 1949
(100) The stabilization ratio was calculated as the fold change in GFP intensity of the AcGFP-PDE5A construct in Sildenafil treated sample compared to vehicle alone treated sample. The ratios are presented in Table 9.
(101) TABLE-US-00009 TABLE 9 PDE5 DD comparative analysis Stabilization Ratio N terminus C terminus Construct fusion fusion #2 1.8 3.75 #41 1.15 3.2
(102) As shown in Table 9, the stabilization ratios obtained with C terminus fusion proteins was much higher that N terminus fusion proteins. Construct #2 however did show modest ligand dependent stabilization when appended to the N terminus of the protein of interest. These data show that the ability of a particular DD mutant to stabilize or destabilize a protein of interest may depend on the positioning of the DD with respect to the protein.
Example 11
Response of PDE5A-Derived Destabilizing Domains to Vardenafil, Tadalafil and Sildenafil
(103) Mutations were created in PDE5A (535-860) catalytic domain using site directed mutagenesis and the mutants were cloned as AcGFP fusion into pELNS vector carrying mCherry marker and packaged in lentiviral vectors. HCT116 cells were transduced with the constructs and stable integrants were selected by cell sorting using mCherry marker. Cells were treated with vehicle (dimethyl sulfoxide, DMSO) or 10 M Vardenafil (VDF) for 48 hours. Following the treatment, cells were analyzed for GFP expression using FACS. Basal expression was calculated as the ratio of GFP signal in the absence of ligand for a given cell line to auto fluorescence of parental HCT-116 cells. Stabilization ratio was calculated as the ratio of the GFP signal observed in the presence of stabilizing ligand to the signal from the same cell line in the absence of ligand. The results are provided in Table 10.
(104) TABLE-US-00010 TABLE 10 Response to Vardenafil Basal Stabilization Construct (DMSO/Parental) ratio PDE5AN (#53) 14.0 6.1 PDE5AC (#13) 11.3 7.0 PDE5AC (#25) 7.1 10.1 PDE5AC (#28) 10.4 6.5 PDE5AC (#42) 20.0 6.0 PDE5AC (#43) 8.7 7.4 PDE5AC (#69) 6.5 6.8
(105) As shown in Table 10, PDE5AC (#25), PDE5AC (#28), PDE5AC (#42), and PDE5AC (#43) showed stabilization ratios with Vardenafil that were greater than the stabilization ratios obtained with sildenafil in similar experiments (see Table 2 and Table 6), indicating that Vardenafil stabilization of PDE5A DDs is more potent that sildenafil. For PDE5AN (#3) PDE5AN (#53), PDE5AC (#13) and PDE5AC (#69), stabilization ratios similar to those observed for sildenafil were obtained (see Table 2 and Table 6) indicating that these PDE5A DDs may be stabilized by multiple ligands. All mutants tested also showed some basal expression in the absence of ligand. PDE5AC (#69) and PDE5AC (#25) showed the lowest basal expression levels among the mutants tested.
(106) HCT 116 cells transduced with the PDE5A DD derived GFP constructs were also tested with increasing doses of Vardenafil. The HCT116 cells were incubated for 48 hours with Vardenafil starting at a dose of 0.002 M to 30 M. The GFP intensity of the Vardenafil treated samples was compared to the parental untransduced HCT116 and DMSO treated cells for each construct. The mean fluorescence intensity was calculated for each sample and used to calculate the stabilization ratios as well as the basal expression for each construct. The GFP expression was measured using flow cytometry and the mean fluorescence intensity (MFI) was calculated for each sample. The MFI values are shown in Table 11 and Table 12. The stabilization ratios are shown in Table 13 and Table 14 and the basal expression is show in Table 15.
(107) TABLE-US-00011 TABLE 11 Response to Vardenafil Vardenafil PDE5AN PDE5AN PDE5AC PDE5AC (M) (#3) (#53) (#13) (#25) DMSO 8934 14196 14659 9555 0.002 8767 14117 18393 9737 0.005 9620 14485 27661 9694 0.014 10487 15735 59673 9767 0.041 14086 17260 78117 10468 0.123 20568 25577 88571 13348 0.370 36786 43744 99160 20522 1.111 66543 81455 99377 38958 3.333 98986 131016 105500 66337 10 119591 173576 97493 94642 30 131667 188519 105335 120927
(108) TABLE-US-00012 TABLE 12 Response to Vardenafil Vardenafil PDE5AC PDE5AC PDE5AC PDE5AC (M) (#28) (#42) (#43) (#69) DMSO 13817 25111 12047 9466 0.002 15437 25236 13329 10817 0.005 19446 28309 17702 13682 0.014 29314 33958 33483 27457 0.041 45804 46882 55300 32264 0.123 74153 81233 70385 49884 0.370 81663 114847 78215 74730 1.111 89426 136303 83052 62065 3.333 92290 147512 88707 66625 10 86985 161587 85867 64380 30 93145 199877 86318 22775
(109) TABLE-US-00013 TABLE 13 Stabilization ratio with Vardenafil Vardenafil PDE5AN PDE5AN PDE5AC PDE5AC (M) (#3) (#53) (#13) (#25) DMSO 0.002 1.0 1.0 1.3 1.0 0.005 1.1 1.0 1.9 1.0 0.014 1.2 1.1 4.1 1.0 0.041 1.6 1.2 5.3 1.1 0.123 2.3 1.8 6.0 1.4 0.370 4.1 3.1 6.8 2.1 1.111 7.4 5.7 6.8 4.1 3.333 11.1 9.2 7.2 6.9 10 13.4 12.2 6.7 9.9 30 14.7 13.3 7.2 12.7
(110) TABLE-US-00014 TABLE 14 Stabilization ratio with Vardenafil Vardenafil PDE5AC PDE5AC PDE5AC PDE5AC (M) (#28) (#42) (#43) (#69) DMSO 0.002 1.1 1.0 1.1 1.1 0.005 1.4 1.1 1.5 1.4 0.014 2.1 1.4 2.8 2.9 0.041 3.3 1.9 4.6 3.4 0.123 5.4 3.2 5.8 5.3 0.370 5.9 4.6 6.5 7.9 1.111 6.5 5.4 6.9 6.6 3.333 6.7 5.9 7.4 7.0 10 6.3 6.4 7.1 6.8 30 6.7 8.0 7.2 2.4
(111) TABLE-US-00015 TABLE 15 Basal expression with Vardenafil MFI Construct (with DMSO) Basal Parental 1954 PDE5AN (#3) 8934 4.57 PDE5AN (#53) 14196 7.27 PDE5AC (#13) 14659 7.50 PDE5AC (#25) 9555 4.89 PDE5AC (#28) 13817 7.07 PDE5AC (#42) 25111 12.85 PDE5AC (#43) 12047 6.17 PDE5AC (#69) 9466 4.84
(112) All mutants tested showed a dose dependent increase in the expression of GFP. As shown in Table 13 and Table 14, PDE5AC (#13), PDE5AN (#3), PDE5AC (#28), PDE5AC (#42) PDE5AC (#43), and PDE5AC (#69) showed ligand dependent stabilization with as little as 0.005 M Vardenafil, as indicated by the greater than 1 stabilization ratios obtained with those constructs. PDE5AN (#3) showed the highest stabilization ratio at maximum ligand dose of 30 M indicating that this construct showed maximum ligand dependent stabilization among the constructs tested. As shown in Table 15, the lowest basal expression was obtained with PDE5AN (#3) which was also the construct that showed the highest stabilization ratio at highest concentration of ligand tested. These data indicate that PDE5AN (#3) has the largest dynamic range among the constructs tested with Vardenafil.
(113) PDE5AN (#3) was cloned as AcGFP fusion into pELNS vector carrying mCherry marker and packaged in lentiviral vectors. HCT116 cells were transduced with the construct and stable integrants were selected by cell sorting using mCherry marker. Cells were treated with vehicle (dimethyl sulfoxide, DMSO) or varying doses of Tadalafil (TDF) for 48 hrs with doses ranging from 0.01 M to 100 M. Following the treatment, cells were analyzed for GFP expression using FACS. Basal expression was calculated as the ratio of GFP signal in the absence of ligand for a given cell line to auto fluorescence of parental HCT-116 cells. Stabilization ratio was calculated as the ratio of the GFP signal observed in the presence of stabilizing ligand to the signal from the same cell line in the absence of ligand. The results are provided in Table 16.
(114) TABLE-US-00016 TABLE 16 Response to Tadalafil Tadalafil Stabilization (M) MFI ratio Parental 1175 DMSO 6944 0.01 6781 1.0 0.02 6685 1.0 0.05 7013 1.0 0.14 6988 1.0 0.41 7648 1.1 1.23 8973 1.3 3.7 14097 2.0 11.11 26560 3.8 33.33 49889 7.2 100 68532 9.9
(115) As shown in Table 16, PDE5AN (#3), a Tadalafil dose dependent increase in the MFI was observed. Stabilization ratios greater than 1 were obtained with Tadalafil at concentrations greater than 0.41 (M), indicating ligand dependent stabilization of PDE5AN (#3) with sub micromolar concentrations of Tadalafil.
(116) HCT 116 cells transduced with the PDE5A DD derived GFP constructs were also tested with increasing doses of Tadalafil. The HCT116 cells were incubated for 48 hours with Tadalafil starting at dose 0.01 M to 100 M. The GFP intensity of the Tadalafil treated samples was compared to the parental untransduced HCT116 and DMSO treated cells for each construct. The mean fluorescence intensity was calculated for each sample and used to calculate the stabilization ratios as well as the basal expression for each construct. The MFI values are shown in Table 17 and Table 18. The stabilization ratios are shown in Table 19 and Table 20 and the basal expression is show in Table 21.
(117) TABLE-US-00017 TABLE 17 Response to Tadalafil Tadalafil PDE5AN PDE5AC PDE5AC (M) (#53) (#13) (#25) DMSO 12071 14416 9297 0.01 11635 14388 9233 0.02 11690 14908 8860 0.05 12100 16488 9404 0.14 12331 21292 9478 0.41 13422 33396 9858 1.23 16255 58867 12432 3.7 24201 81755 19294 11.11 42644 92484 31763 33.33 80088 96959 54151 100 104032 105048 70389
(118) TABLE-US-00018 TABLE 18 Response to Tadalafil Tadalafil PDE5AC PDE5AC PDE5AC PDE5AC (M) (#28) (#42) (#43) (#69) DMSO 15004 22601 10998 8822 0.01 14073 22787 11444 9337 0.02 14513 23274 11479 10353 0.05 15730 23278 11764 12365 0.14 18316 24532 13429 19039 0.41 28462 26765 18940 32821 1.23 44739 35325 32204 52033 3.7 69430 59821 49646 62558 11.11 85998 92400 64186 69440 33.33 95189 122658 74446 68289 100 97016 139002 76281 67259
(119) TABLE-US-00019 TABLE 19 Stabilization ratio with Tadalafil Tadalafil PDE5AN PDE5AC PDE5AC (M) (#53) (#13) (#25) DMSO 0.01 1.0 1.0 1.0 0.02 1.0 1.0 1.0 0.05 1.0 1.1 1.0 0.14 1.0 1.5 1.0 0.41 1.1 2.3 1.1 1.23 1.3 4.1 1.3 3.7 2.0 5.7 2.1 11.11 3.5 6.4 3.4 33.33 6.6 6.7 5.8 100 8.6 7.3 7.6
(120) TABLE-US-00020 TABLE 20 Stabilization ratio with Tadalafil Tadalafil PDE5AC PDE5AC PDE5AC PDE5AC (M) (#28) (#42) (#43) (#69) DMSO 0.01 0.9 1.0 1.0 1.1 0.02 1.0 1.0 1.0 1.2 0.05 1.0 1.0 1.1 1.4 0.14 1.2 1.1 1.2 2.2 0.41 1.9 1.2 1.7 3.7 1.23 3.0 1.6 2.9 5.9 3.7 4.6 2.6 4.5 7.1 11.11 5.7 4.1 5.8 7.9 33.33 6.3 5.4 6.8 7.7 100 6.5 6.2 6.9 7.6
(121) TABLE-US-00021 TABLE 21 Basal expression with Tadalafil Tadalafil MFI Basal (M) (with DMSO) Expression Parental 1280 PDE5AN (#53) 12071 9.43 PDE5AC (#13) 14416 11.26 PDE5AC (#25) 9297 7.26 PDE5AC (#28) 15004 11.72 PDE5AC (#42) 22601 17.66 PDE5AC (#43) 10998 8.59 PDE5AC (#69) 8822 6.89
(122) All mutants tested showed a dose dependent increase in the expression of GFP. As shown in Table 19 and Table 20, PDE5AC (#13), and PDE5AC (#69) showed ligand dependent stabilization with as little as 0.14 M Tadalafil, as indicated by the greater than 1.5 stabilization ratios obtained with those constructs. PDE5AN (#25) and PDE5AC (#69) showed the highest stabilization ratio at maximum ligand dose of 100 M indicating that this construct showed maximum ligand dependent stabilization among the constructs tested. As shown in Table 21, the lowest basal expression was obtained with PDE5AC (#69) which was also one of the constructs that showed the highest stabilization ratio at highest concentration of ligand tested. These data indicate that PDE5AC (#69) has the largest dynamic range among the constructs tested with Tadalafil.
(123) Similar experiments were performed in HCT116 cells using sildenafil. The above-mentioned DDs were cloned as AcGFP fusion into pELNS vector carrying mCherry marker and packaged in lentiviral vectors. HCT116 cells were transduced with the constructs and stable integrants were selected by cell sorting using mCherry marker. Cells were treated with sildenafil at the following M concentrations: 0.01, 0.02, 0.05, 0.14, 0.41, 1.23, 3.7, 11.11, 33.33, and 100 for a duration of 48 hours. The fluorescence was analyzed by flow cytometry and the mean fluorescence intensity was calculated for all samples. All clones tested showed a dose dependent increase in expression. PDE5AC (#28) showed the highest MFI values upon treatment with 100 M sildenafil. The MFI values are shown in Table 22 and Table 23. The stabilization ratios are shown in Table 24 and Table 25 and the basal expression is show in Table 26.
(124) TABLE-US-00022 TABLE 22 Response to Sildenafil Sildenafil PDE5AN PDE5AN PDE5AC PDE5AC (M) (#3) (#53) (#13) (#25) DMSO 9835 13747 15122 10217 0.01 9888 12801 14787 10169 0.02 10157 14045 17318 9354 0.05 9952 13801 26905 10120 0.14 10475 14048 48611 10128 0.41 12302 16175 69042 10207 1.23 16826 20410 84772 12328 3.70 27542 30372 82519 17466 11.11 52641 59723 92732 26947 33.33 85509 99558 93336 46897 100.00 103938 117792 76090 51774
(125) TABLE-US-00023 TABLE 23 Response to Sildenafil Sildenafil PDE5AC PDE5AC PDE5AC PDE5AC (M) (#28) (#42) (#43) (#69) DMSO 13208 23943 11147 9575 0.01 14613 23295 11962 9574 0.02 16502 23606 11940 11755 0.05 17801 24817 15203 11944 0.14 26694 29495 24319 19733 0.41 43862 40817 40470 30090 1.23 65762 63410 57723 44180 3.70 83657 91798 73400 52782 11.11 80269 127187 76900 59723 33.33 83663 149906 94863 65183 100.00 80213 164269 56552 51774
(126) TABLE-US-00024 TABLE 24 Stabilization ratio with Sildenafil Sildenafil PDE5AN PDE5AN PDE5AC PDE5AC (M) (#3) (#53) (#13) (#25) DMSO 0.01 1.0 0.9 1.0 1.0 0.02 1.0 1.0 1.1 0.9 0.05 1.0 1.0 1.8 1.0 0.14 1.1 1.0 3.2 1.0 0.41 1.3 1.2 4.6 1.0 1.23 1.7 1.5 5.6 1.2 3.70 2.8 2.2 5.5 1.7 11.11 5.4 4.3 6.1 2.6 33.33 8.7 7.2 6.2 4.6 100.00 10.6 8.6 5.0 5.1
(127) TABLE-US-00025 TABLE 25 Stabilization ratio with Sildenafil Sildenafil PDE5AC PDE5AC PDE5AC PDE5AC (M) (#28) (#42) (#43) (#69) DMSO 0.01 1.1 1.0 1.1 1.0 0.02 1.2 1.0 1.1 1.2 0.05 1.3 1.0 1.4 1.2 0.14 2.0 1.2 2.2 2.1 0.41 3.3 1.7 3.6 3.1 1.23 5.0 2.6 5.2 4.6 3.70 6.3 3.8 6.6 5.5 11.11 6.1 5.3 6.9 6.2 33.33 6.3 6.3 8.5 6.8 100.00 6.1 6.9 5.1 5.4
(128) TABLE-US-00026 TABLE 26 Basal expression with Sildenafil MFI Basal Description (with DMSO) expression Parental 1287 PDE5AN (#3) 9835 7.6 PDE5AN (#53) 13747 10.7 PDE5AC (#13) 15122 11.7 PDE5AC (#25) 10217 7.9 PDE5AC (#28) 13208 10.3 PDE5AC (#42) 23943 18.6 PDE5AC (#43) 11147 8.7 PDE5AC (#69) 9575 7.4
(129) All mutants tested showed a dose dependent increase in the expression of GFP. As shown in Table 22 and Table 23, PDE5AC (#13), showed ligand dependent stabilization with as little as 0.05 M Sildenafil, as indicated by the greater than 1.5 stabilization ratios obtained with that construct. PDE5AN (#28), PDE5AC (#43) and PDE5AC (#69) showed stabilization ratios greater than 1.5 with 0.14 M of Sildenafil. PDE5AN (#3) showed the highest stabilization ratio at maximum ligand dose of 100 M indicating that this construct showed maximum ligand dependent stabilization among the constructs tested. As shown in Table 26, the lowest basal expression was obtained with PDE5AC (#69). These data indicate that the PDE5A DDs described herein can be stabilized by multiple ligands.
(130) While the present invention has been described at some length and with some particularity with respect to the several described embodiments, it is not intended that it should be limited to any such particulars or embodiments or any particular embodiment, but it is to be construed with references to the appended claims so as to provide the broadest possible interpretation of such claims in view of the prior art and, therefore, to effectively encompass the intended scope of the invention.
(131) All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, section headings, the materials, methods, and examples are illustrative only and not intended to be limiting.