Glycosylated psilocybin derivatives and methods of using
11891360 ยท 2024-02-06
Assignee
Inventors
Cpc classification
C12P19/18
CHEMISTRY; METALLURGY
C07H1/00
CHEMISTRY; METALLURGY
Y02P20/55
GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
C07D209/20
CHEMISTRY; METALLURGY
C07H17/02
CHEMISTRY; METALLURGY
C12P19/44
CHEMISTRY; METALLURGY
International classification
Abstract
Disclosed are novel glycosylated psilocybin derivative compounds and pharmaceutical and recreational drug formulations containing the same. The compounds may be produced by reacting a hydroxylated psilocybin derivative with a glycosyl compound.
Claims
1. A chemical compound of formula (I): ##STR00037## or a salt thereof, wherein R.sub.4 is a galactosyl group, and wherein R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are independently a hydrogen atom, an alkyl group or O-alkyl group, or a glycosyl group, and wherein R.sub.3a and R.sub.3b are independently a hydrogen atom, an alkyl group, an aryl group, or an acyl group.
2. A chemical compound according to claim 1, wherein the galactosyl group is a galactosyloxy group.
3. A chemical compound according to claim 1, wherein the galactosyl group is a C-linked galactosyl group.
4. A chemical compound according to claim 1, wherein the galactosyl group is bonded in the furanose or pyranose form from its anomeric carbon atom.
5. A chemical compound according to claim 1, wherein the galactosyl group is a di or tri-saccharide, wherein the second and/or third glycosyl group is independently selected from a glucosyl group, glucuronic acid group, a galactosyl group, a mannosyl group, a fucosyl group, a xylosyl group, an arabinosyl group, a rhamnosyl group, a glucosaminyl group and a galactosaminyl group.
6. A chemical compound according to claim 2, wherein the galactosyl group is a di or tri-saccharide, wherein the second and/or third glycosyl group is independently selected from a glucosyl group, glucuronic acid group, a galactosyl group, a mannosyl group, a fucosyl group, a xylosyl group, an arabinosyl group, a rhamnosyl group, a glucosaminyl group and a galactosaminyl group.
7. A chemical compound according to claim 1, wherein R.sub.2, R.sub.5, R.sub.6, and R.sub.7 each are a hydrogen atom.
8. A chemical compound according to claim 1, wherein one or at least one of R.sub.2, R.sub.5, R.sub.6, and R.sub.7 is an alkyl group, and the remaining of R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are a hydrogen atom.
9. A chemical compound according to claim 8, wherein the one or at least one alkyl group is a C.sub.1-C.sub.6 alkyl group.
10. A chemical compound according to claim 8, wherein the one or at least one alkyl group is a methyl (CH.sub.3) group.
11. A chemical compound according to claim 1, wherein one or at least one of R.sub.2, R.sub.5, R.sub.6, and R.sub.7 is an O-alkyl group, and the remaining of R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are a hydrogen atom.
12. A chemical compound according to claim 11, wherein the one or at least one O-alkyl group is a C.sub.1-C.sub.6 O-alkyl group.
13. A chemical compound according to claim 11, wherein the one or at least one alkyl group is a methoxy (OCH.sub.3) group.
14. A chemical compound according to claim 1, wherein one or at least one of R.sub.2, R.sub.5, R.sub.6, and R.sub.7 is a glycosyl group, and the remaining of R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are a hydrogen atom.
15. A chemical compound according to claim 14, wherein the glycosyl group is a C-linked glycosyl group.
16. A chemical compound according to claim 14, wherein the glycosyl group is a glycosyl group bonded in the furanose or pyranose form from its anomeric carbon atom.
17. A chemical compound according to claim 14, wherein the glycosyl group is selected from a mono-saccharide, di-saccharide, or tri-saccharide.
18. A chemical compound according to claim 14, wherein the glycosyl group is selected from a pentosyl group, a hexosyl group, and a heptosyl group.
19. A chemical compound according to claim 14, wherein the glycosyl group is selected from a glucosyl group, glucuronic acid group, a galactosyl group, a mannosyl group, a fucosyl group, a xylosyl group, an arabinosyl group, a rhamnosyl group, a glucosaminyl group and a galactosaminyl group.
20. A chemical compound according to claim 1, wherein and R.sub.3a and R.sub.3b are two hydrogen atoms; a hydrogen atom and a C.sub.1-C.sub.6 alkyl group; or two C.sub.1-C.sub.6 alkyl groups.
21. A chemical compound according to claim 1, wherein and R.sub.3a and R.sub.3b are two hydrogen atoms; a hydrogen atom and a phenyl group; or two phenyl groups.
22. A chemical compound according to claim 1, wherein the chemical compound has formula (VI): ##STR00038##
23. A chemical compound or salt thereof according to claim 1, wherein the compound is at least about 95% pure.
24. A pharmaceutical or recreational drug formulation comprising an effective amount of a chemical compound according to claim 1, together with a pharmaceutically acceptable diluent, excipient, or carrier.
25. A method for treating a psychiatric disorder, the method comprising administering to a subject in need thereof a pharmaceutical formulation comprising a chemical compound according to claim 1, wherein the pharmaceutical formulation is administered in an effective amount to treat the psychiatric disorder in the subject.
26. A pharmaceutical or recreational drug formulation comprising an effective amount of a chemical compound according to claim 22, together with a pharmaceutically acceptable diluent, excipient, or carrier.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The disclosure is in the hereinafter provided paragraphs described, by way of example, in relation to the attached figures. The figures provided herein are provided for a better understanding of the example embodiments and to show more clearly how the various embodiments may be carried into effect. The figures are not intended to limit the present disclosure.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16) The figures together with the following detailed description make apparent to those skilled in the art how the disclosure may be implemented in practice.
DETAILED DESCRIPTION
(17) Various compositions, systems or processes will be described below to provide an example of an embodiment of each claimed subject matter. No embodiment described below limits any claimed subject matter and any claimed subject matter may cover processes, compositions or systems that differ from those described below. The claimed subject matter is not limited to compositions, processes or systems having all of the features of any one composition, system or process described below or to features common to multiple or all of the compositions, systems or processes described below. It is possible that a composition, system or process described below is not an embodiment of any claimed subject matter. Any subject matter disclosed in a composition, system or process described below that is not claimed in this document may be the subject matter of another protective instrument, for example, a continuing patent application, and the applicant(s), inventor(s) or owner(s) do not intend to abandon, disclaim or dedicate to the public any such subject matter by its disclosure in this document.
(18) As used herein and in the claims, the singular forms, such a, an and the include the plural reference and vice versa unless the context clearly indicates otherwise. Throughout this specification, unless otherwise indicated, comprise, comprises and comprising are used inclusively rather than exclusively, so that a stated integer or group of integers may include one or more other non-stated integers or groups of integers.
(19) Various compositions, systems or processes will be described below to provide an example of an embodiment of each claimed subject matter. No embodiment described below limits any claimed subject matter and any claimed subject matter may cover processes, compositions or systems that differ from those described below. The claimed subject matter is not limited to compositions, processes or systems having all of the features of any one composition, system or process described below or to features common to multiple or all of the compositions, systems or processes described below. It is possible that a composition, system or process described below is not an embodiment of any claimed subject matter. Any subject matter disclosed in a composition, system or process described below that is not claimed in this document may be the subject matter of another protective instrument, for example, a continuing patent application, and the applicant(s), inventor(s) or owner(s) do not intend to abandon, disclaim or dedicate to the public any such subject matter by its disclosure in this document.
(20) When ranges are used herein for physical properties, such as molecular weight, or chemical properties, such as chemical formulae, all combinations and sub-combinations of ranges and specific embodiments therein are intended to be included. Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term about. The term about when referring to a number or a numerical range means that the number or numerical range referred to is an approximation within experimental variability (or within statistical experimental error), and thus the number or numerical range may vary between 1% and 15% of the stated number or numerical range, as will be readily recognized by context. Furthermore any range of values described herein is intended to specifically include the limiting values of the range, and any intermediate value or sub-range within the given range, and all such intermediate values and sub-ranges are individually and specifically disclosed (e.g. a range of 1 to 5 includes 1, 1.5, 2, 2.75, 3, 3.90, 4, and 5). Similarly, other terms of degree such as substantially and approximately as used herein mean a reasonable amount of deviation of the modified term such that the end result is not significantly changed. These terms of degree should be construed as including a deviation of the modified term if this deviation would not negate the meaning of the term it modifies.
(21) Unless otherwise defined, scientific and technical terms used in connection with the formulations described herein shall have the meanings that are commonly understood by those of ordinary skill in the art. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims.
(22) All publications, patents and patent applications are herein incorporated by reference in their entirety to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated by reference in its entirety.
Terms and Definitions
(23) The term psilocybin, refers to a chemical compound having the structure set forth in
(24) The term indole prototype structure refers to the chemical structure shown in
(25) The terms hydroxy-containing psilocybin derivative or hydroxy-containing psilocybin derivative compound refer to a psilocybin derivative compound comprising one or more hydroxy groups. Reference may be made to specific carbon atoms which may be hydroxylated. For example, a 7-hydroxy-psilocybin derivative refers to a hydroxylated psilocybin derivative in which carbon atom number 7 (as identified in the indole prototype structure) is hydroxylated, or, similarly, 2-hydroxy-psilocybin derivative refers to a hydroxylated psilocybin derivative in which carbon atom number 2 (as identified in the indole prototype structure) is hydroxylated. Thus, for example, hydroxy-containing psilocybin derivatives include, single hydroxy derivatives, 2-hydroxy, 4-hydroxy, 5-hydroxy, 6-hydroxy and 7-hydroxy psilocybin derivatives, for example, and multiple hydroxy derivatives, such as, for example, 4,7-dihydroxy-psilocybin derivatives, and 2,5,7-tri-hydroxy-psilocybin derivatives. The term hydroxy-containing psilocybin derivatives further includes chemical compounds having the chemical formula (II):
(26) ##STR00019##
wherein at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a hydroxy group, and wherein each non-hydroxylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein, R.sub.3 is a hydrogen atom, a 2-aminoethyl group or a N-substituted 2-aminoethyl group, wherein R.sub.4 when it is not hydroxylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group. The term further includes salts of hydroxy-containing psilocybin derivatives, such as a sodium salt, a potassium salt etc.
(27) The terms glycosylated or glycosyl, as used herein, refer to a saccharide group, such as a mono-, di-, tri- oligo- or a poly-saccharide group, which can be or has been bonded from its anomeric carbon either in the pyranose or furanose form, either in the or the conformation, or can be or has been bonded from a non-anomeric carbon atom, and can be in the pyranose or furanose form. The saccharide group can be bonded via an oxygen atom to another entity, the bonded saccharide group, inclusive of the oxygen atom, may be referred to herein as a glycosyloxy group, and can be said to be O-glycosylated or O-linked. Thus, the term glycosyl group, as used herein, includes glucosyloxy groups. Alternatively, the saccharide group may also be bonded from a carbon atom, and can then be said to be C-glycosylated or C-linked. Example monosaccharide groups include, but are not limited to, a pentosyl, a hexosyl, or a heptosyl group. The glycosyl group may also be substituted with various groups. Such substitutions may include lower alkyl, lower alkoxy, acyl, carboxy, carboxyamino, amino, acetamido, halo, thio, nitro, keto, and phosphatyl groups, wherein the substitution may be at one or more positions on the saccharide. Included in the term glycosyl are further stereoisomers, optical isomers, anomers, and epimers of the glycosyl group. Thus, a hexose group, for example, can be either an aldose or a ketose group, can be of D- or L-configuration, can assume either an - or -conformation, and can be a dextro- or levo-rotatory with respect to plane-polarized light. Example glycosyl groups further include, glucosyl group, glucuronic add group, a galactosyl group, a mannosyl group, a fucosyl group, a xylosyl group, an arabinosyl group, a rhamnosyl group, a glucosaminyl group and a galactosaminyl group.
(28) The term glycosylated psilocybin derivative refers to a psilocybin derivative compound to which glycosyl group has been bonded to thereby form an O-linked or C-linked glycosyl bond. Reference may be made to specific carbon atoms which may be glycosylated. For example, a 5-glycosyl psilocybin derivative refers to a hydroxylated psilocybin derivative in which carbon atom number 5 (as identified in the indole prototype structure) is glycosylated, or, similarly, 4-glycosyl-psilocybin derivative refers to a glycosylated psilocybin derivative in which carbon atom number 4 (as identified in the indole prototype structure) is glycosylated. Thus, for example, glycosyl-containing psilocybin derivatives include, single glycosyl derivatives, 2-glycosyl, 4-glycosyl, 5-glycosyl, 6-glycosyl, and 7-glycosyl psilocybin derivatives, for example, and multiple glycosyl derivatives, such as, for example, 4,7-di-glycosyl psilocybin derivatives, and 2,5,7-tri-glycosyl psilocybin derivatives. The term glycosyl containing psilocybin derivatives further includes chemical compounds having the chemical formula (I):
(29) ##STR00020##
wherein at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein R.sub.3A and R.sub.3B are a hydrogen atom, alkyl group, and aryl group or an acyl group. Glycosylated psilocybins further can include salts of chemical compounds having chemical formula (I), such as a sodium salt, a potassium salt etc.
(30) The term phosphate group, as used herein, is a molecule containing one atom of phosphorus, covalently bound to four oxygen atoms (three single bonds and one double bond). Of the four oxygen atoms one oxygen atom may be a hydroxy group, and one of the non-hydroxylated oxygen atom may be chemically bonded to another entity.
(31) The terms hydroxy group, and hydroxy, as used herein, refers to a molecule containing one atom of oxygen bonded to one atom of hydrogen, and having the formula OH. A hydroxy group through its oxygen atom may be chemically bonded to another entity.
(32) The term alkyl, as used herein, refers to a straight and/or branched chain, saturated alkyl radical containing from one to p carbon atoms (C.sub.1-C.sub.p-alkyl) and includes, depending on the identity of p, methyl, ethyl, propyl, isopropyl, n-butyl, s-butyl, isobutyl, t-butyl, 2,2-dimethylbutyl, n-pentyl, 2-methylpentyl, 3-methylpentyl, 4-methylpentyl, n-hexyl and the like, where the variable p is an integer representing the largest number of carbon atoms in the alkyl radical. Alkyl groups further include hydrocarbon groups arranged in a chain having the chemical formula C.sub.nH.sub.2n+1, including, without limitation, methyl groups (CH.sub.3), ethyl groups (C.sub.2H.sub.5), propyl groups (C.sub.3H.sub.7), and butyl groups (C.sub.4H.sub.9).
(33) The term O-alkyl, as used herein, refers to a hydrocarbon group arranged in a chain having the chemical formula OC.sub.nH.sub.2n+1. O-alkyl groups include, without limitation, O-methyl groups (OCH.sub.3), O-ethyl groups (OC.sub.2H.sub.5), O-propyl groups (OC.sub.3H.sub.7) and O-butyl groups (OC.sub.4H.sub.9).
(34) The term aryl, as used herein, refers to a monocyclic, bicyclic or tricyclic aromatic ring system containing, depending on the number of atoms in the rings, for example, from 6 to 14 carbon atoms (C.sub.6-C.sub.14-aryl) or from 6 to 10 carbons (C.sub.6-C.sub.10-aryl), and at least 1 aromatic ring and includes phenyl, naphthyl, anthracenyl, 1,2-dihydronaphthyl, 1,2,3,4-tetrahydronaphthyl, fluorenyl, phenanthrenyl, biphenylenyl, indanyl, indenyl and the like.
(35) The term acyl, as used herein, refers to a carbon atom double bonded to an oxygen and single bonded to an alkyl group. The carbon atom further can be bonded to another entity. An acyl group can be described by the chemical formula: C(O)C.sub.nH.sub.2n+1.
(36) The term 5-HT.sub.2A receptor, as used herein, refers to a subclass of a family of receptors for the neurotransmitter and peripheral signal mediator serotonin. 5-HT.sub.2A receptors can mediate a plurality of central and peripheral physiologic functions of serotonin. Central nervous system effects can include mediation of hallucinogenic effects of hallucinogenic compounds.
(37) The term modulating 5-HT.sub.2A receptors, as used herein, refers to the ability of a compound disclosed herein to alter the function of 5-HT.sub.2A receptors. A 5-HT.sub.2A receptor modulator may activate the activity of a 5-HT.sub.2A receptor, may activate or inhibit the activity of a 5-HT.sub.2A receptor depending on the concentration of the compound exposed to the 5-HT.sub.2A receptor, or may inhibit the activity of a 5-HT.sub.2A receptor. Such activation or inhibition may be contingent on the occurrence of a specific event, such as activation of a signal transduction pathway, and/or maybe manifest only in particular cell types. The term modulating 5-HT.sub.2A receptors, also refers to altering the function of a 5-HT.sub.2A receptor by increasing or decreasing the probability that a complex forms between a 5-HT.sub.2A receptor and a natural binding partner to form a multimer. A 5-HT.sub.2A receptor modulator may increase the probability that such a complex forms between the 5-HT.sub.2A receptor and the natural binding partner, may increase or decrease the probability that a complex forms between the 5-HT.sub.2A receptor and the natural binding partner depending on the concentration of the compound exposed to the 5-HT.sub.2A receptor, and or may decrease the probability that a complex forms between the 5-HT.sub.2A receptor and the natural binding partner.
(38) The term 5-HT.sub.2A receptor-mediated disorder, as used herein, refers to a disorder that is characterized by abnormal 5-HT.sub.2A receptor activity. A 5-HT.sub.2A receptor-mediated disorder may be completely or partially mediated by modulating 5-HT.sub.2A receptors. In particular, a 5-HT.sub.2A receptor-mediated disorder is one in which modulation of 5-HT.sub.2A receptors results in some effect on the underlying disorder e.g., administration of a 5-HT.sub.2A receptor modulator results in some improvement in at least some of the subjects being treated.
(39) The term pharmaceutical formulation, as used herein, refers to a preparation in a form which allows an active ingredient, including a psychoactive ingredient, contained therein to provide effective treatment, and which does not contain any other ingredients which cause excessive toxicity, an allergic response, irritation, or other adverse response commensurate with a reasonable risk/benefit ratio. The pharmaceutical formulation may contain other pharmaceutical ingredients such as excipients, carriers, diluents, or auxiliary agents.
(40) The term recreational drug formulation, as used herein, refers to a preparation in a form which allows a psychoactive ingredient contained therein to be effective for administration as a recreational drug, and which does not contain any other ingredients which cause excessive toxicity, an allergic response, irritation, or other adverse response commensurate with a reasonable risk/benefit ratio. The recreational drug formulation may contain other ingredients such as excipients, carriers, diluents, or auxiliary agents.
(41) The term effective for administration as a recreational drug, as used herein, refers to a preparation in a form which allows a subject to voluntarily induce a psychoactive effect for non-medical purposes upon administration, generally in the form of self-administration. The effect may include an altered state of consciousness, satisfaction, pleasure, euphoria, perceptual distortion, or hallucination.
(42) The term effective amount, as used herein, refers to an amount of an active agent, pharmaceutical formulation or recreational drug formulation, sufficient to induce a desired biological or therapeutic effect, including a prophylactic effect, and further including a psychoactive effect. Such effect can include an effect with respect to the signs, symptoms or causes of a disorder, or disease or any other desired alteration of a biological system. The effective amount can vary depending, for example, on the health condition, injury stage, disorder stage, or disease stage, weight, or sex of a subject being treated, timing of the administration, manner of the administration, age of the subject, and the like, all of which can be determined by those of skill in the art.
(43) The terms treating and treatment, and the like, as used herein, are intended to mean obtaining a desirable physiological, pharmacological, or biological effect, and includes prophylactic and therapeutic treatment. The effect may result in the inhibition, attenuation, amelioration, or reversal of a sign, symptom or cause of a disorder, or disease, attributable to the disorder, or disease, which includes mental and psychiatric diseases and disorders. Clinical evidence of the prevention or treatment may vary with the disorder, or disease, the subject and the selected treatment.
(44) The term pharmaceutically acceptable, as used herein, refers to materials, including excipients, carriers, diluents, or auxiliary agents, that are compatible with other materials in a pharmaceutical or recreational drug formulation and within the scope of reasonable medical judgement suitable for use in contact with a subject without excessive toxicity, allergic response, irritation, or other adverse response commensurate with a reasonable risk/benefit ratio.
(45) The term glycosyl transferase as used herein, refers to any and all enzymes comprising a sequence of amino acid residues which is (i) substantially identical to the amino acid sequences constituting any glycosyl transferase polypeptide set forth herein, including, for example, SEQ.ID NO: 2, or (ii) encoded by a nucleic acid sequence capable of hybridizing under at least moderately stringent conditions to any nucleic acid sequence encoding any glycosyl transferase set forth herein, but for the use of synonymous codons.
(46) The terms nucleic acid sequence encoding a glycosyl transferase, and nucleic acid sequence encoding a glycosyl transferase polypeptide, as may be used interchangeably herein, refer to any and all nucleic acid sequences encoding a glycosyl transferase polypeptide, including, for example, SEQ.ID NO: 1. Nucleic acid sequences encoding a glycosyl transferase polypeptide further include any and all nucleic acid sequences which (i) encode polypeptides that are substantially identical to the glycosyl transferase polypeptide sequences set forth herein; or (ii) hybridize to any glycosyl transferase nucleic acid sequences set forth herein under at least moderately stringent hybridization conditions or which would hybridize thereto under at least moderately stringent conditions but for the use of synonymous codons.
(47) The terms nucleic acid, or nucleic acid sequence, as used herein, refer to a sequence of nucleoside or nucleotide monomers, consisting of naturally occurring bases, sugars and intersugar (backbone) linkages. The term also includes modified or substituted sequences comprising non-naturally occurring monomers or portions thereof. The nucleic acids of the present disclosure may be deoxyribonucleic nucleic acids (DNA) or ribonucleic acids (RNA) and may include naturally occurring bases including adenine, guanine, cytosine, thymidine and uracil. The nucleic acids may also contain modified bases. Examples of such modified bases include aza and deaza adenine, guanine, cytosine, thymidine and uracil, and xanthine and hypoxanthine. A sequence of nucleotide or nucleoside monomers may be referred to as a polynucleotide sequence, nucleic acid sequence, a nucleotide sequence or a nucleoside sequence.
(48) The term polypeptide, as used herein in conjunction with a reference SEQ.ID NO, refers to any and all polypeptides comprising a sequence of amino acid residues which is (i) substantially identical to the amino acid sequence constituting the polypeptide having such reference SEQ.ID NO, or (ii) encoded by a nucleic acid sequence capable of hybridizing under at least moderately stringent conditions to any nucleic acid sequence encoding the polypeptide having such reference SEQ.ID NO, but for the use of synonymous codons. A sequence of amino acid residues may be referred to as an amino acid sequence, or polypeptide sequence.
(49) The term nucleic acid sequence encoding a polypeptide, as used herein in conjunction with a reference SEQ.ID NO, refers to any and all nucleic acid sequences encoding a polypeptide having such reference SEQ.ID NO. Nucleic acid sequences encoding a polypeptide, in conjunction with a reference SEQ.ID NO, further include any and all nucleic acid sequences which (i) encode polypeptides that are substantially identical to the polypeptide having such reference SEQ.ID NO; or (ii) hybridize to any nucleic acid sequences encoding polypeptides having such reference SEQ.ID NO under at least moderately stringent hybridization conditions or which would hybridize thereto under at least moderately stringent conditions but for the use of synonymous codons.
(50) By the term substantially identical it is meant that two amino acid sequences preferably are at least 70% identical, and more preferably are at least 85% identical and most preferably at least 95% identical, for example 96%, 97%, 98% or 99% identical. In order to determine the percentage of identity between two amino acid sequences the amino acid sequences of such two sequences are aligned, using for example the alignment method of Needleman and Wunsch (J. Mol. Biol., 1970, 48: 443), as revised by Smith and Waterman (Adv. Appl. Math., 1981, 2: 482) so that the highest order match is obtained between the two sequences and the number of identical amino acids is determined between the two sequences. Methods to calculate the percentage identity between two amino acid sequences are generally art recognized and include, for example, those described by Carillo and Lipton (SIAM J. Applied Math., 1988, 48:1073) and those described in Computational Molecular Biology, Lesk, e.d. Oxford University Press, New York, 1988, Biocomputing: Informatics and Genomics Projects. Generally, computer programs will be employed for such calculations. Computer programs that may be used in this regard include, but are not limited to, GCG (Devereux et al., Nucleic Acids Res., 1984, 12: 387) BLASTP, BLASTN and FASTA (Altschul et al., J. Mol. Biol., 1990:215:403). A particularly preferred method for determining the percentage identity between two polypeptides involves the Clustal W algorithm (Thompson, J D, Higgines, D G and Gibson T J, 1994, Nucleic Acid Res 22(22): 4673-4680 together with the BLOSUM 62 scoring matrix (Henikoff S & Henikoff, J G, 1992, Proc. Natl. Acad. Sci. USA 89: 10915-10919 using a gap opening penalty of 10 and a gap extension penalty of 0.1, so that the highest order match obtained between two sequences wherein at least 50% of the total length of one of the two sequences is involved in the alignment.
(51) By at least moderately stringent hybridization conditions it is meant that conditions are selected which promote selective hybridization between two complementary nucleic acid molecules in solution. Hybridization may occur to all or a portion of a nucleic acid sequence molecule. The hybridizing portion is typically at least 15 (e.g. 20, 25, 30, 40 or 50) nucleotides in length. Those skilled in the art will recognize that the stability of a nucleic acid duplex, or hybrids, is determined by the Tm, which in sodium containing buffers is a function of the sodium ion concentration and temperature (Tm=81.5 C.-16.6 (Log 10 [Na+])+0.41(% (G+C)-600/l), or similar equation). Accordingly, the parameters in the wash conditions that determine hybrid stability are sodium ion concentration and temperature. In order to identify molecules that are similar, but not identical, to a known nucleic acid molecule a 1% mismatch may be assumed to result in about a 1 C. decrease in Tm, for example if nucleic acid molecules are sought that have a >95% identity, the final wash temperature will be reduced by about 5 C. Based on these considerations those skilled in the art will be able to readily select appropriate hybridization conditions. In preferred embodiments, stringent hybridization conditions are selected. By way of example the following conditions may be employed to achieve stringent hybridization: hybridization at 5 sodium chloride/sodium citrate (SSC)/5Denhardt's solution/1.0% SDS at Tm (based on the above equation) 5 C., followed by a wash of 0.2SSC/0.1% SDS at 60 C. Moderately stringent hybridization conditions include a washing step in 3SSC at 42 C. It is understood however that equivalent stringencies may be achieved using alternative buffers, salts and temperatures. Additional guidance regarding hybridization conditions may be found in: Current Protocols in Molecular Biology, John Wiley & Sons, N.Y., 1989, 6.3.1.-6.3.6 and in: Sambrook et al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989, Vol. 3.
(52) The term functional variant, as used herein in reference to polynucleotides or polypeptides, refers to polynucleotides or polypeptides capable of performing the same function as a noted reference polynucleotide or polypeptide. Thus, for example, a functional variant of the polypeptide set forth in SEQ.ID NO: 2, refers to a polypeptide capable of performing the same function as the polypeptide set forth in SEQ.ID NO: 2. Functional variants include modified a polypeptide wherein, relative to a noted reference polypeptide, the modification includes a substitution, deletion or addition of one or more amino acids. In some embodiments, substitutions are those that result in a replacement of one amino acid with an amino acid having similar characteristics. Such substitutions include, without limitation (i) glutamic acid and aspartic acid; (i) alanine, serine, and threonine; (iii) isoleucine, leucine and valine, (iv) asparagine and glutamine, and (v) tryptophan, tyrosine and phenylalanine. Functional variants further include polypeptides having retained or exhibiting an enhanced psilocybin biosynthetic bioactivity.
(53) The term chimeric, as used herein in the context of nucleic acids, refers to at least two linked nucleic acids which are not naturally linked. Chimeric nucleic acids include linked nucleic acids of different natural origins. For example, a nucleic acid constituting a microbial promoter linked to a nucleic acid encoding a plant polypeptide is considered chimeric. Chimeric nucleic acids also may comprise nucleic acids of the same natural origin, provided they are not naturally linked. For example a nucleic acid constituting a promoter obtained from a particular cell-type may be linked to a nucleic acid encoding a polypeptide obtained from that same cell-type, but not normally linked to the nucleic acid constituting the promoter. Chimeric nucleic acids also include nucleic acids comprising any naturally occurring nucleic acids linked to any non-naturally occurring nucleic acids.
(54) The terms substantially pure and isolated, as may be used interchangeably herein describe a compound, e.g., a psilocybin derivative, polynucleotide or a polypeptide, which has been separated from components that naturally accompany it. Typically, a compound is substantially pure when at least 60%, more preferably at least 75%, more preferably at least 90%, 95%, 96%, 97%, or 98%, and most preferably at least 99% of the total material (by volume, by wet or dry weight, or by mole percent or mole fraction) in a sample is the compound of interest. Purity can be measured by any appropriate method, e.g., in the case of polypeptides, by chromatography, gel electrophoresis or HPLC analysis.
(55) The term recovered as used herein in association with an enzyme, protein, a chemical compound, refers to a more or less pure form of the enzyme, protein, or chemical compound.
(56) General Implementation
(57) As hereinbefore mentioned, the present disclosure relates to psilocybin derivatives. In particular, the present disclosure provides novel glycosylated psilocybin derivatives. In general, the herein provided compositions exhibit functional properties which deviate from the functional properties of psilocybin. Thus, for example, the glycosylated psilocybin derivatives, can exhibit pharmacological properties which deviate from psilocybin. Furthermore, the glycosylated derivatives may psilocybin derivatives may exhibit physico-chemical properties which differ from psilocybin. Thus, for example, glycosylated psilocybin derivatives may exhibit superior solubility in a solvent, for example, an aqueous solvent. The glycosylated psilocybin derivatives in this respect are useful in the formulation of pharmaceutical and recreational drug formulations. Furthermore, the glycosylated psilocybin compounds of the present disclosure may be used as a feedstock material for deriving further psilocybin derivatives. In one embodiment, the glycosylated psilocybin derivatives of the present disclosure can conveniently be biosynthetically produced. The practice of this method avoids the extraction of psilocybin from mushrooms and the performance of subsequent chemical reactions to achieve glycosylated derivatives. Furthermore, the growth of mushrooms can be avoided thus limiting the dependence on climate and weather, and potential legal and social challenges associated with the cultivation of mushrooms containing psychoactive compounds. The method can efficiently yield substantial quantities of glycosylated psilocybin derivatives.
(58) In what follows selected embodiments are described with reference to the drawings.
(59) Initially example glycosylated psilocybin derivatives will be described. Thereafter example methods of using and making the glycosylated psilocybin derivatives will be described.
(60) Accordingly, in one aspect the present disclosure provides derivatives of a compound known as psilocybin of which the chemical structure is shown in
(61) Thus, in one aspect, the present disclosure provides, in accordance with the teachings herein, in at least one embodiment, a chemical compound or salt thereof having formula (I):
(62) ##STR00021##
wherein at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein R.sub.3A and R.sub.3B are a hydrogen, an alkyl group, an aryl group or an acyl group.
(63) Thus, referring to the chemical compound having formula (I), initially it is noted that, in an aspect thereof, at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group.
(64) Continuing to refer to the chemical compound having formula (I), the glycosyl groups, in accordance with the present disclosure, can be any glycosyl group, including a mono-, di-, tri- oligo- or a poly-saccharide group, bonded from the anomeric carbon, either in the pyranose or furanose form, either in the - or the -conformation, or bonded from a non-anomeric carbon atom in either the furanose or pyranose form.
(65) Furthermore, continuing to the chemical compound having formula (I), the glycosyl groups in accordance herewith may be glycosyloxy groups (O-linked glycosyl groups) or C-linked glycosyl groups.
(66) Continuing to refer to the chemical compound having formula (I), in some embodiments, the glycosyl group may be a D-glucosyl group, D-fructosyl group, D-mannosyl group, D-ribosyl group, D-talosyl group, D-lyxosyl group, D-allosyl group, D-altrosyl group, D-gulosyl group, D-idosyl group, N-acetyl-D-glucosaminyl group, N-acetyl-D-galactosaminyl group, D-quinovosyl group, D-maltosyl group, D-cellobiosyl group, D-lactosyl group, N-acetyl-D-lactosaminyl group, D-maltotiosyl group, D-glucuronic acid group, D-galactosyl group, D-mannosyl group, D-fucosyl group, D-xylosyl group, D-arabinosyl group, a D-rhamnosyl group, a D-glucosaminyl group, or a D-galactosaminyl group.
(67) Continuing to refer to the chemical compound having formula (I), embodiments, the glycosyl group may be an L-glucosyl group, L-fructosyl group, L-mannosyl group, L-ribosyl group, L-talosyl group, L-lyxosyl group, L-allosyl group, L-altrosyl group, L-gulosyl group, L-idosyl group, N-acetyl-L-glucosaminyl group, N-acetyl-L-galactosaminyl group, L-quinovosyl group, L-maltosyl group, L-cellobiosyl group, L-lactosyl group, N-acetyl-L-lactosaminyl group, L-maltotiosyl group, L-glucuronic acid group, L-galactosyl group, L-mannosyl group, L-fucosyl group, L-xylosyl group, L-arabinosyl group, a L-rhamnosyl group, a L-glucosaminyl group, or a L-galactosaminyl group.
(68) Continuing to refer to the chemical compound having formula (I), some embodiments, the glycosyl group may be a glycosyloxy group (i.e., a glycosyl group formed by bonding of the saccharide through its anomeric carbon atom). Thus, as will be clear, in some embodiments, the glycosyl group can be a glycosyloxy group selected from a glucosyloxy group, fructosyloxy group, mannosyoxy group, ribosyloxy group, talosyloxy group, lyxosyloxy group, allosyloxy group, altrosyloxy group, gulosyloxy group, idosyloxy group, N-acetyl-glucosaminyloxy group, N-acetyl-galactosaminyloxy group, quinovosyloxy group, maltosyloxy group, cellobiosyloxy group, lactosyloxy group, N-acetyl-lactosaminoxy group, maltotiosyloxy group, glucuronicoxy add group, galactosyloxy group, mannosyloxy group fucosyloxy group, xylosyloxy group, arabinosyloxy group, a rhamnosyloxy group, a glucosaminoxy group, or a galactosaminoxy group.
(69) In some embodiments, the glycosyl group may also be substituted with various groups. Such substitutions may include lower alkyl, lower alkoxy, acyl, carboxy, carboxyamino, amino, acetamido, halo, thio, nitro, keto, and phosphatyl groups. Such substitutions may be at one or more positions on the saccharide.
(70) Continuing to refer to the chemical compound having formula (I), in one embodiment, one of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyloxy group. Thus, in one embodiment, R.sub.2 can be a glycosyloxy group, each of R.sub.5, R.sub.6 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(71) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.4 can be a glycosyloxy group, and each of R.sub.2, R.sub.5, R.sub.6 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(72) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.5 can be a glycosyloxy group, and each of R.sub.2, R.sub.6 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(73) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.6 can be a glycosyloxy group, and each of R.sub.2, R.sub.5 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(74) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.7 can be a glycosyloxy group, and each of R.sub.2, R.sub.5 and R.sub.6 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(75) As noted previously noted, the glycosyl groups may be C-linked or O-linked. Examples of compounds comprising O-linked glycosyl groups in accordance herewith are hereinbefore described with reference to
(76) Still continuing to refer to the chemical compound having formula (I), in one embodiment, one of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a C-linked glycosyl group. Thus, in one embodiment, R.sub.2 can be a C-linked glycosyl group, each of R.sub.5, R.sub.6 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(77) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.4 can be a C-linked glycosyl group, and each of R.sub.2, R.sub.5, R.sub.6 and R.sub.7 can be a hydrogen atom (see: the example glycosylated psilocybin derivatives shown in
(78) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.5 can be a C-linked glycosyl group, and each of R.sub.2, R.sub.6 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(79) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.6 can be a C-linked glycosyl group, and each of R.sub.2, R.sub.5 and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(80) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.7 can be a C-linked glycosyl group, and each of R.sub.2, R.sub.5 and R.sub.6 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivatives shown in
(81) In some embodiments, two of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 of the chemical compound having formula (I) can be glycosyl groups. Thus, continuing to refer to the chemical compound having formula (I), in one embodiment, two of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyl group, wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6 and R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, and wherein R.sub.4, when it is not a glycosyl group, is a phosphate group, a hydrogen atom, or an alkyl group or O-alkyl group.
(82) Still continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.2 and R.sub.4 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.5, R.sub.6 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(83) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.2 and R.sub.5 can be glycosyl groups wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.6 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(84) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.2 and R.sub.6 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.5 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(85) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.2 and R.sub.7 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.5 and R.sub.6 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group and R.sub.4 can be a phosphate group, a hydrogen atom or alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(86) In one embodiment, R.sub.4 and R.sub.5 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.2, R.sub.6 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(87) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.4 and R.sub.6 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.2, R.sub.5 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(88) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.4 and R.sub.7 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.2, R.sub.5 and R.sub.6 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(89) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.5 and R.sub.6 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.2 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(90) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.5 and R.sub.7 can be glycosyl groups, wherein the glycosyl groups are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.2 and R.sub.6 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(91) Continuing to refer to the chemical compound having formula (I), in one embodiment, R.sub.6 and R.sub.7 can be glycosyl groups, wherein the glycosyl are independently selected from a glycosyloxy group or a C-linked glycosyl group, and R.sub.2 and R.sub.5 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(92) It is further noted that in embodiments hereof which include at least two glycosyl groups (as in the example compounds shown in
(93) It is further noted that in embodiments hereof which include at least two glycosyl groups, the glycosyl groups in some embodiments may all be identical glycosyl groups (e.g. two glucosyl groups, two galactosyl groups, three galactosyl groups etc.). In other embodiments, the glycosyl groups may be different glycosyl groups (e.g. a glucosyl and a fucosyl group; a fucosyl group and a galactosyl group; a glucosyl group, a fucosyl group and a lactosyl group etc.).
(94) Referring again to the chemical compound having formula (I), in one further embodiment, three of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and wherein the non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 substituents are independently selected from a hydrogen atom or an alkyl group or O-alkyl group, and wherein R.sub.4, when it is not a glycosyl group, is a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group.
(95) Thus, referring to the chemical compound having formula (I) again, in one embodiment R.sub.2, R.sub.4, and R.sub.5 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.6 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(96) Referring to the chemical compound having formula (I), in one embodiment, R.sub.2, R.sub.5, and R.sub.6 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(97) Referring to the chemical compound having formula (I), in one embodiment, R.sub.2, R.sub.5, and R.sub.7 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.6 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can a phosphate group, a hydrogen atom or alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(98) Referring to the chemical compound having formula (I), in one embodiment, R.sub.4, R.sub.5, and R.sub.6 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.2 and R.sub.7 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(99) Referring to the chemical compound having formula (I), in one embodiment, R.sub.4, R.sub.5, and R.sub.7 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.2 and R.sub.6 can be independently selected from a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(100) Referring to the chemical compound having formula (I), in one embodiment, R.sub.5, R.sub.6, and R.sub.7 can a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.2 can be a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(101) Referring to the chemical compound having formula (I), in one embodiment, three of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyloxy group, the remaining R.sub.2, R.sub.5, R.sub.6, and R.sub.7 being hydrogen atoms or alkyl group or O-alkyl groups, and R.sub.4 when it is not a glycosyloxy group, being a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: e.g. the psilocybin derivatives shown in
(102) In one embodiment, three of R.sub.2, Ra, R.sub.5, R.sub.6 and R.sub.7 can be a C-linked glycosyl groups, the remaining R.sub.2, R.sub.5, R.sub.6, and R.sub.7 being hydrogen atoms or alkyl group or O-alkyl groups, and R.sub.4 when it is not a glycosyl group, being a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group.
(103) In one embodiment, of the three glycosyl groups, at least one of R.sub.2, Ra, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyloxy group, and at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a C-linked glycosyl group, the remaining R.sub.2, R.sub.5, R.sub.6, or R.sub.7 being independently selected from a hydrogen atom and an alkyl group or O-alkyl group, and R.sub.4 when it is not a glycosyl group, being a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: e.g. the glycosylated psilocybin derivatives shown in
(104) Referring again to the chemical compound having formula (I), in one embodiment, four of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and wherein the non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, and wherein R.sub.4, when it is not a glycosyl group, is a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group.
(105) Thus, referring to the chemical compound having formula (I), in one embodiment, R.sub.2, R.sub.4, R.sub.5 and R.sub.6 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.7 can be a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(106) Referring to the chemical compound having formula (I), in one embodiment, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.2 can be a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(107) Referring to the chemical compound having formula (I), in one embodiment, R.sub.2, R.sub.5, R.sub.6 and R.sub.7 can be can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.4 can be a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(108) Referring to the chemical compound having formula (I), in one embodiment R.sub.2, R.sub.4, R.sub.6 and R.sub.7 can be can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.5 can be a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(109) Referring to the chemical compound having formula (I), in one embodiment R.sub.2, R.sub.4, R.sub.5 and R.sub.7 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group, and R.sub.6 can be a hydrogen atom or an alkyl group or O-alkyl group (see: the example glycosylated psilocybin derivative shown in
(110) In one embodiment, four of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyloxy group, the remaining R.sub.2, R.sub.5, R.sub.6, and R.sub.7 being a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 when it is not glycosylated, being a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: e.g. the glycosylated psilocybin derivatives shown in
(111) In one embodiment, four of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a C-linked glycosyl group, the remaining R.sub.2, R.sub.5, R.sub.6, and R.sub.7 being a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 when it is not a glycosylated, being a phosphate group, a hydrogen atom, or an alkyl group or O-alkyl group
(112) Referring again to the chemical compound having formula (I), in one embodiment, of the four glycosyl groups at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyloxy group, and, at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a C-linked glycosyl group, the remaining R.sub.2, R.sub.5, R.sub.6, or R.sub.7 being a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 when it is not a glycosyl group, being a phosphate group, a hydrogen atom or an alkyl group or O-alkyl group (see: e.g. the glycosylated psilocybin derivative shown in
(113) In one embodiment, all five of R.sub.2, R.sub.4, R.sub.5, R.sub.6 and R.sub.7 can be a glycosyl group, wherein the glycosyl groups are independently selected from a glycosyloxy group and C-linked glycosyl group
(114) In one embodiment, of all five glycosyl groups, at least two, at least three, at least four, or all five glycosyl groups can be glycosyloxy groups.
(115) In one embodiment, of all five glycosyl groups, at least two, at least three, at least four, or all five glycosyl groups can be C-linked glycosyl groups.
(116) It is noted that, in a further aspect hereof, R.sub.3A and R.sub.3B can be a hydrogen atom, an alkyl group, an aryl group or an acyl group. Thus, for example, R.sub.3A and R.sub.3B can each be a hydrogen atom, or R.sub.3A and R.sub.3B can each be an alkyl group, such as a methyl group, ethyl group, propyl group, or longer chain alkyl group, or R.sub.3A and R.sub.3B can each be an aryl group, such as a phenyl group or a naphthyl group, or R.sub.3A and R.sub.3B can each be an acyl group, such as an acetyl group. Furthermore, one of R.sub.3A and R.sub.3B can be a hydrogen atom, and one of R.sub.3A and R.sub.3B can be an, and aryl group, or an acyl group. Furthermore, R.sub.3A and R.sub.3B can be an aryl group and an alkyl group, an aryl group and an acyl group, or an alkyl group and an acyl group.
(117) Furthermore, in one embodiment, a glycosylated psilocybin derivative according to the present disclosure can be a chemical compound having the formula (III):
(118) ##STR00022##
or, a chemical compound having the formula (III), wherein the glycosyloxy group is substituted for a C-linked glycosyl group.
(119) Furthermore, in one embodiment, a glycosylated psilocybin derivative according to the present disclosure can be a chemical compound having the formula (IV):
(120) ##STR00023##
or, a chemical compound having the formula (IV), wherein the glycosyloxy group is substituted for a C-linked glycosyl group.
(121) It is noted that the glycosyl groups in compounds (III) and (IV) are known as -D-glucopyranose.
(122) Furthermore, in one embodiment, a glycosylated psilocybin derivative according to the present disclosure can be a chemical compound having the formula (V):
(123) ##STR00024##
or, a chemical compound having the formula (V), wherein the glycosyloxy group is substituted for a C-linked glycosyl group.
(124) Furthermore, in one embodiment, a glycosylated psilocybin derivative according to the present disclosure can be a chemical compound having the formula (VI):
(125) ##STR00025##
or, a chemical compound having the formula (VI), wherein the glycosyloxy group is substituted for a C-linked glycosyl group.
(126) It is noted that the glycosyl groups in compounds (V) and (VI) are known as -D-galactopyranose.
(127) Furthermore, it is noted that the glycosylated psilocybin derivatives of the present disclosure include salts thereof, including pharmaceutically acceptable salts. Thus, the nitrogen atom of the 2-aminoethyl group extending in turn from the C.sub.3 atom may be protonated, and the positive charge may be balanced by, for example, chloride or sulfate ions, to thereby form a chloride salt or a sulfate salt. Furthermore, in compounds wherein R.sub.4 is a phosphate group, the phosphate group may be de-protonated, and the negative charge may be balanced by, for example, sodium ions or potassium ions, to thereby form a sodium salt or a potassium salt.
(128) Furthermore, it is noted that when R.sub.4 is a phosphate group, the term glycosylated psilocybin derivative also includes compounds having the formula (VII):
(129) ##STR00026##
wherein at least one of R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein any R.sub.2, R.sub.5, R.sub.6, or R.sub.7 which are not a glycosyl group are a hydrogen atom or an alkyl group or O-alkyl group, and wherein R.sub.3A and R.sub.3B are a hydrogen atom, an alkyl group and aryl group or an acyl group. Further include are salts of glycosylated psilocybins having the formula (VII), such as a sodium salt, a potassium salt etc.
(130) Thus, to briefly recap, the present disclosure provides glycosylated psilocybin derivatives. The disclosure provides, in particular, a chemical compound or salt thereof having formula (I):
(131) ##STR00027##
wherein in an aspect, at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyloxy group. In an aspect, in formula (I), each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group. In a further aspect, in formula (I), R.sub.4 when it is not glycosylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group. Yet in a further aspect, R.sub.3A and R.sub.3B are a hydrogen atom, an alkyl group, an aryl group, or an acyl group.
(132) In one embodiment of the disclosure, a chemical compound or salt thereof having formula (I) is included:
(133) ##STR00028##
wherein at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, alkyl group or O-alkyl group, or a phosphate group, and wherein R.sub.3A and R.sub.3B are a hydrogen atom, an alkyl group, an aryl group, or an acyl group.
(134) In one embodiment, at least one of R.sub.2, Ra, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or a (C.sub.1-C.sub.20)-alkyl group or (C.sub.1-C.sub.20)O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, a (C.sub.1-C.sub.20)-alkyl group or (C.sub.1-C.sub.20)O-alkyl group, or a phosphate group.
(135) In another embodiment, each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or a (C.sub.1-C.sub.10)-alkyl group or (C.sub.1-C.sub.10)O-alkyl group. In another embodiment, each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or a (C.sub.1-C.sub.6)-alkyl group or (C.sub.1-C.sub.6)O-alkyl group. In another embodiment, each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom, a methyl group, ethyl group, a propyl group, an O-methyl group, an O-ethyl group, or an O-propyl group.
(136) In another embodiment, when R.sub.4 is not glycosylated, R.sub.4 is a hydrogen atom, a (C.sub.1-C.sub.20)-alkyl group or (C.sub.1-C.sub.20)O-alkyl group, or a phosphate group. In another embodiment, when R.sub.4 is not glycosylated, R.sub.4 is a hydrogen atom, a (C.sub.1-C.sub.10)-alkyl group or (C.sub.1-C.sub.10)O-alkyl group, or a phosphate group. In another embodiment, when R.sub.4 is not glycosylated, R.sub.4 is a hydrogen atom, a (C.sub.1-C.sub.6)-alkyl group or (C.sub.1-C.sub.6)O-alkyl group, or a phosphate group. In another embodiment, when R.sub.4 is not glycosylated, R.sub.4 is a hydrogen atom, a methyl group, an ethyl group, a propyl group, a phosphate group, an O-methyl group, an O-ethyl group, or an O-propyl group.
(137) In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a (C.sub.1-C.sub.20)-alkyl group, a (C.sub.6-C.sub.14)-aryl group, or a C(O)(C.sub.1-C.sub.20)-alkyl group. In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a (C.sub.1-C.sub.10)-alkyl group, a (C.sub.6-C.sub.10)-aryl group, or a C(O)(C.sub.1-C.sub.10)-alkyl group. In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a (C.sub.1-C.sub.6)-alkyl group, a phenyl group, or a C(O)(C.sub.1-C.sub.6)-alkyl group. In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a methyl group, an ethyl group, a propyl group, a phenyl group, C(O)CH.sub.3, C(O)CH.sub.2CH.sub.3, or C(O)CH.sub.2CH.sub.2CH.sub.3.
(138) In one embodiment of the disclosure, a chemical compound or salt thereof having formula (I) is included:
(139) ##STR00029##
wherein
R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are independently or simultaneously H, an alkyl group or O-alkyl group or a glycosyl group, R.sub.3A and R.sub.3B are a hydrogen atom, an alkyl group, an aryl group, or an acyl group; and R.sub.4 is hydrogen atom, alkyl group or O-alkyl group, a glycosyl group or a phosphate group; wherein at least one of R.sub.2, R.sub.4 R.sub.5, R.sub.6, and R.sub.7 is a glycosyl group.
(140) In one embodiment, R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are independently or simultaneously H, (C.sub.1-C.sub.20)-alkyl group or (C.sub.1-C.sub.20)O-alkyl group or a glycosyl group. In one embodiment, R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are independently or simultaneously H, (C.sub.1-C.sub.10)-alkyl group or (C.sub.1-C.sub.10)O-alkyl group or a glycosyl group. In one embodiment, R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are independently or simultaneously H, (C.sub.1-C.sub.6)-alkyl group or (C.sub.1-C.sub.6)O-alkyl group or a glycosyl group. In one embodiment, R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are independently or simultaneously H, methyl, ethyl, propyl, O-methyl, O-ethyl, O-propyl, or a glycosyl group.
(141) In one embodiment, R.sub.4 is H, (C.sub.1-C.sub.20)-alkyl group or (C.sub.1-C.sub.20)O-alkyl group, a glycosyl group or a phosphate group. In one embodiment, R.sub.4 is H, (C.sub.1-C.sub.10)-alkyl group or (C.sub.1-C.sub.10)O-alkyl group, a glycosyl group or a phosphate group. In one embodiment, R.sub.4 is H, (C.sub.1-C.sub.6)-alkyl group or (C.sub.1-C.sub.6)O-alkyl group, a glycosyl group or a phosphate group. In one embodiment, R.sub.4 is H, methyl, ethyl, propyl, O-methyl, O-ethyl, O-propyl, a glycosyl group, or a phosphate group.
(142) In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a (C.sub.1-C.sub.20-alkyl group, a (C.sub.6-C.sub.14)-aryl group, or a C(O)(C.sub.1-C.sub.20)-alkyl group. In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a (C.sub.1-C.sub.10)-alkyl group, a (C.sub.6-C.sub.10)-aryl group, or a C(O)(C.sub.1-C.sub.10)-alkyl group or O-alkyl group. In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a (C.sub.1-C.sub.6)-alkyl group, a phenyl group, or a C(O)(C.sub.1-C.sub.6)-alkyl group. In another embodiment, R.sub.3A and R.sub.3B are a hydrogen atom, a methyl group, an ethyl group, a propyl group, a phenyl group, C(O)CH.sub.3, C(O)CH.sub.2CH.sub.3, or C(O)CH.sub.2CH.sub.2CH.sub.3.
(143) The glycosylated psilocybin derivatives of the present disclosure may be used to prepare a pharmaceutical or recreational drug formulation. Thus in one embodiment, the present disclosure further provides in another aspect, pharmaceutical and recreational drug formulations comprising glycosylated psilocybin derivatives. Accordingly, in one aspect, the present disclosure provides in a further embodiment a pharmaceutical or recreational drug formulation comprising a chemical compound having formula (I):
(144) ##STR00030##
wherein at least one of R.sub.2, Ra, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein R.sub.3A and R.sub.3B are a hydrogen atom an alkyl group, an aryl group, or an acyl group, or a slat of the chemical compound, together with a diluent, carrier or excipient.
(145) The dose when using the compounds of the present disclosure can vary within wide limits, and as is customary and is known to those of skill in the art, the dose can be tailored to the individual conditions in each individual case. The dose depends, for example, on the nature and severity of the illness to be treated, on the condition of the patient, on the compound employed or on whether an acute or chronic disease state is treated or prophylaxis is conducted, on the mode of delivery of the compound, or on whether further active compounds are administered in addition to the compounds of the present disclosure. Representative doses of the present disclosure include, but are not limited to, about 0.001 mg to about 5000 mg, about 0.001 mg to about 2500 mg, about 0.001 mg to about 1000 mg, about 0.001 mg to about 500 mg, about 0.001 mg to about 250 mg, about 0.001 mg to about 100 mg, about 0.001 mg to about 50 mg, and about 0.001 mg to about 25 mg. Representative doses of the present disclosure include, but are not limited to, about 0.0001 to about 1,000 mg, about 10 to about 160 mg, about 10 mg, about 20 mg, about 40 mg, about 80 mg, or about 160 mg. Multiple doses may be administered during the day, especially when relatively large amounts are deemed to be needed, for example 2, 3 or 4, doses. Depending on the subject and as deemed appropriate from the patient's physician or care giver it may be necessary to deviate upward or downward from the doses described herein.
(146) The pharmaceutical or recreational drug formulations may be prepared as liquids, tablets, capsules, microcapsules, nanocapsules, trans-dermal patches, gels, foams, oils, aerosols, nanoparticulates, powders, creams, emulsions, micellar systems, films, sprays, ovules, infusions, teas, decoctions, suppositories, etc. and include a pharmaceutically acceptable salt or solvate of the glycosylated psilocybin compound together with an excipient. The term excipient as used herein means any ingredient other than the chemical compound of the disclosure. As will readily be appreciated by those of skill in art, the selection of excipient may depend on factors such as the particular mode of administration, the effect of the excipient on solubility of the chemical compounds of the present disclosure and methods for their preparation will be readily apparent to those skilled in the art. Such compositions and methods for their preparation may be found, for example, in Remington's Pharmaceutical Sciences, 22nd Edition (Pharmaceutical Press and Philadelphia College of Pharmacy at the University of the Sciences, 2012).
(147) The pharmaceutical and drug formulations comprising the glycosylated psilocybin derivatives of the present disclosure may be administered orally. Oral administration may involve swallowing, so that the compound enters the gastrointestinal tract, or buccal or sublingual administration may be employed by which the compound enters the blood stream directly from the mouth. Formulations suitable for oral administration include both solid and liquid formulations.
(148) Solid formulations include tablets, capsules (containing particulates, liquids, microcapsules, or powders), lozenges (including liquid-filled lozenges), chews, multi- and nano-particulates, gels, solid solutions, liposomal preparations, microencapsulated preparations, creams, films, ovules, suppositories and sprays.
(149) Liquid formulations include suspensions, solutions, syrups and elixirs. Such formulations may be employed as fillers in soft or hard capsules and typically comprise a carrier, for example, water, ethanol, polyethylene glycol, propylene glycol, methylcellulose, or a suitable oil, and one or more emulsifying agents and/or suspending agents. Liquid formulations may also be prepared by the reconstitution of a solid, for example, from a sachet.
(150) Binders are generally used to impart cohesive qualities to a tablet formulation. Suitable binders include microcrystalline cellulose, gelatin, sugars, polyethylene glycol, natural and synthetic gums, polyvinylpyrrolidone, pregelatinized starch, hydroxypropyl cellulose and hydroxypropyl methylcellulose.
(151) Tablets may also contain diluents, such as lactose (monohydrate, spray-dried monohydrate, anhydrous and the like), mannitol, xylitol, dextrose, sucrose, sorbitol, microcrystalline cellulose, starch and dibasic calcium phosphate dihydrate.
(152) Tablets may also optionally comprise surface active agents, such as sodium lauryl sulfate and polysorbate 80. When present, surface active agents may comprise from 0.2% (w/w) to 5% (w/w) of the tablet.
(153) Tablets may further contain lubricants such as magnesium stearate, calcium stearate, zinc stearate, sodium stearyl fumarate, and mixtures of magnesium stearate with sodium lauryl sulphate. Lubricants generally comprise from 0.25% (w/w) to 10% (w/w), from 0.5% (w/w) to 3% (w/w) of the tablet.
(154) In addition to the glycosylated psilocybin derivative, tablets may contain a disintegrant. Examples of disintegrants include sodium starch glycolate, sodium carboxymethyl cellulose, calcium carboxymethyl cellulose, croscarmellose sodium, crospovidone, polyvinylpyrrolidone, methyl cellulose, microcrystalline cellulose, lower alkyl-substituted hydroxypropyl cellulose, starch, pregelatinized starch and sodium alginate. Generally, the disintegrant will comprise from 1% (w/w) to 25% (w/w) or from 5% (w/w) to 20% (w/w) of the dosage form.
(155) Other possible auxiliary ingredients include anti-oxidants, colourants, flavouring agents, preservatives and taste-masking agents.
(156) For tablet dosage forms, depending on the desired effective amount of the chemical compound, the chemical compound of the present disclosure may make up from 1% (w/w) to 80% (w/w) of the dosage form, more typically from 5% (w/w) to 60% (w/w) of the dosage form.
(157) Exemplary tablets contain up to about 80% (w/w) of the chemical compound, from about 10% (w/w) to about 90% (w/w) binder, from about 0% (w/w) to about 85% (w/w) diluent, from about 2% (w/w) to about 10% (w/w) disintegrant, and from about 0.25% (w/w) to about 10% (w/w) lubricant.
(158) The formulation of tablets is discussed in Pharmaceutical Dosage Forms: Tablets, Vol. 1-Vol. 3, by CRC Press (2008).
(159) The pharmaceutical and recreational drug formulations comprising the glycosylated psilocybin derivatives of the present disclosure may also be administered directly into the blood stream, into muscle, or into an internal organ. Thus, the pharmaceutical and recreational drug formulations can be administered parenterally (for example, by subcutaneous, intravenous, intraarterial, intrathecal, intraventricular, intracranial, intramuscular, or intraperitoneal injection). Parenteral formulations are typically aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (in one embodiment, to a pH of from 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile water.
(160) Formulations comprising the glycosylated psilocybin derivatives of the present disclosure for parenteral administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release. Thus the chemical compounds of the disclosure may be formulated as a solid, semi-solid, or thixotropic liquid for administration as an implanted depot providing modified release of the active compound. Examples of such formulations include drug-coated stents and poly(dl-lactic-coglycolic) acid (PGLA) microspheres.
(161) The pharmaceutical or recreational drug formulations of the present disclosure also may be administered topically to the skin or mucosa, i.e. dermally or transdermally. Example pharmaceutical and recreational drug formulations for this purpose include gels, hydrogels, lotions, solutions, creams, ointments, dusting powders, cosmetics, oils, eye drops, dressings, foams, films, skin patches, wafers, implants, sponges, fibres, bandages and microemulsions. Liposomes may also be used. Example carriers include alcohol, water, mineral oil, liquid petrolatum, white petrolatum, glycerin, polyethylene glycol and propylene glycol. Penetration enhancers may be incorporate (see: for example, Finnin, B. and Morgan, T. M., 1999 J. Pharm. Sci, 88 (10), 955-958).
(162) Other means of topical administration include delivery by electroporation, iontophoresis, phonophoresis, sonophoresis and microneedle or needle-free (e.g. Powderject, Bioject, etc.) injection.
(163) Pharmaceutical and recreational drug formulations for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders. The liquid or solid pharmaceutical compositions can contain suitable pharmaceutically acceptable excipients. In some embodiments, the pharmaceutical compositions are administered by the oral or nasal respiratory route for local or systemic effect. Pharmaceutical compositions in pharmaceutically acceptable solvents can be nebulized by use of inert gases. Nebulized solutions can be inhaled directly from the nebulizing device or the nebulizing device can be attached to a face mask tent, or intermittent positive pressure breathing machine. Solution, suspension, or powder pharmaceutical compositions can be administered, e.g., orally or nasally, from devices that deliver the formulation in an appropriate manner.
(164) In further embodiments, in which the glycosylated psilocybin compounds of present disclosure are used as a recreational drug, the compounds may be included in compositions such as a food or food product, a beverage, a food seasoning, a personal care product, such as a cosmetic, perfume or bath oil, or oils (both for topical administration as massage oil, or to be burned or aerosolized). The chemical compounds of the present disclosure may also be included in a vape product, which may also include other drugs, such as nicotine, and flavorings.
(165) The pharmaceutical formulations comprising the chemical compounds of the present disclosure may be used to treat a subject, and in particular to treat a psychiatric disorder in a subject. Accordingly, the present disclosure includes in a further embodiment, a method for treating a psychiatric disorder, the method comprising administering to a subject in need thereof a pharmaceutical formulation comprising a chemical compound or salt thereof having formula (I):
(166) ##STR00031##
wherein at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein R.sub.3A and R.sub.3B are a hydrogen atom, an alkyl group, an aryl group, or an acyl group, together with a diluent, carrier or excipient.
(167) Psychiatric disorders that may be treated include, for example, neurodevelopmental disorders such as intellectual disability, global development delay, communication disorders, autism spectrum disorder, and attention-deficit hyperactivity disorder (ADHD); bipolar and related disorders, such as mania, and depressive episodes; anxiety disorder, such as generalized anxiety disorder (GAD), agoraphobia, social anxiety disorder, specific phobias (natural events, medical, animal, situational, for example), panic disorder, and separation anxiety disorder; stress disorders, such as acute stress disorder, adjustment disorders, post-traumatic stress disorder (PTSD), and reactive attachment disorder; dissociative disorders, such as dissociative amnesia, dissociative identity disorder, and depersonalization/derealization disorder; somatoform disorders, such as somatic symptom disorders, illness anxiety disorder, conversion disorder, and factitious disorder; eating disorders, such as anorexia nervosa, bulimia nervosa, rumination disorder, pica, and binge-eating disorder; sleep disorders, such as narcolepsy, insomnia disorder, hypersomnolence, breathing-related sleep disorders, parasomnias, and restless legs syndrome; disruptive disorders, such as kleptomania, pyromania, intermittent explosive disorder, conduct disorder, and oppositional defiant disorder; depressive disorders, such as disruptive mood dysregulation disorder, major depressive disorder, persistent depressive disorder (dysthymia), premenstrual dysphoric disorder, substance/medication-induced depressive disorder, postpartum depression, and depressive disorder caused by another medical condition, for example, psychiatric and existential distress within life-threatening cancer situations (ACS Pharmacol. Transl. Sci. 4: 553-562; J Psychiatr Res 137: 273-282); substance-related disorders, such as alcohol-related disorders, cannabis related disorders, inhalant-use related disorders, stimulant use disorders, and tobacco use disorders; neurocognitive disorders, such as delirium; schizophrenia; compulsive disorders, such as obsessive compulsive disorders (OCD), body dysmorphic disorder, hoarding disorder, trichotillomania disorder, excoriation disorder, substance/medication induced obsessive-compulsive disorder, and obsessive-compulsive disorder related to another medical condition; and personality disorders, such as antisocial personality disorder, avoidant personality disorder, borderline personality disorder, dependent personality disorder, histrionic personality disorder, narcissistic personality disorder, obsessive-compulsive personality disorder, paranoid personality disorder, schizoid personality disorder, schizotypal personality disorder.
(168) In an aspect, the compounds of the present disclosure may be used to be contacted with a 5-HT.sub.2A receptor to thereby modulate the 5-HT.sub.2A receptor. Such contacting includes bringing a compound of the present disclosure and 5-HT.sub.2A receptor together under in vitro conditions, for example, by introducing the compounds in a sample containing a 5-HT.sub.2A receptor, for example, a sample containing purified 5-HT.sub.2A receptors, or a sample containing cells comprising 5-HT.sub.2A receptors. In vitro conditions further include the conditions described in Example 3 hereof. Contacting further includes bringing a compound of the present disclosure and 5-HT.sub.2A receptor together under in vivo conditions. Such in vivo conditions include the administration to an animal or human subject, for example, of a pharmaceutically effective amount of the compound of the present disclosure, when the compound is formulated together with a pharmaceutically active carrier, diluent or excipient, as hereinbefore described, to thereby treat the subject. Upon having contacted the 5-HT.sub.2A receptor, the compound may activate the 5-HT.sub.2A receptor or inhibit the 5-HT.sub.2A receptor.
(169) Thus, in a further aspect, the condition that may be treated in accordance herewith can be any 5-HT.sub.2A receptor mediated disorder. Such disorders include, but are not limited to schizophrenia, psychotic disorder, attention deficit hyperactivity disorder, autism, and bipolar disorder.
(170) Turning now to methods of making the glycosylated psilocybin derivatives of the present disclosure, it is initially noted that the glycosylated psilocybin derivatives of the present disclosure may be prepared in any suitable manner, including by any organic chemical synthesis methods, biosynthetic methods, or a combination thereof.
(171) One suitable method of to making the glycosylated psilocybin derivatives of the present disclosure initially involves selecting and obtaining or preparing a hydroxy-containing psilocybin derivative compound. Suitable hydroxy-containing psilocybin derivative compounds include compounds comprising an indole prototype structure (see:
(172) ##STR00032##
wherein at least one of R.sub.2, Ra, R.sub.5, R.sub.6, or R.sub.7 is a hydroxy group, and wherein each non-hydroxylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.3 is a hydrogen atom, 2-aminoethyl group, or an N-substituted 2-aminoethyl group, and wherein R.sub.4 when it is not hydroxylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group. Hydroxy-containing psilocybin derivative compound (II) comprises a plurality of compounds, some examples of which will next be described.
(173) In one example embodiment, the hydroxy-containing psilocybin derivative can be selected to be a chemical compound wherein R.sub.2 is a hydroxy group, R.sub.5, R.sub.6, and R.sub.7 are a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 is hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein the 2-aminoethyl group comprises R.sub.3A and R.sub.3B which are a hydrogen atom an alkyl group or O-alkyl group, such as, for example, the hydroxy-containing psilocybin derivative shown in
(174) In one example embodiment, the hydroxy-containing psilocybin derivative can be selected to be a chemical compound wherein R.sub.4 can be a hydroxy group, R.sub.2, R.sub.5, R.sub.6, and R.sub.7 are a hydrogen atom or an alkyl group or O-alkyl group, and wherein the 2-aminoethyl group comprises R.sub.3A and R.sub.3B which are a hydrogen atom or an alkyl group, such as, for example, the hydroxy-containing psilocybin derivative shown in
(175) In one example embodiment, the hydroxy-containing psilocybin derivative can be selected to be a chemical compound wherein R.sub.5 can be a hydroxy group, R.sub.2, R.sub.6, and R.sub.7 are a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 is hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein the 2-aminoethyl group comprises R.sub.3A and R.sub.3B which are a hydrogen atom or an alkyl group, such as, for example, the hydroxy-containing psilocybin derivative shown in
(176) In one example embodiment, the hydroxy-containing psilocybin derivative can be selected to be a chemical compound wherein R.sub.6 can be a hydroxy group, R.sub.2, R.sub.5, and R.sub.7 are a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 is hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein the 2-aminoethyl group comprises R.sub.3A and R.sub.3B which are a hydrogen atom or an alkyl group, such as, for example, the hydroxy-containing psilocybin derivative shown in
(177) In one example embodiment, the hydroxy-containing psilocybin derivative can be selected to be a chemical compound wherein R.sub.7 can be a hydroxy group, R.sub.2, R.sub.5, and R.sub.6 are a hydrogen atom or an alkyl group or O-alkyl group, and R.sub.4 is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein the 2-aminoethyl group comprises which R.sub.3A and R.sub.3B are a hydrogen atom or an alkyl group, such as, for example, the hydroxy-containing psilocybin derivative shown in
(178) The hydroxy-containing psilocybin derivative compounds may be provided in a more or less chemically pure form, for example, in the form of a hydroxy-containing psilocybin derivative preparation having a purity of at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least 99.9%. The hydroxy-containing psilocybin derivative may be chemically synthesized, or obtained from a fine chemical manufacturer.
(179) Turning now to the glycosyl compounds, in general, in accordance herewith any glycosyl compound may be selected, obtained or prepared and used. Suitable glycosyl compounds include, for example, hexosyl or pentosyl compounds. Further suitable compounds include mono-saccharides, disaccharides, tri-saccharides and poly-saccharides.
(180) In an example embodiment, glycosyl compounds which may be selected are glucose and glucosyl containing compounds and glucose and glucosyl derivatives, such as uridine diphosphate glucose (UDP-glucose).
(181) In a further example embodiment, glycosyl compounds which may be selected are glucuronic acid and derivatives thereof.
(182) In a further example embodiment, glycosyl compounds which may be selected are galactose and galactosyl containing compounds and galactose and galactosyl derivatives, such as uridine diphosphate galactose (UDP-galactose).
(183) In a further example embodiment, glycosyl compounds which may be selected are mannose and derivatives thereof.
(184) In a further example embodiment, glycosyl compounds which may be selected are fucose and fucosyl containing compounds and fucose and fucosyl derivatives.
(185) In a further example embodiment, glycosyl compounds which may be selected are xylose and derivatives thereof,
(186) In a further example embodiment, glycosyl compounds which may be selected are arabinose and derivatives thereof.
(187) In a yet further example embodiment, glycosyl compounds which may be selected are and rhamnose and derivatives thereof.
(188) The glycosyl compound may be provided in a more or less chemically pure form, for example, in the form of a glycosyl compound preparation having a purity of at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least 99.9%. The glycosyl compound may be chemically synthesized, or obtained from a fine chemical manufacturer.
(189) Thus, initially, in an aspect hereof, a hydroxy-containing psilocybin derivative and a glycosyl compound and glycosyl transferase are provided, and the hydroxy-containing psilocybin derivative compound and a glycosyl compound are contacted to react in a chemical reaction resulting in the formation of a glycosylated psilocybin derivative compound.
(190) Referring now to
(191) Thus, it will now be clear that, in an aspect hereof, the hydroxy-containing psilocybin derivatives disclosed herein may be reacted with glycosyl compounds to form the glycosylated psilocybin derivatives of the present disclosure. Thus, in addition to 4-hydroxy-psilocybin shown in
(192) Referring now to
(193) Referring now to
(194) It is noted that following synthesis the desired glycosyl derivative psilocybin compounds may be separated from other reactants and obtained in more or less pure form, for example, in at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% pure form, using purification methods generally known to those of skill in the art.
(195) Thus, It is noted that the reactions depicted in
(196) Thus, it will now be clear that, in an aspect hereof, other glycosyl psilocybin derivatives can be formed by following a similar reaction sequence reaction using an indole derivative that contains one or more hydroxyl groups on the indole ring, as a starting material. The 2,3,4,6-tetra-O-acetyl--D-glucopyranosyl/galactopyranosyl bromides can be changed to other glycosyl halides to form the desired glycosidic bond. The glycosyl bromide can be changed to other types of glycosyl donors such as glycosyl imidates, thioglycoside, glycosyl fluoride, glycosyl 1-O-acetate etc. with different protecting group patterns. Using well-established activation conditions, the corresponding - or -glycosylated psilocybin derivatives disclosed herein may be synthesized. If a Lewis acid is used to promote the glycosylation, the corresponding C-glycosides can also be prepared by following literature conditions (see: Ref: (1) T. Matsumoto, M. Katsuki, and K. Suzuki, Tetrahedron Lett., 29, 6935-6938 (1988); (2) Y. Li, G. Wei, B. Yu, Carbohydr. Res., 341, 2717-2722). The amount of aldehyde/ketone used in the final reductive amination step can be controlled to allow mono- or di-alkylation. Instead of using reductive amination, the amine functionality can also be N-alkylated using an appropriate alkylating reagent such as an alkyl halides, alkyl p-tosylate/mesylate/triflate or / conjugated reagents to afford higher substituted amines or quaternary ammonium salts. Multiple N-alkylations can be carried out in one-pot or stepwise manner using the same or different alkyl halides. The amine functionality can also be N-acylated using an appropriate acylating reagent such as an acid anhydride or acyl halide. Thus, in addition to 4-hydroxy-psilocybin shown in
(197) In general, the reactants are reacted under reaction conditions which permit the reactants to chemically react with each other and form a product, i.e. the glycosylated psilocybin derivatives of the present disclosure. Such reactions conditions may be selected, adjusted and optimized as known by those of skill in the art. Thus, for example, as is known to those of skill in the art, it is noted that the reaction may be catalyzed by initially preparing a glycosyl derivative compound to enhance the reactivity between the glycosyl compound and the hydroxy-containing psilocybin derivative. Thus, for example, the anomeric carbon of the glycosyl compound may be complexed with a halogen, such as bromide and chloride, and furthermore the reaction may be performed in the presence of, for example, Ag.sub.2CO.sub.3 or another heavy metal based compound, which can act as an acid (HCl or HBr) scavenger. Other glycosyl compound derivatives that may be used include acylate (such as acetate), imidate (such as trichloroacetimidate), thioalkyl or thioaryl of glycosyl compound derivatives.
(198) The reactions may be conducted in any suitable reaction vessel (e.g. a tube, bottle). Suitable solvents that may be used are polar solvents such as, for example, dichloromethane, dichloroethane, toluene, and so called participating solvents such as acetonitrile and diethyl ether. Suitable temperatures may range from, for example, e.g. from about 78 C. to about 60 C. Furthermore, catalysts, also known as promoters, may be included in the reaction such as iodonium dicollidine perchlorate (IDCP), any silver or mercury salts, trimethylsilyl trifluoromethanesulfonate (TMS-triflate, TMSOTf), or trifluoronmethanesulfonic acid (triflic acid, TfOH), N-iodosuccinimide, methyl triflate. Furthermore, reaction times may be varied. As will readily be appreciated by those of skill in the art, the reaction conditions may be optimized, for example by preparing several glycosyl compound preparations and hydroxy-containing psilocybin derivative preparations and reacting these in different reaction vessels under different reaction conditions, for example, different temperatures, using different solvents etc., evaluating the obtained glycosylated psilocybin derivative reaction product, adjusting reaction conditions, and selecting a desired reaction condition. Further general guidance regarding appropriate reaction conditions for performing glycosylation reactions may be found in Demchenko, A., handbook of chemical glycosylation: advances in stereoselectivity and therapeutic relevance, 2008, Wiley-VCH Verlag GmbH.
(199) In one example embodiment, the reaction may be catalyzed by a glucosyl transferase. Referring now to
(200) The reaction shown in
(201) In one embodiment of the present disclosure the glycosylated psilocybin derivatives may be formed biosynthetically. Accordingly, the present disclosure further includes in one embodiment, a method of making a glycosylated psilocybin derivative the method comprising: (a) contacting a hydroxy-containing psilocybin derivative compound with a host cell comprising a glycosyl transferase, wherein the hydroxy-containing psilocybin derivative compound or salt thereof has the chemical formula (II):
(202) ##STR00033## wherein at least one of R.sub.2, Ra, R.sub.5, R.sub.6, or R.sub.7 is a hydroxy group, and wherein each non-hydroxylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.3 is a hydrogen atom, a 2-aminoethyl group, or an N-substituted 2-aminoethyl amino group, wherein R.sub.4 when it is not hydroxylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and (b) growing the host cell to produce a glycosylated psilocybin derivative compound or salt thereof having formula (I):
(203) ##STR00034## wherein at least one of R.sub.2, R.sub.4, R.sub.5, R.sub.6, or R.sub.7 is a glycosyl group, and wherein each non-glycosylated R.sub.2, R.sub.5, R.sub.6, or R.sub.7 is a hydrogen atom or an alkyl group or O-alkyl group, wherein R.sub.4 when it is not glycosylated is a hydrogen atom, an alkyl group or O-alkyl group or a phosphate group, and wherein R.sub.3A and R.sub.3B are a hydrogen atom, an alkyl group, an aryl group, an acyl group.
(204) Implementation of the foregoing example embodiment initially involves providing hydroxy-containing psilocybin precursor compounds and host cells comprising a glycosyl transferase. Accordingly, next, exemplary hydroxy-containing psilocybin compounds and example host cells that may be selected and used in accordance with the present disclosure will be described. Thereafter, example methodologies and techniques will be described to contact and use the hydroxy-containing psilocybin precursor compounds and cells to produce example glycosylated psilocybin compounds.
(205) In general any hydroxy-containing compounds of the formula (II) may be used including any and all of the hereinbefore described hydroxy compounds, such as, for example the compounds shown in
(206) Turning now to the host cells that can be used in accordance with the present disclosure, it is initially noted that a variety of host cells may be selected in accordance with the present disclosure, including microorganism host cells, plant host cells, and animal host cells.
(207) In accordance herewith the host cell include a glycosyl transferase. Such cells can be obtained in at least two ways. First, in some embodiments, host cells may be selected in which a glycosyl transferase is naturally present. Second, in some embodiments, a host cell that not naturally produces a suitable glycosyl transferase may modulated to produce a glycosyl transferase. Thus, for example, a nucleic acid sequence encoding a glycosyl transferase may be introduced into a host cell, and upon cell growth the host cells can make the glycosyl transferase.
(208) Typically, a nucleic acid sequence encoding a glycosyl transferase further includes one or more additional nucleic acid sequences, for example, a nucleic acid sequences controlling expression of the glycosyl transferase, and these one or more additional nucleic acid sequences together with the nucleic acid sequence encoding the glycosyl transferase can be said to form a chimeric nucleic acid sequence.
(209) A host cell which upon cultivation expresses the chimeric nucleic acid can be selected and used in accordance with the present disclosure. Suitable host cells in this respect include, for example, microbial cells, such as bacterial cells, yeast cells, for example, and algal cells or plant cells. A variety of techniques and methodologies to manipulate host cells to introduce nucleic acid sequences in cells and attain expression exists and are well known to the skilled artisan. These methods include, for example, cation based methods, for example, lithium ion or calcium ion based methods, electroporation, biolistics, and glass beads based methods. As will be known to those of skill in the art, depending on the host cell selected, the methodology to introduce nucleic acid material in the host cell may vary, and, furthermore, methodologies may be optimized for uptake of nucleic acid material by the host cell, for example, by comparing uptake of nucleic acid material using different conditions. Detailed guidance can be found, for example, in Sambrook et al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor Laboratory Press, 2012, Fourth Ed. It is noted that the chimeric nucleic acid is a non-naturally occurring chimeric nucleic acid sequence and can be said to be heterologous to the host cell.
(210) In some embodiments, the glycosyl transferase can be selected a nucleic acid sequence selected from the nucleic acid sequences consisting of: (a) SEQ.ID NO: 1, SEQ.ID NO: 3, SEQ.ID NO: 5, SEQ.ID NO: 7, and SEQ.ID NO: 9; (b) a nucleic acid sequence that is substantially identical to any one of the nucleic acid sequences of (a); (c) a nucleic acid sequence that is substantially identical to any one of the nucleic acid sequences of (a) but for the degeneration of the genetic code; (d) a nucleic acid sequence that is complementary to any one of the nucleic acid sequences of (a); (e) a nucleic acid sequence encoding a polypeptide having any one of the amino acid sequences set forth in SEQ.ID NO: 2, SEQ.ID NO: 4, SEQ.ID NO: 6, SEQ.ID NO: 8, and SEQ.ID NO: 10; (f) a nucleic acid sequence that encodes a functional variant of any one of the amino acid sequences set forth in SEQ.ID NO: 2, SEQ.ID NO: 4, SEQ.ID NO: 6, SEQ.ID NO: 8, and SEQ.ID NO: 10; and (g) a nucleic acid sequence that hybridizes under stringent conditions to any one of the nucleic acid sequences set forth in (a), (b), (c), (d), (e) or (f).
(211) Thus any of the nucleic acid sequences set forth in (a), (b), (c), (d), (e), (f) or (g) may be selected and introduced into a host cell.
(212) One example host cell that conveniently may be used is Escherichia coll. The preparation of the E. coli vectors may be accomplished using commonly known techniques such as restriction digestion, ligation, gel electrophoresis, DNA sequencing, the polymerase chain reaction (PCR) and other methodologies. A wide variety of cloning vectors is available to perform the necessary steps required to prepare a recombinant expression vector. Among the vectors with a replication system functional in E. coli, are vectors such as pBR322, the pUC series of vectors, the M13 mp series of vectors, pBluescript etc. Suitable promoter sequences for use in E. coli include, for example, the T7 promoter, the T5 promoter, tryptophan (trp) promoter, lactose (lac) promoter, tryptophan/lactose (tac) promoter, lipoprotein (lpp) promoter, and phage PL promoter. Typically, cloning vectors contain a marker, for example, an antibiotic resistance marker, such as ampicillin or kanamycin resistance marker, allowing selection of transformed cells. Nucleic acid sequences may be introduced in these vectors, and the vectors may be introduced in E. coli by preparing competent cells, electroporation or using other well known methodologies to a person of skill in the art. E. coli may be grown in an appropriate medium, such as Luria-Broth medium and harvested. Recombinant expression vectors may readily be recovered from cells upon harvesting and lysing of the cells.
(213) Another example host cell that may be conveniently used is a yeast cell. Example yeast host cells that can be used are yeast cells belonging to the genus Candida, Kiuyverornyces, Saccharomyces, Schizosaccharomyces, Pichia, Hansenula, and Yarrowia. In specific example embodiments, the yeast cell can be a Saccharomyces cerevisiae cell, a Yarrowia lipolytica cell, or Pichia pastoris cell.
(214) A number of vectors exist for the expression of recombinant proteins in yeast host cells. Examples of vectors that may be used in yeast host cells include, for example, Yip type vectors, YEp type vectors, YRp type vectors, YCp type vectors, pGPD-2, pAO815, pGAPZ, pGAPZ, pHIL-D2, pHIL-S1, pPIC3.5K, pPIC9K, pPICZ, pPICZ, pPIC3K, pHWO10, pPUZZLE and 2 m plasmids. Such vectors are known to the art and are, for example, described in Gregg et al., Mol Biotechnol. (2000) 16(1): 23-52. Suitable promoter sequences for use in yeast host cells are also known and described, for example, in Mattanovich et al., Methods Mot Biol., 2012, 824:329-58, and in Romanos et al., 1992, Yeast 8: 423-488. Examples of suitable promoters for use in yeast host cells include promoters of glycolytic, enzymes, like triosephosphate isomerase (TPI), phosphoglycerate Kinase (PGK), glyceraldehyde-3-phosphate dehydrogenase (GAPDH or GAP) and variants thereof, lactase (LAC) and galactosidase (GAL), P. pastoris glucose-6-phosphate isomerase promoter (PPG), the 3-phosphoglycerate kinase promoter (PP K), the glycerol aldehyde phosphate dehydrogenase promoter (PGAP), translation elongation factor promoter (PTEF), S. cerevisiae enolase (ENO-1), S cerevisiae galactokinase (GAL1), S. cerevisiae alcohol dehydrogenase/glyceraldehyde-3-phosphate dehydrogenase (ADH1, ADH2/GAP), S. cerevisiae triose phosphate isomerase (TPI), S. cerevisiae metallothionein (CUP1), and S. cerevisiae 3-phosphoglycerate kinase (PGK), and the maltase gene promoter (MAL), Marker genes suitable for use in yeast host cells are also known to the art. Thus, antibiotic resistance markers, such as ampicillin resistance markers, can be used in yeast, as well as marker genes providing genetic functions for essential nutrients, for example, leucine (LEU2), tryptophan (TRP1 and TRP2), uracil (URA3, URA5, URA6), histidine (HIS3), and the like. Methods for introducing vectors into yeast host cells can, for example, be found in S. Kawai et al., 2010, Bioeng. Bugs 1(6): 395-403.
(215) Further, guidance with respect to the preparation of expression vectors and introduction thereof into host cells, including in E. coli cells, yeast cells, and other host cells, may be found in, for example: Sambrook et al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor Laboratory Press, 2012, Fourth Ed.
(216) Thus, to briefly recap, a host cell comprising a chimeric nucleic acid comprising (i) a nucleic acid sequence controlling expression in a host cell and (ii) a nucleic acid sequence encoding a glycosyl transferase, can be prepared in accordance with the present disclosure.
(217) In accordance herewith, host cells are grown to multiply and to express a chimeric nucleic acid. Expression of the chimeric nucleic acid results in the biosynthetic production in the host cell of a glycosyl transferase. Growth media and growth conditions can vary depending on the host cell that is selected, as will be readily appreciated to those of ordinary skill in the art. Growth media typically contain a carbon source, one or several nitrogen sources, essential salts including salts of potassium, sodium, magnesium, phosphate and sulphate, trace metals, water soluble vitamins, and process aids including but not limited to antifoam agents, protease inhibitors, stabilizers, ligands and inducers. Example carbon sources are e.g. mono- or disaccharides. Example nitrogen sources are, e.g. ammonia, urea, amino adds, yeast extract, corn steep liquor and fully or partially hydrolyzed proteins. Example trace metals are e.g., Fe, Zn, Mn, Cu, Mo and H.sub.3BO.sub.3. Example water soluble vitamins are e.g. biotin, pantothenate, niacin, thiamine, p-aminobenzoic acid, choline, pyridoxine, folic add, riboflavin and ascorbic add. Further, specific example media include liquid culture media for the growth of yeast cells and bacterial cells including, Luria-Bertani (LB) broth for bacterial cell cultivation, and yeast extract peptone dextrose (YEPD or YPD), for yeast cell cultivation. Further media and growth conditions can be found in Sambrook et al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor Laboratory Press, 2012, Fourth Ed.
(218) In order for the host cells to produce the glycosylated psilocybin, the cells are provided with a hydroxyl-containing psilocybin derivative. Thus, in accordance herewith, host cells may be contacted with a hydroxyl-containing psilocybin derivative. The psilocybin precursor compound can be exogenously supplied, for example, by including a hydroxyl-containing psilocybin derivative in the growth medium of the host cells, and growing the host cells in a medium including the hydroxyl-containing psilocybin derivative.
(219) Upon production by the host cells of the glycosylated psilocybin compounds in accordance with the methods of the present disclosure, the glycosylated psilocybin compounds may be extracted from the host cell suspension, and separated from other constituents within the host cell suspension, such as media constituents and cellular debris. Separation techniques will be known to those of skill in the art and include, for example, solvent extraction (e.g. butane, chloroform, ethanol), column chromatography based techniques, high-performance liquid chromatography (HPLC), for example, and/or countercurrent separation (CCS) based systems. The recovered glycosylated psilocybin compounds may be obtained in a more or less pure form, for example, a preparation of glycosylated psilocybin compounds of at least about 60% (w/v), about 70% (w/v), about 80% (w/v), about 90% (w/v), about 95% (w/v) or about 99% (w/v) purity may be obtained. Thus, in this manner, glycosylated psilocybin derivatives in more or less pure form may be prepared.
(220) It will now be clear form the foregoing that novel glycosylated psilocybin derivatives are disclosed herein, as well as methods of making glycosylated psilocybin derivatives. The glycosylated psilocybin compounds may be formulated for use as a pharmaceutical drug or recreational drug.
(221) Summary of Sequences
(222) SEQ.ID NO: 1 sets forth a human nucleic acid sequence encoding a human glycosyl transferase polypeptide.
(223) SEQ.ID NO: 2 sets forth a deduced amino acid sequence of a human glycosyl transferase polypeptide.
(224) SEQ.ID NO: 3 sets forth a human nucleic acid sequence encoding another glycosyl transferase polypeptide.
(225) SEQ.ID NO: 4 sets forth a deduced amino acid sequence of another human glycosyl transferase polypeptide.
(226) SEQ.ID NO: 5 sets forth a human nucleic acid sequence encoding another glycosyl transferase polypeptide.
(227) SEQ.ID NO: 6 sets forth a deduced amino acid sequence of another human glycosyl transferase polypeptide.
(228) SEQ.ID NO: 7 sets forth a human nucleic acid sequence encoding another glycosyl transferase polypeptide.
(229) SEQ.ID NO: 8 sets forth a deduced amino acid sequence of another human glycosyl transferase polypeptide.
(230) SEQ.ID NO: 9 sets forth a human nucleic acid sequence encoding another glycosyl transferase polypeptide.
(231) SEQ.ID NO: 10 sets forth a deduced amino acid sequence of another human glycosyl transferase polypeptide.
(232) TABLE-US-00001 SEQUENCELISTING SEQ.IDNO:1 ATGGCTCGCGCAGGGTGGACCAGCCCCGTTCCTTTATGTGTGTGTCTACTGCTGACCTGTGGCTTTGCCGAGG CAGGGAAGCTGCTGGTAGTGCCCATGGATGGGAGTCACTGGTTCACCATGCAGTCGGTGGTGGAGAAACTTAT CCTCAGGGGGCATGAGGTGGTTGTAGTCATGCCAGAGGTGAGTTGGCAACTGGAAAGATCACTGAATTGCACA GTGAAGACTTACTCAACCTCGTACACTCTGGAAGATCAGAACCGGGAATTCATGGTTTTCGCCCATGCTCAAT GGAAAGCACAGGCACAAAGTATATTTTCTCTATTAATGAGTTCATCCAGTGGTTTTCTTGACTTATTTTTTTC GCATTGCAGGAGTTTGTTTAATGACCGAAAATTAGTAGAATACTTAAAGGAGAGTTCTTTTGATGCAGTGTTT CTGGATCCTTTTGATACCTGTGGCTTAATTGTTGCTAAATATTTCTCCCTCCCCTCTGTGGTCTTCACCAGGG GAATATTTTGCCACCATCTTGAAGAAGGTGCACAGTGCCCTGCTCCTCTTTCCTATGTCCCCAATGATCTCTT AGGGTTCTCAGATGCCATGACTTTCAAGGAGAGAGTATGGAACCACATCGTGCACTTGGAGGACCATTTATTT TGCCAGTATCTTTTTAGAAATGCCCTAGAAATAGCCTCTGAAATTCTCCAAACCCCTGTCACGGCATATGATC TCTACAGTCACACATCAATTTGGTTGTTGCGAACGGACTTTGTTTTGGACTATCCCAAACCCGTGATGCCCAA CATGATCTTCATTGGTGGTATCAACTGTCATCAGGGAAAGCCATTGCCTATGGAATTTGAAGCCTACATTAAT GCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTA TGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGAACCCGACCATCGAA TCTTGCGAACAACACGATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCC TTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCT TGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGA AATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATG CGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGA TGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGA CGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTAC CGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGA SEQ.IDNO:2 MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSLNCT VKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKESSFDAVF LDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLF CQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYIN ASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRA FITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIM RLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGY RKCLGKKGRVKKAHKSKTH SEQ.IDNO:3 ATGGCTTGCACAGGGTGGACCAGCcCcCTTCCTCTATGTGTGTGTCTGCTGCTGACCTGTGGCTTTGCCGAGG CAGGGAAGCTACTGGTAGTGCCCATGGATGGGAGCCACTGGTTCACCATGAGGTCGGTGGTGGAGAAACTCAT TCTCAGGGGGCATGAGGTGGTTGTAGTCATGCCAGAGGTGAGTTGGCAACTGGGAAGATCACTGAATTGCACA GTGAAGACTTATTCAACTTCATATACCCTGGAGGATCTGGACCGGGAGTTCAAGGCTTTTGCCCATGCTCAAT GGAAAGCACAAGTACGAAGTATATATTCTCTATTAATGGGTTCATACAATGACATTTTTGACTTATTTTTTTC AAATTGCAGGAGTTTGTTTAAAGACAAAAAATTAGTAGAATACTTAAAGGAGAGTTCTTTTGATGCAGTGTTT CTCGATCCTTTTGATAACTGTGGCTTAATTGTTGCCAAATATTTCTCCCTCCCCTCCGTGGTCTTCGCCAGGG GAATACTTTGCCACTATCTTGAAGAAGGTGCACAGTGCCCTGCTCCTCTTTCCTATGTCCCCAGAATTCTCTT AGGGTTCTCAGATGCCATGACTTTCAAGGAGAGAGTACGGAACCACATCATGCACTTGGAGGAACATTTATTA TGCCACCGTTTTTTCAAAAATGCCCTAGAAATAGCCTCTGAAATTCTCCAAACACCTGTTACGGAGTATGATC TCTACAGCCACACATCAATTTGGTTGTTGCGAACGGACTTTGTTTTGGACTATCCCAAACCCGTGATGCCCAA CATGATCTTCATTGGTGGTATCAACTGCCATCAGGGAAAGCCGTTGCCTATGGAATTTGAAGCCTACATTAAT GCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTA TGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGAACCCGACCATCGAA TCTTGCGAACAACACGATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCC TTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCT TGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGA AATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATG CGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGA TGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGA CGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTAC CGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGA SEQ.IDNO:4 MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCT VKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVF LDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAOCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLL CHRFFKNALEIASEILQTPVTEYDLYSHTSTWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYIN ASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRA FITHAGSHGVYESICNGVPMVMMPLFGDOMDNAKRMETKGAGVTLNVLEMTSECLENALKAVINDKSYKENIM RLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGY RKCLGKKGRVKKAHKSKTH SEQ.IDNO:5 ATGGCTCGCACAGGGTGGACCAGCCCCATTCCCCTATGTGTTTCTCTGCTGCTGACCTGTGGCTTTGCTGAGG CAGGGAAGCTGCTGGTAGTGCCCATGGATGGGAGTCACTGGTTCACCATGCAGTCGGTGGTGGAGAAACTTAT CCTCAGGGGGCATGAGGTGGTTGTAGTCATGCCAGAGGTGAGTTGGCAACTGGGAAAATCACTGAATTGCACA GTGAAGACTTACTCAACCTCATACACTCTGGAGGATCTGGACCGGGAATTCATGGATTTCGCCGATGCTCAAT GGAAAGCACAAGTACGAAGTTTGTTTTCTCTATTTCTGAGTTCATCCAATGGTTTTTTTAACTTATTTTTTTC GCATTGCAGGAGTTTGTTTAATGACCGAAAATTAGTAGAATACTTAAAGGAGAGTTCTTTTGATGCGGTGTTT CTTGATCCTTTTGATGCCTGTGGCTTAATTGTTGCCAAATATTTCTCCCTCCCCTCTGTGGTCTTCGCCAGGG GAATAGCTTGCCACTATCTTGAAGAAGGTGCACAGTGCCCTGCTCCTCTTTCCTATGTCCCCAGAATTCTCTT AGGGTTCTCAGATGCCATGACTTTCAAGGAGAGAGTACGGAACCACATCATGCACTTGGAGGAACATTTATTT TGCCAGTATTTTTCCAAAAATGCCCTAGAAATAGCCTCTGAAATTCTCCAAACACCTGTCACAGCATATGATC TCTACAGCCACACATCAATTTGGTTGTTGCGAACAGACTTTGTTTTGGACTATCCCAAACCCGTGATGCCCAA TATGATCTTCATTGGTGGTATCAACTGCCATCAGGGAAAGCCATTGCCTATGGAATTTGAAGCCTACATTAAT GCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTA TGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGAACCCGACCATCGAA TCTTGCGAACAACACGATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCC TTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCT TGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGTTCTGGA AATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATG CGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGA TGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGA CGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTAC CGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGA SEQ.IDNO:6 MAKTGWTSPLPLCVSLLLTCGFAEAGKLLVVPMDGSHWETMQSVVEKLLLRGHEVVVVMPEVSWQLGKSLNCT VKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLFFSHCRSLFNDRKLVEYLKESSFDAVF LDPFDACGLIVAKYFSLPSVVFARGIACHYIEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLF CQYFSKNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYIN ASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRA FTTHAGSHGVYESICNGVPMVMMPIFGDOMDNAKRMETKGAGVTLNVIEMTSEDLENALKAVTNDKSYKENIM RLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAWLTVAFITFKCCAYGYR KCLGKKGRVKKAHKSKTH SEQ.IDNO:7 ATGGCTCGTGCAGGGTGGACTGGCCTCCTTCCCCTATATGTGTGTCTACTGCTGACCTGTGGCTTTGCCAAGG CAGGGAAGCTGCTGGTAGTGCCCATGGATGGGAGCCACTGGTTCACCATGCAGTCGGTGGTGGAGAAACTCAT CCTCAGGGGGCATGAGGTGGTCGTAGTCATGCCAGAGGTGAGTTGGCAACTGGGAAGATCACTGAATTGCACA GTGAAGACTTACTCAACCTCATACACTCTGGAGGATCAGGACCGGGAGTTCATGGTTTTTGCCGATGCTCGCT GGACGGCACCATTGCGAAGTGCATTTTCTCTATTAACAAGTTCATCCAATGGTATTTTTGACTTATTTTTTTC AAATTGCAGGAGTTTGTTTAATGACCGAAAATTAGTAGAATACTTAAAGGAGAGTTGTTTTGATGCAGTGTTT CTCGATCCTTTTGATGCCTGTGGCTTAATTGTTGCCAAATATTTCTCCCTCCCCTCTGTGGTCTTCGCCAGGG GAATATTTTGCCACTATCTTGAAGAAGGTGCACAGTGCCCTGCTCCTCTTTCCTATGTCCCCAGACTTCTCTT AGGGTTCTCAGACGCCATGACTTTCAAGGAGAGAGTATGGAACCACATCATGCACTTGGAGGAACATTTATTT TGCCCCTATTTTTTCAAAAATGTCTTAGAAATAGCCTCTGAAATTCTCCAAACCCCTGTCACGGCATATGATC TCTACAGCCACACATCAATTTGGTTGTTGCGAACTGACTTTGTTTTGGAGTATCCCAAACCCGTGATGCCCAA TATGATCTTCATTGGTGGTATCAACTGTCATCAGGGAAAGCCAGTGCCTATGGAATTTGAAGCCTACATTAAA GCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGAAAGCTA TGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGAACCCGACCATCGAA TCTTGCGAACAACACGATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACCCGTGCC TTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGATGCCCT TGTTTGGTGATCAGATGGAGAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGAGCGTGAATGTTCTGGA AATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAACATCATG CGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGTTTGTGA TGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTCCTTGGA CGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTATGGCTAC CGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGA SEQ.IDNO:8 MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWETMQSVVEKLILRGHEVVVVMPEVSWQLGRSLNCT VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSNCRSLFNDRKLVEYLKESCFDAVF LDPFDACGLIVAKYFSLPSVVFARGIFCHYIEEGAQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLF CPYFFKNVLEIASEILQTPVTAYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYIN ASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRA FTTHAGSHGVYESICNGVPMVMMPIFGDOMDNAKRMETKGAGVTLNVIEMTSEDLENALKAVTNDKSYKENIM RLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAWLTVAFITFKCCAYGYR KCLGKKGRVKKAHKSKTH SEQ.IDNO:9 ATGGCCTGCCTCCTTCGCTCATTTCAGAGAATTTCTGCAGGGGTTTTCTTCTTAGCACTTTGGGGCATGGTTG TAGGTGACAAGCTGCTGGTGGTCCCTCAGGACGGAAGCCACTGGCTTAGTATGAAGGATATAGTTGAGGTTCT CAGTGACCGGGGTCATGAGATTGTAGTGGTGGTGCCTGAAGTTAATTTGCTTTTGAAAGAATCCAAATACTAC ACAAGAAAAATCTATCCAGTGCCGTATGACCAAGAAGAGCTGAAGAACCGTTACCAATCATTTGGAAACAATC ACTTTGCTGAGCGATCATTCCTAACTGCTCCTCAGACAGAGTACAGGAATAACATGATTGTTATTGGCCTGTA CTTCATCAACTGCCAGAGCCTCCTGCAGGACAGGGACACCCTGAACTTCTTTAAGGAGAGCAAGTTTGATGCT CTTTTCACAGACCCAGCCTTACCCTGTGGGGTGATCCTGGCTGAGTATTTGGGCCTACCATCTGTGTACCTCT TCAGGGGTTTTCCGTGTTCCCTGGAGCATACATTCAGCAGAAGCCCAGACCCTGTGTCCTACATTCCCAGGTG CTACACAAAGTTTTCAGACCACATGACTTTTTCCCAACGAGTGGCCAACTTCCTTGTTAATTTGTTGGAGCCC TATCTATTTTATTGTCTGTTTTCAAAGTATGAAGAACTCGCATCAGCTGTCCTCAAGAGAGATGTGGATATAA TCACCTTATATCAGAAGGTCTCTGTTTGGCTGTTAAGATATGACTTTGTGCTTGAATATCCTAGGCCGGTCAT GCCCAACATGGTCTTCATTGGAGGTATCAACTGTAAGAAGAGGAAAGACTTGTCTCAGGAATTTGAAGCCTAC ATTAATGCTTCTGGAGAACATGGAATTGTGGTTTTCTCTTTGGGATCAATGGTCTCAGAAATTCCAGAGAAGA AAGCTATGGCAATTGCTGATGCTTTGGGCAAAATCCCTCAGACAGTCCTGTGGCGGTACACTGGAACCCGACC ATCGAATCTTGCGAACAACACGATACTTGTTAAGTGGCTACCCCAAAACGATCTGCTTGGTCACCCGATGACC CGTGCCTTTATCACCCATGCTGGTTCCCATGGTGTTTATGAAAGCATATGCAATGGCGTTCCCATGGTGATGA TGCCCTTGTTTGGTGATCAGATGGACAATGCAAAGCGCATGGAGACTAAGGGAGCTGGAGTGACCCTGAATGT TCTGGAAATGACTTCTGAAGATTTAGAAAATGCTCTAAAAGCAGTCATCAATGACAAAAGTTACAAGGAGAAC ATCATGCGCCTCTCCAGCCTTCACAAGGACCGCCCGGTGGAGCCGCTGGACCTGGCCGTGTTCTGGGTGGAGT TTGTGATGAGGCACAAGGGCGCGCCACACCTGCGCCCCGCAGCCCACGACCTCACCTGGTACCAGTACCATTC CTTGGACGTGATTGGTTTCCTCTTGGCCGTCGTGCTGACAGTGGCCTTCATCACCTTTAAATGTTGTGCTTAT GGCTACCGGAAATGCTTGGGGAAAAAAGGGCGAGTTAAGAAAGCCCACAAATCCAAGACCCATTGA SEQ.IDNO:10 MACLLRSFQRISAGVFFLALWGMVVGDKLLVVPQDGSHWLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYY TRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDA LFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEP YLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPNMVFIGGINCKKRKDLSQEFEAY INASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMT RAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKEN IMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAADLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYG YRKCLGKKGRVKKAHKSKTH
(233) Hereinafter are provided examples of specific implementations for performing the methods of the present disclosure, as well as implementations representing the compositions of the present disclosure. The examples are provided for illustrative purposes only, and are not intended to limit the scope of the present disclosure in any way.
EXAMPLES
Example 1Processes for Making -4-O-Glucosyl-Psilocybin Derivatives
(234) This example refers to
(235) ##STR00035##
(236) It is noted that in
(237) A flame-dried round-bottom flask under argon atmosphere was charged with 4-hydroxy indole (11A-1) (5.00 g, 37.6 mmol, 1.00 eq), tetramethylammonium hydroxide pentahydrate (6.81 g, 37.6 mmol, 1.00 eq), and anhydrous DMF (100.0 mL). To aid dissolution, the stirring mixture was heated to for 15 minutes, yielding a dark-blue solution. Flame-activated 4 molecular sieves (5.00 g) were added to the reaction flask and allowed to stir for 5 minutes at room temperature. In a separate flame-dried vial, the 2,3,4,6-tetra-O-acetyl--D-glucopyranosyl bromide 11A-2 (18.53 g, 45.1 mmol, 1.20 eq) was dissolved in anhydrous DMF (30.0 mL) and subsequently added to the reaction mixture dropwise. The reaction mixture was allowed to stir at room temperature for 3 hours. The molecular sieves were removed via vacuum filtration and the collected filtrate was poured onto deionized water (140 mL). This solution was extracted with dichloromethane (530 mL), and the combined organic extracts were dried with MgSO.sub.4 and concentrated under vacuum. The crude mixture was purified by column chromatography on silica gel using 30% EtOActoluene containing 0.25% triethylamine as an eluent. The obtained product was further purified by a second column chromatography on silica gel using 0.5% MeOHdichloromethane containing 0.25% triethylamine as the eluent to afford the desired glycoside 11A-3 as a white solid (1.85 g, 3.99 mmol, 11%). .sup.1H NMR (400 MHz, CDCl.sub.3): (ppm)=8.22 (s, 1H), 7.17-7.12 (m, 2H), 7.10 (d, J=7.7 Hz, 1H), 6.72 (dd, J=7.6, 0.9 Hz, 1H), 6.57 (ddd, J=3.1, 2.1, 0.9 Hz, 1H), 5.43-5.38 (m, 1H), 5.33 (t, J=9.3 Hz, 1H), 5.25-5.18 (m, 2H), 4.32 (dd, J=12.2, 5.3 Hz, 1H), 4.20 (dd, J=12.2, 2.5 Hz, 1H), 3.89 (ddd, J=9.9, 5.3, 2.5 Hz, 1H), 2.11-2.03 (m, 12H).
(238) To a solution of glycoside 11A-3 (900 mg, 1.94 mmol, 1.00 eq) and 1-(dimethylamino)-2-nitroethylene (248 mg, 2.14 mmol, 1.10 eq) in anhydrous dichloromethane (2.0 mL) under argon, was added trifluoracetic acid (3.32 g, 29.1 mmol, 15.0 eq), and the resulting mixture was stirred at room temperature for 3 hours until completion as determined by TLC (4:1 EtOAc/hexanes). The reaction mixture was diluted with EtOAc (15 mL) and slowly poured onto saturated NaHCO.sub.3(100 mL). The biphasic solution was separated, the aqueous phase extracted with EtOAc (425 mL), the organic extracts were combined and washed with brine (30 mL), dried with MgSO.sub.4, and concentrated under reduced pressure. The mixture was purified by column chromatography on silica gel using a gradient of 45%.fwdarw.60% EtOAchexanes as an eluent to yield the desired product 11A-4 as an orange solid (137 mg, 0.256 mmol, 13%). .sup.1H NMR (400 MHz, Acetone-d.sub.6): (ppm)=11.31 (s, 1H), 8.57 (dd, J=13.5, 0.7 Hz, 1H), 8.20-8.11 (m, 2H), 7.98-7.90 (m, 1H), 7.31 (dd, J=8.2, 0.9 Hz, 1H), 7.24 (t, J=8.0 Hz, 1H), 7.02 (dd, J=7.8, 0.9 Hz, 1H), 6.66 (d, J=10.6 Hz, 1H), 5.75 (d, J=8.0 Hz, 1H), 5.48 (t, J=9.5 Hz, 1H), 5.38 (dd, J=9.6, 8.0 Hz, 1H), 5.24 (dd, J=9.9, 9.3 Hz, 1H), 4.33 (dd, J=11.9, 5.2 Hz, 1H), 4.26 (ddd, J=10.0, 5.2, 2.2 Hz, 1H), 4.19 (dd, J=11.9, 2.2 Hz, 1H), 2.05 (s, 3H), 2.01 (s, 3H), 2.01 (s, 3H), 1.97 (s, 3H).
(239) Compound 11A-4 (137 mg, 0.256 mmol, 1.00 eq) was dissolved in a solution of ethanol (1.0 mL)-THF (1.0 mL) at 0 C., and sodium borohydride (48 mg, 1.27 mmol, 5.00 eq) was added. The reaction was stirred at 0 C. for 1 hour, and then warmed up to room temperature for 2 hours. The reaction mixture was poured onto ice-water (20 mL) and extracted with dichloromethane (410 mL). The combined organic extracts were washed with brine (15 mL), dried with MgSO.sub.4, and concentrated under reduced pressure. The residue was purified by column chromatography on silica gel using a gradient of 30%.fwdarw.50% EtOAchexanes as the eluent to afford compound 11A-5 as a white solid (45 mg, 0.0839 mmol, 33%). .sup.1H NMR (400 MHz, Acetone-d.sub.6): (ppm)=10.21 (s, 1H), 7.16-7.03 (m, 3H), 6.79 (dd, J=7.9, 0.8 Hz, 1H), 5.76 (dd, J=7.9, 0.4 Hz, 1H), 5.49 (t, J=9.5 Hz, 1H), 5.35 (dd, J=9.7, 7.9 Hz, 1H), 5.22-5.15 (m, 1H), 4.87-4.74 (m, 2H), 4.35-4.23 (m, 2H), 4.20-4.13 (m, 1H), 3.54-3.39 (m, 2H), 2.08 (s, 3H), 2.05 (s, 3H), 2.01 (s, 3H), 2.00 (s, 3H).
(240) Compound 11A-5 (45 mg, 0.084 mmol, 1.0 eq) was dissolved in anhydrous methanol (1.5 mL) with the help of sonication. A methanolic solution of sodium methoxide (1.5 M, 0.10 mL, 0.15 mmol, 1.8 eq) was added and the reaction was stirred at room temperature for 10 minutes. TLC (10% MeOHdichloromethane revealed that the starting material was consumed. Acetic acid was added until a pH of 5-6 was achieved. The reaction mixture was concentrated under reduced pressure to afford compound 11A-6 as an amber oil that was used directly in the following step without purification.
(241) To a vigorously stirring solution of above crude compound 11A-6 in methanol (5.0 mL) was added 10% palladium on activated charcoal (70 mg, 0.066 mmol) and ammonium formate (140 mg, 2.22 mmol), and the resulting mixture was heated to 50 C. for 1 hour. The reaction mixture was cooled to room temperature, filtered to remove the catalyst, and concentrated under reduced pressure. The mixture was purified by size exclusion chromatography on Sephadex LH-20 using methanol as the eluent to yield compound 11A-7 as a white solid (23 mg, 0.058 mmol, 69% over 2 steps). .sup.1H NMR (400 MHz, D.sub.2O): (ppm)=7.18-7.06 (m, 3H), 6.73 (dd, J=7.5, 0.9 Hz, 1H), 5.25 (d, J=7.3 Hz, 1H), 3.84 (dd, J=12.5, 2.2 Hz, 1H), 3.67 (dd, J=12.4, 5.7 Hz, 1H), 3.63-3.52 (m, 3H), 3.48-3.39 (m, 1H), 3.29 (ddt, J=10.3, 7.0, 4.9 Hz, 2H), 3.25-3.11 (m, 2H), 1.86 (s, 7H). .sup.13C NMR (100 MHz, D.sub.2O): (ppm)=150.6, 138.6, 124.2, 122.8, 116.8, 108.8, 107.0, 102.9, 100.0, 99.4, 76.1, 73.1, 69.4, 60.6, 40.8, 24.2, 22.8.
Example 2Processes for Making -4-O-Galactosyl-Psilocybin Derivatives
(242) This example refers to
(243) ##STR00036##
(244) It is noted that in
(245) To a solution of 4-hydroxyindole (11B-1, 1.0 g, 7.51 mmol) in DMF (10.0 mL) was added tetramethyammonium hydroxide pentahydrate (1.36 g, 7.51 mmol) under argon, and the mixture was stirred at ambient temperature for 10 mins. Molecular sieves 4A (2.0 g) was added and the mixture was stirred for another 10 mins. Then 2,3,4,6-Tetra-O-acetyl--D-galactopyranosyl bromide (11B-2, 4.63 g, 11.3 mmol, 1.5 equiv.) was added in small portions, and the reaction was continued for 18 hours. The reaction mixture was diluted with EtOAc (100 mL) and filtered off to remove the insoluble materials. The organic solution was washed with 10% brine (250 mL), dried over anhydrous Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel using a gradient of EtOAc-hexanes (10.fwdarw.40%) as the eluent to afford the desired glycoside 11B-3 (1.41 g, 41% yield). .sup.1H NMR (400 MHz, CDCl.sub.3) 8.38 (s, 1H), 7.17-7.12 (m, 2H), 7.09 (t, J=7.9 Hz, 1H), 6.73 (dd, J=7.6, 0.7 Hz, 1H), 6.58 (m, 1H), 5.63 (dd, J=10.5, 8.0 Hz, 1H), 5.48 (dd, J=1.0, 3.5 Hz, 1H), 5.17 (d, J=7.9 Hz, 1H), 5.14 (dd, J=10.4, 3.4 Hz, 1H), 4.28 (dd, J=11.2, 7.0 Hz, 1H), 4.20 (dd, J=11.2, 6.3 Hz, 1H), 4.12-4.06 (ddd, J=6.7, 6.7, 1.0 Hz, 1H), 2.19 (s, 3H), 2.07 (s, 3H), 2.07 (s, 4H), 2.03 (s, 3H). .sup.13C NMR (101 MHz, CDCl.sub.3) 170.4, 170.35, 170.2, 169.6, 150.6, 137.5, 123.6, 122.4, 119.5, 106.8, 104.9, 100.5, 99.6, 71.0, 70.8, 68.8, 67.0, 61.4, 20.8, 20.7 (x2), 20.6. HRMS (ESI) m/z for C.sub.22H.sub.25NO.sub.10Na (M+Na).sup.+ calcd 486.1371, found 486.1370.
(246) A solution of compound 11B-3 (PZ11088, 95.4 mg, 0.206 mmol) and 1-(dimethylamino)-2-nitroethylene (26.3 mg, 0.226 mmol, 1.1 equiv.) in anhydrous dichloromethane (0.8 mL) was cooled to 0 C., and trifluoroacetic acid (0.5 mL) was added. After stirring for 20 mins, the mixture was diluted with EtOAc (40 mL), and washed with a solution of 2N NaOH (110 mL) followed by 10% aqueous NaHCO.sub.3(110 mL), dried over anhydrous Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel using a gradient of EtOAc-hexanes (10.fwdarw.50%) containing 0.1% Et.sub.3N as the eluent to afford the desired compound 11B-4 (36.8 mg, 33% yield). .sup.1H NMR (400 MHz, Acetone-d.sub.6) 11.27 (s, 1H), 8.59 (dd, J=13.4, 0.5 Hz, 1H), 8.16 (s, 1H), 7.98 (d, J=13.5 Hz, 1H), 7.29 (dd, J=8.1, 0.9 Hz, 1H), 7.23 (t, J=8.0 Hz, 1H), 7.01 (dd, J=7.8, 0.7 Hz, 1H), 5.71 (d, J=8.1 Hz, 1H), 5.60 (dd, J=10.2, 8.1 Hz, 1H), 5.50 (dd, J=3.5, 1.0 Hz, 1H), 5.33 (dd, J=10.2, 3.5 Hz, 1H), 4.48 (td, J=6.5, 1.1 Hz, 1H), 4.23-4.13 (m, 2H), 2.21 (d, J=3.1 Hz, 3H), 1.97 (s, 3H), 1.96 (s, 3H), 1.96 (s, 3H). .sup.13C NMR (101 MHz, Acetone-d.sub.6) 170.0, 169.6, 169.4, 168.5, 151.3, 133.8, 133.79 (x2), 130.4, 130.2, 124.0, 107.8, 107.78, 106.9, 99.5, 71.1, 71.0, 68.9, 67.4, 61.3, 19.9, 19.7, 19.66, 19.6.
(247) To a solution of compound 11B-4 (PZ11098-2, 36.8 mg, 0.0689 mmol) in methanol (1.0 mL) was added NaBH.sub.4 (13.0 mg, 0.343 mmol, 5 equiv.) in small portions, and reaction was stirred for 1 hour at ambient temperature. Then AcOH (2 drops) was added, and the reaction mixture was diluted with EtOAc (20 mL), washed with a solution of 10% brine (210 mL), dried over anhydrous Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel using a gradient of EtOAc-hexanes (10.fwdarw.50%) containing 0.1% Et.sub.3N as the eluent to afford the desired compound 11B-5 (25.2 mg, 68% yield). .sup.1H NMR (400 MHz, Acetone-d.sub.6) 10.21 (s, 1H), 7.11 (m, 2H), 7.05 (t, J=7.9 Hz, 1H), 6.78 (d, J=7.3 Hz, 1H), 5.71 (d, J=8.0 Hz, 1H), 5.53 (dd, J=10.4, 8.0 Hz, 1H), 5.50 (dd, J=3.6, 1.0 Hz, 1H), 5.34 (dd, J=10.4, 3.6 Hz, 1H), 4.87-4.73 (m, 2H), 4.49 (ddd, J=6.5, 6.5, 1.1 Hz, 1H), 4.23-4.14 (m, 2H), 3.54-3.40 (m, 2H), 2.19 (s, 3H), 2.09 (s, 3H), 1.98 (s, 3H), 1.97 (s, 3H). .sup.13C NMR (101 MHz, Acetone-d.sub.6) 169.9, 169.4 (x3), 150.8, 138.9, 128.9, 128.1, 123.2, 122.2, 106.7, 103.0, 97.8, 76.8, 70.9, 70.89, 68.8, 67.4, 61.3, 24.7, 19.9, 19.7, 19.65, 19.6.
(248) To a solution of compound 11B-5 (PZ11102, 41 mg, 0.0764 mmol) in anhydrous methanol (3.0 mL) was added a solution of NaOMe in anhydrous MeOH (1.0 M, 30 mL), and reaction was stirred at ambient temperature for 1 hour. AcOH (2 drops) was added, and the reaction mixture was evaporated to dryness under reduced pressure. NMR spectra of the crude compound 11B-6 showed a complete removal of the O-acetates. .sup.1H NMR (400 MHz, CD.sub.3OD) 8.55 (s, 1H), 7.05-6.97 (m, 2H), 6.96 (s, 1H), 6.80-6.71 (m, 1H), 5.13 (d, J=7.8 Hz, 1H), 4.88 (t, J=7.0 Hz, 2H), 3.98 (d, J=3.0, 0.7 Hz, 1H), 3.90 (dd, J=9.6, 7.8 Hz, 1H), 3.80 (m, 2H), 3.74 (ddd, J=6.2, 5.2, 0.7 Hz, 1H), 3.65 (dd, J=3.4, 9.6 Hz, 1H), 3.64-3.47 (m, 2H). Selected .sup.13C NMR (101 MHz, CD.sub.3OD) b 154.4, 135.7, 129.2, 128.5, 122.5, 121.9, 109.2, 105.7, 104.0, 102.7, 101.2, 77.1, 75.4, 74.0, 71.1, 68.9, 60.9, 25.2.
(249) To a solution of the crude residue 11B-6 (PZ11104) obtained from above in MeOH (3.0 mL), was added 10% Pd/C (35 mg) and ammonium formate (85 mg), and the mixture was heated at 60 C. After 30 mins, the solution was filtered off through a syringe membrane, and evaporated to dryness. The residue was purified by size exclusion chromatography on Sephadex LH-20 using methanol as an eluent to afford the desired compound 11B-7 which was freeze-dried as white solid (24.6 mg, 81%). .sup.1H NMR (400 MHz, D.sub.2O) b 7.12-7.07 (dd, J=0.8, 7.6 Hz, 1H), 7.05 (m, 2H), 6.66 (d, J=0.8, 7.6 Hz, 1H), 5.07 (d, J=7.9 Hz, 1H), 3.85 (d, J=3.4 Hz, 1H), 3.77 (dd, J=9.8, 7.9 Hz, 1H), 3.64 (m, 3H), 3.58 (dd, J=9.9, 3.4 Hz, 1H), 3.29-3.21 (m, 2H), 3.19-3.03 (m, 2H), 1.78 (s, 3H). .sup.13C NMR (101 MHz, D.sub.2O) 181.4, 150.7, 138.5, 124.1, 122.8, 116.7, 108.8, 106.8, 102.7, 99.8, 75.3, 73.0, 70.6, 68.4, 60.7, 40.8, 24.2, 23.2. HRMS (ESI) m/z for C.sub.16H.sub.23N.sub.2O.sub.6 (M+H).sup.+ calcd 339.1551, found 339.1568.
(250) To a solution of compound 11B-7 (PZ11105, 19.2 mg, 0.0568 mmol) in MeOH (1.0 mL) at 0 C., was added 37% formaldehyde in water (12 mL, 0.137 mmol), AcOH (13 mL, 1.17 mmol) and NaBH.sub.3CN (7.6 mg, 0.115 mmo), and the reaction was continued at ambient temperature overnight. A solution of 10% NaHCO.sub.3 was added to adjust the pH of the solution to 8-9, and the mixture was concentrated under reduced pressure. The residue was purified by size exclusion chromatography on Sephadex LH-20 using methanol as an eluent to afford the desired compound 11B-8 which was freeze-dried as white solid (19.3 mg, 94%). .sup.1H NMR (400 MHz, D.sub.2O) 7.16-7.02 (m, 3H), 6.69 (dd, J=0.9, 7.6 Hz, 1H), 5.14 (d, J=7.9 Hz, 1H), 3.89 (dd, J=0.6, 3.5 Hz, 1H), 3.78 (dd, J=7.9, 9.8 Hz, 1H), 3.75 (ddd, J=0.8, 6.1, 6.1 Hz, 1H), 3.71-3.60 (m, 3H), 3.38 (m, 2H), 3.19 (m, 2H), 2.75 (s, 6H), 1.80 (s, 3H). .sup.13C NMR (101 MHz, D.sub.2O) 150.7, 138.5, 124.1, 122.9, 116.6, 108.1, 106.9, 102.8, 100.0, 75.4, 73.0, 70.7, 68.5, 60.8, 58.9, 42.7, 23.2, 21.9. HRMS (ESI) m/z for C.sub.18H.sub.27N.sub.2O.sub.6 (M+H).sup.+ calcd 367.1867, found 367.1857.
Example 3Efficacy of a -4-O-Glucosyl-Psilocybin Derivative
(251) This example describes the performance of calcium mobilization assays to demonstrate activation of 5-HT.sub.2A receptor by a first example glycosylated psilocybin derivative, namely a -4-O-glucosyl-psilocybin compound having the formula (III) (see: Example 1). The 5-HT.sub.2A receptor belongs to the class of serotonin receptors and is known to be playing a role in the mediation of responses to serotonogenic compounds.
(252) Cell lines for pharmacology assays. CHO-K1/Galpha15 (GenScript, M00257) (5-HT.sub.2A) and CHO-K1/5-HT.sub.2A (GenScript, M00250) (+5-HT.sub.2A) cells lines were used in both toxicology/growth inhibition (MTT) and calcium release assays. Briefly, CHO-K1/Galpha15 is a control cell line that constitutively expresses Galpha15 which is a promiscuous Gq protein. It is engineered as a host cell, allowing transfected receptor(s) to signal through the Gq signal transduction pathway and mobilize intracellular calcium from the endoplasmic reticulum (ER). These control cells lack any transgene encoding 5-HT.sub.2A receptors, thus preventing calcium mobilization in response to 5-HT.sub.2A activation. Conversely, CHO-K1/5-HT.sub.2A cells stably express 5-HT.sub.2A receptor in the CHO-K1 host background. This design enables Gq-11 expressed in CHO-K1 cells to mobilize intracellular calcium changes when 5-HT.sub.2A receptors are activated by ligands.
(253) Cell lines were maintained in Ham's F12 media plus 10% FBS in the presence of 100 ug/ml hygromycin for CHO-K1/Ga15 or 400 ug/ml G418 for CHO-K1/5-HT.sub.2A unless indicated otherwise for specific assays. Cell maintenance was carried out as recommended by the cell supplier. Briefly, vials with cells were removed from the liquid nitrogen and thawed quickly in 37 C. water bath. Just before cells were completely thawed, vial exteriors were decontaminated with 70% ethanol spray. Cell suspension was then retrieved from the vial and added to warm (37 C.), complete (non-dropout) growth media, and centrifuged at 1,000 rpm for 5 minutes. The supernatant was discarded and the cell pellet was then resuspended in another 10 ml of complete growth media, and added to a 10 cm cell culture dish (Greiner Bio-One #664160). The media was changed every third day until the cells reached 90% confluence. The 90% confluent cells were then split 10:1, and used either for maintenance or pharmacological study.
(254) Assessment of cell viability upon treatment of glycosylated psilocybin derivatives. To establish suitable ligand concentrations for the calcium release assays, MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium) assays were first performed. Results of these assays were conducted using both control ligands (e.g. psilocybin, psilocin, DMT) and novel derivatives, in part as a pre-screen for any remarkable toxic effects on cell cultures up to concentrations of 1 mM. A known cellular toxin (Triton X-100, Pyrgiotakis G. et al., 2009, Ann. Biomed. Eng. 37: 1464-1473) was included as a general marker of toxicity. Modified Chinese Hamster Ovary cells (CHO-K1/Ga15) were cultured using standard procedures using the manufacture's protocols (Genscript, M00257). Briefly, cells were cultured in Ham's F12 medium supplemented with 10% fetal bovine serum and 100 mg/ml Hygromycin B, and grown at 37 C. in the presence of 5% CO.sub.2. To test the various compounds with the cell line, cells were seeded in a clear 96-well culture plate at 10,000 cells per well. After allowing cells to attach and grow for 24 hours, assay compounds were added at 1 M, 10 M, 100 M, and 1 mM final concentrations. Methanol concentrations used are 0.001, 0.01, 0.1, and 1%. Triton concentrations used are 0.0001, 0.001, 0.01 and 0.1%. Cells were incubated with compounds for 48 hours before accessing cell viability with the MTT assay following the manufacture's protocol (MTT Cell Growth Assay Kit; Millipore Sigma, CT02). MTT reagent was added to cells and allowed to incubate for 4 hours before solubilization with isopropanol plus 0.04 N HCl. Absorbance readings were performed at 570 nm with the reference at 630 nm on a SpectraMax iD3 plate reader. Non-treated cells were assigned 100% viability. Results of the cell viability assays are shown in
(255) Increase in cytosolic calcium concentration by 5-HT.sub.2A activation. Changes in intracellular calcium concentration due to the treatment with assay compounds was measured using Fluo-8 dye (Abcam, #ab112129) according to the manufacturer's instructions. Briefly, CHO-K1 cells stably expressing 5-HT.sub.2A (Genscript #M00250) (+5-HT.sub.2A) or lacking 5-HT.sub.2A (Genscript, M00257) (5-HT.sub.2A) were seeded on black walled clear bottom 96-well plates (Thermo Scientific #NUNC165305), allowing 70,000 cells/well in 100 ul media (HAM's F12, GIBCO #11765-047) with 1% FBS (Thermo Scientific #12483020). Cultures were maintained in a humidified incubator at 37 C. and 5% CO.sub.2. Fluo-8 dye was loaded into the cultures for 30 min at 37 C., followed by 30 min additional incubation at room temperature. Next, different dilutions of novel molecules and controls were prepared in serum-free culture media and added to the cells. Fluorescence (ex 490 nm/em 525 nm) obtained after the addition of molecules was expressed relative to values obtained before addition of the molecules (relative Fluo-8 fluorescence=Fmax/F0, where Fmax=maximum fluorescence and F0=baseline fluorescence). Fluorescence intensities were measured using a Spectramax ID3 plate reader (www.moleculardevices.com). Relative fluorescence (RFU) was plotted with respected to time (seconds) illustrating time-dependent calcium flux. Psilocin, a known agonist with binding activity at 5-HT.sub.2A (Rickli A. et al., 2016, Europ. Neuropsychopharmacol., 26: 1326-1337) was used as a positive control to establish assay functionality. The Example compound (Ill) was then evaluated. Results are shown in
Example 4Efficacy of a First -4-O-Galactosyl-Psilocybin Derivative
(256) This example describes the performance of calcium mobilization assays to demonstrate activation of 5-HT.sub.2A receptor by a second example glycosylated psilocybin derivative, namely a first -4-O-galactosyl-psilocybin derivative compound having the formula (V) (see: Example 2). The assay methods were as described in Example 3. Briefly, to establish suitable ligand concentrations for the calcium release assays, MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium) assays were first performed. CHO-K1/Ga15 cells were treated with 1 M, 10 M, 100 M, and 1 mM of derivative for 48 hours and cell viability was measured by MTT assay (n=3). Methanol concentrations used are 0.001, 0.01, 0.1, and 1%. Triton concentrations used are 0.0001, 0.001, 0.01 and 0.1%. Results of the cell viability assays are shown in
(257) To assess changes in cytosolic calcium concentration in response to 5-HT.sub.2A activation, the derivative was evaluated in the same manner as psilocin and Example compound with formula (III) (see: Example 3). The results are shown in
Example 5Efficacy of a Second -4-O-Galactosyl-Psilocybin Derivative
(258) This example describes the performance of calcium mobilization assays to demonstrate activation of 5-HT.sub.2A receptor by a second example glycosylated psilocybin derivative, namely a second -4-O-galactosyl-psilocybin compound having the formula (VI) (see: Example 2). The assay methods were as described in Example 3, with additional analysis of calcium mobilization data as described herein. Briefly, to establish suitable ligand concentrations for the calcium release assays, MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium) assays were first performed. CHO-K1/Ga15 cells were treated with 1 M, 10 M, 100 M, and 1 mM of derivative for 48 hours and cell viability was measured by MTT assay (n=3). Methanol concentrations used are 0.001, 0.01, 0.1, and 1%. Triton concentrations used are 0.0001, 0.001, 0.01 and 0.1%. Results of the cell viability assays are shown in
(259) To assess changes in cytosolic calcium concentration in response to 5-HT.sub.2A activation, the derivative was evaluated in the same manner as in Example 3, with additional, curve-fitting analysis as follows. Relative fluorescence (RFU) was subjected to four parameter logistic curve fittings to determine EC.sub.50 (3.814 uM) with the aid of GraphPad Prism (Version 9.2.0). The results are shown in