TIM3-BINDING CHIMERIC ANTIGEN RECEPTORS

20190374579 ยท 2019-12-12

    Inventors

    Cpc classification

    International classification

    Abstract

    Disclosed herein are chimeric antigen receptor (CAR) polypeptides that can be used with adoptive cell transfer to target and kill TIM3-expressing cancers. Also disclosed are immune effector cells, such as T cells or Natural Killer (NK) cells, that are engineered to express these CARs. Therefore, also disclosed are methods of providing an anti-tumor immunity in a subject with a TIM3-expressing cancer that involves adoptive transfer of the disclosed immune effector cells engineered to express the disclosed CARs.

    Claims

    1. A chimeric antigen receptor (CAR) polypeptide, comprising a TIM3 antigen binding domain, a transmembrane domain, a signaling domain, and a co-stimulatory signaling region.

    2. The polypeptide of claim 1, wherein the TIM3 antigen binding domain is a single-chain variable fragment (scFv) of an antibody that specifically binds TIM3.

    3. The polypeptide of claim 2, wherein the anti-TIM3 scFv V.sub.H domain comprises the amino acid sequence SEQ ID NO:1 or 2.

    4. The polypeptide of claim 2, wherein the anti-TIM3 scFv V.sub.L domain comprises the amino acid sequence SEQ ID NO:3, 4, 5, or 6.

    5. The polypeptide of claim 1, wherein the costimulatory signaling region comprises the cytoplasmic domain of a costimulatory molecule selected from the group consisting of CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, and any combination thereof.

    6. The polypeptide of claim 1, wherein the CAR polypeptide is defined by the formula:
    SP-TIM3-HG-TM-CSR-SD; or
    SP-TIM3-HG-TM-SD-CSR wherein SP represents a signal peptide, wherein TIM3 represents a TIM3-binding region, wherein HG represents and optional hinge domain, wherein TM represents a transmembrane domain, wherein CSR represents a co-stimulatory signaling region, wherein SD represents a signaling domain, and wherein represents a bivalent linker.

    7. The polypeptide of claim 1, wherein the signaling domain comprises a CD3 zeta (CD3?) signaling domain.

    8. An isolated nucleic acid sequence encoding the recombinant polypeptide of claim 1.

    9. A vector comprising the isolated nucleic acid sequence of claim 8.

    10. A cell comprising the vector of claim 9.

    11. The cell of claim 10, wherein the cell is selected from the group consisting of an ??T cell, ??T cell, a Natural Killer (NK) cells, a Natural Killer T (NKT) cell, a B cell, an innate lymphoid cell (ILC), a cytokine induced killer (CIK) cell, a cytotoxic T lymphocyte (CTL), a lymphokine activated killer (LAK) cell, a regulatory T cell, or any combination thereof.

    12. The cell of claim 11, wherein the cell exhibits an anti-tumor immunity when the antigen binding domain of the CAR binds to TIM3.

    13. A method of providing an anti-cancer immunity in a subject with a TIM3-expressing cancer, the method comprising administering to the subject an effective amount of an immune effector cell genetically modified to express the CAR polypeptide of claim 1, thereby providing an anti-tumor immunity in the mammal.

    14. The method of claim 13, wherein the immune effector cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), and a regulatory T cell.

    15. The method of claim 13, further comprising administering to the subject a checkpoint inhibitor.

    16. The method of claim 15, wherein the checkpoint inhibitor comprises an anti-PD-1 antibody, anti-PD-L1 antibody, anti-CTLA-4 antibody, or a combination thereof.

    17. The method of claim 14, wherein the cancer comprises an acute myeloid leukemia (AML).

    Description

    DESCRIPTION OF DRAWINGS

    [0018] FIG. 1 is an illustration of a TIM3-specific chimeric antigen receptor (CAR).

    [0019] FIG. 2 illustrates a next generation sequencing (NGS) screening procedure for identifying anti-TIM3 sequences. 1) immunizing mice, 2) isolate splenic B cells, 3) isolate RNA, 4) FuzeSeq? (GENEWIZ) antibody sequencing, 5) bioinformatics analysis of IgH and IgL rearrangements to select putative anti-TIM3 sequences, and 6) in vitro screening to validate.

    [0020] FIG. 3 illustrates how next generation sequencing (NGS) can improve in vivo discovery methods using hybridomas.

    [0021] FIG. 4 illustrates the work flow of B cell antibody library profiling using NGS. Advantages include a snapshot of antibody responses at a certain moment, in depth profiling of diverse antibody repertoire, no humanization needed for therapeutic antibody, saves time and effort creating and selecting hybridomas, and no dropout of high affinity antibodies due to inefficient cell fusion.

    [0022] FIG. 5 illustrates the process for preparing a library for NGS.

    [0023] FIG. 6 illustrates the data analysis workflow and deliverables of B cell antibody library profiling using NGS. This involves data quality control, multiplexing, and quality trimming; CDR identification and frequency analysis; V-D-J usage an lineage frequency; and CDR length distribution and CDR3 clustering.

    [0024] FIGS. 7A and 7B show the most common shared VJ.sub.k (FIG. 7A) and VDJ.sub.H(FIG. 7B) rearrangements in three TIM3 immunized mice. Sequences selected for validation are boxed (Vk13-85 is not in the top 10 vk sequences and was included as a control).

    [0025] FIG. 8 illustrates an example scFv constructed to target TIM3 (IGHV812-IGKV461 scFv).

    [0026] FIG. 9 is a sequence alignment of IGHV812-based anti-TIM3 scFv sequences. IGHV812 is paired with one of four IGK rearrangements to create 4 separate anti-TIM3 scFv. IGHV812-IGKV1385: SEQ ID NO:15; IGHV812-IGKV539: SEQ ID NO:16; IGHV812-IGKV486: SEQ ID NO:17; IGHV812-IGKV461: SEQ ID NO:18.

    [0027] FIG. 10 is a sequence alignment of IGHV1S81-based anti-TIM3 scFv sequences. IGHV1S81 is paired with one of four IGK rearrangements to create 4 separate anti-TIM3 scFv. IGHV1S81-IGKV461: SEQ ID NO:19; IGHV1S81-IGKV539: SEQ ID NO:20; IGHV1S81-IGKV1385: SEQ ID NO:21; IGHV1S81-IGKV486: SEQ ID NO:22.

    [0028] FIG. 11 shows an example anti-TIM3/BBz GFP CAR construct. The transmembrane and hinge domains are derived from CD8. Human 41BB intracellular co-stimulatory domain is fused to human CD3zeta.

    [0029] FIGS. 12A and 12B show TIM3 retargeting of Jurkat T cells transduced with IGHV812-based anti-TIM3 scFv. FIG. 12A shows TIM3-positive targets, and FIG. 12B shows TIM3-negative targets. Interferon-gamma is secreted only when TIM3-postive targets are encountered.

    [0030] FIGS. 13A and 13B show TIM3 retargeting of Jurkat T cells transduced with IGHV1S81-based anti-TIM3 scFv. FIG. 13A shows TIM3-positive targets, and FIG. 13B shows TIM3-negative targets. Interferon-gamma is secreted only when TIM3-postive targets are encountered.

    [0031] FIGS. 14A to 14D show primary human T cells expressing anti-TIM3 CARs can effectively kill TIM3 target cells as measured using a Real-Time cell Analysis cytotoxicity assay. Target cells are CHO-TIM3. E:T ratio of 10:1 was used. Untransduced cells are negative control for T cells. CHO-CD20 are negative controls for targets.

    [0032] FIGS. 15A to 15H show primary human T cells expressing anti-TIM3 CARs can effectively kill TIM3 target cells as measured using a Real-Time cell Analysis cytotoxicity assay. Target cells are CHO-TIM3. E:T ratio of 10:1 was used. Untransduced cells are negative control for T cells. CHO-CD20 are negative controls for targets.

    [0033] FIGS. 16A to 16H show primary human T cells expressing anti-TIM3 CARs can effectively kill TIM3 target cells as measured using a Real-Time cell Analysis cytotoxicity assay. Target cells are CHO-TIM3. Untransduced cells are negative control for T cells. CHO-CD20 are negative controls for targets. They compare killing at an E:T 10:1 vs. 5:1 ratios.

    [0034] FIGS. 17A and 17B show primary human T cells expressing anti-TIM3 CARs can effectively kill TIM3 target cells as measured using a Real-Time cell Analysis cytotoxicity assay. T cells were treated with TIM3 blocking antibody before added to target cells. Target cells are CHO-TIM3 or CHO-CD20. E:T ratio of 10:1 was used.

    [0035] FIGS. 18A to 18H show primary human T cells expressing anti-TIM3 CARs can effectively kill TIM3 target cells as measured using a Real-Time cell Analysis cytotoxicity assay. T cells were treated with TIM3 blocking antibody before added to target cells. Target cells are CHO-TIM3 or CHO-CD20. E:T ratio of 10:1 was used.

    [0036] FIGS. 19A to 19C show Jurkat cells expressing anti-TIM3 CAR VHS-539 have robust gene transfer (B) and IFN? expression (A) after stimulation with target cells expressing TIM3.

    [0037] FIGS. 20A to 20H show primary human T cells transduced with anti-TIM3 CARs have significantly increased secretion of cytokines after TIM3 antigen-stimulation for 24 hr. Cytokines measured by Luminex.

    [0038] FIGS. 21A and 21B show proliferation of TIM3 CAR-T in vivo and AML Killing. FIG. 21A shows CAR T cell numbers analyzed via GFP fluorescence showed significant expansion of TIM3 CAR T cells in human AML xenografted mice compared to control group. FIG. 21B shows TIM3 CAR-T were able to kill the Human AML (CD33+CD45+) cells compared to control CAR T untreated group in peripheral blood. NSG mice were engrafted with patient derived AML cells via IV injection. Six weeks after confirmation of engraftment, xenografted mice were treated TIM3 directed CAR T cells or saline as a control generated from normal healthy donor T cells. Three weeks following CAR T cells injection, mice were bled to quantitate CAR T cells proliferation and myeloid cells ablation.

    DETAILED DESCRIPTION

    [0039] Disclosed herein are chimeric antigen receptors (CAR) that can specifically recognize tumor-associated antigens (TAA) on TIM3-expressing cancers. Also disclosed are immune effector cells, such as T cells or Natural Killer (NK) cells, that are engineered to express these CARs. Therefore, also disclosed are methods for providing an anti-tumor immunity in a subject with TIM3-expressing cancers that involves adoptive transfer of the disclosed immune effector cells engineered to express the disclosed TIM3-specific CARs.

    [0040] TIM3-Specific Chimeric Antigen Receptors (CAR)

    [0041] CARs generally incorporate an antigen recognition domain from the single-chain variable fragments (scFv) of a monocional antibody (mAb) with transmembrane signaling motifs involved in lymphocyte activation (Sadelain M, et al. Nat Rev Cancer 2003 3:35-45). Disclosed herein is a TIM3-specific chimeric antigen receptor (CAR) that can be that can be expressed in immune effector cells to enhance antitumor activity against TIM3-specific CARs.

    [0042] The disclosed CAR is generally made up of three domains: an ectodomain, a transmembrane domain, and an endodomain. The ectodomain comprises the TIM3-binding region and is responsible for antigen recognition. It also optionally contains a signal peptide (SP) so that the CAR can be glycosylated and anchored in the cell membrane of the immune effector cell. The transmembrane domain (TD), is as its name suggests, connects the ectodomain to the endodomain and resides within the cell membrane when expressed by a cell. The endodomain is the business end of the CAR that transmits an activation signal to the immune effector cell after antigen recognition. For example, the endodomain can contain a signaling domain (SD) and a co-stimulatory signaling region (CSR).

    [0043] A signaling domain (SD) generally contains immunoreceptor tyrosine-based activation motifs (ITAMs) that activate a signaling cascade when the ITAM is phosphorylated. The term co-stimulatory signaling region (CSR) refers to intracellular signaling domains from costimulatory protein receptors, such as CD28, 41BB, and ICOS, that are able to enhance T-cell activation by T-cell receptors.

    [0044] In some embodiments, the endodomain contains an SD or a CSR, but not both. In these embodiments, an immune effector cell containing the disclosed CAR is only activated if another CAR (or a T-cell receptor) containing the missing domain also binds its respective antigen.

    [0045] In some embodiments, the disclosed CAR is defined by the formula:


    SP-TIM3-HG-TM-CSR-SD; or


    SP-TIM3-HG-TM-SD-CSR

    [0046] wherein SP represents an optional signal peptide,

    [0047] wherein TIM3 represents a TIM3-binding region,

    [0048] wherein HG represents an optional hinge domain,

    [0049] wherein TM represents a transmembrane domain,

    [0050] wherein CSR represents one or more co-stimulatory signaling regions,

    [0051] wherein SD represents a signaling domain, and

    [0052] wherein represents a peptide bond or linker.

    [0053] Additional CAR constructs are described, for example, in Fresnak A D, et al.

    [0054] Engineered T cells: the promise and challenges of cancer immunotherapy. Nat Rev Cancer. 2016 Aug. 23; 16(9):566-81, which is incorporated by reference in its entirety for the teaching of these CAR models.

    [0055] For example, the CAR can be a TRUCK, Universal CAR, Self-driving CAR, Armored CAR, Self-destruct CAR, Conditional CAR, Marked CAR, TenCAR, Dual CAR, or sCAR.

    [0056] TRUCKs (T cells redirected for universal cytokine killing) co-express a chimeric antigen receptor (CAR) and an antitumor cytokine. Cytokine expression may be constitutive or induced by T cell activation. Targeted by CAR specificity, localized production of pro-inflammatory cytokines recruits endogenous immune cells to tumor sites and may potentiate an antitumor response.

    [0057] Universal, allogeneic CAR T cells are engineered to no longer express endogenous T cell receptor (TCR) and/or major histocompatibility complex (MHC) molecules, thereby preventing graft-versus-host disease (GVHD) or rejection, respectively.

    [0058] Self-driving CARs co-express a CAR and a chemokine receptor, which binds to a tumor ligand, thereby enhancing tumor homing.

    [0059] CAR T cells engineered to be resistant to immunosuppression (Armored CARs) may be genetically modified to no longer express various immune checkpoint molecules (for example, cytotoxic T lymphocyte-associated antigen 4 (CTLA4) or programmed cell death protein 1 (PD1)), with an immune checkpoint switch receptor, or may be administered with a monoclonal antibody that blocks immune checkpoint signaling.

    [0060] A self-destruct CAR may be designed using RNA delivered by electroporation to encode the CAR. Alternatively, inducible apoptosis of the T cell may be achieved based on ganciclovir binding to thymidine kinase in gene-modified lymphocytes or the more recently described system of activation of human caspase 9 by a small-molecule dimerizer.

    [0061] A conditional CAR T cell is by default unresponsive, or switched off, until the addition of a small molecule to complete the circuit, enabling full transduction of both signal 1 and signal 2, thereby activating the CAR T cell. Alternatively, T cells may be engineered to express an adaptor-specific receptor with affinity for subsequently administered secondary antibodies directed at target antigen.

    [0062] Marked CAR T cells express a CAR plus a tumor epitope to which an existing monocional antibody agent binds. In the setting of intolerable adverse effects, administration of the monoclonal antibody clears the CAR T cells and alleviates symptoms with no additional off-tumor effects.

    [0063] A tandem CAR (TanCAR) T cell expresses a single CAR consisting of two linked single-chain variable fragments (scFvs) that have different affinities fused to intracellular co-stimulatory domain(s) and a CD3? domain. TanCAR T cell activation is achieved only when target cells co-express both targets.

    [0064] A dual CAR T cell expresses two separate CARs with different ligand binding targets; one CAR includes only the CD3? domain and the other CAR includes only the co-stimulatory domain(s). Dual CAR T cell activation requires co-expression of both targets on the tumor.

    [0065] A safety CAR (sCAR) consists of an extracellular scFv fused to an intracellular inhibitory domain, sCAR T cells co-expressing a standard CAR become activated only when encountering target cells that possess the standard CAR target but lack the sCAR target.

    [0066] The antigen recognition domain of the disclosed CAR is usually an scFv. There are however many alternatives. An antigen recognition domain from native T-cell receptor (TCR) alpha and beta single chains have been described, as have simple ectodomains (e.g. CD4 ectodomain to recognize HIV infected cells) and more exotic recognition components such as a linked cytokine (which leads to recognition of cells bearing the cytokine receptor). In fact almost anything that binds a given target with high affinity can be used as an antigen recognition region.

    [0067] The endodomain is the business end of the CAR that after antigen recognition transmits a signal to the immune effector cell, activating at least one of the normal effector functions of the immune effector cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Therefore, the endodomain may comprise the signaling domain of a T cell receptor (TCR). While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal.

    [0068] Cytoplasmic signaling sequences that regulate primary activation of the TCR complex that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs (ITAMs). Examples of ITAM containing cytoplasmic signaling sequences include those derived from CD8, CD3?, CD3?, CD3?, CD3?, CD32 (Fc gamma RIIa), DAP10, DAP12, CD79a, CD79b, Fc?RI?, Fc?RIII?, Fc?RI? (FCERIB), and Fc?RI? (FCERIG).

    [0069] In particular embodiments, the signaling domain is derived from CD3 zeta (CD3?) (TCR zeta, GenBank accno. BAG36664.1). T-cell surface glycoprotein CD3 zeta (CD3?) chain, also known as T-cell receptor T3 zeta chain or CD247 (Cluster of Differentiation 247), is a protein that in humans is encoded by the CD247 gene.

    [0070] First-generation CARs typically had the intracellular domain from the CD3? chain, which is the primary transmitter of signals from endogenous TCRs. Second-generation CARs add intracellular signaling domains from various costimulatory protein receptors (e.g., CD28, 41BB, ICOS) to the endodomain of the CAR to provide additional signals to the T cell. Preclinical studies have indicated that the second generation of CAR designs improves the antitumor activity of T cells. More recent, third-generation CARs combine multiple signaling domains to further augment potency. T cells grafted with these CARs have demonstrated improved expansion, activation, persistence, and tumor-eradicating efficiency independent of costimulatory receptor/ligand interaction (Imai C, et al. Leukemia 2004 18:676-84; Maher J, et al. Nat Biotechnol 2002 20:70-5).

    [0071] For example, the endodomain of the CAR can be designed to comprise the CD3? signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the invention. For example, the cytoplasmic domain of the CAR can comprise a CD3? chain portion and a costimulatory signaling region. The costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen. Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, CD8, CD4, b2c, CD80, CD86, DAP10, DAP12, MyD88, BTNL3, and NKG2D. Thus, while the CAR is exemplified primarily with CD28 as the co-stimulatory signaling element, other costimulatory elements can be used alone or in combination with other co-stimulatory signaling elements.

    [0072] In some embodiments, the CAR comprises a hinge sequence. A hinge sequence is a short sequence of amino acids that facilitates antibody flexibility (see, e.g., Woof et al., Nat. Rev. Immunol., 4(2): 89-99 (2004)). The hinge sequence may be positioned between the antigen recognition moiety (e.g., anti-TIM3 scFv) and the transmembrane domain. The hinge sequence can be any suitable sequence derived or obtained from any suitable molecule. In some embodiments, for example, the hinge sequence is derived from a CD8a molecule or a CD28 molecule.

    [0073] The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. For example, the transmembrane region may be derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8 (e.g., CD8 alpha, CD8 beta), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, or CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CD11a, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R ?, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAMI, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), SLAMF6 (NTB-A, Ly108), SLAM (SLAMFI, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, and PAG/Cbp. Alternatively the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In some cases, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. A short oligo- or polypeptide linker, such as between 2 and 10 amino acids in length, may form the linkage between the transmembrane domain and the endoplasmic domain of the CAR.

    [0074] In some embodiments, the CAR has more than one transmembrane domain, which can be a repeat of the same transmembrane domain, or can be different transmembrane domains.

    [0075] In some embodiments, the CAR is a multi-chain CAR, as described in WO2015/039523, which is incorporated by reference for this teaching. A multi-chain CAR can comprise separate extracellular ligand binding and signaling domains in different transmembrane polypeptides. The signaling domains can be designed to assemble in juxtamembrane position, which forms flexible architecture closer to natural receptors, that confers optimal signal transduction. For example, the multi-chain CAR can comprise a part of an FCERI alpha chain and a part of an FCERI beta chain such that the FCERI chains spontaneously dimerize together to form a CAR.

    [0076] Tables 1, 2, and 3 below provide some example combinations of TIM3-binding region, co-stimulatory signaling regions, and signaling domains that can occur in the disclosed CARs. Tables 4 to 6 provide examples of combinations without either a signaling domain or a co-stimulatory signal region, i.e. so the CAR provides suboptimal activation upon binding to TIM3 and requires a second CAR containing the missing domain to bind its respective antigen in order for the cell to be activated.

    TABLE-US-00001 TABLE 1 First Generation CARs ScFv Signal Domain TIM3 CD8 TIM3 CD3? TIM3 CD3? TIM3 CD3? TIM3 CD3? TIM3 Fc?RI-? TIM3 Fc?RIII-? TIM3 Fc?RI? TIM3 Fc?RI? TIM3 DAP10 TIM3 DAP12 TIM3 CD32 TIM3 CD79a

    TABLE-US-00002 TABLE 2 Second Generation CARs Co-stimulatory Signal Co-stimulatory Signal ScFv Signal Domain ScFv Signal Domain TIM3 CD28 CD8 TIM3 CD80 Fc?RI? TIM3 CD28 CD3? TIM3 CD80 Fc?RI? TIM3 CD28 CD3? TIM3 CD80 DAP10 TIM3 CD28 CD3? TIM3 CD80 DAP12 TIM3 CD28 CD3? TIM3 CD80 CD32 TIM3 CD28 Fc?RI-? TIM3 CD80 CD79a TIM3 CD28 Fc?RIII-? TIM3 CD80 CD79b TIM3 CD28 Fc?RI? TIM3 CD86 CD8 TIM3 CD28 Fc?RI? TIM3 CD86 CD3? TIM3 CD28 DAP10 TIM3 CD86 CD3? TIM3 CD28 DAP12 TIM3 CD86 CD3? TIM3 CD28 CD32 TIM3 CD86 CD3? TIM3 CD28 CD79a TIM3 CD86 Fc?RI-? TIM3 CD28 CD79b TIM3 CD86 Fc?RIII-? TIM3 CD8 CD8 TIM3 CD86 Fc?RI? TIM3 CD8 CD3? TIM3 CD86 Fc?RI? TIM3 CD8 CD3? TIM3 CD86 DAP10 TIM3 CD8 CD3? TIM3 CD86 DAP12 TIM3 CD8 CD3? TIM3 CD86 CD32 TIM3 CD8 Fc?RI-? TIM3 CD86 CD79a TIM3 CD8 Fc?RIII-? TIM3 CD86 CD79b TIM3 CD8 Fc?RI? TIM3 OX40 CD8 TIM3 CD8 Fc?RI? TIM3 OX40 CD3? TIM3 CD8 DAP10 TIM3 OX40 CD3? TIM3 CD8 DAP12 TIM3 OX40 CD3? TIM3 CD8 CD32 TIM3 OX40 CD3? TIM3 CD8 CD79a TIM3 OX40 Fc?RI-? TIM3 CD8 CD79b TIM3 OX40 Fc?RIII-? TIM3 CD4 CD8 TIM3 OX40 Fc?RI? TIM3 CD4 CD3? TIM3 OX40 Fc?RI? TIM3 CD4 CD3? TIM3 OX40 DAP10 TIM3 CD4 CD3? TIM3 OX40 DAP12 TIM3 CD4 CD3? TIM3 OX40 CD32 TIM3 CD4 Fc?RI-? TIM3 OX40 CD79a TIM3 CD4 Fc?RIII-? TIM3 OX40 CD79b TIM3 CD4 Fc?RI? TIM3 DAP10 CD8 TIM3 CD4 Fc?RI? TIM3 DAP10 CD3? TIM3 CD4 DAP10 TIM3 DAP10 CD3? TIM3 CD4 DAP12 TIM3 DAP10 CD3? TIM3 CD4 CD32 TIM3 DAP10 CD3? TIM3 CD4 CD79a TIM3 DAP10 Fc?RI-? TIM3 CD4 CD79b TIM3 DAP10 Fc?RIII-? TIM3 b2c CD8 TIM3 DAP10 Fc?RI? TIM3 b2c CD3? TIM3 DAP10 Fc?RI? TIM3 b2c CD3? TIM3 DAP10 DAP10 TIM3 b2c CD3? TIM3 DAP10 DAP12 TIM3 b2c CD3? TIM3 DAP10 CD32 TIM3 b2c Fc?RI-? TIM3 DAP10 CD79a TIM3 b2c Fc?RIII-? TIM3 DAP10 CD79b TIM3 b2c Fc?RI? TIM3 DAP12 CD8 TIM3 b2c Fc?RI? TIM3 DAP12 CD3? TIM3 b2c DAP10 TIM3 DAP12 CD3? TIM3 b2c DAP12 TIM3 DAP12 CD3? TIM3 b2c CD32 TIM3 DAP12 CD3? TIM3 b2c CD79a TIM3 DAP12 Fc?RI-? TIM3 b2c CD79b TIM3 DAP12 Fc?RIII-? TIM3 CD137/41BB CD8 TIM3 DAP12 Fc?RI? TIM3 CD137/41BB CD3? TIM3 DAP12 Fc?RI? TIM3 CD137/41BB CD3? TIM3 DAP12 DAP10 TIM3 CD137/41BB CD3? TIM3 DAP12 DAP12 TIM3 CD137/41BB CD3? TIM3 DAP12 CD32 TIM3 CD137/41BB Fc?RI-? TIM3 DAP12 CD79a TIM3 CD137/41BB Fc?RIII-? TIM3 DAP12 CD79b TIM3 CD137/41BB Fc?RI? TIM3 MyD88 CD8 TIM3 CD137/41BB Fc?RI? TIM3 MyD88 CD3? TIM3 CD137/41BB DAP10 TIM3 MyD88 CD3? TIM3 CD137/41BB DAP12 TIM3 MyD88 CD3? TIM3 CD137/41BB CD32 TIM3 MyD88 CD3? TIM3 CD137/41BB CD79a TIM3 MyD88 Fc?RI-? TIM3 CD137/41BB CD79b TIM3 MyD88 Fc?RIII-? TIM3 ICOS CD8 TIM3 MyD88 Fc?RI? TIM3 ICOS CD3? TIM3 MyD88 Fc?RI? TIM3 ICOS CD3? TIM3 MyD88 DAP10 TIM3 ICOS CD3? TIM3 MyD88 DAP12 TIM3 ICOS CD3? TIM3 MyD88 CD32 TIM3 ICOS Fc?RI-? TIM3 MyD88 CD79a TIM3 ICOS Fc?RIII-? TIM3 MyD88 CD79b TIM3 ICOS Fc?RI? TIM3 CD7 CD8 TIM3 ICOS Fc?RI? TIM3 CD7 CD3? TIM3 ICOS DAP10 TIM3 CD7 CD3? TIM3 ICOS DAP12 TIM3 CD7 CD3? TIM3 ICOS CD32 TIM3 CD7 CD3? TIM3 ICOS CD79a TIM3 CD7 Fc?RI-? TIM3 ICOS CD79b TIM3 CD7 Fc?RIII-? TIM3 CD27 CD8 TIM3 CD7 Fc?RI? TIM3 CD27 CD3? TIM3 CD7 Fc?RI? TIM3 CD27 CD3? TIM3 CD7 DAP10 TIM3 CD27 CD3? TIM3 CD7 DAP12 TIM3 CD27 CD3? TIM3 CD7 CD32 TIM3 CD27 Fc?RI-? TIM3 CD7 CD79a TIM3 CD27 Fc?RIII-? TIM3 CD7 CD79b TIM3 CD27 Fc?RI? TIM3 BTNL3 CD8 TIM3 CD27 Fc?RI? TIM3 BTNL3 CD3? TIM3 CD27 DAP10 TIM3 BTNL3 CD3? TIM3 CD27 DAP12 TIM3 BTNL3 CD3? TIM3 CD27 CD32 TIM3 BTNL3 CD3? TIM3 CD27 CD79a TIM3 BTNL3 Fc?RI-? TIM3 CD27 CD79b TIM3 BTNL3 Fc?RIII-? TIM3 CD28? CD8 TIM3 BTNL3 Fc?RI? TIM3 CD28? CD3? TIM3 BTNL3 Fc?RI? TIM3 CD28? CD3? TIM3 BTNL3 DAP10 TIM3 CD28? CD3? TIM3 BTNL3 DAP12 TIM3 CD28? CD3? TIM3 BTNL3 CD32 TIM3 CD28? Fc?RI-? TIM3 BTNL3 CD79a TIM3 CD28? Fc?RIII-? TIM3 BTNL3 CD79b TIM3 CD28? Fc?RI? TIM3 NKG2D CD8 TIM3 CD28? Fc?RI? TIM3 NKG2D CD3? TIM3 CD28? DAP10 TIM3 NKG2D CD3? TIM3 CD28? DAP12 TIM3 NKG2D CD3? TIM3 CD28? CD32 TIM3 NKG2D CD3? TIM3 CD28? CD79a TIM3 NKG2D Fc?RI-? TIM3 CD28? CD79b TIM3 NKG2D Fc?RIII-? TIM3 CD80 CD8 TIM3 NKG2D Fc?RI? TIM3 CD80 CD3? TIM3 NKG2D Fc?RI? TIM3 CD80 CD3? TIM3 NKG2D DAP10 TIM3 CD80 CD3? TIM3 NKG2D DAP12 TIM3 CD80 CD3? TIM3 NKG2D CD32 TIM3 CD80 Fc?RI-? TIM3 NKG2D CD79a TIM3 CD80 Fc?RIII-? TIM3 NKG2D CD79b

    TABLE-US-00003 TABLE 3 Third Generation CARs Co-stimulatory Co-stimulatory Signal ScFv Signal Signal Domain TIM3 CD28 CD28 CD8 TIM3 CD28 CD28 CD3? TIM3 CD28 CD28 CD3? TIM3 CD28 CD28 CD3? TIM3 CD28 CD28 CD3? TIM3 CD28 CD28 Fc?RI-? TIM3 CD28 CD28 Fc?RIII-? TIM3 CD28 CD28 Fc?RI? TIM3 CD28 CD28 Fc?RI? TIM3 CD28 CD28 DAP10 TIM3 CD28 CD28 DAP12 TIM3 CD28 CD28 CD32 TIM3 CD28 CD28 CD79a TIM3 CD28 CD28 CD79b TIM3 CD28 CD8 CD8 TIM3 CD28 CD8 CD3? TIM3 CD28 CD8 CD3? TIM3 CD28 CD8 CD3? TIM3 CD28 CD8 CD3? TIM3 CD28 CD8 Fc?RI-? TIM3 CD28 CD8 Fc?RIII-? TIM3 CD28 CD8 Fc?RI? TIM3 CD28 CD8 Fc?RI? TIM3 CD28 CD8 DAP10 TIM3 CD28 CD8 DAP12 TIM3 CD28 CD8 CD32 TIM3 CD28 CD8 CD79a TIM3 CD28 CD8 CD79b TIM3 CD28 CD4 CD8 TIM3 CD28 CD4 CD3? TIM3 CD28 CD4 CD3? TIM3 CD28 CD4 CD3? TIM3 CD28 CD4 CD3? TIM3 CD28 CD4 Fc?RI-? TIM3 CD28 CD4 Fc?RIII-? TIM3 CD28 CD4 Fc?RI? TIM3 CD28 CD4 Fc?RI? TIM3 CD28 CD4 DAP10 TIM3 CD28 CD4 DAP12 TIM3 CD28 CD4 CD32 TIM3 CD28 CD4 CD79a TIM3 CD28 CD4 CD79b TIM3 CD28 b2c CD8 TIM3 CD28 b2c CD3? TIM3 CD28 b2c CD3? TIM3 CD28 b2c CD3? TIM3 CD28 b2c CD3? TIM3 CD28 b2c Fc?RI-? TIM3 CD28 b2c Fc?RIII-? TIM3 CD28 b2c Fc?RI? TIM3 CD28 b2c Fc?RI? TIM3 CD28 b2c DAP10 TIM3 CD28 b2c DAP12 TIM3 CD28 b2c CD32 TIM3 CD28 b2c CD79a TIM3 CD28 b2c CD79b TIM3 CD28 CD137/41BB CD8 TIM3 CD28 CD137/41BB CD3? TIM3 CD28 CD137/41BB CD3? TIM3 CD28 CD137/41BB CD3? TIM3 CD28 CD137/41BB CD3? TIM3 CD28 CD137/41BB Fc?RI-? TIM3 CD28 CD137/41BB Fc?RIII-? TIM3 CD28 CD137/41BB Fc?RI? TIM3 CD28 CD137/41BB Fc?RI? TIM3 CD28 CD137/41BB DAP10 TIM3 CD28 CD137/41BB DAP12 TIM3 CD28 CD137/41BB CD32 TIM3 CD28 CD137/41BB CD79a TIM3 CD28 CD137/41BB CD79b TIM3 CD28 ICOS CD8 TIM3 CD28 ICOS CD3? TIM3 CD28 ICOS CD3? TIM3 CD28 ICOS CD3? TIM3 CD28 ICOS CD3? TIM3 CD28 ICOS Fc?RI-? TIM3 CD28 ICOS Fc?RIII-? TIM3 CD28 ICOS Fc?RI? TIM3 CD28 ICOS Fc?RI? TIM3 CD28 ICOS DAP10 TIM3 CD28 ICOS DAP12 TIM3 CD28 ICOS CD32 TIM3 CD28 ICOS CD79a TIM3 CD28 ICOS CD79b TIM3 CD28 CD27 CD8 TIM3 CD28 CD27 CD3? TIM3 CD28 CD27 CD3? TIM3 CD28 CD27 CD3? TIM3 CD28 CD27 CD3? TIM3 CD28 CD27 Fc?RI-? TIM3 CD28 CD27 Fc?RIII-? TIM3 CD28 CD27 Fc?RI? TIM3 CD28 CD27 Fc?RI? TIM3 CD28 CD27 DAP10 TIM3 CD28 CD27 DAP12 TIM3 CD28 CD27 CD32 TIM3 CD28 CD27 CD79a TIM3 CD28 CD27 CD79b TIM3 CD28 CD28? CD8 TIM3 CD28 CD28? CD3? TIM3 CD28 CD28? CD3? TIM3 CD28 CD28? CD3? TIM3 CD28 CD28? CD3? TIM3 CD28 CD28? Fc?RI-? TIM3 CD28 CD28? Fc?RIII-? TIM3 CD28 CD28? Fc?RI? TIM3 CD28 CD28? Fc?RI? TIM3 CD28 CD28? DAP10 TIM3 CD28 CD28? DAP12 TIM3 CD28 CD28? CD32 TIM3 CD28 CD28? CD79a TIM3 CD28 CD28? CD79b TIM3 CD28 CD80 CD8 TIM3 CD28 CD80 CD3? TIM3 CD28 CD80 CD3? TIM3 CD28 CD80 CD3? TIM3 CD28 CD80 CD3? TIM3 CD28 CD80 Fc?RI-? TIM3 CD28 CD80 Fc?RIII-? TIM3 CD28 CD80 Fc?RI? TIM3 CD28 CD80 Fc?RI? TIM3 CD28 CD80 DAP10 TIM3 CD28 CD80 DAP12 TIM3 CD28 CD80 CD32 TIM3 CD28 CD80 CD79a TIM3 CD28 CD80 CD79b TIM3 CD28 CD86 CD8 TIM3 CD28 CD86 CD3? TIM3 CD28 CD86 CD3? TIM3 CD28 CD86 CD3? TIM3 CD28 CD86 CD3? TIM3 CD28 CD86 Fc?RI-? TIM3 CD28 CD86 Fc?RIII-? TIM3 CD28 CD86 Fc?RI? TIM3 CD28 CD86 Fc?RI? TIM3 CD28 CD86 DAP10 TIM3 CD28 CD86 DAP12 TIM3 CD28 CD86 CD32 TIM3 CD28 CD86 CD79a TIM3 CD28 CD86 CD79b TIM3 CD28 OX40 CD8 TIM3 CD28 OX40 CD3? TIM3 CD28 OX40 CD3? TIM3 CD28 OX40 CD3? TIM3 CD28 OX40 CD3? TIM3 CD28 OX40 Fc?RI-? TIM3 CD28 OX40 Fc?RIII-? TIM3 CD28 OX40 Fc?RI? TIM3 CD28 OX40 Fc?RI? TIM3 CD28 OX40 DAP10 TIM3 CD28 OX40 DAP12 TIM3 CD28 OX40 CD32 TIM3 CD28 OX40 CD79a TIM3 CD28 OX40 CD79b TIM3 CD28 DAP10 CD8 TIM3 CD28 DAP10 CD3? TIM3 CD28 DAP10 CD3? TIM3 CD28 DAP10 CD3? TIM3 CD28 DAP10 CD3? TIM3 CD28 DAP10 Fc?RI-? TIM3 CD28 DAP10 Fc?RIII-? TIM3 CD28 DAP10 Fc?RI? TIM3 CD28 DAP10 Fc?RI? TIM3 CD28 DAP10 DAP10 TIM3 CD28 DAP10 DAP12 TIM3 CD28 DAP10 CD32 TIM3 CD28 DAP10 CD79a TIM3 CD28 DAP10 CD79b TIM3 CD28 DAP12 CD8 TIM3 CD28 DAP12 CD3? TIM3 CD28 DAP12 CD3? TIM3 CD28 DAP12 CD3? TIM3 CD28 DAP12 CD3? TIM3 CD28 DAP12 Fc?RI-? TIM3 CD28 DAP12 Fc?RIII-? TIM3 CD28 DAP12 Fc?RI? TIM3 CD28 DAP12 Fc?RI? TIM3 CD28 DAP12 DAP10 TIM3 CD28 DAP12 DAP12 TIM3 CD28 DAP12 CD32 TIM3 CD28 DAP12 CD79a TIM3 CD28 DAP12 CD79b TIM3 CD28 MyD88 CD8 TIM3 CD28 MyD88 CD3? TIM3 CD28 MyD88 CD3? TIM3 CD28 MyD88 CD3? TIM3 CD28 MyD88 CD3? TIM3 CD28 MyD88 Fc?RI-? TIM3 CD28 MyD88 Fc?RIII-? TIM3 CD28 MyD88 Fc?RI? TIM3 CD28 MyD88 Fc?RI? TIM3 CD28 MyD88 DAP10 TIM3 CD28 MyD88 DAP12 TIM3 CD28 MyD88 CD32 TIM3 CD28 MyD88 CD79a TIM3 CD28 MyD88 CD79b TIM3 CD28 CD7 CD8 TIM3 CD28 CD7 CD3? TIM3 CD28 CD7 CD3? TIM3 CD28 CD7 CD3? TIM3 CD28 CD7 CD3? TIM3 CD28 CD7 Fc?RI-? TIM3 CD28 CD7 Fc?RIII-? TIM3 CD28 CD7 Fc?RI? TIM3 CD28 CD7 Fc?RI? TIM3 CD28 CD7 DAP10 TIM3 CD28 CD7 DAP12 TIM3 CD28 CD7 CD32 TIM3 CD28 CD7 CD79a TIM3 CD28 CD7 CD79b TIM3 CD28 BTNL3 CD8 TIM3 CD28 BTNL3 CD3? TIM3 CD28 BTNL3 CD3? TIM3 CD28 BTNL3 CD3? TIM3 CD28 BTNL3 CD3? TIM3 CD28 BTNL3 Fc?RI-? TIM3 CD28 BTNL3 Fc?RIII-? TIM3 CD28 BTNL3 Fc?RI? TIM3 CD28 BTNL3 Fc?RI? TIM3 CD28 BTNL3 DAP10 TIM3 CD28 BTNL3 DAP12 TIM3 CD28 BTNL3 CD32 TIM3 CD28 BTNL3 CD79a TIM3 CD28 BTNL3 CD79b TIM3 CD28 NKG2D CD8 TIM3 CD28 NKG2D CD3? TIM3 CD28 NKG2D CD3? TIM3 CD28 NKG2D CD3? TIM3 CD28 NKG2D CD3? TIM3 CD28 NKG2D Fc?RI-? TIM3 CD28 NKG2D Fc?RIII-? TIM3 CD28 NKG2D Fc?RI? TIM3 CD28 NKG2D Fc?RI? TIM3 CD28 NKG2D DAP10 TIM3 CD28 NKG2D DAP12 TIM3 CD28 NKG2D CD32 TIM3 CD28 NKG2D CD79a TIM3 CD28 NKG2D CD79b TIM3 CD8 CD28 CD8 TIM3 CD8 CD28 CD3? TIM3 CD8 CD28 CD3? TIM3 CD8 CD28 CD3? TIM3 CD8 CD28 CD3? TIM3 CD8 CD28 Fc?RI-? TIM3 CD8 CD28 Fc?RIII-? TIM3 CD8 CD28 Fc?RI? TIM3 CD8 CD28 Fc?RI? TIM3 CD8 CD28 DAP10 TIM3 CD8 CD28 DAP12 TIM3 CD8 CD28 CD32 TIM3 CD8 CD28 CD79a TIM3 CD8 CD28 CD79b TIM3 CD8 CD8 CD8 TIM3 CD8 CD8 CD3? TIM3 CD8 CD8 CD3? TIM3 CD8 CD8 CD3? TIM3 CD8 CD8 CD3? TIM3 CD8 CD8 Fc?RI-? TIM3 CD8 CD8 Fc?RIII-? TIM3 CD8 CD8 Fc?RI? TIM3 CD8 CD8 Fc?RI? TIM3 CD8 CD8 DAP10 TIM3 CD8 CD8 DAP12 TIM3 CD8 CD8 CD32 TIM3 CD8 CD8 CD79a TIM3 CD8 CD8 CD79b TIM3 CD8 CD4 CD8 TIM3 CD8 CD4 CD3? TIM3 CD8 CD4 CD3? TIM3 CD8 CD4 CD3? TIM3 CD8 CD4 CD3? TIM3 CD8 CD4 Fc?RI-? TIM3 CD8 CD4 Fc?RIII-? TIM3 CD8 CD4 Fc?RI? TIM3 CD8 CD4 Fc?RI? TIM3 CD8 CD4 DAP10 TIM3 CD8 CD4 DAP12 TIM3 CD8 CD4 CD32 TIM3 CD8 CD4 CD79a TIM3 CD8 CD4 CD79b TIM3 CD8 b2c CD8 TIM3 CD8 b2c CD3? TIM3 CD8 b2c CD3? TIM3 CD8 b2c CD3? TIM3 CD8 b2c CD3? TIM3 CD8 b2c Fc?RI-? TIM3 CD8 b2c Fc?RIII-? TIM3 CD8 b2c Fc?RI? TIM3 CD8 b2c Fc?RI? TIM3 CD8 b2c DAP10 TIM3 CD8 b2c DAP12 TIM3 CD8 b2c CD32 TIM3 CD8 b2c CD79a TIM3 CD8 b2c CD79b TIM3 CD8 CD137/41BB CD8 TIM3 CD8 CD137/41BB CD3? TIM3 CD8 CD137/41BB CD3? TIM3 CD8 CD137/41BB CD3? TIM3 CD8 CD137/41BB CD3? TIM3 CD8 CD137/41BB Fc?RI-? TIM3 CD8 CD137/41BB Fc?RIII-? TIM3 CD8 CD137/41BB Fc?RI? TIM3 CD8 CD137/41BB Fc?RI? TIM3 CD8 CD137/41BB DAP10 TIM3 CD8 CD137/41BB DAP12 TIM3 CD8 CD137/41BB CD32 TIM3 CD8 CD137/41BB CD79a TIM3 CD8 CD137/41BB CD79b TIM3 CD8 ICOS CD8 TIM3 CD8 ICOS CD3? TIM3 CD8 ICOS CD3? TIM3 CD8 ICOS CD3? TIM3 CD8 ICOS CD3? TIM3 CD8 ICOS Fc?RI-? TIM3 CD8 ICOS Fc?RIII-? TIM3 CD8 ICOS Fc?RI? TIM3 CD8 ICOS Fc?RI? TIM3 CD8 ICOS DAP10 TIM3 CD8 ICOS DAP12 TIM3 CD8 ICOS CD32 TIM3 CD8 ICOS CD79a TIM3 CD8 ICOS CD79b TIM3 CD8 CD27 CD8 TIM3 CD8 CD27 CD3? TIM3 CD8 CD27 CD3? TIM3 CD8 CD27 CD3? TIM3 CD8 CD27 CD3? TIM3 CD8 CD27 Fc?RI-? TIM3 CD8 CD27 Fc?RIII-? TIM3 CD8 CD27 Fc?RI? TIM3 CD8 CD27 Fc?RI? TIM3 CD8 CD27 DAP10 TIM3 CD8 CD27 DAP12 TIM3 CD8 CD27 CD32 TIM3 CD8 CD27 CD79a TIM3 CD8 CD27 CD79b TIM3 CD8 CD28? CD8 TIM3 CD8 CD28? CD3? TIM3 CD8 CD28? CD3? TIM3 CD8 CD28? CD3? TIM3 CD8 CD28? CD3? TIM3 CD8 CD28? Fc?RI-? TIM3 CD8 CD28? Fc?RIII-? TIM3 CD8 CD28? Fc?RI? TIM3 CD8 CD28? Fc?RI? TIM3 CD8 CD28? DAP10 TIM3 CD8 CD28? DAP12 TIM3 CD8 CD28? CD32 TIM3 CD8 CD28? CD79a TIM3 CD8 CD28? CD79b TIM3 CD8 CD80 CD8 TIM3 CD8 CD80 CD3? TIM3 CD8 CD80 CD3? TIM3 CD8 CD80 CD3? TIM3 CD8 CD80 CD3? TIM3 CD8 CD80 Fc?RI-? TIM3 CD8 CD80 Fc?RIII-? TIM3 CD8 CD80 Fc?RI? TIM3 CD8 CD80 Fc?RI? TIM3 CD8 CD80 DAP10 TIM3 CD8 CD80 DAP12 TIM3 CD8 CD80 CD32 TIM3 CD8 CD80 CD79a TIM3 CD8 CD80 CD79b TIM3 CD8 CD86 CD8 TIM3 CD8 CD86 CD3? TIM3 CD8 CD86 CD3? TIM3 CD8 CD86 CD3? TIM3 CD8 CD86 CD3? TIM3 CD8 CD86 Fc?RI-? TIM3 CD8 CD86 Fc?RIII-? TIM3 CD8 CD86 Fc?RI? TIM3 CD8 CD86 Fc?RI? TIM3 CD8 CD86 DAP10 TIM3 CD8 CD86 DAP12 TIM3 CD8 CD86 CD32 TIM3 CD8 CD86 CD79a TIM3 CD8 CD86 CD79b TIM3 CD8 OX40 CD8 TIM3 CD8 OX40 CD3? TIM3 CD8 OX40 CD3? TIM3 CD8 OX40 CD3? TIM3 CD8 OX40 CD3? TIM3 CD8 OX40 Fc?RI-? TIM3 CD8 OX40 Fc?RIII-? TIM3 CD8 OX40 Fc?RI? TIM3 CD8 OX40 Fc?RI? TIM3 CD8 OX40 DAP10 TIM3 CD8 OX40 DAP12 TIM3 CD8 OX40 CD32 TIM3 CD8 OX40 CD79a TIM3 CD8 OX40 CD79b TIM3 CD8 DAP10 CD8 TIM3 CD8 DAP10 CD3? TIM3 CD8 DAP10 CD3? TIM3 CD8 DAP10 CD3? TIM3 CD8 DAP10 CD3? TIM3 CD8 DAP10 Fc?RI-? TIM3 CD8 DAP10 Fc?RIII-? TIM3 CD8 DAP10 Fc?RI? TIM3 CD8 DAP10 Fc?RI? TIM3 CD8 DAP10 DAP10 TIM3 CD8 DAP10 DAP12 TIM3 CD8 DAP10 CD32 TIM3 CD8 DAP10 CD79a TIM3 CD8 DAP10 CD79b TIM3 CD8 DAP12 CD8 TIM3 CD8 DAP12 CD3? TIM3 CD8 DAP12 CD3? TIM3 CD8 DAP12 CD3? TIM3 CD8 DAP12 CD3? TIM3 CD8 DAP12 Fc?RI-? TIM3 CD8 DAP12 Fc?RIII-? TIM3 CD8 DAP12 Fc?RI? TIM3 CD8 DAP12 Fc?RI? TIM3 CD8 DAP12 DAP10 TIM3 CD8 DAP12 DAP12 TIM3 CD8 DAP12 CD32 TIM3 CD8 DAP12 CD79a TIM3 CD8 DAP12 CD79b TIM3 CD8 MyD88 CD8 TIM3 CD8 MyD88 CD3? TIM3 CD8 MyD88 CD3? TIM3 CD8 MyD88 CD3? TIM3 CD8 MyD88 CD3? TIM3 CD8 MyD88 Fc?RI-? TIM3 CD8 MyD88 Fc?RIII-? TIM3 CD8 MyD88 Fc?RI? TIM3 CD8 MyD88 Fc?RI? TIM3 CD8 MyD88 DAP10 TIM3 CD8 MyD88 DAP12 TIM3 CD8 MyD88 CD32 TIM3 CD8 MyD88 CD79a TIM3 CD8 MyD88 CD79b TIM3 CD8 CD7 CD8 TIM3 CD8 CD7 CD3? TIM3 CD8 CD7 CD3? TIM3 CD8 CD7 CD3? TIM3 CD8 CD7 CD3? TIM3 CD8 CD7 Fc?RI-? TIM3 CD8 CD7 Fc?RIII-? TIM3 CD8 CD7 Fc?RI? TIM3 CD8 CD7 Fc?RI? TIM3 CD8 CD7 DAP10 TIM3 CD8 CD7 DAP12 TIM3 CD8 CD7 CD32 TIM3 CD8 CD7 CD79a TIM3 CD8 CD7 CD79b TIM3 CD8 BTNL3 CD8 TIM3 CD8 BTNL3 CD3? TIM3 CD8 BTNL3 CD3? TIM3 CD8 BTNL3 CD3? TIM3 CD8 BTNL3 CD3? TIM3 CD8 BTNL3 Fc?RI-? TIM3 CD8 BTNL3 Fc?RIII-? TIM3 CD8 BTNL3 Fc?RI? TIM3 CD8 BTNL3 Fc?RI? TIM3 CD8 BTNL3 DAP10 TIM3 CD8 BTNL3 DAP12 TIM3 CD8 BTNL3 CD32 TIM3 CD8 BTNL3 CD79a TIM3 CD8 BTNL3 CD79b TIM3 CD8 NKG2D CD8 TIM3 CD8 NKG2D CD3? TIM3 CD8 NKG2D CD3? TIM3 CD8 NKG2D CD3? TIM3 CD8 NKG2D CD3? TIM3 CD8 NKG2D Fc?RI-? TIM3 CD8 NKG2D Fc?RIII-? TIM3 CD8 NKG2D Fc?RI? TIM3 CD8 NKG2D Fc?RI? TIM3 CD8 NKG2D DAP10 TIM3 CD8 NKG2D DAP12 TIM3 CD8 NKG2D CD32 TIM3 CD8 NKG2D CD79a TIM3 CD8 NKG2D CD79b TIM3 CD4 CD28 CD8 TIM3 CD4 CD28 CD3? TIM3 CD4 CD28 CD3? TIM3 CD4 CD28 CD3? TIM3 CD4 CD28 CD3? TIM3 CD4 CD28 Fc?RI-? TIM3 CD4 CD28 Fc?RIII-? TIM3 CD4 CD28 Fc?RI? TIM3 CD4 CD28 Fc?RI? TIM3 CD4 CD28 DAP10 TIM3 CD4 CD28 DAP12 TIM3 CD4 CD28 CD32 TIM3 CD4 CD28 CD79a TIM3 CD4 CD28 CD79b TIM3 CD4 CD8 CD8 TIM3 CD4 CD8 CD3? TIM3 CD4 CD8 CD3? TIM3 CD4 CD8 CD3? TIM3 CD4 CD8 CD3? TIM3 CD4 CD8 Fc?RI-? TIM3 CD4 CD8 Fc?RIII-? TIM3 CD4 CD8 Fc?RI? TIM3 CD4 CD8 Fc?RI? TIM3 CD4 CD8 DAP10 TIM3 CD4 CD8 DAP12 TIM3 CD4 CD8 CD32 TIM3 CD4 CD8 CD79a TIM3 CD4 CD8 CD79b TIM3 CD4 CD4 CD8 TIM3 CD4 CD4 CD3? TIM3 CD4 CD4 CD3? TIM3 CD4 CD4 CD3? TIM3 CD4 CD4 CD3? TIM3 CD4 CD4 Fc?RI-? TIM3 CD4 CD4 Fc?RIII-? TIM3 CD4 CD4 Fc?RI? TIM3 CD4 CD4 Fc?RI? TIM3 CD4 CD4 DAP10 TIM3 CD4 CD4 DAP12 TIM3 CD4 CD4 CD32 TIM3 CD4 CD4 CD79a TIM3 CD4 CD4 CD79b TIM3 CD4 b2c CD8 TIM3 CD4 b2c CD3? TIM3 CD4 b2c CD3? TIM3 CD4 b2c CD3? TIM3 CD4 b2c CD3? TIM3 CD4 b2c Fc?RI-? TIM3 CD4 b2c Fc?RIII-? TIM3 CD4 b2c Fc?RI? TIM3 CD4 b2c Fc?RI? TIM3 CD4 b2c DAP10 TIM3 CD4 b2c DAP12 TIM3 CD4 b2c CD32 TIM3 CD4 b2c CD79a TIM3 CD4 b2c CD79b TIM3 CD4 CD137/41BB CD8 TIM3 CD4 CD137/41BB CD3? TIM3 CD4 CD137/41BB CD3? TIM3 CD4 CD137/41BB CD3? TIM3 CD4 CD137/41BB CD3? TIM3 CD4 CD137/41BB Fc?RI-? TIM3 CD4 CD137/41BB Fc?RIII-? TIM3 CD4 CD137/41BB Fc?RI? TIM3 CD4 CD137/41BB Fc?RI? TIM3 CD4 CD137/41BB DAP10 TIM3 CD4 CD137/41BB DAP12 TIM3 CD4 CD137/41BB CD32 TIM3 CD4 CD137/41BB CD79a TIM3 CD4 CD137/41BB CD79b TIM3 CD4 ICOS CD8 TIM3 CD4 ICOS CD3? TIM3 CD4 ICOS CD3? TIM3 CD4 ICOS CD3? TIM3 CD4 ICOS CD3? TIM3 CD4 ICOS Fc?RI-? TIM3 CD4 ICOS Fc?RIII-? TIM3 CD4 ICOS Fc?RI? TIM3 CD4 ICOS Fc?RI? TIM3 CD4 ICOS DAP10 TIM3 CD4 ICOS DAP12 TIM3 CD4 ICOS CD32 TIM3 CD4 ICOS CD79a TIM3 CD4 ICOS CD79b TIM3 CD4 CD27 CD8 TIM3 CD4 CD27 CD3? TIM3 CD4 CD27 CD3? TIM3 CD4 CD27 CD3? TIM3 CD4 CD27 CD3? TIM3 CD4 CD27 Fc?RI-? TIM3 CD4 CD27 Fc?RIII-? TIM3 CD4 CD27 Fc?RI? TIM3 CD4 CD27 Fc?RI? TIM3 CD4 CD27 DAP10 TIM3 CD4 CD27 DAP12 TIM3 CD4 CD27 CD32 TIM3 CD4 CD27 CD79a TIM3 CD4 CD27 CD79b TIM3 CD4 CD28? CD8 TIM3 CD4 CD28? CD3? TIM3 CD4 CD28? CD3? TIM3 CD4 CD28? CD3? TIM3 CD4 CD28? CD3? TIM3 CD4 CD28? Fc?RI-? TIM3 CD4 CD28? Fc?RIII-? TIM3 CD4 CD28? Fc?RI? TIM3 CD4 CD28? Fc?RI? TIM3 CD4 CD28? DAP10 TIM3 CD4 CD28? DAP12 TIM3 CD4 CD28? CD32 TIM3 CD4 CD28? CD79a TIM3 CD4 CD28? CD79b TIM3 CD4 CD80 CD8 TIM3 CD4 CD80 CD3? TIM3 CD4 CD80 CD3? TIM3 CD4 CD80 CD3? TIM3 CD4 CD80 CD3? TIM3 CD4 CD80 Fc?RI-? TIM3 CD4 CD80 Fc?RIII-? TIM3 CD4 CD80 Fc?RI? TIM3 CD4 CD80 Fc?RI? TIM3 CD4 CD80 DAP10 TIM3 CD4 CD80 DAP12 TIM3 CD4 CD80 CD32 TIM3 CD4 CD80 CD79a TIM3 CD4 CD80 CD79b TIM3 CD4 CD86 CD8 TIM3 CD4 CD86 CD3? TIM3 CD4 CD86 CD3? TIM3 CD4 CD86 CD3? TIM3 CD4 CD86 CD3? TIM3 CD4 CD86 Fc?RI-? TIM3 CD4 CD86 Fc?RIII-? TIM3 CD4 CD86 Fc?RI? TIM3 CD4 CD86 Fc?RI? TIM3 CD4 CD86 DAP10 TIM3 CD4 CD86 DAP12 TIM3 CD4 CD86 CD32 TIM3 CD4 CD86 CD79a TIM3 CD4 CD86 CD79b TIM3 CD4 OX40 CD8 TIM3 CD4 OX40 CD3? TIM3 CD4 OX40 CD3? TIM3 CD4 OX40 CD3? TIM3 CD4 OX40 CD3? TIM3 CD4 OX40 Fc?RI-? TIM3 CD4 OX40 Fc?RIII-? TIM3 CD4 OX40 Fc?RI? TIM3 CD4 OX40 Fc?RI? TIM3 CD4 OX40 DAP10 TIM3 CD4 OX40 DAP12 TIM3 CD4 OX40 CD32 TIM3 CD4 OX40 CD79a TIM3 CD4 OX40 CD79b TIM3 CD4 DAP10 CD8 TIM3 CD4 DAP10 CD3? TIM3 CD4 DAP10 CD3? TIM3 CD4 DAP10 CD3? TIM3 CD4 DAP10 CD3? TIM3 CD4 DAP10 Fc?RI-? TIM3 CD4 DAP10 Fc?RIII-? TIM3 CD4 DAP10 Fc?RI? TIM3 CD4 DAP10 Fc?RI? TIM3 CD4 DAP10 DAP10 TIM3 CD4 DAP10 DAP12 TIM3 CD4 DAP10 CD32 TIM3 CD4 DAP10 CD79a TIM3 CD4 DAP10 CD79b TIM3 CD4 DAP12 CD8 TIM3 CD4 DAP12 CD3? TIM3 CD4 DAP12 CD3? TIM3 CD4 DAP12 CD3? TIM3 CD4 DAP12 CD3? TIM3 CD4 DAP12 Fc?RI-? TIM3 CD4 DAP12 Fc?RIII-? TIM3 CD4 DAP12 Fc?RI? TIM3 CD4 DAP12 Fc?RI? TIM3 CD4 DAP12 DAP10 TIM3 CD4 DAP12 DAP12 TIM3 CD4 DAP12 CD32 TIM3 CD4 DAP12 CD79a TIM3 CD4 DAP12 CD79b TIM3 CD4 MyD88 CD8 TIM3 CD4 MyD88 CD3? TIM3 CD4 MyD88 CD3? TIM3 CD4 MyD88 CD3? TIM3 CD4 MyD88 CD3? TIM3 CD4 MyD88 Fc?RI-? TIM3 CD4 MyD88 Fc?RIII-? TIM3 CD4 MyD88 Fc?RI? TIM3 CD4 MyD88 Fc?RI? TIM3 CD4 MyD88 DAP10 TIM3 CD4 MyD88 DAP12 TIM3 CD4 MyD88 CD32 TIM3 CD4 MyD88 CD79a TIM3 CD4 MyD88 CD79b TIM3 CD4 CD7 CD8 TIM3 CD4 CD7 CD3? TIM3 CD4 CD7 CD3? TIM3 CD4 CD7 CD3? TIM3 CD4 CD7 CD3? TIM3 CD4 CD7 Fc?RI-? TIM3 CD4 CD7 Fc?RIII-? TIM3 CD4 CD7 Fc?RI? TIM3 CD4 CD7 Fc?RI? TIM3 CD4 CD7 DAP10 TIM3 CD4 CD7 DAP12 TIM3 CD4 CD7 CD32 TIM3 CD4 CD7 CD79a TIM3 CD4 CD7 CD79b TIM3 CD4 BTNL3 CD8 TIM3 CD4 BTNL3 CD3? TIM3 CD4 BTNL3 CD3? TIM3 CD4 BTNL3 CD3? TIM3 CD4 BTNL3 CD3? TIM3 CD4 BTNL3 Fc?RI-? TIM3 CD4 BTNL3 Fc?RIII-? TIM3 CD4 BTNL3 Fc?RI? TIM3 CD4 BTNL3 Fc?RI? TIM3 CD4 BTNL3 DAP10 TIM3 CD4 BTNL3 DAP12 TIM3 CD4 BTNL3 CD32 TIM3 CD4 BTNL3 CD79a TIM3 CD4 BTNL3 CD79b TIM3 CD4 NKG2D CD8 TIM3 CD4 NKG2D CD3? TIM3 CD4 NKG2D CD3? TIM3 CD4 NKG2D CD3? TIM3 CD4 NKG2D CD3? TIM3 CD4 NKG2D Fc?RI-? TIM3 CD4 NKG2D Fc?RIII-? TIM3 CD4 NKG2D Fc?RI? TIM3 CD4 NKG2D Fc?RI? TIM3 CD4 NKG2D DAP10 TIM3 CD4 NKG2D DAP12 TIM3 CD4 NKG2D CD32 TIM3 CD4 NKG2D CD79a TIM3 CD4 NKG2D CD79b TIM3 b2c CD28 CD8 TIM3 b2c CD28 CD3? TIM3 b2c CD28 CD3? TIM3 b2c CD28 CD3? TIM3 b2c CD28 CD3? TIM3 b2c CD28 Fc?RI-? TIM3 b2c CD28 Fc?RIII-? TIM3 b2c CD28 Fc?RI? TIM3 b2c CD28 Fc?RI? TIM3 b2c CD28 DAP10 TIM3 b2c CD28 DAP12 TIM3 b2c CD28 CD32 TIM3 b2c CD28 CD79a TIM3 b2c CD28 CD79b TIM3 b2c CD8 CD8 TIM3 b2c CD8 CD3? TIM3 b2c CD8 CD3? TIM3 b2c CD8 CD3? TIM3 b2c CD8 CD3? TIM3 b2c CD8 Fc?RI-? TIM3 b2c CD8 Fc?RIII-? TIM3 b2c CD8 Fc?RI? TIM3 b2c CD8 Fc?RI? TIM3 b2c CD8 DAP10 TIM3 b2c CD8 DAP12 TIM3 b2c CD8 CD32 TIM3 b2c CD8 CD79a TIM3 b2c CD8 CD79b TIM3 b2c CD4 CD8 TIM3 b2c CD4 CD3? TIM3 b2c CD4 CD3? TIM3 b2c CD4 CD3? TIM3 b2c CD4 CD3? TIM3 b2c CD4 Fc?RI-? TIM3 b2c CD4 Fc?RIII-? TIM3 b2c CD4 Fc?RI? TIM3 b2c CD4 Fc?RI? TIM3 b2c CD4 DAP10 TIM3 b2c CD4 DAP12 TIM3 b2c CD4 CD32 TIM3 b2c CD4 CD79a TIM3 b2c CD4 CD79b TIM3 b2c b2c CD8 TIM3 b2c b2c CD3? TIM3 b2c b2c CD3? TIM3 b2c b2c CD3? TIM3 b2c b2c CD3? TIM3 b2c b2c Fc?RI-? TIM3 b2c b2c Fc?RIII-? TIM3 b2c b2c Fc?RI? TIM3 b2c b2c Fc?RI? TIM3 b2c b2c DAP10 TIM3 b2c b2c DAP12 TIM3 b2c b2c CD32 TIM3 b2c b2c CD79a TIM3 b2c b2c CD79b TIM3 b2c CD137/41BB CD8 TIM3 b2c CD137/41BB CD3? TIM3 b2c CD137/41BB CD3? TIM3 b2c CD137/41BB CD3? TIM3 b2c CD137/41BB CD3? TIM3 b2c CD137/41BB Fc?RI-? TIM3 b2c CD137/41BB Fc?RIII-? TIM3 b2c CD137/41BB Fc?RI? TIM3 b2c CD137/41BB Fc?RI? TIM3 b2c CD137/41BB DAP10 TIM3 b2c CD137/41BB DAP12 TIM3 b2c CD137/41BB CD32 TIM3 b2c CD137/41BB CD79a TIM3 b2c CD137/41BB CD79b TIM3 b2c ICOS CD8 TIM3 b2c ICOS CD3? TIM3 b2c ICOS CD3? TIM3 b2c ICOS CD3? TIM3 b2c ICOS CD3? TIM3 b2c ICOS Fc?RI-? TIM3 b2c ICOS Fc?RIII-? TIM3 b2c ICOS Fc?RI? TIM3 b2c ICOS Fc?RI? TIM3 b2c ICOS DAP10 TIM3 b2c ICOS DAP12 TIM3 b2c ICOS CD32 TIM3 b2c ICOS CD79a TIM3 b2c ICOS CD79b TIM3 b2c CD27 CD8 TIM3 b2c CD27 CD3? TIM3 b2c CD27 CD3? TIM3 b2c CD27 CD3? TIM3 b2c CD27 CD3? TIM3 b2c CD27 Fc?RI-? TIM3 b2c CD27 Fc?RIII-? TIM3 b2c CD27 Fc?RI? TIM3 b2c CD27 Fc?RI? TIM3 b2c CD27 DAP10 TIM3 b2c CD27 DAP12 TIM3 b2c CD27 CD32 TIM3 b2c CD27 CD79a TIM3 b2c CD27 CD79b TIM3 b2c CD28? CD8 TIM3 b2c CD28? CD3? TIM3 b2c CD28? CD3? TIM3 b2c CD28? CD3? TIM3 b2c CD28? CD3? TIM3 b2c CD28? Fc?RI-? TIM3 b2c CD28? Fc?RIII-? TIM3 b2c CD28? Fc?RI? TIM3 b2c CD28? Fc?RI? TIM3 b2c CD28? DAP10 TIM3 b2c CD28? DAP12 TIM3 b2c CD28? CD32 TIM3 b2c CD28? CD79a TIM3 b2c CD28? CD79b TIM3 b2c CD80 CD8 TIM3 b2c CD80 CD3? TIM3 b2c CD80 CD3? TIM3 b2c CD80 CD3? TIM3 b2c CD80 CD3? TIM3 b2c CD80 Fc?RI-? TIM3 b2c CD80 Fc?RIII-? TIM3 b2c CD80 Fc?RI? TIM3 b2c CD80 Fc?RI? TIM3 b2c CD80 DAP10 TIM3 b2c CD80 DAP12 TIM3 b2c CD80 CD32 TIM3 b2c CD80 CD79a TIM3 b2c CD80 CD79b TIM3 b2c CD86 CD8 TIM3 b2c CD86 CD3? TIM3 b2c CD86 CD3? TIM3 b2c CD86 CD3? TIM3 b2c CD86 CD3? TIM3 b2c CD86 Fc?RI-? TIM3 b2c CD86 Fc?RIII-? TIM3 b2c CD86 Fc?RI? TIM3 b2c CD86 Fc?RI? TIM3 b2c CD86 DAP10 TIM3 b2c CD86 DAP12 TIM3 b2c CD86 CD32 TIM3 b2c CD86 CD79a TIM3 b2c CD86 CD79b TIM3 b2c OX40 CD8 TIM3 b2c OX40 CD3? TIM3 b2c OX40 CD3? TIM3 b2c OX40 CD3? TIM3 b2c OX40 CD3? TIM3 b2c OX40 Fc?RI-? TIM3 b2c OX40 Fc?RIII-? TIM3 b2c OX40 Fc?RI? TIM3 b2c OX40 Fc?RI? TIM3 b2c OX40 DAP10 TIM3 b2c OX40 DAP12 TIM3 b2c OX40 CD32 TIM3 b2c OX40 CD79a TIM3 b2c OX40 CD79b TIM3 b2c DAP10 CD8 TIM3 b2c DAP10 CD3? TIM3 b2c DAP10 CD3? TIM3 b2c DAP10 CD3? TIM3 b2c DAP10 CD3? TIM3 b2c DAP10 Fc?RI-? TIM3 b2c DAP10 Fc?RIII-? TIM3 b2c DAP10 Fc?RI? TIM3 b2c DAP10 Fc?RI? TIM3 b2c DAP10 DAP10 TIM3 b2c DAP10 DAP12 TIM3 b2c DAP10 CD32 TIM3 b2c DAP10 CD79a TIM3 b2c DAP10 CD79b TIM3 b2c DAP12 CD8 TIM3 b2c DAP12 CD3? TIM3 b2c DAP12 CD3? TIM3 b2c DAP12 CD3? TIM3 b2c DAP12 CD3? TIM3 b2c DAP12 Fc?RI-? TIM3 b2c DAP12 Fc?RIII-? TIM3 b2c DAP12 Fc?RI? TIM3 b2c DAP12 Fc?RI? TIM3 b2c DAP12 DAP10 TIM3 b2c DAP12 DAP12 TIM3 b2c DAP12 CD32 TIM3 b2c DAP12 CD79a TIM3 b2c DAP12 CD79b TIM3 b2c MyD88 CD8 TIM3 b2c MyD88 CD3? TIM3 b2c MyD88 CD3? TIM3 b2c MyD88 CD3? TIM3 b2c MyD88 CD3? TIM3 b2c MyD88 Fc?RI-? TIM3 b2c MyD88 Fc?RIII-? TIM3 b2c MyD88 Fc?RI? TIM3 b2c MyD88 Fc?RI? TIM3 b2c MyD88 DAP10 TIM3 b2c MyD88 DAP12 TIM3 b2c MyD88 CD32 TIM3 b2c MyD88 CD79a TIM3 b2c MyD88 CD79b TIM3 b2c CD7 CD8 TIM3 b2c CD7 CD3? TIM3 b2c CD7 CD3? TIM3 b2c CD7 CD3? TIM3 b2c CD7 CD3? TIM3 b2c CD7 Fc?RI-? TIM3 b2c CD7 Fc?RIII-? TIM3 b2c CD7 Fc?RI? TIM3 b2c CD7 Fc?RI? TIM3 b2c CD7 DAP10 TIM3 b2c CD7 DAP12 TIM3 b2c CD7 CD32 TIM3 b2c CD7 CD79a TIM3 b2c CD7 CD79b TIM3 b2c BTNL3 CD8 TIM3 b2c BTNL3 CD3? TIM3 b2c BTNL3 CD3? TIM3 b2c BTNL3 CD3? TIM3 b2c BTNL3 CD3? TIM3 b2c BTNL3 Fc?RI-? TIM3 b2c BTNL3 Fc?RIII-? TIM3 b2c BTNL3 Fc?RI? TIM3 b2c BTNL3 Fc?RI? TIM3 b2c BTNL3 DAP10 TIM3 b2c BTNL3 DAP12 TIM3 b2c BTNL3 CD32 TIM3 b2c BTNL3 CD79a TIM3 b2c BTNL3 CD79b TIM3 b2c NKG2D CD8 TIM3 b2c NKG2D CD3? TIM3 b2c NKG2D CD3? TIM3 b2c NKG2D CD3? TIM3 b2c NKG2D CD3? TIM3 b2c NKG2D Fc?RI-? TIM3 b2c NKG2D Fc?RIII-? TIM3 b2c NKG2D Fc?RI? TIM3 b2c NKG2D Fc?RI? TIM3 b2c NKG2D DAP10 TIM3 b2c NKG2D DAP12 TIM3 b2c NKG2D CD32 TIM3 b2c NKG2D CD79a TIM3 b2c NKG2D CD79b TIM3 CD137/41BB CD28 CD8 TIM3 CD137/41BB CD28 CD3? TIM3 CD137/41BB CD28 CD3? TIM3 CD137/41BB CD28 CD3? TIM3 CD137/41BB CD28 CD3? TIM3 CD137/41BB CD28 Fc?RI-? TIM3 CD137/41BB CD28 Fc?RIII-? TIM3 CD137/41BB CD28 Fc?RI? TIM3 CD137/41BB CD28 Fc?RI? TIM3 CD137/41BB CD28 DAP10 TIM3 CD137/41BB CD28 DAP12 TIM3 CD137/41BB CD28 CD32 TIM3 CD137/41BB CD28 CD79a TIM3 CD137/41BB CD28 CD79b TIM3 CD137/41BB CD8 CD8 TIM3 CD137/41BB CD8 CD3? TIM3 CD137/41BB CD8 CD3? TIM3 CD137/41BB CD8 CD3? TIM3 CD137/41BB CD8 CD3? TIM3 CD137/41BB CD8 Fc?RI-? TIM3 CD137/41BB CD8 Fc?RIII-? TIM3 CD137/41BB CD8 Fc?RI? TIM3 CD137/41BB CD8 Fc?RI? TIM3 CD137/41BB CD8 DAP10 TIM3 CD137/41BB CD8 DAP12 TIM3 CD137/41BB CD8 CD32 TIM3 CD137/41BB CD8 CD79a TIM3 CD137/41BB CD8 CD79b TIM3 CD137/41BB CD4 CD8 TIM3 CD137/41BB CD4 CD3? TIM3 CD137/41BB CD4 CD3? TIM3 CD137/41BB CD4 CD3? TIM3 CD137/41BB CD4 CD3? TIM3 CD137/41BB CD4 Fc?RI-? TIM3 CD137/41BB CD4 Fc?RIII-? TIM3 CD137/41BB CD4 Fc?RI? TIM3 CD137/41BB CD4 Fc?RI? TIM3 CD137/41BB CD4 DAP10 TIM3 CD137/41BB CD4 DAP12 TIM3 CD137/41BB CD4 CD32 TIM3 CD137/41BB CD4 CD79a TIM3 CD137/41BB CD4 CD79b TIM3 CD137/41BB b2c CD8 TIM3 CD137/41BB b2c CD3? TIM3 CD137/41BB b2c CD3? TIM3 CD137/41BB b2c CD3? TIM3 CD137/41BB b2c CD3? TIM3 CD137/41BB b2c Fc?RI-? TIM3 CD137/41BB b2c Fc?RIII-? TIM3 CD137/41BB b2c Fc?RI? TIM3 CD137/41BB b2c Fc?RI? TIM3 CD137/41BB b2c DAP10 TIM3 CD137/41BB b2c DAP12 TIM3 CD137/41BB b2c CD32 TIM3 CD137/41BB b2c CD79a TIM3 CD137/41BB b2c CD79b TIM3 CD137/41BB CD137/41BB CD8 TIM3 CD137/41BB CD137/41BB CD3? TIM3 CD137/41BB CD137/41BB CD3? TIM3 CD137/41BB CD137/41BB CD3? TIM3 CD137/41BB CD137/41BB CD3? TIM3 CD137/41BB CD137/41BB Fc?RI-? TIM3 CD137/41BB CD137/41BB Fc?RIII-? TIM3 CD137/41BB CD137/41BB Fc?RI? TIM3 CD137/41BB CD137/41BB Fc?RI? TIM3 CD137/41BB CD137/41BB DAP10 TIM3 CD137/41BB CD137/41BB DAP12 TIM3 CD137/41BB CD137/41BB CD32 TIM3 CD137/41BB CD137/41BB CD79a TIM3 CD137/41BB CD137/41BB CD79b TIM3 CD137/41BB ICOS CD8 TIM3 CD137/41BB ICOS CD3? TIM3 CD137/41BB ICOS CD3? TIM3 CD137/41BB ICOS CD3? TIM3 CD137/41BB ICOS CD3? TIM3 CD137/41BB ICOS Fc?RI-? TIM3 CD137/41BB ICOS Fc?RIII-? TIM3 CD137/41BB ICOS Fc?RI? TIM3 CD137/41BB ICOS Fc?RI? TIM3 CD137/41BB ICOS DAP10 TIM3 CD137/41BB ICOS DAP12 TIM3 CD137/41BB ICOS CD32 TIM3 CD137/41BB ICOS CD79a TIM3 CD137/41BB ICOS CD79b TIM3 CD137/41BB CD27 CD8 TIM3 CD137/41BB CD27 CD3? TIM3 CD137/41BB CD27 CD3? TIM3 CD137/41BB CD27 CD3? TIM3 CD137/41BB CD27 CD3? TIM3 CD137/41BB CD27 Fc?RI-? TIM3 CD137/41BB CD27 Fc?RIII-? TIM3 CD137/41BB CD27 Fc?RI? TIM3 CD137/41BB CD27 Fc?RI? TIM3 CD137/41BB CD27 DAP10 TIM3 CD137/41BB CD27 DAP12 TIM3 CD137/41BB CD27 CD32 TIM3 CD137/41BB CD27 CD79a TIM3 CD137/41BB CD27 CD79b TIM3 CD137/41BB CD28? CD8 TIM3 CD137/41BB CD28? CD3? TIM3 CD137/41BB CD28? CD3? TIM3 CD137/41BB CD28? CD3? TIM3 CD137/41BB CD28? CD3? TIM3 CD137/41BB CD28? Fc?RI-? TIM3 CD137/41BB CD28? Fc?RIII-? TIM3 CD137/41BB CD28? Fc?RI? TIM3 CD137/41BB CD28? Fc?RI? TIM3 CD137/41BB CD28? DAP10 TIM3 CD137/41BB CD28? DAP12 TIM3 CD137/41BB CD28? CD32 TIM3 CD137/41BB CD28? CD79a TIM3 CD137/41BB CD28? CD79b TIM3 CD137/41BB CD80 CD8 TIM3 CD137/41BB CD80 CD3? TIM3 CD137/41BB CD80 CD3? TIM3 CD137/41BB CD80 CD3? TIM3 CD137/41BB CD80 CD3? TIM3 CD137/41BB CD80 Fc?RI-? TIM3 CD137/41BB CD80 Fc?RIII-? TIM3 CD137/41BB CD80 Fc?RI? TIM3 CD137/41BB CD80 Fc?RI? TIM3 CD137/41BB CD80 DAP10 TIM3 CD137/41BB CD80 DAP12 TIM3 CD137/41BB CD80 CD32 TIM3 CD137/41BB CD80 CD79a TIM3 CD137/41BB CD80 CD79b TIM3 CD137/41BB CD86 CD8 TIM3 CD137/41BB CD86 CD3? TIM3 CD137/41BB CD86 CD3? TIM3 CD137/41BB CD86 CD3? TIM3 CD137/41BB CD86 CD3? TIM3 CD137/41BB CD86 Fc?RI-? TIM3 CD137/41BB CD86 Fc?RIII-? TIM3 CD137/41BB CD86 Fc?RI? TIM3 CD137/41BB CD86 Fc?RI? TIM3 CD137/41BB CD86 DAP10 TIM3 CD137/41BB CD86 DAP12 TIM3 CD137/41BB CD86 CD32 TIM3 CD137/41BB CD86 CD79a TIM3 CD137/41BB CD86 CD79b TIM3 CD137/41BB OX40 CD8 TIM3 CD137/41BB OX40 CD3? TIM3 CD137/41BB OX40 CD3? TIM3 CD137/41BB OX40 CD3? TIM3 CD137/41BB OX40 CD3? TIM3 CD137/41BB OX40 Fc?RI-? TIM3 CD137/41BB OX40 Fc?RIII-? TIM3 CD137/41BB OX40 Fc?RI? TIM3 CD137/41BB OX40 Fc?RI? TIM3 CD137/41BB OX40 DAP10 TIM3 CD137/41BB OX40 DAP12 TIM3 CD137/41BB OX40 CD32 TIM3 CD137/41BB OX40 CD79a TIM3 CD137/41BB OX40 CD79b TIM3 CD137/41BB DAP10 CD8 TIM3 CD137/41BB DAP10 CD3? TIM3 CD137/41BB DAP10 CD3? TIM3 CD137/41BB DAP10 CD3? TIM3 CD137/41BB DAP10 CD3? TIM3 CD137/41BB DAP10 Fc?RI-? TIM3 CD137/41BB DAP10 Fc?RIII-? TIM3 CD137/41BB DAP10 Fc?RI? TIM3 CD137/41BB DAP10 Fc?RI? TIM3 CD137/41BB DAP10 DAP10 TIM3 CD137/41BB DAP10 DAP12 TIM3 CD137/41BB DAP10 CD32 TIM3 CD137/41BB DAP10 CD79a TIM3 CD137/41BB DAP10 CD79b TIM3 CD137/41BB DAP12 CD8 TIM3 CD137/41BB DAP12 CD3? TIM3 CD137/41BB DAP12 CD3? TIM3 CD137/41BB DAP12 CD3? TIM3 CD137/41BB DAP12 CD3? TIM3 CD137/41BB DAP12 Fc?RI-? TIM3 CD137/41BB DAP12 Fc?RIII-? TIM3 CD137/41BB DAP12 Fc?RI? TIM3 CD137/41BB DAP12 Fc?RI? TIM3 CD137/41BB DAP12 DAP10 TIM3 CD137/41BB DAP12 DAP12 TIM3 CD137/41BB DAP12 CD32 TIM3 CD137/41BB DAP12 CD79a TIM3 CD137/41BB DAP12 CD79b TIM3 CD137/41BB MyD88 CD8 TIM3 CD137/41BB MyD88 CD3? TIM3 CD137/41BB MyD88 CD3? TIM3 CD137/41BB MyD88 CD3? TIM3 CD137/41BB MyD88 CD3? TIM3 CD137/41BB MyD88 Fc?RI-? TIM3 CD137/41BB MyD88 Fc?RIII-? TIM3 CD137/41BB MyD88 Fc?RI? TIM3 CD137/41BB MyD88 Fc?RI? TIM3 CD137/41BB MyD88 DAP10 TIM3 CD137/41BB MyD88 DAP12 TIM3 CD137/41BB MyD88 CD32 TIM3 CD137/41BB MyD88 CD79a TIM3 CD137/41BB MyD88 CD79b TIM3 CD137/41BB CD7 CD8 TIM3 CD137/41BB CD7 CD3? TIM3 CD137/41BB CD7 CD3? TIM3 CD137/41BB CD7 CD3? TIM3 CD137/41BB CD7 CD3? TIM3 CD137/41BB CD7 Fc?RI-? TIM3 CD137/41BB CD7 Fc?RIII-? TIM3 CD137/41BB CD7 Fc?RI? TIM3 CD137/41BB CD7 Fc?RI? TIM3 CD137/41BB CD7 DAP10 TIM3 CD137/41BB CD7 DAP12 TIM3 CD137/41BB CD7 CD32 TIM3 CD137/41BB CD7 CD79a TIM3 CD137/41BB CD7 CD79b TIM3 CD137/41BB BTNL3 CD8 TIM3 CD137/41BB BTNL3 CD3? TIM3 CD137/41BB BTNL3 CD3? TIM3 CD137/41BB BTNL3 CD3? TIM3 CD137/41BB BTNL3 CD3? TIM3 CD137/41BB BTNL3 Fc?RI-? TIM3 CD137/41BB BTNL3 Fc?RIII-? TIM3 CD137/41BB BTNL3 Fc?RI? TIM3 CD137/41BB BTNL3 Fc?RI? TIM3 CD137/41BB BTNL3 DAP10 TIM3 CD137/41BB BTNL3 DAP12 TIM3 CD137/41BB BTNL3 CD32 TIM3 CD137/41BB BTNL3 CD79a TIM3 CD137/41BB BTNL3 CD79b TIM3 CD137/41BB NKG2D CD8 TIM3 CD137/41BB NKG2D CD3? TIM3 CD137/41BB NKG2D CD3? TIM3 CD137/41BB NKG2D CD3? TIM3 CD137/41BB NKG2D CD3? TIM3 CD137/41BB NKG2D Fc?RI-? TIM3 CD137/41BB NKG2D Fc?RIII-? TIM3 CD137/41BB NKG2D Fc?RI? TIM3 CD137/41BB NKG2D Fc?RI? TIM3 CD137/41BB NKG2D DAP10 TIM3 CD137/41BB NKG2D DAP12 TIM3 CD137/41BB NKG2D CD32 TIM3 CD137/41BB NKG2D CD79a TIM3 CD137/41BB NKG2D CD79b TIM3 ICOS CD28 CD8 TIM3 ICOS CD28 CD3? TIM3 ICOS CD28 CD3? TIM3 ICOS CD28 CD3? TIM3 ICOS CD28 CD3? TIM3 ICOS CD28 Fc?RI-? TIM3 ICOS CD28 Fc?RIII-? TIM3 ICOS CD28 Fc?RI? TIM3 ICOS CD28 Fc?RI? TIM3 ICOS CD28 DAP10 TIM3 ICOS CD28 DAP12 TIM3 ICOS CD28 CD32 TIM3 ICOS CD28 CD79a TIM3 ICOS CD28 CD79b TIM3 ICOS CD8 CD8 TIM3 ICOS CD8 CD3? TIM3 ICOS CD8 CD3? TIM3 ICOS CD8 CD3? TIM3 ICOS CD8 CD3? TIM3 ICOS CD8 Fc?RI-? TIM3 ICOS CD8 Fc?RIII-? TIM3 ICOS CD8 Fc?RI? TIM3 ICOS CD8 Fc?RI? TIM3 ICOS CD8 DAP10 TIM3 ICOS CD8 DAP12 TIM3 ICOS CD8 CD32 TIM3 ICOS CD8 CD79a TIM3 ICOS CD8 CD79b TIM3 ICOS CD4 CD8 TIM3 ICOS CD4 CD3? TIM3 ICOS CD4 CD3? TIM3 ICOS CD4 CD3? TIM3 ICOS CD4 CD3? TIM3 ICOS CD4 Fc?RI-? TIM3 ICOS CD4 Fc?RIII-? TIM3 ICOS CD4 Fc?RI? TIM3 ICOS CD4 Fc?RI? TIM3 ICOS CD4 DAP10 TIM3 ICOS CD4 DAP12 TIM3 ICOS CD4 CD32 TIM3 ICOS CD4 CD79a TIM3 ICOS CD4 CD79b TIM3 ICOS b2c CD8 TIM3 ICOS b2c CD3? TIM3 ICOS b2c CD3? TIM3 ICOS b2c CD3? TIM3 ICOS b2c CD3? TIM3 ICOS b2c Fc?RI-? TIM3 ICOS b2c Fc?RIII-? TIM3 ICOS b2c Fc?RI? TIM3 ICOS b2c Fc?RI? TIM3 ICOS b2c DAP10 TIM3 ICOS b2c DAP12 TIM3 ICOS b2c CD32 TIM3 ICOS b2c CD79a TIM3 ICOS b2c CD79b TIM3 ICOS CD137/41BB CD8 TIM3 ICOS CD137/41BB CD3? TIM3 ICOS CD137/41BB CD3? TIM3 ICOS CD137/41BB CD3? TIM3 ICOS CD137/41BB CD3? TIM3 ICOS CD137/41BB Fc?RI-? TIM3 ICOS CD137/41BB Fc?RIII-? TIM3 ICOS CD137/41BB Fc?RI? TIM3 ICOS CD137/41BB Fc?RI? TIM3 ICOS CD137/41BB DAP10 TIM3 ICOS CD137/41BB DAP12 TIM3 ICOS CD137/41BB CD32 TIM3 ICOS CD137/41BB CD79a TIM3 ICOS CD137/41BB CD79b TIM3 ICOS ICOS CD8 TIM3 ICOS ICOS CD3? TIM3 ICOS ICOS CD3? TIM3 ICOS ICOS CD3? TIM3 ICOS ICOS CD3? TIM3 ICOS ICOS Fc?RI-? TIM3 ICOS ICOS Fc?RIII-? TIM3 ICOS ICOS Fc?RI? TIM3 ICOS ICOS Fc?RI? TIM3 ICOS ICOS DAP10 TIM3 ICOS ICOS DAP12 TIM3 ICOS ICOS CD32 TIM3 ICOS ICOS CD79a TIM3 ICOS ICOS CD79b TIM3 ICOS CD27 CD8 TIM3 ICOS CD27 CD3? TIM3 ICOS CD27 CD3? TIM3 ICOS CD27 CD3? TIM3 ICOS CD27 CD3? TIM3 ICOS CD27 Fc?RI-? TIM3 ICOS CD27 Fc?RIII-? TIM3 ICOS CD27 Fc?RI? TIM3 ICOS CD27 Fc?RI? TIM3 ICOS CD27 DAP10 TIM3 ICOS CD27 DAP12 TIM3 ICOS CD27 CD32 TIM3 ICOS CD27 CD79a TIM3 ICOS CD27 CD79b TIM3 ICOS CD28? CD8 TIM3 ICOS CD28? CD3? TIM3 ICOS CD28? CD3? TIM3 ICOS CD28? CD3? TIM3 ICOS CD28? CD3? TIM3 ICOS CD28? Fc?RI-? TIM3 ICOS CD28? Fc?RIII-? TIM3 ICOS CD28? Fc?RI? TIM3 ICOS CD28? Fc?RI? TIM3 ICOS CD28? DAP10 TIM3 ICOS CD28? DAP12 TIM3 ICOS CD28? CD32 TIM3 ICOS CD28? CD79a TIM3 ICOS CD28? CD79b TIM3 ICOS CD80 CD8 TIM3 ICOS CD80 CD3? TIM3 ICOS CD80 CD3? TIM3 ICOS CD80 CD3? TIM3 ICOS CD80 CD3? TIM3 ICOS CD80 Fc?RI-? TIM3 ICOS CD80 Fc?RIII-? TIM3 ICOS CD80 Fc?RI? TIM3 ICOS CD80 Fc?RI? TIM3 ICOS CD80 DAP10 TIM3 ICOS CD80 DAP12 TIM3 ICOS CD80 CD32 TIM3 ICOS CD80 CD79a TIM3 ICOS CD80 CD79b TIM3 ICOS CD86 CD8 TIM3 ICOS CD86 CD3? TIM3 ICOS CD86 CD3? TIM3 ICOS CD86 CD3? TIM3 ICOS CD86 CD3? TIM3 ICOS CD86 Fc?RI-? TIM3 ICOS CD86 Fc?RIII-? TIM3 ICOS CD86 Fc?RI? TIM3 ICOS CD86 Fc?RI? TIM3 ICOS CD86 DAP10 TIM3 ICOS CD86 DAP12 TIM3 ICOS CD86 CD32 TIM3 ICOS CD86 CD79a TIM3 ICOS CD86 CD79b TIM3 ICOS OX40 CD8 TIM3 ICOS OX40 CD3? TIM3 ICOS OX40 CD3? TIM3 ICOS OX40 CD3? TIM3 ICOS OX40 CD3? TIM3 ICOS OX40 Fc?RI-? TIM3 ICOS OX40 Fc?RIII-? TIM3 ICOS OX40 Fc?RI? TIM3 ICOS OX40 Fc?RI? TIM3 ICOS OX40 DAP10 TIM3 ICOS OX40 DAP12 TIM3 ICOS OX40 CD32 TIM3 ICOS OX40 CD79a TIM3 ICOS OX40 CD79b TIM3 ICOS DAP10 CD8 TIM3 ICOS DAP10 CD3? TIM3 ICOS DAP10 CD3? TIM3 ICOS DAP10 CD3? TIM3 ICOS DAP10 CD3? TIM3 ICOS DAP10 Fc?RI-? TIM3 ICOS DAP10 Fc?RIII-? TIM3 ICOS DAP10 Fc?RI? TIM3 ICOS DAP10 Fc?RI? TIM3 ICOS DAP10 DAP10 TIM3 ICOS DAP10 DAP12 TIM3 ICOS DAP10 CD32 TIM3 ICOS DAP10 CD79a TIM3 ICOS DAP10 CD79b TIM3 ICOS DAP12 CD8 TIM3 ICOS DAP12 CD3? TIM3 ICOS DAP12 CD3? TIM3 ICOS DAP12 CD3? TIM3 ICOS DAP12 CD3? TIM3 ICOS DAP12 Fc?RI-? TIM3 ICOS DAP12 Fc?RIII-? TIM3 ICOS DAP12 Fc?RI? TIM3 ICOS DAP12 Fc?RI? TIM3 ICOS DAP12 DAP10 TIM3 ICOS DAP12 DAP12 TIM3 ICOS DAP12 CD32 TIM3 ICOS DAP12 CD79a TIM3 ICOS DAP12 CD79b TIM3 ICOS MyD88 CD8 TIM3 ICOS MyD88 CD3? TIM3 ICOS MyD88 CD3? TIM3 ICOS MyD88 CD3? TIM3 ICOS MyD88 CD3? TIM3 ICOS MyD88 Fc?RI-? TIM3 ICOS MyD88 Fc?RIII-? TIM3 ICOS MyD88 Fc?RI? TIM3 ICOS MyD88 Fc?RI? TIM3 ICOS MyD88 DAP10 TIM3 ICOS MyD88 DAP12 TIM3 ICOS MyD88 CD32 TIM3 ICOS MyD88 CD79a TIM3 ICOS MyD88 CD79b TIM3 ICOS CD7 CD8 TIM3 ICOS CD7 CD3? TIM3 ICOS CD7 CD3? TIM3 ICOS CD7 CD3? TIM3 ICOS CD7 CD3? TIM3 ICOS CD7 Fc?RI-? TIM3 ICOS CD7 Fc?RIII-? TIM3 ICOS CD7 Fc?RI? TIM3 ICOS CD7 Fc?RI? TIM3 ICOS CD7 DAP10 TIM3 ICOS CD7 DAP12 TIM3 ICOS CD7 CD32 TIM3 ICOS CD7 CD79a TIM3 ICOS CD7 CD79b TIM3 ICOS BTNL3 CD8 TIM3 ICOS BTNL3 CD3? TIM3 ICOS BTNL3 CD3? TIM3 ICOS BTNL3 CD3? TIM3 ICOS BTNL3 CD3? TIM3 ICOS BTNL3 Fc?RI-? TIM3 ICOS BTNL3 Fc?RIII-? TIM3 ICOS BTNL3 Fc?RI? TIM3 ICOS BTNL3 Fc?RI? TIM3 ICOS BTNL3 DAP10 TIM3 ICOS BTNL3 DAP12 TIM3 ICOS BTNL3 CD32 TIM3 ICOS BTNL3 CD79a TIM3 ICOS BTNL3 CD79b TIM3 ICOS NKG2D CD8 TIM3 ICOS NKG2D CD3? TIM3 ICOS NKG2D CD3? TIM3 ICOS NKG2D CD3? TIM3 ICOS NKG2D CD3? TIM3 ICOS NKG2D Fc?RI-? TIM3 ICOS NKG2D Fc?RIII-? TIM3 ICOS NKG2D Fc?RI? TIM3 ICOS NKG2D Fc?RI? TIM3 ICOS NKG2D DAP10 TIM3 ICOS NKG2D DAP12 TIM3 ICOS NKG2D CD32 TIM3 ICOS NKG2D CD79a TIM3 ICOS NKG2D CD79b TIM3 CD27 CD28 CD8 TIM3 CD27 CD28 CD3? TIM3 CD27 CD28 CD3? TIM3 CD27 CD28 CD3? TIM3 CD27 CD28 CD3? TIM3 CD27 CD28 Fc?RI-? TIM3 CD27 CD28 Fc?RIII-? TIM3 CD27 CD28 Fc?RI? TIM3 CD27 CD28 Fc?RI? TIM3 CD27 CD28 DAP10 TIM3 CD27 CD28 DAP12 TIM3 CD27 CD28 CD32 TIM3 CD27 CD28 CD79a TIM3 CD27 CD28 CD79b TIM3 CD27 CD8 CD8 TIM3 CD27 CD8 CD3? TIM3 CD27 CD8 CD3? TIM3 CD27 CD8 CD3? TIM3 CD27 CD8 CD3? TIM3 CD27 CD8 Fc?RI-? TIM3 CD27 CD8 Fc?RIII-? TIM3 CD27 CD8 Fc?RI? TIM3 CD27 CD8 Fc?RI? TIM3 CD27 CD8 DAP10 TIM3 CD27 CD8 DAP12 TIM3 CD27 CD8 CD32 TIM3 CD27 CD8 CD79a TIM3 CD27 CD8 CD79b TIM3 CD27 CD4 CD8 TIM3 CD27 CD4 CD3? TIM3 CD27 CD4 CD3? TIM3 CD27 CD4 CD3? TIM3 CD27 CD4 CD3? TIM3 CD27 CD4 Fc?RI-? TIM3 CD27 CD4 Fc?RIII-? TIM3 CD27 CD4 Fc?RI? TIM3 CD27 CD4 Fc?RI? TIM3 CD27 CD4 DAP10 TIM3 CD27 CD4 DAP12 TIM3 CD27 CD4 CD32 TIM3 CD27 CD4 CD79a TIM3 CD27 CD4 CD79b TIM3 CD27 b2c CD8 TIM3 CD27 b2c CD3? TIM3 CD27 b2c CD3? TIM3 CD27 b2c CD3? TIM3 CD27 b2c CD3? TIM3 CD27 b2c Fc?RI-? TIM3 CD27 b2c Fc?RIII-? TIM3 CD27 b2c Fc?RI? TIM3 CD27 b2c Fc?RI? TIM3 CD27 b2c DAP10 TIM3 CD27 b2c DAP12 TIM3 CD27 b2c CD32 TIM3 CD27 b2c CD79a TIM3 CD27 b2c CD79b TIM3 CD27 CD137/41BB CD8 TIM3 CD27 CD137/41BB CD3? TIM3 CD27 CD137/41BB CD3? TIM3 CD27 CD137/41BB CD3? TIM3 CD27 CD137/41BB CD3? TIM3 CD27 CD137/41BB Fc?RI-? TIM3 CD27 CD137/41BB Fc?RIII-? TIM3 CD27 CD137/41BB Fc?RI? TIM3 CD27 CD137/41BB Fc?RI? TIM3 CD27 CD137/41BB DAP10 TIM3 CD27 CD137/41BB DAP12 TIM3 CD27 CD137/41BB CD32 TIM3 CD27 CD137/41BB CD79a TIM3 CD27 CD137/41BB CD79b TIM3 CD27 ICOS CD8 TIM3 CD27 ICOS CD3? TIM3 CD27 ICOS CD3? TIM3 CD27 ICOS CD3? TIM3 CD27 ICOS CD3? TIM3 CD27 ICOS Fc?RI-? TIM3 CD27 ICOS Fc?RIII-? TIM3 CD27 ICOS Fc?RI? TIM3 CD27 ICOS Fc?RI? TIM3 CD27 ICOS DAP10 TIM3 CD27 ICOS DAP12 TIM3 CD27 ICOS CD32 TIM3 CD27 ICOS CD79a TIM3 CD27 ICOS CD79b TIM3 CD27 CD27 CD8 TIM3 CD27 CD27 CD3? TIM3 CD27 CD27 CD3? TIM3 CD27 CD27 CD3? TIM3 CD27 CD27 CD3? TIM3 CD27 CD27 Fc?RI-? TIM3 CD27 CD27 Fc?RIII-? TIM3 CD27 CD27 Fc?RI? TIM3 CD27 CD27 Fc?RI? TIM3 CD27 CD27 DAP10 TIM3 CD27 CD27 DAP12 TIM3 CD27 CD27 CD32 TIM3 CD27 CD27 CD79a TIM3 CD27 CD27 CD79b TIM3 CD27 CD28? CD8 TIM3 CD27 CD28? CD3? TIM3 CD27 CD28? CD3? TIM3 CD27 CD28? CD3? TIM3 CD27 CD28? CD3? TIM3 CD27 CD28? Fc?RI-? TIM3 CD27 CD28? Fc?RIII-? TIM3 CD27 CD28? Fc?RI? TIM3 CD27 CD28? Fc?RI? TIM3 CD27 CD28? DAP10 TIM3 CD27 CD28? DAP12 TIM3 CD27 CD28? CD32 TIM3 CD27 CD28? CD79a TIM3 CD27 CD28? CD79b TIM3 CD27 CD80 CD8 TIM3 CD27 CD80 CD3? TIM3 CD27 CD80 CD3? TIM3 CD27 CD80 CD3? TIM3 CD27 CD80 CD3? TIM3 CD27 CD80 Fc?RI-? TIM3 CD27 CD80 Fc?RIII-? TIM3 CD27 CD80 Fc?RI? TIM3 CD27 CD80 Fc?RI? TIM3 CD27 CD80 DAP10 TIM3 CD27 CD80 DAP12 TIM3 CD27 CD80 CD32 TIM3 CD27 CD80 CD79a TIM3 CD27 CD80 CD79b TIM3 CD27 CD86 CD8 TIM3 CD27 CD86 CD3? TIM3 CD27 CD86 CD3? TIM3 CD27 CD86 CD3? TIM3 CD27 CD86 CD3? TIM3 CD27 CD86 Fc?RI-? TIM3 CD27 CD86 Fc?RIII-? TIM3 CD27 CD86 Fc?RI? TIM3 CD27 CD86 Fc?RI? TIM3 CD27 CD86 DAP10 TIM3 CD27 CD86 DAP12 TIM3 CD27 CD86 CD32 TIM3 CD27 CD86 CD79a TIM3 CD27 CD86 CD79b TIM3 CD27 OX40 CD8 TIM3 CD27 OX40 CD3? TIM3 CD27 OX40 CD3? TIM3 CD27 OX40 CD3? TIM3 CD27 OX40 CD3? TIM3 CD27 OX40 Fc?RI-? TIM3 CD27 OX40 Fc?RIII-? TIM3 CD27 OX40 Fc?RI? TIM3 CD27 OX40 Fc?RI? TIM3 CD27 OX40 DAP10 TIM3 CD27 OX40 DAP12 TIM3 CD27 OX40 CD32 TIM3 CD27 OX40 CD79a TIM3 CD27 OX40 CD79b TIM3 CD27 DAP10 CD8 TIM3 CD27 DAP10 CD3? TIM3 CD27 DAP10 CD3? TIM3 CD27 DAP10 CD3? TIM3 CD27 DAP10 CD3? TIM3 CD27 DAP10 Fc?RI-? TIM3 CD27 DAP10 Fc?RIII-? TIM3 CD27 DAP10 Fc?RI? TIM3 CD27 DAP10 Fc?RI? TIM3 CD27 DAP10 DAP10 TIM3 CD27 DAP10 DAP12 TIM3 CD27 DAP10 CD32 TIM3 CD27 DAP10 CD79a TIM3 CD27 DAP10 CD79b TIM3 CD27 DAP12 CD8 TIM3 CD27 DAP12 CD3? TIM3 CD27 DAP12 CD3? TIM3 CD27 DAP12 CD3? TIM3 CD27 DAP12 CD3? TIM3 CD27 DAP12 Fc?RI-? TIM3 CD27 DAP12 Fc?RIII-? TIM3 CD27 DAP12 Fc?RI? TIM3 CD27 DAP12 Fc?RI? TIM3 CD27 DAP12 DAP10 TIM3 CD27 DAP12 DAP12 TIM3 CD27 DAP12 CD32 TIM3 CD27 DAP12 CD79a TIM3 CD27 DAP12 CD79b TIM3 CD27 MyD88 CD8 TIM3 CD27 MyD88 CD3? TIM3 CD27 MyD88 CD3? TIM3 CD27 MyD88 CD3? TIM3 CD27 MyD88 CD3? TIM3 CD27 MyD88 Fc?RI-? TIM3 CD27 MyD88 Fc?RIII-? TIM3 CD27 MyD88 Fc?RI? TIM3 CD27 MyD88 Fc?RI? TIM3 CD27 MyD88 DAP10 TIM3 CD27 MyD88 DAP12 TIM3 CD27 MyD88 CD32 TIM3 CD27 MyD88 CD79a TIM3 CD27 MyD88 CD79b TIM3 CD27 CD7 CD8 TIM3 CD27 CD7 CD3? TIM3 CD27 CD7 CD3? TIM3 CD27 CD7 CD3? TIM3 CD27 CD7 CD3? TIM3 CD27 CD7 Fc?RI-? TIM3 CD27 CD7 Fc?RIII-? TIM3 CD27 CD7 Fc?RI? TIM3 CD27 CD7 Fc?RI? TIM3 CD27 CD7 DAP10 TIM3 CD27 CD7 DAP12 TIM3 CD27 CD7 CD32 TIM3 CD27 CD7 CD79a TIM3 CD27 CD7 CD79b TIM3 CD27 BTNL3 CD8 TIM3 CD27 BTNL3 CD3? TIM3 CD27 BTNL3 CD3? TIM3 CD27 BTNL3 CD3? TIM3 CD27 BTNL3 CD3? TIM3 CD27 BTNL3 Fc?RI-? TIM3 CD27 BTNL3 Fc?RIII-? TIM3 CD27 BTNL3 Fc?RI? TIM3 CD27 BTNL3 Fc?RI? TIM3 CD27 BTNL3 DAP10 TIM3 CD27 BTNL3 DAP12 TIM3 CD27 BTNL3 CD32 TIM3 CD27 BTNL3 CD79a TIM3 CD27 BTNL3 CD79b TIM3 CD27 NKG2D CD8 TIM3 CD27 NKG2D CD3? TIM3 CD27 NKG2D CD3? TIM3 CD27 NKG2D CD3? TIM3 CD27 NKG2D CD3? TIM3 CD27 NKG2D Fc?RI-? TIM3 CD27 NKG2D Fc?RIII-? TIM3 CD27 NKG2D Fc?RI? TIM3 CD27 NKG2D Fc?RI? TIM3 CD27 NKG2D DAP10 TIM3 CD27 NKG2D DAP12 TIM3 CD27 NKG2D CD32 TIM3 CD27 NKG2D CD79a TIM3 CD27 NKG2D CD79b TIM3 CD28? CD28 CD8 TIM3 CD28? CD28 CD3? TIM3 CD28? CD28 CD3? TIM3 CD28? CD28 CD3? TIM3 CD28? CD28 CD3? TIM3 CD28? CD28 Fc?RI-? TIM3 CD28? CD28 Fc?RIII-? TIM3 CD28? CD28 Fc?RI? TIM3 CD28? CD28 Fc?RI? TIM3 CD28? CD28 DAP10 TIM3 CD28? CD28 DAP12 TIM3 CD28? CD28 CD32 TIM3 CD28? CD28 CD79a TIM3 CD28? CD28 CD79b TIM3 CD28? CD8 CD8 TIM3 CD28? CD8 CD3? TIM3 CD28? CD8 CD3? TIM3 CD28? CD8 CD3? TIM3 CD28? CD8 CD3? TIM3 CD28? CD8 Fc?RI-? TIM3 CD28? CD8 Fc?RIII-? TIM3 CD28? CD8 Fc?RI? TIM3 CD28? CD8 Fc?RI? TIM3 CD28? CD8 DAP10 TIM3 CD28? CD8 DAP12 TIM3 CD28? CD8 CD32 TIM3 CD28? CD8 CD79a TIM3 CD28? CD8 CD79b TIM3 CD28? CD4 CD8 TIM3 CD28? CD4 CD3? TIM3 CD28? CD4 CD3? TIM3 CD28? CD4 CD3? TIM3 CD28? CD4 CD3? TIM3 CD28? CD4 Fc?RI-? TIM3 CD28? CD4 Fc?RIII-? TIM3 CD28? CD4 Fc?RI? TIM3 CD28? CD4 Fc?RI? TIM3 CD28? CD4 DAP10 TIM3 CD28? CD4 DAP12 TIM3 CD28? CD4 CD32 TIM3 CD28? CD4 CD79a TIM3 CD28? CD4 CD79b TIM3 CD28? b2c CD8 TIM3 CD28? b2c CD3? TIM3 CD28? b2c CD3? TIM3 CD28? b2c CD3? TIM3 CD28? b2c CD3? TIM3 CD28? b2c Fc?RI-? TIM3 CD28? b2c Fc?RIII-? TIM3 CD28? b2c Fc?RI? TIM3 CD28? b2c Fc?RI? TIM3 CD28? b2c DAP10 TIM3 CD28? b2c DAP12 TIM3 CD28? b2c CD32 TIM3 CD28? b2c CD79a TIM3 CD28? b2c CD79b TIM3 CD28? CD137/41BB CD8 TIM3 CD28? CD137/41BB CD3? TIM3 CD28? CD137/41BB CD3? TIM3 CD28? CD137/41BB CD3? TIM3 CD28? CD137/41BB CD3? TIM3 CD28? CD137/41BB Fc?RI-? TIM3 CD28? CD137/41BB Fc?RIII-? TIM3 CD28? CD137/41BB Fc?RI? TIM3 CD28? CD137/41BB Fc?RI? TIM3 CD28? CD137/41BB DAP10 TIM3 CD28? CD137/41BB DAP12 TIM3 CD28? CD137/41BB CD32 TIM3 CD28? CD137/41BB CD79a TIM3 CD28? CD137/41BB CD79b TIM3 CD28? ICOS CD8 TIM3 CD28? ICOS CD3? TIM3 CD28? ICOS CD3? TIM3 CD28? ICOS CD3? TIM3 CD28? ICOS CD3? TIM3 CD28? ICOS Fc?RI-? TIM3 CD28? ICOS Fc?RIII-? TIM3 CD28? ICOS Fc?RI? TIM3 CD28? ICOS Fc?RI? TIM3 CD28? ICOS DAP10 TIM3 CD28? ICOS DAP12 TIM3 CD28? ICOS CD32 TIM3 CD28? ICOS CD79a TIM3 CD28? ICOS CD79b TIM3 CD28? CD27 CD8 TIM3 CD28? CD27 CD3? TIM3 CD28? CD27 CD3? TIM3 CD28? CD27 CD3? TIM3 CD28? CD27 CD3? TIM3 CD28? CD27 Fc?RI-? TIM3 CD28? CD27 Fc?RIII-? TIM3 CD28? CD27 Fc?RI? TIM3 CD28? CD27 Fc?RI? TIM3 CD28? CD27 DAP10 TIM3 CD28? CD27 DAP12 TIM3 CD28? CD27 CD32 TIM3 CD28? CD27 CD79a TIM3 CD28? CD27 CD79b TIM3 CD28? CD28? CD8 TIM3 CD28? CD28? CD3? TIM3 CD28? CD28? CD3? TIM3 CD28? CD28? CD3? TIM3 CD28? CD28? CD3? TIM3 CD28? CD28? Fc?RI-? TIM3 CD28? CD28? Fc?RIII-? TIM3 CD28? CD28? Fc?RI? TIM3 CD28? CD28? Fc?RI? TIM3 CD28? CD28? DAP10 TIM3 CD28? CD28? DAP12 TIM3 CD28? CD28? CD32 TIM3 CD28? CD28? CD79a TIM3 CD28? CD28? CD79b TIM3 CD28? CD80 CD8 TIM3 CD28? CD80 CD3? TIM3 CD28? CD80 CD3? TIM3 CD28? CD80 CD3? TIM3 CD28? CD80 CD3? TIM3 CD28? CD80 Fc?RI-? TIM3 CD28? CD80 Fc?RIII-? TIM3 CD28? CD80 Fc?RI? TIM3 CD28? CD80 Fc?RI? TIM3 CD28? CD80 DAP10 TIM3 CD28? CD80 DAP12 TIM3 CD28? CD80 CD32 TIM3 CD28? CD80 CD79a TIM3 CD28? CD80 CD79b TIM3 CD28? CD86 CD8 TIM3 CD28? CD86 CD3? TIM3 CD28? CD86 CD3? TIM3 CD28? CD86 CD3? TIM3 CD28? CD86 CD3? TIM3 CD28? CD86 Fc?RI-? TIM3 CD28? CD86 Fc?RIII-? TIM3 CD28? CD86 Fc?RI? TIM3 CD28? CD86 Fc?RI? TIM3 CD28? CD86 DAP10 TIM3 CD28? CD86 DAP12 TIM3 CD28? CD86 CD32 TIM3 CD28? CD86 CD79a TIM3 CD28? CD86 CD79b TIM3 CD28? OX40 CD8 TIM3 CD28? OX40 CD3? TIM3 CD28? OX40 CD3? TIM3 CD28? OX40 CD3? TIM3 CD28? OX40 CD3? TIM3 CD28? OX40 Fc?RI-? TIM3 CD28? OX40 Fc?RIII-? TIM3 CD28? OX40 Fc?RI? TIM3 CD28? OX40 Fc?RI? TIM3 CD28? OX40 DAP10 TIM3 CD28? OX40 DAP12 TIM3 CD28? OX40 CD32 TIM3 CD28? OX40 CD79a TIM3 CD28? OX40 CD79b TIM3 CD28? DAP10 CD8 TIM3 CD28? DAP10 CD3? TIM3 CD28? DAP10 CD3? TIM3 CD28? DAP10 CD3? TIM3 CD28? DAP10 CD3? TIM3 CD28? DAP10 Fc?RI-? TIM3 CD28? DAP10 Fc?RIII-? TIM3 CD28? DAP10 Fc?RI? TIM3 CD28? DAP10 Fc?RI? TIM3 CD28? DAP10 DAP10 TIM3 CD28? DAP10 DAP12 TIM3 CD28? DAP10 CD32 TIM3 CD28? DAP10 CD79a TIM3 CD28? DAP10 CD79b TIM3 CD28? DAP12 CD8 TIM3 CD28? DAP12 CD3? TIM3 CD28? DAP12 CD3? TIM3 CD28? DAP12 CD3? TIM3 CD28? DAP12 CD3? TIM3 CD28? DAP12 Fc?RI-? TIM3 CD28? DAP12 Fc?RIII-? TIM3 CD28? DAP12 Fc?RI? TIM3 CD28? DAP12 Fc?RI? TIM3 CD28? DAP12 DAP10 TIM3 CD28? DAP12 DAP12 TIM3 CD28? DAP12 CD32 TIM3 CD28? DAP12 CD79a TIM3 CD28? DAP12 CD79b TIM3 CD28? MyD88 CD8 TIM3 CD28? MyD88 CD3? TIM3 CD28? MyD88 CD3? TIM3 CD28? MyD88 CD3? TIM3 CD28? MyD88 CD3? TIM3 CD28? MyD88 Fc?RI-? TIM3 CD28? MyD88 Fc?RIII-? TIM3 CD28? MyD88 Fc?RI? TIM3 CD28? MyD88 Fc?RI? TIM3 CD28? MyD88 DAP10 TIM3 CD28? MyD88 DAP12 TIM3 CD28? MyD88 CD32 TIM3 CD28? MyD88 CD79a TIM3 CD28? MyD88 CD79b TIM3 CD28? CD7 CD8 TIM3 CD28? CD7 CD3? TIM3 CD28? CD7 CD3? TIM3 CD28? CD7 CD3? TIM3 CD28? CD7 CD3? TIM3 CD28? CD7 Fc?RI-? TIM3 CD28? CD7 Fc?RIII-? TIM3 CD28? CD7 Fc?RI? TIM3 CD28? CD7 Fc?RI? TIM3 CD28? CD7 DAP10 TIM3 CD28? CD7 DAP12 TIM3 CD28? CD7 CD32 TIM3 CD28? CD7 CD79a TIM3 CD28? CD7 CD79b TIM3 CD28? BTNL3 CD8 TIM3 CD28? BTNL3 CD3? TIM3 CD28? BTNL3 CD3? TIM3 CD28? BTNL3 CD3? TIM3 CD28? BTNL3 CD3? TIM3 CD28? BTNL3 Fc?RI-? TIM3 CD28? BTNL3 Fc?RIII-? TIM3 CD28? BTNL3 Fc?RI? TIM3 CD28? BTNL3 Fc?RI? TIM3 CD28? BTNL3 DAP10 TIM3 CD28? BTNL3 DAP12 TIM3 CD28? BTNL3 CD32 TIM3 CD28? BTNL3 CD79a TIM3 CD28? BTNL3 CD79b TIM3 CD28? NKG2D CD8 TIM3 CD28? NKG2D CD3? TIM3 CD28? NKG2D CD3? TIM3 CD28? NKG2D CD3? TIM3 CD28? NKG2D CD3? TIM3 CD28? NKG2D Fc?RI-? TIM3 CD28? NKG2D Fc?RIII-? TIM3 CD28? NKG2D Fc?RI? TIM3 CD28? NKG2D Fc?RI? TIM3 CD28? NKG2D DAP10 TIM3 CD28? NKG2D DAP12 TIM3 CD28? NKG2D CD32 TIM3 CD28? NKG2D CD79a TIM3 CD28? NKG2D CD79b TIM3 CD80 CD28 CD8 TIM3 CD80 CD28 CD3? TIM3 CD80 CD28 CD3? TIM3 CD80 CD28 CD3? TIM3 CD80 CD28 CD3? TIM3 CD80 CD28 Fc?RI-? TIM3 CD80 CD28 Fc?RIII-? TIM3 CD80 CD28 Fc?RI? TIM3 CD80 CD28 Fc?RI? TIM3 CD80 CD28 DAP10 TIM3 CD80 CD28 DAP12 TIM3 CD80 CD28 CD32 TIM3 CD80 CD28 CD79a TIM3 CD80 CD28 CD79b TIM3 CD80 CD8 CD8 TIM3 CD80 CD8 CD3? TIM3 CD80 CD8 CD3? TIM3 CD80 CD8 CD3? TIM3 CD80 CD8 CD3? TIM3 CD80 CD8 Fc?RI-? TIM3 CD80 CD8 Fc?RIII-? TIM3 CD80 CD8 Fc?RI? TIM3 CD80 CD8 Fc?RI? TIM3 CD80 CD8 DAP10 TIM3 CD80 CD8 DAP12 TIM3 CD80 CD8 CD32 TIM3 CD80 CD8 CD79a TIM3 CD80 CD8 CD79b TIM3 CD80 CD4 CD8 TIM3 CD80 CD4 CD3? TIM3 CD80 CD4 CD3? TIM3 CD80 CD4 CD3? TIM3 CD80 CD4 CD3? TIM3 CD80 CD4 Fc?RI-? TIM3 CD80 CD4 Fc?RIII-? TIM3 CD80 CD4 Fc?RI? TIM3 CD80 CD4 Fc?RI? TIM3 CD80 CD4 DAP10 TIM3 CD80 CD4 DAP12 TIM3 CD80 CD4 CD32 TIM3 CD80 CD4 CD79a TIM3 CD80 CD4 CD79b TIM3 CD80 b2c CD8 TIM3 CD80 b2c CD3? TIM3 CD80 b2c CD3? TIM3 CD80 b2c CD3? TIM3 CD80 b2c CD3? TIM3 CD80 b2c Fc?RI-? TIM3 CD80 b2c Fc?RIII-? TIM3 CD80 b2c Fc?RI? TIM3 CD80 b2c Fc?RI? TIM3 CD80 b2c DAP10 TIM3 CD80 b2c DAP12 TIM3 CD80 b2c CD32 TIM3 CD80 b2c CD79a TIM3 CD80 b2c CD79b TIM3 CD80 CD137/41BB CD8 TIM3 CD80 CD137/41BB CD3? TIM3 CD80 CD137/41BB CD3? TIM3 CD80 CD137/41BB CD3? TIM3 CD80 CD137/41BB CD3? TIM3 CD80 CD137/41BB Fc?RI-? TIM3 CD80 CD137/41BB Fc?RIII-? TIM3 CD80 CD137/41BB Fc?RI? TIM3 CD80 CD137/41BB Fc?RI? TIM3 CD80 CD137/41BB DAP10 TIM3 CD80 CD137/41BB DAP12 TIM3 CD80 CD137/41BB CD32 TIM3 CD80 CD137/41BB CD79a TIM3 CD80 CD137/41BB CD79b TIM3 CD80 ICOS CD8 TIM3 CD80 ICOS CD3? TIM3 CD80 ICOS CD3? TIM3 CD80 ICOS CD3? TIM3 CD80 ICOS CD3? TIM3 CD80 ICOS Fc?RI-? TIM3 CD80 ICOS Fc?RIII-? TIM3 CD80 ICOS Fc?RI? TIM3 CD80 ICOS Fc?RI? TIM3 CD80 ICOS DAP10 TIM3 CD80 ICOS DAP12 TIM3 CD80 ICOS CD32 TIM3 CD80 ICOS CD79a TIM3 CD80 ICOS CD79b TIM3 CD80 CD27 CD8 TIM3 CD80 CD27 CD3? TIM3 CD80 CD27 CD3? TIM3 CD80 CD27 CD3? TIM3 CD80 CD27 CD3? TIM3 CD80 CD27 Fc?RI-? TIM3 CD80 CD27 Fc?RIII-? TIM3 CD80 CD27 Fc?RI? TIM3 CD80 CD27 Fc?RI? TIM3 CD80 CD27 DAP10 TIM3 CD80 CD27 DAP12 TIM3 CD80 CD27 CD32 TIM3 CD80 CD27 CD79a TIM3 CD80 CD27 CD79b TIM3 CD80 CD28? CD8 TIM3 CD80 CD28? CD3? TIM3 CD80 CD28? CD3? TIM3 CD80 CD28? CD3? TIM3 CD80 CD28? CD3? TIM3 CD80 CD28? Fc?RI-? TIM3 CD80 CD28? Fc?RIII-? TIM3 CD80 CD28? Fc?RI? TIM3 CD80 CD28? Fc?RI? TIM3 CD80 CD28? DAP10 TIM3 CD80 CD28? DAP12 TIM3 CD80 CD28? CD32 TIM3 CD80 CD28? CD79a TIM3 CD80 CD28? CD79b TIM3 CD80 CD80 CD8 TIM3 CD80 CD80 CD3? TIM3 CD80 CD80 CD3? TIM3 CD80 CD80 CD3? TIM3 CD80 CD80 CD3? TIM3 CD80 CD80 Fc?RI-? TIM3 CD80 CD80 Fc?RIII-? TIM3 CD80 CD80 Fc?RI? TIM3 CD80 CD80 Fc?RI? TIM3 CD80 CD80 DAP10 TIM3 CD80 CD80 DAP12 TIM3 CD80 CD80 CD32 TIM3 CD80 CD80 CD79a TIM3 CD80 CD80 CD79b TIM3 CD80 CD86 CD8 TIM3 CD80 CD86 CD3? TIM3 CD80 CD86 CD3? TIM3 CD80 CD86 CD3? TIM3 CD80 CD86 CD3? TIM3 CD80 CD86 Fc?RI-? TIM3 CD80 CD86 Fc?RIII-? TIM3 CD80 CD86 Fc?RI? TIM3 CD80 CD86 Fc?RI? TIM3 CD80 CD86 DAP10 TIM3 CD80 CD86 DAP12 TIM3 CD80 CD86 CD32 TIM3 CD80 CD86 CD79a TIM3 CD80 CD86 CD79b TIM3 CD80 OX40 CD8 TIM3 CD80 OX40 CD3? TIM3 CD80 OX40 CD3? TIM3 CD80 OX40 CD3? TIM3 CD80 OX40 CD3? TIM3 CD80 OX40 Fc?RI-? TIM3 CD80 OX40 Fc?RIII-? TIM3 CD80 OX40 Fc?RI? TIM3 CD80 OX40 Fc?RI? TIM3 CD80 OX40 DAP10 TIM3 CD80 OX40 DAP12 TIM3 CD80 OX40 CD32 TIM3 CD80 OX40 CD79a TIM3 CD80 OX40 CD79b TIM3 CD80 DAP10 CD8 TIM3 CD80 DAP10 CD3? TIM3 CD80 DAP10 CD3? TIM3 CD80 DAP10 CD3? TIM3 CD80 DAP10 CD3? TIM3 CD80 DAP10 Fc?RI-? TIM3 CD80 DAP10 Fc?RIII-? TIM3 CD80 DAP10 Fc?RI? TIM3 CD80 DAP10 Fc?RI? TIM3 CD80 DAP10 DAP10 TIM3 CD80 DAP10 DAP12 TIM3 CD80 DAP10 CD32 TIM3 CD80 DAP10 CD79a TIM3 CD80 DAP10 CD79b TIM3 CD80 DAP12 CD8 TIM3 CD80 DAP12 CD3? TIM3 CD80 DAP12 CD3? TIM3 CD80 DAP12 CD3? TIM3 CD80 DAP12 CD3? TIM3 CD80 DAP12 Fc?RI-? TIM3 CD80 DAP12 Fc?RIII-? TIM3 CD80 DAP12 Fc?RI? TIM3 CD80 DAP12 Fc?RI? TIM3 CD80 DAP12 DAP10 TIM3 CD80 DAP12 DAP12 TIM3 CD80 DAP12 CD32 TIM3 CD80 DAP12 CD79a TIM3 CD80 DAP12 CD79b TIM3 CD80 MyD88 CD8 TIM3 CD80 MyD88 CD3? TIM3 CD80 MyD88 CD3? TIM3 CD80 MyD88 CD3? TIM3 CD80 MyD88 CD3? TIM3 CD80 MyD88 Fc?RI-? TIM3 CD80 MyD88 Fc?RIII-? TIM3 CD80 MyD88 Fc?RI? TIM3 CD80 MyD88 Fc?RI? TIM3 CD80 MyD88 DAP10 TIM3 CD80 MyD88 DAP12 TIM3 CD80 MyD88 CD32 TIM3 CD80 MyD88 CD79a TIM3 CD80 MyD88 CD79b TIM3 CD80 CD7 CD8 TIM3 CD80 CD7 CD3? TIM3 CD80 CD7 CD3? TIM3 CD80 CD7 CD3? TIM3 CD80 CD7 CD3? TIM3 CD80 CD7 Fc?RI-? TIM3 CD80 CD7 Fc?RIII-? TIM3 CD80 CD7 Fc?RI? TIM3 CD80 CD7 Fc?RI? TIM3 CD80 CD7 DAP10 TIM3 CD80 CD7 DAP12 TIM3 CD80 CD7 CD32 TIM3 CD80 CD7 CD79a TIM3 CD80 CD7 CD79b TIM3 CD80 BTNL3 CD8 TIM3 CD80 BTNL3 CD3? TIM3 CD80 BTNL3 CD3? TIM3 CD80 BTNL3 CD3? TIM3 CD80 BTNL3 CD3? TIM3 CD80 BTNL3 Fc?RI-? TIM3 CD80 BTNL3 Fc?RIII-? TIM3 CD80 BTNL3 Fc?RI? TIM3 CD80 BTNL3 Fc?RI? TIM3 CD80 BTNL3 DAP10 TIM3 CD80 BTNL3 DAP12 TIM3 CD80 BTNL3 CD32 TIM3 CD80 BTNL3 CD79a TIM3 CD80 BTNL3 CD79b TIM3 CD80 NKG2D CD8 TIM3 CD80 NKG2D CD3? TIM3 CD80 NKG2D CD3? TIM3 CD80 NKG2D CD3? TIM3 CD80 NKG2D CD3? TIM3 CD80 NKG2D Fc?RI-? TIM3 CD80 NKG2D Fc?RIII-? TIM3 CD80 NKG2D Fc?RI? TIM3 CD80 NKG2D Fc?RI? TIM3 CD80 NKG2D DAP10 TIM3 CD80 NKG2D DAP12 TIM3 CD80 NKG2D CD32 TIM3 CD80 NKG2D CD79a TIM3 CD80 NKG2D CD79b TIM3 CD86 CD28 CD8 TIM3 CD86 CD28 CD3? TIM3 CD86 CD28 CD3? TIM3 CD86 CD28 CD3? TIM3 CD86 CD28 CD3? TIM3 CD86 CD28 Fc?RI-? TIM3 CD86 CD28 Fc?RIII-? TIM3 CD86 CD28 Fc?RI? TIM3 CD86 CD28 Fc?RI? TIM3 CD86 CD28 DAP10 TIM3 CD86 CD28 DAP12 TIM3 CD86 CD28 CD32 TIM3 CD86 CD28 CD79a TIM3 CD86 CD28 CD79b TIM3 CD86 CD8 CD8 TIM3 CD86 CD8 CD3? TIM3 CD86 CD8 CD3? TIM3 CD86 CD8 CD3? TIM3 CD86 CD8 CD3? TIM3 CD86 CD8 Fc?RI-? TIM3 CD86 CD8 Fc?RIII-? TIM3 CD86 CD8 Fc?RI? TIM3 CD86 CD8 Fc?RI? TIM3 CD86 CD8 DAP10 TIM3 CD86 CD8 DAP12 TIM3 CD86 CD8 CD32 TIM3 CD86 CD8 CD79a TIM3 CD86 CD8 CD79b TIM3 CD86 CD4 CD8 TIM3 CD86 CD4 CD3? TIM3 CD86 CD4 CD3? TIM3 CD86 CD4 CD3? TIM3 CD86 CD4 CD3? TIM3 CD86 CD4 Fc?RI-? TIM3 CD86 CD4 Fc?RIII-? TIM3 CD86 CD4 Fc?RI? TIM3 CD86 CD4 Fc?RI? TIM3 CD86 CD4 DAP10 TIM3 CD86 CD4 DAP12 TIM3 CD86 CD4 CD32 TIM3 CD86 CD4 CD79a TIM3 CD86 CD4 CD79b TIM3 CD86 b2c CD8 TIM3 CD86 b2c CD3? TIM3 CD86 b2c CD3? TIM3 CD86 b2c CD3? TIM3 CD86 b2c CD3? TIM3 CD86 b2c Fc?RI-? TIM3 CD86 b2c Fc?RIII-? TIM3 CD86 b2c Fc?RI? TIM3 CD86 b2c Fc?RI? TIM3 CD86 b2c DAP10 TIM3 CD86 b2c DAP12 TIM3 CD86 b2c CD32 TIM3 CD86 b2c CD79a TIM3 CD86 b2c CD79b TIM3 CD86 CD137/41BB CD8 TIM3 CD86 CD137/41BB CD3? TIM3 CD86 CD137/41BB CD3? TIM3 CD86 CD137/41BB CD3? TIM3 CD86 CD137/41BB CD3? TIM3 CD86 CD137/41BB Fc?RI-? TIM3 CD86 CD137/41BB Fc?RIII-? TIM3 CD86 CD137/41BB Fc?RI? TIM3 CD86 CD137/41BB Fc?RI? TIM3 CD86 CD137/41BB DAP10 TIM3 CD86 CD137/41BB DAP12 TIM3 CD86 CD137/41BB CD32 TIM3 CD86 CD137/41BB CD79a TIM3 CD86 CD137/41BB CD79b TIM3 CD86 ICOS CD8 TIM3 CD86 ICOS CD3? TIM3 CD86 ICOS CD3? TIM3 CD86 ICOS CD3? TIM3 CD86 ICOS CD3? TIM3 CD86 ICOS Fc?RI-? TIM3 CD86 ICOS Fc?RIII-? TIM3 CD86 ICOS Fc?RI? TIM3 CD86 ICOS Fc?RI? TIM3 CD86 ICOS DAP10 TIM3 CD86 ICOS DAP12 TIM3 CD86 ICOS CD32 TIM3 CD86 ICOS CD79a TIM3 CD86 ICOS CD79b TIM3 CD86 CD27 CD8 TIM3 CD86 CD27 CD3? TIM3 CD86 CD27 CD3? TIM3 CD86 CD27 CD3? TIM3 CD86 CD27 CD3? TIM3 CD86 CD27 Fc?RI-? TIM3 CD86 CD27 Fc?RIII-? TIM3 CD86 CD27 Fc?RI? TIM3 CD86 CD27 Fc?RI? TIM3 CD86 CD27 DAP10 TIM3 CD86 CD27 DAP12 TIM3 CD86 CD27 CD32 TIM3 CD86 CD27 CD79a TIM3 CD86 CD27 CD79b TIM3 CD86 CD28? CD8 TIM3 CD86 CD28? CD3? TIM3 CD86 CD28? CD3? TIM3 CD86 CD28? CD3? TIM3 CD86 CD28? CD3? TIM3 CD86 CD28? Fc?RI-? TIM3 CD86 CD28? Fc?RIII-? TIM3 CD86 CD28? Fc?RI? TIM3 CD86 CD28? Fc?RI? TIM3 CD86 CD28? DAP10 TIM3 CD86 CD28? DAP12 TIM3 CD86 CD28? CD32 TIM3 CD86 CD28? CD79a TIM3 CD86 CD28? CD79b TIM3 CD86 CD80 CD8 TIM3 CD86 CD80 CD3? TIM3 CD86 CD80 CD3? TIM3 CD86 CD80 CD3? TIM3 CD86 CD80 CD3? TIM3 CD86 CD80 Fc?RI-? TIM3 CD86 CD80 Fc?RIII-? TIM3 CD86 CD80 Fc?RI? TIM3 CD86 CD80 Fc?RI? TIM3 CD86 CD80 DAP10 TIM3 CD86 CD80 DAP12 TIM3 CD86 CD80 CD32 TIM3 CD86 CD80 CD79a TIM3 CD86 CD80 CD79b TIM3 CD86 CD86 CD8 TIM3 CD86 CD86 CD3? TIM3 CD86 CD86 CD3? TIM3 CD86 CD86 CD3? TIM3 CD86 CD86 CD3? TIM3 CD86 CD86 Fc?RI-? TIM3 CD86 CD86 Fc?RIII-? TIM3 CD86 CD86 Fc?RI? TIM3 CD86 CD86 Fc?RI? TIM3 CD86 CD86 DAP10 TIM3 CD86 CD86 DAP12 TIM3 CD86 CD86 CD32 TIM3 CD86 CD86 CD79a TIM3 CD86 CD86 CD79b TIM3 CD86 OX40 CD8 TIM3 CD86 OX40 CD3? TIM3 CD86 OX40 CD3? TIM3 CD86 OX40 CD3? TIM3 CD86 OX40 CD3? TIM3 CD86 OX40 Fc?RI-? TIM3 CD86 OX40 Fc?RIII-? TIM3 CD86 OX40 Fc?RI? TIM3 CD86 OX40 Fc?RI? TIM3 CD86 OX40 DAP10 TIM3 CD86 OX40 DAP12 TIM3 CD86 OX40 CD32 TIM3 CD86 OX40 CD79a TIM3 CD86 OX40 CD79b TIM3 CD86 DAP10 CD8 TIM3 CD86 DAP10 CD3? TIM3 CD86 DAP10 CD3? TIM3 CD86 DAP10 CD3? TIM3 CD86 DAP10 CD3? TIM3 CD86 DAP10 Fc?RI-? TIM3 CD86 DAP10 Fc?RIII-? TIM3 CD86 DAP10 Fc?RI? TIM3 CD86 DAP10 Fc?RI? TIM3 CD86 DAP10 DAP10 TIM3 CD86 DAP10 DAP12 TIM3 CD86 DAP10 CD32 TIM3 CD86 DAP10 CD79a TIM3 CD86 DAP10 CD79b TIM3 CD86 DAP12 CD8 TIM3 CD86 DAP12 CD3? TIM3 CD86 DAP12 CD3? TIM3 CD86 DAP12 CD3? TIM3 CD86 DAP12 CD3? TIM3 CD86 DAP12 Fc?RI-? TIM3 CD86 DAP12 Fc?RIII-? TIM3 CD86 DAP12 Fc?RI? TIM3 CD86 DAP12 Fc?RI? TIM3 CD86 DAP12 DAP10 TIM3 CD86 DAP12 DAP12 TIM3 CD86 DAP12 CD32 TIM3 CD86 DAP12 CD79a TIM3 CD86 DAP12 CD79b TIM3 CD86 MyD88 CD8 TIM3 CD86 MyD88 CD3? TIM3 CD86 MyD88 CD3? TIM3 CD86 MyD88 CD3? TIM3 CD86 MyD88 CD3? TIM3 CD86 MyD88 Fc?RI-? TIM3 CD86 MyD88 Fc?RIII-? TIM3 CD86 MyD88 Fc?RI? TIM3 CD86 MyD88 Fc?RI? TIM3 CD86 MyD88 DAP10 TIM3 CD86 MyD88 DAP12 TIM3 CD86 MyD88 CD32 TIM3 CD86 MyD88 CD79a TIM3 CD86 MyD88 CD79b TIM3 CD86 CD7 CD8 TIM3 CD86 CD7 CD3? TIM3 CD86 CD7 CD3? TIM3 CD86 CD7 CD3? TIM3 CD86 CD7 CD3? TIM3 CD86 CD7 Fc?RI-? TIM3 CD86 CD7 Fc?RIII-? TIM3 CD86 CD7 Fc?RI? TIM3 CD86 CD7 Fc?RI? TIM3 CD86 CD7 DAP10 TIM3 CD86 CD7 DAP12 TIM3 CD86 CD7 CD32 TIM3 CD86 CD7 CD79a TIM3 CD86 CD7 CD79b TIM3 CD86 BTNL3 CD8 TIM3 CD86 BTNL3 CD3? TIM3 CD86 BTNL3 CD3? TIM3 CD86 BTNL3 CD3? TIM3 CD86 BTNL3 CD3? TIM3 CD86 BTNL3 Fc?RI-? TIM3 CD86 BTNL3 Fc?RIII-? TIM3 CD86 BTNL3 Fc?RI? TIM3 CD86 BTNL3 Fc?RI? TIM3 CD86 BTNL3 DAP10 TIM3 CD86 BTNL3 DAP12 TIM3 CD86 BTNL3 CD32 TIM3 CD86 BTNL3 CD79a TIM3 CD86 BTNL3 CD79b TIM3 CD86 NKG2D CD8 TIM3 CD86 NKG2D CD3? TIM3 CD86 NKG2D CD3? TIM3 CD86 NKG2D CD3? TIM3 CD86 NKG2D CD3? TIM3 CD86 NKG2D Fc?RI-? TIM3 CD86 NKG2D Fc?RIII-? TIM3 CD86 NKG2D Fc?RI? TIM3 CD86 NKG2D Fc?RI? TIM3 CD86 NKG2D DAP10 TIM3 CD86 NKG2D DAP12 TIM3 CD86 NKG2D CD32 TIM3 CD86 NKG2D CD79a TIM3 CD86 NKG2D CD79b TIM3 OX40 CD28 CD8 TIM3 OX40 CD28 CD3? TIM3 OX40 CD28 CD3? TIM3 OX40 CD28 CD3? TIM3 OX40 CD28 CD3? TIM3 OX40 CD28 Fc?RI-? TIM3 OX40 CD28 Fc?RIII-? TIM3 OX40 CD28 Fc?RI? TIM3 OX40 CD28 Fc?RI? TIM3 OX40 CD28 DAP10 TIM3 OX40 CD28 DAP12 TIM3 OX40 CD28 CD32 TIM3 OX40 CD28 CD79a TIM3 OX40 CD28 CD79b TIM3 OX40 CD8 CD8 TIM3 OX40 CD8 CD3? TIM3 OX40 CD8 CD3? TIM3 OX40 CD8 CD3? TIM3 OX40 CD8 CD3? TIM3 OX40 CD8 Fc?RI-? TIM3 OX40 CD8 Fc?RIII-? TIM3 OX40 CD8 Fc?RI? TIM3 OX40 CD8 Fc?RI? TIM3 OX40 CD8 DAP10 TIM3 OX40 CD8 DAP12 TIM3 OX40 CD8 CD32 TIM3 OX40 CD8 CD79a TIM3 OX40 CD8 CD79b TIM3 OX40 CD4 CD8 TIM3 OX40 CD4 CD3? TIM3 OX40 CD4 CD3? TIM3 OX40 CD4 CD3? TIM3 OX40 CD4 CD3? TIM3 OX40 CD4 Fc?RI-? TIM3 OX40 CD4 Fc?RIII-? TIM3 OX40 CD4 Fc?RI? TIM3 OX40 CD4 Fc?RI? TIM3 OX40 CD4 DAP10 TIM3 OX40 CD4 DAP12 TIM3 OX40 CD4 CD32 TIM3 OX40 CD4 CD79a TIM3 OX40 CD4 CD79b TIM3 OX40 b2c CD8 TIM3 OX40 b2c CD3? TIM3 OX40 b2c CD3? TIM3 OX40 b2c CD3? TIM3 OX40 b2c CD3? TIM3 OX40 b2c Fc?RI-? TIM3 OX40 b2c Fc?RIII-? TIM3 OX40 b2c Fc?RI? TIM3 OX40 b2c Fc?RI? TIM3 OX40 b2c DAP10 TIM3 OX40 b2c DAP12 TIM3 OX40 b2c CD32 TIM3 OX40 b2c CD79a TIM3 OX40 b2c CD79b TIM3 OX40 CD137/41BB CD8 TIM3 OX40 CD137/41BB CD3? TIM3 OX40 CD137/41BB CD3? TIM3 OX40 CD137/41BB CD3? TIM3 OX40 CD137/41BB CD3? TIM3 OX40 CD137/41BB Fc?RI-? TIM3 OX40 CD137/41BB Fc?RIII-? TIM3 OX40 CD137/41BB Fc?RI? TIM3 OX40 CD137/41BB Fc?RI? TIM3 OX40 CD137/41BB DAP10 TIM3 OX40 CD137/41BB DAP12 TIM3 OX40 CD137/41BB CD32 TIM3 OX40 CD137/41BB CD79a TIM3 OX40 CD137/41BB CD79b TIM3 OX40 ICOS CD8 TIM3 OX40 ICOS CD3? TIM3 OX40 ICOS CD3? TIM3 OX40 ICOS CD3? TIM3 OX40 ICOS CD3? TIM3 OX40 ICOS Fc?RI-? TIM3 OX40 ICOS Fc?RIII-? TIM3 OX40 ICOS Fc?RI? TIM3 OX40 ICOS Fc?RI? TIM3 OX40 ICOS DAP10 TIM3 OX40 ICOS DAP12 TIM3 OX40 ICOS CD32 TIM3 OX40 ICOS CD79a TIM3 OX40 ICOS CD79b TIM3 OX40 CD27 CD8 TIM3 OX40 CD27 CD3? TIM3 OX40 CD27 CD3? TIM3 OX40 CD27 CD3? TIM3 OX40 CD27 CD3? TIM3 OX40 CD27 Fc?RI-? TIM3 OX40 CD27 Fc?RIII-? TIM3 OX40 CD27 Fc?RI? TIM3 OX40 CD27 Fc?RI? TIM3 OX40 CD27 DAP10 TIM3 OX40 CD27 DAP12 TIM3 OX40 CD27 CD32 TIM3 OX40 CD27 CD79a TIM3 OX40 CD27 CD79b TIM3 OX40 CD28? CD8 TIM3 OX40 CD28? CD3? TIM3 OX40 CD28? CD3? TIM3 OX40 CD28? CD3? TIM3 OX40 CD28? CD3? TIM3 OX40 CD28? Fc?RI-? TIM3 OX40 CD28? Fc?RIII-? TIM3 OX40 CD28? Fc?RI? TIM3 OX40 CD28? Fc?RI? TIM3 OX40 CD28? DAP10 TIM3 OX40 CD28? DAP12 TIM3 OX40 CD28? CD32 TIM3 OX40 CD28? CD79a TIM3 OX40 CD28? CD79b TIM3 OX40 CD80 CD8 TIM3 OX40 CD80 CD3? TIM3 OX40 CD80 CD3? TIM3 OX40 CD80 CD3? TIM3 OX40 CD80 CD3? TIM3 OX40 CD80 Fc?RI-? TIM3 OX40 CD80 Fc?RIII-? TIM3 OX40 CD80 Fc?RI? TIM3 OX40 CD80 Fc?RI? TIM3 OX40 CD80 DAP10 TIM3 OX40 CD80 DAP12 TIM3 OX40 CD80 CD32 TIM3 OX40 CD80 CD79a TIM3 OX40 CD80 CD79b TIM3 OX40 CD86 CD8 TIM3 OX40 CD86 CD3? TIM3 OX40 CD86 CD3? TIM3 OX40 CD86 CD3? TIM3 OX40 CD86 CD3? TIM3 OX40 CD86 Fc?RI-? TIM3 OX40 CD86 Fc?RIII-? TIM3 OX40 CD86 Fc?RI? TIM3 OX40 CD86 Fc?RI? TIM3 OX40 CD86 DAP10 TIM3 OX40 CD86 DAP12 TIM3 OX40 CD86 CD32 TIM3 OX40 CD86 CD79a TIM3 OX40 CD86 CD79b TIM3 OX40 OX40 CD8 TIM3 OX40 OX40 CD3? TIM3 OX40 OX40 CD3? TIM3 OX40 OX40 CD3? TIM3 OX40 OX40 CD3? TIM3 OX40 OX40 Fc?RI-? TIM3 OX40 OX40 Fc?RIII-? TIM3 OX40 OX40 Fc?RI? TIM3 OX40 OX40 Fc?RI? TIM3 OX40 OX40 DAP10 TIM3 OX40 OX40 DAP12 TIM3 OX40 OX40 CD32 TIM3 OX40 OX40 CD79a TIM3 OX40 OX40 CD79b TIM3 OX40 DAP10 CD8 TIM3 OX40 DAP10 CD3? TIM3 OX40 DAP10 CD3? TIM3 OX40 DAP10 CD3? TIM3 OX40 DAP10 CD3? TIM3 OX40 DAP10 Fc?RI-? TIM3 OX40 DAP10 Fc?RIII-? TIM3 OX40 DAP10 Fc?RI? TIM3 OX40 DAP10 Fc?RI? TIM3 OX40 DAP10 DAP10 TIM3 OX40 DAP10 DAP12 TIM3 OX40 DAP10 CD32 TIM3 OX40 DAP10 CD79a TIM3 OX40 DAP10 CD79b TIM3 OX40 DAP12 CD8 TIM3 OX40 DAP12 CD3? TIM3 OX40 DAP12 CD3? TIM3 OX40 DAP12 CD3? TIM3 OX40 DAP12 CD3? TIM3 OX40 DAP12 Fc?RI-? TIM3 OX40 DAP12 Fc?RIII-? TIM3 OX40 DAP12 Fc?RI? TIM3 OX40 DAP12 Fc?RI? TIM3 OX40 DAP12 DAP10 TIM3 OX40 DAP12 DAP12 TIM3 OX40 DAP12 CD32 TIM3 OX40 DAP12 CD79a TIM3 OX40 DAP12 CD79b TIM3 OX40 MyD88 CD8 TIM3 OX40 MyD88 CD3? TIM3 OX40 MyD88 CD3? TIM3 OX40 MyD88 CD3? TIM3 OX40 MyD88 CD3? TIM3 OX40 MyD88 Fc?RI-? TIM3 OX40 MyD88 Fc?RIII-? TIM3 OX40 MyD88 Fc?RI? TIM3 OX40 MyD88 Fc?RI? TIM3 OX40 MyD88 DAP10 TIM3 OX40 MyD88 DAP12 TIM3 OX40 MyD88 CD32 TIM3 OX40 MyD88 CD79a TIM3 OX40 MyD88 CD79b TIM3 OX40 CD7 CD8 TIM3 OX40 CD7 CD3? TIM3 OX40 CD7 CD3? TIM3 OX40 CD7 CD3? TIM3 OX40 CD7 CD3? TIM3 OX40 CD7 Fc?RI-? TIM3 OX40 CD7 Fc?RIII-? TIM3 OX40 CD7 Fc?RI? TIM3 OX40 CD7 Fc?RI? TIM3 OX40 CD7 DAP10 TIM3 OX40 CD7 DAP12 TIM3 OX40 CD7 CD32 TIM3 OX40 CD7 CD79a TIM3 OX40 CD7 CD79b TIM3 OX40 BTNL3 CD8 TIM3 OX40 BTNL3 CD3? TIM3 OX40 BTNL3 CD3? TIM3 OX40 BTNL3 CD3? TIM3 OX40 BTNL3 CD3? TIM3 OX40 BTNL3 Fc?RI-? TIM3 OX40 BTNL3 Fc?RIII-? TIM3 OX40 BTNL3 Fc?RI? TIM3 OX40 BTNL3 Fc?RI? TIM3 OX40 BTNL3 DAP10 TIM3 OX40 BTNL3 DAP12 TIM3 OX40 BTNL3 CD32 TIM3 OX40 BTNL3 CD79a TIM3 OX40 BTNL3 CD79b TIM3 OX40 NKG2D CD8 TIM3 OX40 NKG2D CD3? TIM3 OX40 NKG2D CD3? TIM3 OX40 NKG2D CD3? TIM3 OX40 NKG2D CD3? TIM3 OX40 NKG2D Fc?RI-? TIM3 OX40 NKG2D Fc?RIII-? TIM3 OX40 NKG2D Fc?RI? TIM3 OX40 NKG2D Fc?RI? TIM3 OX40 NKG2D DAP10 TIM3 OX40 NKG2D DAP12 TIM3 OX40 NKG2D CD32 TIM3 OX40 NKG2D CD79a TIM3 OX40 NKG2D CD79b TIM3 DAP10 CD28 CD8 TIM3 DAP10 CD28 CD3? TIM3 DAP10 CD28 CD3? TIM3 DAP10 CD28 CD3? TIM3 DAP10 CD28 CD3? TIM3 DAP10 CD28 Fc?RI-? TIM3 DAP10 CD28 Fc?RIII-? TIM3 DAP10 CD28 Fc?RI? TIM3 DAP10 CD28 Fc?RI? TIM3 DAP10 CD28 DAP10 TIM3 DAP10 CD28 DAP12 TIM3 DAP10 CD28 CD32 TIM3 DAP10 CD28 CD79a TIM3 DAP10 CD28 CD79b TIM3 DAP10 CD8 CD8 TIM3 DAP10 CD8 CD3? TIM3 DAP10 CD8 CD3? TIM3 DAP10 CD8 CD3? TIM3 DAP10 CD8 CD3? TIM3 DAP10 CD8 Fc?RI-? TIM3 DAP10 CD8 Fc?RIII-? TIM3 DAP10 CD8 Fc?RI? TIM3 DAP10 CD8 Fc?RI? TIM3 DAP10 CD8 DAP10 TIM3 DAP10 CD8 DAP12 TIM3 DAP10 CD8 CD32 TIM3 DAP10 CD8 CD79a TIM3 DAP10 CD8 CD79b TIM3 DAP10 CD4 CD8 TIM3 DAP10 CD4 CD3? TIM3 DAP10 CD4 CD3? TIM3 DAP10 CD4 CD3? TIM3 DAP10 CD4 CD3? TIM3 DAP10 CD4 Fc?RI-? TIM3 DAP10 CD4 Fc?RIII-? TIM3 DAP10 CD4 Fc?RI? TIM3 DAP10 CD4 Fc?RI? TIM3 DAP10 CD4 DAP10 TIM3 DAP10 CD4 DAP12 TIM3 DAP10 CD4 CD32 TIM3 DAP10 CD4 CD79a TIM3 DAP10 CD4 CD79b TIM3 DAP10 b2c CD8 TIM3 DAP10 b2c CD3? TIM3 DAP10 b2c CD3? TIM3 DAP10 b2c CD3? TIM3 DAP10 b2c CD3? TIM3 DAP10 b2c Fc?RI-? TIM3 DAP10 b2c Fc?RIII-? TIM3 DAP10 b2c Fc?RI? TIM3 DAP10 b2c Fc?RI? TIM3 DAP10 b2c DAP10 TIM3 DAP10 b2c DAP12 TIM3 DAP10 b2c CD32 TIM3 DAP10 b2c CD79a TIM3 DAP10 b2c CD79b TIM3 DAP10 CD137/41BB CD8 TIM3 DAP10 CD137/41BB CD3? TIM3 DAP10 CD137/41BB CD3? TIM3 DAP10 CD137/41BB CD3? TIM3 DAP10 CD137/41BB CD3? TIM3 DAP10 CD137/41BB Fc?RI-? TIM3 DAP10 CD137/41BB Fc?RIII-? TIM3 DAP10 CD137/41BB Fc?RI? TIM3 DAP10 CD137/41BB Fc?RI? TIM3 DAP10 CD137/41BB DAP10 TIM3 DAP10 CD137/41BB DAP12 TIM3 DAP10 CD137/41BB CD32 TIM3 DAP10 CD137/41BB CD79a TIM3 DAP10 CD137/41BB CD79b TIM3 DAP10 ICOS CD8 TIM3 DAP10 ICOS CD3? TIM3 DAP10 ICOS CD3? TIM3 DAP10 ICOS CD3? TIM3 DAP10 ICOS CD3? TIM3 DAP10 ICOS Fc?RI-? TIM3 DAP10 ICOS Fc?RIII-? TIM3 DAP10 ICOS Fc?RI? TIM3 DAP10 ICOS Fc?RI? TIM3 DAP10 ICOS DAP10 TIM3 DAP10 ICOS DAP12 TIM3 DAP10 ICOS CD32 TIM3 DAP10 ICOS CD79a TIM3 DAP10 ICOS CD79b TIM3 DAP10 CD27 CD8 TIM3 DAP10 CD27 CD3? TIM3 DAP10 CD27 CD3? TIM3 DAP10 CD27 CD3? TIM3 DAP10 CD27 CD3? TIM3 DAP10 CD27 Fc?RI-? TIM3 DAP10 CD27 Fc?RIII-? TIM3 DAP10 CD27 Fc?RI? TIM3 DAP10 CD27 Fc?RI? TIM3 DAP10 CD27 DAP10 TIM3 DAP10 CD27 DAP12 TIM3 DAP10 CD27 CD32 TIM3 DAP10 CD27 CD79a TIM3 DAP10 CD27 CD79b TIM3 DAP10 CD28? CD8 TIM3 DAP10 CD28? CD3? TIM3 DAP10 CD28? CD3? TIM3 DAP10 CD28? CD3? TIM3 DAP10 CD28? CD3? TIM3 DAP10 CD28? Fc?RI-? TIM3 DAP10 CD28? Fc?RIII-? TIM3 DAP10 CD28? Fc?RI? TIM3 DAP10 CD28? Fc?RI? TIM3 DAP10 CD28? DAP10 TIM3 DAP10 CD28? DAP12 TIM3 DAP10 CD28? CD32 TIM3 DAP10 CD28? CD79a TIM3 DAP10 CD28? CD79b TIM3 DAP10 CD80 CD8 TIM3 DAP10 CD80 CD3? TIM3 DAP10 CD80 CD3? TIM3 DAP10 CD80 CD3? TIM3 DAP10 CD80 CD3? TIM3 DAP10 CD80 Fc?RI-? TIM3 DAP10 CD80 Fc?RIII-? TIM3 DAP10 CD80 Fc?RI? TIM3 DAP10 CD80 Fc?RI? TIM3 DAP10 CD80 DAP10 TIM3 DAP10 CD80 DAP12 TIM3 DAP10 CD80 CD32 TIM3 DAP10 CD80 CD79a TIM3 DAP10 CD80 CD79b TIM3 DAP10 CD86 CD8 TIM3 DAP10 CD86 CD3? TIM3 DAP10 CD86 CD3? TIM3 DAP10 CD86 CD3? TIM3 DAP10 CD86 CD3? TIM3 DAP10 CD86 Fc?RI-? TIM3 DAP10 CD86 Fc?RIII-? TIM3 DAP10 CD86 Fc?RI? TIM3 DAP10 CD86 Fc?RI? TIM3 DAP10 CD86 DAP10 TIM3 DAP10 CD86 DAP12 TIM3 DAP10 CD86 CD32 TIM3 DAP10 CD86 CD79a TIM3 DAP10 CD86 CD79b TIM3 DAP10 OX40 CD8 TIM3 DAP10 OX40 CD3? TIM3 DAP10 OX40 CD3? TIM3 DAP10 OX40 CD3? TIM3 DAP10 OX40 CD3? TIM3 DAP10 OX40 Fc?RI-? TIM3 DAP10 OX40 Fc?RIII-? TIM3 DAP10 OX40 Fc?RI? TIM3 DAP10 OX40 Fc?RI? TIM3 DAP10 OX40 DAP10 TIM3 DAP10 OX40 DAP12 TIM3 DAP10 OX40 CD32 TIM3 DAP10 OX40 CD79a TIM3 DAP10 OX40 CD79b TIM3 DAP10 DAP10 CD8 TIM3 DAP10 DAP10 CD3? TIM3 DAP10 DAP10 CD3? TIM3 DAP10 DAP10 CD3? TIM3 DAP10 DAP10 CD3? TIM3 DAP10 DAP10 Fc?RI-? TIM3 DAP10 DAP10 Fc?RIII-? TIM3 DAP10 DAP10 Fc?RI? TIM3 DAP10 DAP10 Fc?RI? TIM3 DAP10 DAP10 DAP10 TIM3 DAP10 DAP10 DAP12 TIM3 DAP10 DAP10 CD32 TIM3 DAP10 DAP10 CD79a TIM3 DAP10 DAP10 CD79b TIM3 DAP10 DAP12 CD8 TIM3 DAP10 DAP12 CD3? TIM3 DAP10 DAP12 CD3? TIM3 DAP10 DAP12 CD3? TIM3 DAP10 DAP12 CD3? TIM3 DAP10 DAP12 Fc?RI-? TIM3 DAP10 DAP12 Fc?RIII-? TIM3 DAP10 DAP12 Fc?RI? TIM3 DAP10 DAP12 Fc?RI? TIM3 DAP10 DAP12 DAP10 TIM3 DAP10 DAP12 DAP12 TIM3 DAP10 DAP12 CD32 TIM3 DAP10 DAP12 CD79a TIM3 DAP10 DAP12 CD79b TIM3 DAP10 MyD88 CD8 TIM3 DAP10 MyD88 CD3? TIM3 DAP10 MyD88 CD3? TIM3 DAP10 MyD88 CD3? TIM3 DAP10 MyD88 CD3? TIM3 DAP10 MyD88 Fc?RI-? TIM3 DAP10 MyD88 Fc?RIII-? TIM3 DAP10 MyD88 Fc?RI? TIM3 DAP10 MyD88 Fc?RI? TIM3 DAP10 MyD88 DAP10 TIM3 DAP10 MyD88 DAP12 TIM3 DAP10 MyD88 CD32 TIM3 DAP10 MyD88 CD79a TIM3 DAP10 MyD88 CD79b TIM3 DAP10 CD7 CD8 TIM3 DAP10 CD7 CD3? TIM3 DAP10 CD7 CD3? TIM3 DAP10 CD7 CD3? TIM3 DAP10 CD7 CD3? TIM3 DAP10 CD7 Fc?RI-? TIM3 DAP10 CD7 Fc?RIII-? TIM3 DAP10 CD7 Fc?RI? TIM3 DAP10 CD7 Fc?RI? TIM3 DAP10 CD7 DAP10 TIM3 DAP10 CD7 DAP12 TIM3 DAP10 CD7 CD32 TIM3 DAP10 CD7 CD79a TIM3 DAP10 CD7 CD79b TIM3 DAP10 BTNL3 CD8 TIM3 DAP10 BTNL3 CD3? TIM3 DAP10 BTNL3 CD3? TIM3 DAP10 BTNL3 CD3? TIM3 DAP10 BTNL3 CD3? TIM3 DAP10 BTNL3 Fc?RI-? TIM3 DAP10 BTNL3 Fc?RIII-? TIM3 DAP10 BTNL3 Fc?RI? TIM3 DAP10 BTNL3 Fc?RI? TIM3 DAP10 BTNL3 DAP10 TIM3 DAP10 BTNL3 DAP12 TIM3 DAP10 BTNL3 CD32 TIM3 DAP10 BTNL3 CD79a TIM3 DAP10 BTNL3 CD79b TIM3 DAP10 NKG2D CD8 TIM3 DAP10 NKG2D CD3? TIM3 DAP10 NKG2D CD3? TIM3 DAP10 NKG2D CD3? TIM3 DAP10 NKG2D CD3? TIM3 DAP10 NKG2D Fc?RI-? TIM3 DAP10 NKG2D Fc?RIII-? TIM3 DAP10 NKG2D Fc?RI? TIM3 DAP10 NKG2D Fc?RI? TIM3 DAP10 NKG2D DAP10 TIM3 DAP10 NKG2D DAP12 TIM3 DAP10 NKG2D CD32 TIM3 DAP10 NKG2D CD79a TIM3 DAP10 NKG2D CD79b TIM3 DAP12 CD28 CD8 TIM3 DAP12 CD28 CD3? TIM3 DAP12 CD28 CD3? TIM3 DAP12 CD28 CD3? TIM3 DAP12 CD28 CD3? TIM3 DAP12 CD28 Fc?RI-? TIM3 DAP12 CD28 Fc?RIII-? TIM3 DAP12 CD28 Fc?RI? TIM3 DAP12 CD28 Fc?RI? TIM3 DAP12 CD28 DAP10 TIM3 DAP12 CD28 DAP12 TIM3 DAP12 CD28 CD32 TIM3 DAP12 CD28 CD79a TIM3 DAP12 CD28 CD79b TIM3 DAP12 CD8 CD8 TIM3 DAP12 CD8 CD3? TIM3 DAP12 CD8 CD3? TIM3 DAP12 CD8 CD3? TIM3 DAP12 CD8 CD3? TIM3 DAP12 CD8 Fc?RI-? TIM3 DAP12 CD8 Fc?RIII-? TIM3 DAP12 CD8 Fc?RI? TIM3 DAP12 CD8 Fc?RI? TIM3 DAP12 CD8 DAP10 TIM3 DAP12 CD8 DAP12 TIM3 DAP12 CD8 CD32 TIM3 DAP12 CD8 CD79a TIM3 DAP12 CD8 CD79b TIM3 DAP12 CD4 CD8 TIM3 DAP12 CD4 CD3? TIM3 DAP12 CD4 CD3? TIM3 DAP12 CD4 CD3? TIM3 DAP12 CD4 CD3? TIM3 DAP12 CD4 Fc?RI-? TIM3 DAP12 CD4 Fc?RIII-? TIM3 DAP12 CD4 Fc?RI? TIM3 DAP12 CD4 Fc?RI? TIM3 DAP12 CD4 DAP10 TIM3 DAP12 CD4 DAP12 TIM3 DAP12 CD4 CD32 TIM3 DAP12 CD4 CD79a TIM3 DAP12 CD4 CD79b TIM3 DAP12 b2c CD8 TIM3 DAP12 b2c CD3? TIM3 DAP12 b2c CD3? TIM3 DAP12 b2c CD3? TIM3 DAP12 b2c CD3? TIM3 DAP12 b2c Fc?RI-? TIM3 DAP12 b2c Fc?RIII-? TIM3 DAP12 b2c Fc?RI? TIM3 DAP12 b2c Fc?RI? TIM3 DAP12 b2c DAP10 TIM3 DAP12 b2c DAP12 TIM3 DAP12 b2c CD32 TIM3 DAP12 b2c CD79a TIM3 DAP12 b2c CD79b TIM3 DAP12 CD137/41BB CD8 TIM3 DAP12 CD137/41BB CD3? TIM3 DAP12 CD137/41BB CD3? TIM3 DAP12 CD137/41BB CD3? TIM3 DAP12 CD137/41BB CD3? TIM3 DAP12 CD137/41BB Fc?RI-? TIM3 DAP12 CD137/41BB Fc?RIII-? TIM3 DAP12 CD137/41BB Fc?RI? TIM3 DAP12 CD137/41BB Fc?RI? TIM3 DAP12 CD137/41BB DAP10 TIM3 DAP12 CD137/41BB DAP12 TIM3 DAP12 CD137/41BB CD32 TIM3 DAP12 CD137/41BB CD79a TIM3 DAP12 CD137/41BB CD79b TIM3 DAP12 ICOS CD8 TIM3 DAP12 ICOS CD3? TIM3 DAP12 ICOS CD3? TIM3 DAP12 ICOS CD3? TIM3 DAP12 ICOS CD3? TIM3 DAP12 ICOS Fc?RI-? TIM3 DAP12 ICOS Fc?RIII-? TIM3 DAP12 ICOS Fc?RI? TIM3 DAP12 ICOS Fc?RI? TIM3 DAP12 ICOS DAP10 TIM3 DAP12 ICOS DAP12 TIM3 DAP12 ICOS CD32 TIM3 DAP12 ICOS CD79a TIM3 DAP12 ICOS CD79b TIM3 DAP12 CD27 CD8 TIM3 DAP12 CD27 CD3? TIM3 DAP12 CD27 CD3? TIM3 DAP12 CD27 CD3? TIM3 DAP12 CD27 CD3? TIM3 DAP12 CD27 Fc?RI-? TIM3 DAP12 CD27 Fc?RIII-? TIM3 DAP12 CD27 Fc?RI? TIM3 DAP12 CD27 Fc?RI? TIM3 DAP12 CD27 DAP10 TIM3 DAP12 CD27 DAP12 TIM3 DAP12 CD27 CD32 TIM3 DAP12 CD27 CD79a TIM3 DAP12 CD27 CD79b TIM3 DAP12 CD28? CD8 TIM3 DAP12 CD28? CD3? TIM3 DAP12 CD28? CD3? TIM3 DAP12 CD28? CD3? TIM3 DAP12 CD28? CD3? TIM3 DAP12 CD28? Fc?RI-? TIM3 DAP12 CD28? Fc?RIII-? TIM3 DAP12 CD28? Fc?RI? TIM3 DAP12 CD28? Fc?RI? TIM3 DAP12 CD28? DAP10 TIM3 DAP12 CD28? DAP12 TIM3 DAP12 CD28? CD32 TIM3 DAP12 CD28? CD79a TIM3 DAP12 CD28? CD79b TIM3 DAP12 CD80 CD8 TIM3 DAP12 CD80 CD3? TIM3 DAP12 CD80 CD3? TIM3 DAP12 CD80 CD3? TIM3 DAP12 CD80 CD3? TIM3 DAP12 CD80 Fc?RI-? TIM3 DAP12 CD80 Fc?RIII-? TIM3 DAP12 CD80 Fc?RI? TIM3 DAP12 CD80 Fc?RI? TIM3 DAP12 CD80 DAP10 TIM3 DAP12 CD80 DAP12 TIM3 DAP12 CD80 CD32 TIM3 DAP12 CD80 CD79a TIM3 DAP12 CD80 CD79b TIM3 DAP12 CD86 CD8 TIM3 DAP12 CD86 CD3? TIM3 DAP12 CD86 CD3? TIM3 DAP12 CD86 CD3? TIM3 DAP12 CD86 CD3? TIM3 DAP12 CD86 Fc?RI-? TIM3 DAP12 CD86 Fc?RIII-? TIM3 DAP12 CD86 Fc?RI? TIM3 DAP12 CD86 Fc?RI? TIM3 DAP12 CD86 DAP10 TIM3 DAP12 CD86 DAP12 TIM3 DAP12 CD86 CD32 TIM3 DAP12 CD86 CD79a TIM3 DAP12 CD86 CD79b TIM3 DAP12 OX40 CD8 TIM3 DAP12 OX40 CD3? TIM3 DAP12 OX40 CD3? TIM3 DAP12 OX40 CD3? TIM3 DAP12 OX40 CD3? TIM3 DAP12 OX40 Fc?RI-? TIM3 DAP12 OX40 Fc?RIII-? TIM3 DAP12 OX40 Fc?RI? TIM3 DAP12 OX40 Fc?RI? TIM3 DAP12 OX40 DAP10 TIM3 DAP12 OX40 DAP12 TIM3 DAP12 OX40 CD32 TIM3 DAP12 OX40 CD79a TIM3 DAP12 OX40 CD79b TIM3 DAP12 DAP10 CD8 TIM3 DAP12 DAP10 CD3? TIM3 DAP12 DAP10 CD3? TIM3 DAP12 DAP10 CD3? TIM3 DAP12 DAP10 CD3? TIM3 DAP12 DAP10 Fc?RI-? TIM3 DAP12 DAP10 Fc?RIII-? TIM3 DAP12 DAP10 Fc?RI? TIM3 DAP12 DAP10 Fc?RI? TIM3 DAP12 DAP10 DAP10 TIM3 DAP12 DAP10 DAP12 TIM3 DAP12 DAP10 CD32 TIM3 DAP12 DAP10 CD79a TIM3 DAP12 DAP10 CD79b TIM3 DAP12 DAP12 CD8 TIM3 DAP12 DAP12 CD3? TIM3 DAP12 DAP12 CD3? TIM3 DAP12 DAP12 CD3? TIM3 DAP12 DAP12 CD3? TIM3 DAP12 DAP12 Fc?RI-? TIM3 DAP12 DAP12 Fc?RIII-? TIM3 DAP12 DAP12 Fc?RI? TIM3 DAP12 DAP12 Fc?RI? TIM3 DAP12 DAP12 DAP10 TIM3 DAP12 DAP12 DAP12 TIM3 DAP12 DAP12 CD32 TIM3 DAP12 DAP12 CD79a TIM3 DAP12 DAP12 CD79b TIM3 DAP12 MyD88 CD8 TIM3 DAP12 MyD88 CD3? TIM3 DAP12 MyD88 CD3? TIM3 DAP12 MyD88 CD3? TIM3 DAP12 MyD88 CD3? TIM3 DAP12 MyD88 Fc?RI-? TIM3 DAP12 MyD88 Fc?RIII-? TIM3 DAP12 MyD88 Fc?RI? TIM3 DAP12 MyD88 Fc?RI? TIM3 DAP12 MyD88 DAP10 TIM3 DAP12 MyD88 DAP12 TIM3 DAP12 MyD88 CD32 TIM3 DAP12 MyD88 CD79a TIM3 DAP12 MyD88 CD79b TIM3 DAP12 CD7 CD8 TIM3 DAP12 CD7 CD3? TIM3 DAP12 CD7 CD3? TIM3 DAP12 CD7 CD3? TIM3 DAP12 CD7 CD3? TIM3 DAP12 CD7 Fc?RI-? TIM3 DAP12 CD7 Fc?RIII-? TIM3 DAP12 CD7 Fc?RI? TIM3 DAP12 CD7 Fc?RI? TIM3 DAP12 CD7 DAP10 TIM3 DAP12 CD7 DAP12 TIM3 DAP12 CD7 CD32 TIM3 DAP12 CD7 CD79a TIM3 DAP12 CD7 CD79b TIM3 DAP12 BTNL3 CD8 TIM3 DAP12 BTNL3 CD3? TIM3 DAP12 BTNL3 CD3? TIM3 DAP12 BTNL3 CD3? TIM3 DAP12 BTNL3 CD3? TIM3 DAP12 BTNL3 Fc?RI-? TIM3 DAP12 BTNL3 Fc?RIII-? TIM3 DAP12 BTNL3 Fc?RI? TIM3 DAP12 BTNL3 Fc?RI? TIM3 DAP12 BTNL3 DAP10 TIM3 DAP12 BTNL3 DAP12 TIM3 DAP12 BTNL3 CD32 TIM3 DAP12 BTNL3 CD79a TIM3 DAP12 BTNL3 CD79b TIM3 DAP12 NKG2D CD8 TIM3 DAP12 NKG2D CD3? TIM3 DAP12 NKG2D CD3? TIM3 DAP12 NKG2D CD3? TIM3 DAP12 NKG2D CD3? TIM3 DAP12 NKG2D Fc?RI-? TIM3 DAP12 NKG2D Fc?RIII-? TIM3 DAP12 NKG2D Fc?RI? TIM3 DAP12 NKG2D Fc?RI? TIM3 DAP12 NKG2D DAP10 TIM3 DAP12 NKG2D DAP12 TIM3 DAP12 NKG2D CD32 TIM3 DAP12 NKG2D CD79a TIM3 DAP12 NKG2D CD79b TIM3 MyD88 CD28 CD8 TIM3 MyD88 CD28 CD3? TIM3 MyD88 CD28 CD3? TIM3 MyD88 CD28 CD3? TIM3 MyD88 CD28 CD3? TIM3 MyD88 CD28 Fc?RI-? TIM3 MyD88 CD28 Fc?RIII-? TIM3 MyD88 CD28 Fc?RI? TIM3 MyD88 CD28 Fc?RI? TIM3 MyD88 CD28 DAP10 TIM3 MyD88 CD28 DAP12 TIM3 MyD88 CD28 CD32 TIM3 MyD88 CD28 CD79a TIM3 MyD88 CD28 CD79b TIM3 MyD88 CD8 CD8 TIM3 MyD88 CD8 CD3? TIM3 MyD88 CD8 CD3? TIM3 MyD88 CD8 CD3? TIM3 MyD88 CD8 CD3? TIM3 MyD88 CD8 Fc?RI-? TIM3 MyD88 CD8 Fc?RIII-? TIM3 MyD88 CD8 Fc?RI? TIM3 MyD88 CD8 Fc?RI? TIM3 MyD88 CD8 DAP10 TIM3 MyD88 CD8 DAP12 TIM3 MyD88 CD8 CD32 TIM3 MyD88 CD8 CD79a TIM3 MyD88 CD8 CD79b TIM3 MyD88 CD4 CD8 TIM3 MyD88 CD4 CD3? TIM3 MyD88 CD4 CD3? TIM3 MyD88 CD4 CD3? TIM3 MyD88 CD4 CD3? TIM3 MyD88 CD4 Fc?RI-? TIM3 MyD88 CD4 Fc?RIII-? TIM3 MyD88 CD4 Fc?RI? TIM3 MyD88 CD4 Fc?RI? TIM3 MyD88 CD4 DAP10 TIM3 MyD88 CD4 DAP12 TIM3 MyD88 CD4 CD32 TIM3 MyD88 CD4 CD79a TIM3 MyD88 CD4 CD79b TIM3 MyD88 b2c CD8 TIM3 MyD88 b2c CD3? TIM3 MyD88 b2c CD3? TIM3 MyD88 b2c CD3? TIM3 MyD88 b2c CD3? TIM3 MyD88 b2c Fc?RI-? TIM3 MyD88 b2c Fc?RIII-? TIM3 MyD88 b2c Fc?RI? TIM3 MyD88 b2c Fc?RI? TIM3 MyD88 b2c DAP10 TIM3 MyD88 b2c DAP12 TIM3 MyD88 b2c CD32 TIM3 MyD88 b2c CD79a TIM3 MyD88 b2c CD79b TIM3 MyD88 CD137/41BB CD8 TIM3 MyD88 CD137/41BB CD3? TIM3 MyD88 CD137/41BB CD3? TIM3 MyD88 CD137/41BB CD3? TIM3 MyD88 CD137/41BB CD3? TIM3 MyD88 CD137/41BB Fc?RI-? TIM3 MyD88 CD137/41BB Fc?RIII-? TIM3 MyD88 CD137/41BB Fc?RI? TIM3 MyD88 CD137/41BB Fc?RI? TIM3 MyD88 CD137/41BB DAP10 TIM3 MyD88 CD137/41BB DAP12 TIM3 MyD88 CD137/41BB CD32 TIM3 MyD88 CD137/41BB CD79a TIM3 MyD88 CD137/41BB CD79b TIM3 MyD88 ICOS CD8 TIM3 MyD88 ICOS CD3? TIM3 MyD88 ICOS CD3? TIM3 MyD88 ICOS CD3? TIM3 MyD88 ICOS CD3? TIM3 MyD88 ICOS Fc?RI-? TIM3 MyD88 ICOS Fc?RIII-? TIM3 MyD88 ICOS Fc?RI? TIM3 MyD88 ICOS Fc?RI? TIM3 MyD88 ICOS DAP10 TIM3 MyD88 ICOS DAP12 TIM3 MyD88 ICOS CD32 TIM3 MyD88 ICOS CD79a TIM3 MyD88 ICOS CD79b TIM3 MyD88 CD27 CD8 TIM3 MyD88 CD27 CD3? TIM3 MyD88 CD27 CD3? TIM3 MyD88 CD27 CD3? TIM3 MyD88 CD27 CD3? TIM3 MyD88 CD27 Fc?RI-? TIM3 MyD88 CD27 Fc?RIII-? TIM3 MyD88 CD27 Fc?RI? TIM3 MyD88 CD27 Fc?RI? TIM3 MyD88 CD27 DAP10 TIM3 MyD88 CD27 DAP12 TIM3 MyD88 CD27 CD32 TIM3 MyD88 CD27 CD79a TIM3 MyD88 CD27 CD79b TIM3 MyD88 CD28? CD8 TIM3 MyD88 CD28? CD3? TIM3 MyD88 CD28? CD3? TIM3 MyD88 CD28? CD3? TIM3 MyD88 CD28? CD3? TIM3 MyD88 CD28? Fc?RI-? TIM3 MyD88 CD28? Fc?RIII-? TIM3 MyD88 CD28? Fc?RI? TIM3 MyD88 CD28? Fc?RI? TIM3 MyD88 CD28? DAP10 TIM3 MyD88 CD28? DAP12 TIM3 MyD88 CD28? CD32 TIM3 MyD88 CD28? CD79a TIM3 MyD88 CD28? CD79b TIM3 MyD88 CD80 CD8 TIM3 MyD88 CD80 CD3? TIM3 MyD88 CD80 CD3? TIM3 MyD88 CD80 CD3? TIM3 MyD88 CD80 CD3? TIM3 MyD88 CD80 Fc?RI-? TIM3 MyD88 CD80 Fc?RIII-? TIM3 MyD88 CD80 Fc?RI? TIM3 MyD88 CD80 Fc?RI? TIM3 MyD88 CD80 DAP10 TIM3 MyD88 CD80 DAP12 TIM3 MyD88 CD80 CD32 TIM3 MyD88 CD80 CD79a TIM3 MyD88 CD80 CD79b TIM3 MyD88 CD86 CD8 TIM3 MyD88 CD86 CD3? TIM3 MyD88 CD86 CD3? TIM3 MyD88 CD86 CD3? TIM3 MyD88 CD86 CD3? TIM3 MyD88 CD86 Fc?RI-? TIM3 MyD88 CD86 Fc?RIII-? TIM3 MyD88 CD86 Fc?RI? TIM3 MyD88 CD86 Fc?RI? TIM3 MyD88 CD86 DAP10 TIM3 MyD88 CD86 DAP12 TIM3 MyD88 CD86 CD32 TIM3 MyD88 CD86 CD79a TIM3 MyD88 CD86 CD79b TIM3 MyD88 OX40 CD8 TIM3 MyD88 OX40 CD3? TIM3 MyD88 OX40 CD3? TIM3 MyD88 OX40 CD3? TIM3 MyD88 OX40 CD3? TIM3 MyD88 OX40 Fc?RI-? TIM3 MyD88 OX40 Fc?RIII-? TIM3 MyD88 OX40 Fc?RI? TIM3 MyD88 OX40 Fc?RI? TIM3 MyD88 OX40 DAP10 TIM3 MyD88 OX40 DAP12 TIM3 MyD88 OX40 CD32 TIM3 MyD88 OX40 CD79a TIM3 MyD88 OX40 CD79b TIM3 MyD88 DAP10 CD8 TIM3 MyD88 DAP10 CD3? TIM3 MyD88 DAP10 CD3? TIM3 MyD88 DAP10 CD3? TIM3 MyD88 DAP10 CD3? TIM3 MyD88 DAP10 Fc?RI-? TIM3 MyD88 DAP10 Fc?RIII-? TIM3 MyD88 DAP10 Fc?RI? TIM3 MyD88 DAP10 Fc?RI? TIM3 MyD88 DAP10 DAP10 TIM3 MyD88 DAP10 DAP12 TIM3 MyD88 DAP10 CD32 TIM3 MyD88 DAP10 CD79a TIM3 MyD88 DAP10 CD79b TIM3 MyD88 DAP12 CD8 TIM3 MyD88 DAP12 CD3? TIM3 MyD88 DAP12 CD3? TIM3 MyD88 DAP12 CD3? TIM3 MyD88 DAP12 CD3? TIM3 MyD88 DAP12 Fc?RI-? TIM3 MyD88 DAP12 Fc?RIII-? TIM3 MyD88 DAP12 Fc?RI? TIM3 MyD88 DAP12 Fc?RI? TIM3 MyD88 DAP12 DAP10 TIM3 MyD88 DAP12 DAP12 TIM3 MyD88 DAP12 CD32 TIM3 MyD88 DAP12 CD79a TIM3 MyD88 DAP12 CD79b TIM3 MyD88 MyD88 CD8 TIM3 MyD88 MyD88 CD3? TIM3 MyD88 MyD88 CD3? TIM3 MyD88 MyD88 CD3? TIM3 MyD88 MyD88 CD3? TIM3 MyD88 MyD88 Fc?RI-? TIM3 MyD88 MyD88 Fc?RIII-? TIM3 MyD88 MyD88 Fc?RI? TIM3 MyD88 MyD88 Fc?RI? TIM3 MyD88 MyD88 DAP10 TIM3 MyD88 MyD88 DAP12 TIM3 MyD88 MyD88 CD32 TIM3 MyD88 MyD88 CD79a TIM3 MyD88 MyD88 CD79b TIM3 MyD88 CD7 CD8 TIM3 MyD88 CD7 CD3? TIM3 MyD88 CD7 CD3? TIM3 MyD88 CD7 CD3? TIM3 MyD88 CD7 CD3? TIM3 MyD88 CD7 Fc?RI-? TIM3 MyD88 CD7 Fc?RIII-? TIM3 MyD88 CD7 Fc?RI? TIM3 MyD88 CD7 Fc?RI? TIM3 MyD88 CD7 DAP10 TIM3 MyD88 CD7 DAP12 TIM3 MyD88 CD7 CD32 TIM3 MyD88 CD7 CD79a TIM3 MyD88 CD7 CD79b TIM3 MyD88 BTNL3 CD8 TIM3 MyD88 BTNL3 CD3? TIM3 MyD88 BTNL3 CD3? TIM3 MyD88 BTNL3 CD3? TIM3 MyD88 BTNL3 CD3? TIM3 MyD88 BTNL3 Fc?RI-? TIM3 MyD88 BTNL3 Fc?RIII-? TIM3 MyD88 BTNL3 Fc?RI? TIM3 MyD88 BTNL3 Fc?RI? TIM3 MyD88 BTNL3 DAP10 TIM3 MyD88 BTNL3 DAP12 TIM3 MyD88 BTNL3 CD32 TIM3 MyD88 BTNL3 CD79a TIM3 MyD88 BTNL3 CD79b TIM3 MyD88 NKG2D CD8 TIM3 MyD88 NKG2D CD3? TIM3 MyD88 NKG2D CD3? TIM3 MyD88 NKG2D CD3? TIM3 MyD88 NKG2D CD3? TIM3 MyD88 NKG2D Fc?RI-? TIM3 MyD88 NKG2D Fc?RIII-? TIM3 MyD88 NKG2D Fc?RI? TIM3 MyD88 NKG2D Fc?RI? TIM3 MyD88 NKG2D DAP10 TIM3 MyD88 NKG2D DAP12 TIM3 MyD88 NKG2D CD32 TIM3 MyD88 NKG2D CD79a TIM3 MyD88 NKG2D CD79b TIM3 CD7 CD28 CD8 TIM3 CD7 CD28 CD3? TIM3 CD7 CD28 CD3? TIM3 CD7 CD28 CD3? TIM3 CD7 CD28 CD3? TIM3 CD7 CD28 Fc?RI-? TIM3 CD7 CD28 Fc?RIII-? TIM3 CD7 CD28 Fc?RI? TIM3 CD7 CD28 Fc?RI? TIM3 CD7 CD28 DAP10 TIM3 CD7 CD28 DAP12 TIM3 CD7 CD28 CD32 TIM3 CD7 CD28 CD79a TIM3 CD7 CD28 CD79b TIM3 CD7 CD8 CD8 TIM3 CD7 CD8 CD3? TIM3 CD7 CD8 CD3? TIM3 CD7 CD8 CD3? TIM3 CD7 CD8 CD3? TIM3 CD7 CD8 Fc?RI-? TIM3 CD7 CD8 Fc?RIII-? TIM3 CD7 CD8 Fc?RI? TIM3 CD7 CD8 Fc?RI? TIM3 CD7 CD8 DAP10 TIM3 CD7 CD8 DAP12 TIM3 CD7 CD8 CD32 TIM3 CD7 CD8 CD79a TIM3 CD7 CD8 CD79b TIM3 CD7 CD4 CD8 TIM3 CD7 CD4 CD3? TIM3 CD7 CD4 CD3? TIM3 CD7 CD4 CD3? TIM3 CD7 CD4 CD3? TIM3 CD7 CD4 Fc?RI-? TIM3 CD7 CD4 Fc?RIII-? TIM3 CD7 CD4 Fc?RI? TIM3 CD7 CD4 Fc?RI? TIM3 CD7 CD4 DAP10 TIM3 CD7 CD4 DAP12 TIM3 CD7 CD4 CD32 TIM3 CD7 CD4 CD79a TIM3 CD7 CD4 CD79b TIM3 CD7 b2c CD8 TIM3 CD7 b2c CD3? TIM3 CD7 b2c CD3? TIM3 CD7 b2c CD3? TIM3 CD7 b2c CD3? TIM3 CD7 b2c Fc?RI-? TIM3 CD7 b2c Fc?RIII-? TIM3 CD7 b2c Fc?RI? TIM3 CD7 b2c Fc?RI? TIM3 CD7 b2c DAP10 TIM3 CD7 b2c DAP12 TIM3 CD7 b2c CD32 TIM3 CD7 b2c CD79a TIM3 CD7 b2c CD79b TIM3 CD7 CD137/41BB CD8 TIM3 CD7 CD137/41BB CD3? TIM3 CD7 CD137/41BB CD3? TIM3 CD7 CD137/41BB CD3? TIM3 CD7 CD137/41BB CD3? TIM3 CD7 CD137/41BB Fc?RI-? TIM3 CD7 CD137/41BB Fc?RIII-? TIM3 CD7 CD137/41BB Fc?RI? TIM3 CD7 CD137/41BB Fc?RI? TIM3 CD7 CD137/41BB DAP10 TIM3 CD7 CD137/41BB DAP12 TIM3 CD7 CD137/41BB CD32 TIM3 CD7 CD137/41BB CD79a TIM3 CD7 CD137/41BB CD79b TIM3 CD7 ICOS CD8 TIM3 CD7 ICOS CD3? TIM3 CD7 ICOS CD3? TIM3 CD7 ICOS CD3? TIM3 CD7 ICOS CD3? TIM3 CD7 ICOS Fc?RI-? TIM3 CD7 ICOS Fc?RIII-? TIM3 CD7 ICOS Fc?RI? TIM3 CD7 ICOS Fc?RI? TIM3 CD7 ICOS DAP10 TIM3 CD7 ICOS DAP12 TIM3 CD7 ICOS CD32 TIM3 CD7 ICOS CD79a TIM3 CD7 ICOS CD79b TIM3 CD7 CD27 CD8 TIM3 CD7 CD27 CD3? TIM3 CD7 CD27 CD3? TIM3 CD7 CD27 CD3? TIM3 CD7 CD27 CD3? TIM3 CD7 CD27 Fc?RI-? TIM3 CD7 CD27 Fc?RIII-? TIM3 CD7 CD27 Fc?RI? TIM3 CD7 CD27 Fc?RI? TIM3 CD7 CD27 DAP10 TIM3 CD7 CD27 DAP12 TIM3 CD7 CD27 CD32 TIM3 CD7 CD27 CD79a TIM3 CD7 CD27 CD79b TIM3 CD7 CD28? CD8 TIM3 CD7 CD28? CD3? TIM3 CD7 CD28? CD3? TIM3 CD7 CD28? CD3? TIM3 CD7 CD28? CD3? TIM3 CD7 CD28? Fc?RI-? TIM3 CD7 CD28? Fc?RIII-? TIM3 CD7 CD28? Fc?RI? TIM3 CD7 CD28? Fc?RI? TIM3 CD7 CD28? DAP10 TIM3 CD7 CD28? DAP12 TIM3 CD7 CD28? CD32 TIM3 CD7 CD28? CD79a TIM3 CD7 CD28? CD79b TIM3 CD7 CD80 CD8 TIM3 CD7 CD80 CD3? TIM3 CD7 CD80 CD3? TIM3 CD7 CD80 CD3? TIM3 CD7 CD80 CD3? TIM3 CD7 CD80 Fc?RI-? TIM3 CD7 CD80 Fc?RIII-? TIM3 CD7 CD80 Fc?RI? TIM3 CD7 CD80 Fc?RI? TIM3 CD7 CD80 DAP10 TIM3 CD7 CD80 DAP12 TIM3 CD7 CD80 CD32 TIM3 CD7 CD80 CD79a TIM3 CD7 CD80 CD79b TIM3 CD7 CD86 CD8 TIM3 CD7 CD86 CD3? TIM3 CD7 CD86 CD3? TIM3 CD7 CD86 CD3? TIM3 CD7 CD86 CD3? TIM3 CD7 CD86 Fc?RI-? TIM3 CD7 CD86 Fc?RIII-? TIM3 CD7 CD86 Fc?RI? TIM3 CD7 CD86 Fc?RI? TIM3 CD7 CD86 DAP10 TIM3 CD7 CD86 DAP12 TIM3 CD7 CD86 CD32 TIM3 CD7 CD86 CD79a TIM3 CD7 CD86 CD79b TIM3 CD7 OX40 CD8 TIM3 CD7 OX40 CD3? TIM3 CD7 OX40 CD3? TIM3 CD7 OX40 CD3? TIM3 CD7 OX40 CD3? TIM3 CD7 OX40 Fc?RI-? TIM3 CD7 OX40 Fc?RIII-? TIM3 CD7 OX40 Fc?RI? TIM3 CD7 OX40 Fc?RI? TIM3 CD7 OX40 DAP10 TIM3 CD7 OX40 DAP12 TIM3 CD7 OX40 CD32 TIM3 CD7 OX40 CD79a TIM3 CD7 OX40 CD79b TIM3 CD7 DAP10 CD8 TIM3 CD7 DAP10 CD3? TIM3 CD7 DAP10 CD3? TIM3 CD7 DAP10 CD3? TIM3 CD7 DAP10 CD3? TIM3 CD7 DAP10 Fc?RI-? TIM3 CD7 DAP10 Fc?RIII-? TIM3 CD7 DAP10 Fc?RI? TIM3 CD7 DAP10 Fc?RI? TIM3 CD7 DAP10 DAP10 TIM3 CD7 DAP10 DAP12 TIM3 CD7 DAP10 CD32 TIM3 CD7 DAP10 CD79a TIM3 CD7 DAP10 CD79b TIM3 CD7 DAP12 CD8 TIM3 CD7 DAP12 CD3? TIM3 CD7 DAP12 CD3? TIM3 CD7 DAP12 CD3? TIM3 CD7 DAP12 CD3? TIM3 CD7 DAP12 Fc?RI-? TIM3 CD7 DAP12 Fc?RIII-? TIM3 CD7 DAP12 Fc?RI? TIM3 CD7 DAP12 Fc?RI? TIM3 CD7 DAP12 DAP10 TIM3 CD7 DAP12 DAP12 TIM3 CD7 DAP12 CD32 TIM3 CD7 DAP12 CD79a TIM3 CD7 DAP12 CD79b TIM3 CD7 MyD88 CD8 TIM3 CD7 MyD88 CD3? TIM3 CD7 MyD88 CD3? TIM3 CD7 MyD88 CD3? TIM3 CD7 MyD88 CD3? TIM3 CD7 MyD88 Fc?RI-? TIM3 CD7 MyD88 Fc?RIII-? TIM3 CD7 MyD88 Fc?RI? TIM3 CD7 MyD88 Fc?RI? TIM3 CD7 MyD88 DAP10 TIM3 CD7 MyD88 DAP12 TIM3 CD7 MyD88 CD32 TIM3 CD7 MyD88 CD79a TIM3 CD7 MyD88 CD79b TIM3 CD7 CD7 CD8 TIM3 CD7 CD7 CD3? TIM3 CD7 CD7 CD3? TIM3 CD7 CD7 CD3? TIM3 CD7 CD7 CD3? TIM3 CD7 CD7 Fc?RI-? TIM3 CD7 CD7 Fc?RIII-? TIM3 CD7 CD7 Fc?RI? TIM3 CD7 CD7 Fc?RI? TIM3 CD7 CD7 DAP10 TIM3 CD7 CD7 DAP12 TIM3 CD7 CD7 CD32 TIM3 CD7 CD7 CD79a TIM3 CD7 CD7 CD79b TIM3 CD7 BTNL3 CD8 TIM3 CD7 BTNL3 CD3? TIM3 CD7 BTNL3 CD3? TIM3 CD7 BTNL3 CD3? TIM3 CD7 BTNL3 CD3? TIM3 CD7 BTNL3 Fc?RI-? TIM3 CD7 BTNL3 Fc?RIII-? TIM3 CD7 BTNL3 Fc?RI? TIM3 CD7 BTNL3 Fc?RI? TIM3 CD7 BTNL3 DAP10 TIM3 CD7 BTNL3 DAP12 TIM3 CD7 BTNL3 CD32 TIM3 CD7 BTNL3 CD79a TIM3 CD7 BTNL3 CD79b TIM3 CD7 NKG2D CD8 TIM3 CD7 NKG2D CD3? TIM3 CD7 NKG2D CD3? TIM3 CD7 NKG2D CD3? TIM3 CD7 NKG2D CD3? TIM3 CD7 NKG2D Fc?RI-? TIM3 CD7 NKG2D Fc?RIII-? TIM3 CD7 NKG2D Fc?RI? TIM3 CD7 NKG2D Fc?RI? TIM3 CD7 NKG2D DAP10 TIM3 CD7 NKG2D DAP12 TIM3 CD7 NKG2D CD32 TIM3 CD7 NKG2D CD79a TIM3 CD7 NKG2D CD79b TIM3 BTNL3 CD28 CD8 TIM3 BTNL3 CD28 CD3? TIM3 BTNL3 CD28 CD3? TIM3 BTNL3 CD28 CD3? TIM3 BTNL3 CD28 CD3? TIM3 BTNL3 CD28 Fc?RI-? TIM3 BTNL3 CD28 Fc?RIII-? TIM3 BTNL3 CD28 Fc?RI? TIM3 BTNL3 CD28 Fc?RI? TIM3 BTNL3 CD28 DAP10 TIM3 BTNL3 CD28 DAP12 TIM3 BTNL3 CD28 CD32 TIM3 BTNL3 CD28 CD79a TIM3 BTNL3 CD28 CD79b TIM3 BTNL3 CD8 CD8 TIM3 BTNL3 CD8 CD3? TIM3 BTNL3 CD8 CD3? TIM3 BTNL3 CD8 CD3? TIM3 BTNL3 CD8 CD3? TIM3 BTNL3 CD8 Fc?RI-? TIM3 BTNL3 CD8 Fc?RIII-? TIM3 BTNL3 CD8 Fc?RI? TIM3 BTNL3 CD8 Fc?RI? TIM3 BTNL3 CD8 DAP10 TIM3 BTNL3 CD8 DAP12 TIM3 BTNL3 CD8 CD32 TIM3 BTNL3 CD8 CD79a TIM3 BTNL3 CD8 CD79b TIM3 BTNL3 CD4 CD8 TIM3 BTNL3 CD4 CD3? TIM3 BTNL3 CD4 CD3? TIM3 BTNL3 CD4 CD3? TIM3 BTNL3 CD4 CD3? TIM3 BTNL3 CD4 Fc?RI-? TIM3 BTNL3 CD4 Fc?RIII-? TIM3 BTNL3 CD4 Fc?RI? TIM3 BTNL3 CD4 Fc?RI? TIM3 BTNL3 CD4 DAP10 TIM3 BTNL3 CD4 DAP12 TIM3 BTNL3 CD4 CD32 TIM3 BTNL3 CD4 CD79a TIM3 BTNL3 CD4 CD79b TIM3 BTNL3 b2c CD8 TIM3 BTNL3 b2c CD3? TIM3 BTNL3 b2c CD3? TIM3 BTNL3 b2c CD3? TIM3 BTNL3 b2c CD3? TIM3 BTNL3 b2c Fc?RI-? TIM3 BTNL3 b2c Fc?RIII-? TIM3 BTNL3 b2c Fc?RI? TIM3 BTNL3 b2c Fc?RI? TIM3 BTNL3 b2c DAP10 TIM3 BTNL3 b2c DAP12 TIM3 BTNL3 b2c CD32 TIM3 BTNL3 b2c CD79a TIM3 BTNL3 b2c CD79b TIM3 BTNL3 CD137/41BB CD8 TIM3 BTNL3 CD137/41BB CD3? TIM3 BTNL3 CD137/41BB CD3? TIM3 BTNL3 CD137/41BB CD3? TIM3 BTNL3 CD137/41BB CD3? TIM3 BTNL3 CD137/41BB Fc?RI-? TIM3 BTNL3 CD137/41BB Fc?RIII-? TIM3 BTNL3 CD137/41BB Fc?RI? TIM3 BTNL3 CD137/41BB Fc?RI? TIM3 BTNL3 CD137/41BB DAP10 TIM3 BTNL3 CD137/41BB DAP12 TIM3 BTNL3 CD137/41BB CD32 TIM3 BTNL3 CD137/41BB CD79a TIM3 BTNL3 CD137/41BB CD79b TIM3 BTNL3 ICOS CD8 TIM3 BTNL3 ICOS CD3? TIM3 BTNL3 ICOS CD3? TIM3 BTNL3 ICOS CD3? TIM3 BTNL3 ICOS CD3? TIM3 BTNL3 ICOS Fc?RI-? TIM3 BTNL3 ICOS Fc?RIII-? TIM3 BTNL3 ICOS Fc?RI? TIM3 BTNL3 ICOS Fc?RI? TIM3 BTNL3 ICOS DAP10 TIM3 BTNL3 ICOS DAP12 TIM3 BTNL3 ICOS CD32 TIM3 BTNL3 ICOS CD79a TIM3 BTNL3 ICOS CD79b TIM3 BTNL3 CD27 CD8 TIM3 BTNL3 CD27 CD3? TIM3 BTNL3 CD27 CD3? TIM3 BTNL3 CD27 CD3? TIM3 BTNL3 CD27 CD3? TIM3 BTNL3 CD27 Fc?RI-? TIM3 BTNL3 CD27 Fc?RIII-? TIM3 BTNL3 CD27 Fc?RI? TIM3 BTNL3 CD27 Fc?RI? TIM3 BTNL3 CD27 DAP10 TIM3 BTNL3 CD27 DAP12 TIM3 BTNL3 CD27 CD32 TIM3 BTNL3 CD27 CD79a TIM3 BTNL3 CD27 CD79b TIM3 BTNL3 CD28? CD8 TIM3 BTNL3 CD28? CD3? TIM3 BTNL3 CD28? CD3? TIM3 BTNL3 CD28? CD3? TIM3 BTNL3 CD28? CD3? TIM3 BTNL3 CD28? Fc?RI-? TIM3 BTNL3 CD28? Fc?RIII-? TIM3 BTNL3 CD28? Fc?RI? TIM3 BTNL3 CD28? Fc?RI? TIM3 BTNL3 CD28? DAP10 TIM3 BTNL3 CD28? DAP12 TIM3 BTNL3 CD28? CD32 TIM3 BTNL3 CD28? CD79a TIM3 BTNL3 CD28? CD79b TIM3 BTNL3 CD80 CD8 TIM3 BTNL3 CD80 CD3? TIM3 BTNL3 CD80 CD3? TIM3 BTNL3 CD80 CD3? TIM3 BTNL3 CD80 CD3? TIM3 BTNL3 CD80 Fc?RI-? TIM3 BTNL3 CD80 Fc?RIII-? TIM3 BTNL3 CD80 Fc?RI? TIM3 BTNL3 CD80 Fc?RI? TIM3 BTNL3 CD80 DAP10 TIM3 BTNL3 CD80 DAP12 TIM3 BTNL3 CD80 CD32 TIM3 BTNL3 CD80 CD79a TIM3 BTNL3 CD80 CD79b TIM3 BTNL3 CD86 CD8 TIM3 BTNL3 CD86 CD3? TIM3 BTNL3 CD86 CD3? TIM3 BTNL3 CD86 CD3? TIM3 BTNL3 CD86 CD3? TIM3 BTNL3 CD86 Fc?RI-? TIM3 BTNL3 CD86 Fc?RIII-? TIM3 BTNL3 CD86 Fc?RI? TIM3 BTNL3 CD86 Fc?RI? TIM3 BTNL3 CD86 DAP10 TIM3 BTNL3 CD86 DAP12 TIM3 BTNL3 CD86 CD32 TIM3 BTNL3 CD86 CD79a TIM3 BTNL3 CD86 CD79b TIM3 BTNL3 OX40 CD8 TIM3 BTNL3 OX40 CD3? TIM3 BTNL3 OX40 CD3? TIM3 BTNL3 OX40 CD3? TIM3 BTNL3 OX40 CD3? TIM3 BTNL3 OX40 Fc?RI-? TIM3 BTNL3 OX40 Fc?RIII-? TIM3 BTNL3 OX40 Fc?RI? TIM3 BTNL3 OX40 Fc?RI? TIM3 BTNL3 OX40 DAP10 TIM3 BTNL3 OX40 DAP12 TIM3 BTNL3 OX40 CD32 TIM3 BTNL3 OX40 CD79a TIM3 BTNL3 OX40 CD79b TIM3 BTNL3 DAP10 CD8 TIM3 BTNL3 DAP10 CD3? TIM3 BTNL3 DAP10 CD3? TIM3 BTNL3 DAP10 CD3? TIM3 BTNL3 DAP10 CD3? TIM3 BTNL3 DAP10 Fc?RI-? TIM3 BTNL3 DAP10 Fc?RIII-? TIM3 BTNL3 DAP10 Fc?RI? TIM3 BTNL3 DAP10 Fc?RI? TIM3 BTNL3 DAP10 DAP10 TIM3 BTNL3 DAP10 DAP12 TIM3 BTNL3 DAP10 CD32 TIM3 BTNL3 DAP10 CD79a TIM3 BTNL3 DAP10 CD79b TIM3 BTNL3 DAP12 CD8 TIM3 BTNL3 DAP12 CD3? TIM3 BTNL3 DAP12 CD3? TIM3 BTNL3 DAP12 CD3? TIM3 BTNL3 DAP12 CD3? TIM3 BTNL3 DAP12 Fc?RI-? TIM3 BTNL3 DAP12 Fc?RIII-? TIM3 BTNL3 DAP12 Fc?RI? TIM3 BTNL3 DAP12 Fc?RI? TIM3 BTNL3 DAP12 DAP10 TIM3 BTNL3 DAP12 DAP12 TIM3 BTNL3 DAP12 CD32 TIM3 BTNL3 DAP12 CD79a TIM3 BTNL3 DAP12 CD79b TIM3 BTNL3 MyD88 CD8 TIM3 BTNL3 MyD88 CD3? TIM3 BTNL3 MyD88 CD3? TIM3 BTNL3 MyD88 CD3? TIM3 BTNL3 MyD88 CD3? TIM3 BTNL3 MyD88 Fc?RI-? TIM3 BTNL3 MyD88 Fc?RIII-? TIM3 BTNL3 MyD88 Fc?RI? TIM3 BTNL3 MyD88 Fc?RI? TIM3 BTNL3 MyD88 DAP10 TIM3 BTNL3 MyD88 DAP12 TIM3 BTNL3 MyD88 CD32 TIM3 BTNL3 MyD88 CD79a TIM3 BTNL3 MyD88 CD79b TIM3 BTNL3 CD7 CD8 TIM3 BTNL3 CD7 CD3? TIM3 BTNL3 CD7 CD3? TIM3 BTNL3 CD7 CD3? TIM3 BTNL3 CD7 CD3? TIM3 BTNL3 CD7 Fc?RI-? TIM3 BTNL3 CD7 Fc?RIII-? TIM3 BTNL3 CD7 Fc?RI? TIM3 BTNL3 CD7 Fc?RI? TIM3 BTNL3 CD7 DAP10 TIM3 BTNL3 CD7 DAP12 TIM3 BTNL3 CD7 CD32 TIM3 BTNL3 CD7 CD79a TIM3 BTNL3 CD7 CD79b TIM3 BTNL3 BTNL3 CD8 TIM3 BTNL3 BTNL3 CD3? TIM3 BTNL3 BTNL3 CD3? TIM3 BTNL3 BTNL3 CD3? TIM3 BTNL3 BTNL3 CD3? TIM3 BTNL3 BTNL3 Fc?RI-? TIM3 BTNL3 BTNL3 Fc?RIII-? TIM3 BTNL3 BTNL3 Fc?RI? TIM3 BTNL3 BTNL3 Fc?RI? TIM3 BTNL3 BTNL3 DAP10 TIM3 BTNL3 BTNL3 DAP12 TIM3 BTNL3 BTNL3 CD32 TIM3 BTNL3 BTNL3 CD79a TIM3 BTNL3 BTNL3 CD79b TIM3 BTNL3 NKG2D CD8 TIM3 BTNL3 NKG2D CD3? TIM3 BTNL3 NKG2D CD3? TIM3 BTNL3 NKG2D CD3? TIM3 BTNL3 NKG2D CD3? TIM3 BTNL3 NKG2D Fc?RI-? TIM3 BTNL3 NKG2D Fc?RIII-? TIM3 BTNL3 NKG2D Fc?RI? TIM3 BTNL3 NKG2D Fc?RI? TIM3 BTNL3 NKG2D DAP10 TIM3 BTNL3 NKG2D DAP12 TIM3 BTNL3 NKG2D CD32 TIM3 BTNL3 NKG2D CD79a TIM3 BTNL3 NKG2D CD79b TIM3 NKG2D CD28 CD8 TIM3 NKG2D CD28 CD3? TIM3 NKG2D CD28 CD3? TIM3 NKG2D CD28 CD3? TIM3 NKG2D CD28 CD3? TIM3 NKG2D CD28 Fc?RI-? TIM3 NKG2D CD28 Fc?RIII-? TIM3 NKG2D CD28 Fc?RI? TIM3 NKG2D CD28 Fc?RI? TIM3 NKG2D CD28 DAP10 TIM3 NKG2D CD28 DAP12 TIM3 NKG2D CD28 CD32 TIM3 NKG2D CD28 CD79a TIM3 NKG2D CD28 CD79b TIM3 NKG2D CD8 CD8 TIM3 NKG2D CD8 CD3? TIM3 NKG2D CD8 CD3? TIM3 NKG2D CD8 CD3? TIM3 NKG2D CD8 CD3? TIM3 NKG2D CD8 Fc?RI-? TIM3 NKG2D CD8 Fc?RIII-? TIM3 NKG2D CD8 Fc?RI? TIM3 NKG2D CD8 Fc?RI? TIM3 NKG2D CD8 DAP10 TIM3 NKG2D CD8 DAP12 TIM3 NKG2D CD8 CD32 TIM3 NKG2D CD8 CD79a TIM3 NKG2D CD8 CD79b TIM3 NKG2D CD4 CD8 TIM3 NKG2D CD4 CD3? TIM3 NKG2D CD4 CD3? TIM3 NKG2D CD4 CD3? TIM3 NKG2D CD4 CD3? TIM3 NKG2D CD4 Fc?RI-? TIM3 NKG2D CD4 Fc?RIII-? TIM3 NKG2D CD4 Fc?RI? TIM3 NKG2D CD4 Fc?RI? TIM3 NKG2D CD4 DAP10 TIM3 NKG2D CD4 DAP12 TIM3 NKG2D CD4 CD32 TIM3 NKG2D CD4 CD79a TIM3 NKG2D CD4 CD79b TIM3 NKG2D b2c CD8 TIM3 NKG2D b2c CD3? TIM3 NKG2D b2c CD3? TIM3 NKG2D b2c CD3? TIM3 NKG2D b2c CD3? TIM3 NKG2D b2c Fc?RI-? TIM3 NKG2D b2c Fc?RIII-? TIM3 NKG2D b2c Fc?RI? TIM3 NKG2D b2c Fc?RI? TIM3 NKG2D b2c DAP10 TIM3 NKG2D b2c DAP12 TIM3 NKG2D b2c CD32 TIM3 NKG2D b2c CD79a TIM3 NKG2D b2c CD79b TIM3 NKG2D CD137/41BB CD8 TIM3 NKG2D CD137/41BB CD3? TIM3 NKG2D CD137/41BB CD3? TIM3 NKG2D CD137/41BB CD3? TIM3 NKG2D CD137/41BB CD3? TIM3 NKG2D CD137/41BB Fc?RI-? TIM3 NKG2D CD137/41BB Fc?RIII-? TIM3 NKG2D CD137/41BB Fc?RI? TIM3 NKG2D CD137/41BB Fc?RI? TIM3 NKG2D CD137/41BB DAP10 TIM3 NKG2D CD137/41BB DAP12 TIM3 NKG2D CD137/41BB CD32 TIM3 NKG2D CD137/41BB CD79a TIM3 NKG2D CD137/41BB CD79b TIM3 NKG2D ICOS CD8 TIM3 NKG2D ICOS CD3? TIM3 NKG2D ICOS CD3? TIM3 NKG2D ICOS CD3? TIM3 NKG2D ICOS CD3? TIM3 NKG2D ICOS Fc?RI-? TIM3 NKG2D ICOS Fc?RIII-? TIM3 NKG2D ICOS Fc?RI? TIM3 NKG2D ICOS Fc?RI? TIM3 NKG2D ICOS DAP10 TIM3 NKG2D ICOS DAP12 TIM3 NKG2D ICOS CD32 TIM3 NKG2D ICOS CD79a TIM3 NKG2D ICOS CD79b TIM3 NKG2D CD27 CD8 TIM3 NKG2D CD27 CD3? TIM3 NKG2D CD27 CD3? TIM3 NKG2D CD27 CD3? TIM3 NKG2D CD27 CD3? TIM3 NKG2D CD27 Fc?RI-? TIM3 NKG2D CD27 Fc?RIII-? TIM3 NKG2D CD27 Fc?RI? TIM3 NKG2D CD27 Fc?RI? TIM3 NKG2D CD27 DAP10 TIM3 NKG2D CD27 DAP12 TIM3 NKG2D CD27 CD32 TIM3 NKG2D CD27 CD79a TIM3 NKG2D CD27 CD79b TIM3 NKG2D CD28? CD8 TIM3 NKG2D CD28? CD3? TIM3 NKG2D CD28? CD3? TIM3 NKG2D CD28? CD3? TIM3 NKG2D CD28? CD3? TIM3 NKG2D CD28? Fc?RI-? TIM3 NKG2D CD28? Fc?RIII-? TIM3 NKG2D CD28? Fc?RI? TIM3 NKG2D CD28? Fc?RI? TIM3 NKG2D CD28? DAP10 TIM3 NKG2D CD28? DAP12 TIM3 NKG2D CD28? CD32 TIM3 NKG2D CD28? CD79a TIM3 NKG2D CD28? CD79b TIM3 NKG2D CD80 CD8 TIM3 NKG2D CD80 CD3? TIM3 NKG2D CD80 CD3? TIM3 NKG2D CD80 CD3? TIM3 NKG2D CD80 CD3? TIM3 NKG2D CD80 Fc?RI-? TIM3 NKG2D CD80 Fc?RIII-? TIM3 NKG2D CD80 Fc?RI? TIM3 NKG2D CD80 Fc?RI? TIM3 NKG2D CD80 DAP10 TIM3 NKG2D CD80 DAP12 TIM3 NKG2D CD80 CD32 TIM3 NKG2D CD80 CD79a TIM3 NKG2D CD80 CD79b TIM3 NKG2D CD86 CD8 TIM3 NKG2D CD86 CD3? TIM3 NKG2D CD86 CD3? TIM3 NKG2D CD86 CD3? TIM3 NKG2D CD86 CD3? TIM3 NKG2D CD86 Fc?RI-? TIM3 NKG2D CD86 Fc?RIII-? TIM3 NKG2D CD86 Fc?RI? TIM3 NKG2D CD86 Fc?RI? TIM3 NKG2D CD86 DAP10 TIM3 NKG2D CD86 DAP12 TIM3 NKG2D CD86 CD32 TIM3 NKG2D CD86 CD79a TIM3 NKG2D CD86 CD79b TIM3 NKG2D OX40 CD8 TIM3 NKG2D OX40 CD3? TIM3 NKG2D OX40 CD3? TIM3 NKG2D OX40 CD3? TIM3 NKG2D OX40 CD3? TIM3 NKG2D OX40 Fc?RI-? TIM3 NKG2D OX40 Fc?RIII-? TIM3 NKG2D OX40 Fc?RI? TIM3 NKG2D OX40 Fc?RI? TIM3 NKG2D OX40 DAP10 TIM3 NKG2D OX40 DAP12 TIM3 NKG2D OX40 CD32 TIM3 NKG2D OX40 CD79a TIM3 NKG2D OX40 CD79b TIM3 NKG2D DAP10 CD8 TIM3 NKG2D DAP10 CD3? TIM3 NKG2D DAP10 CD3? TIM3 NKG2D DAP10 CD3? TIM3 NKG2D DAP10 CD3? TIM3 NKG2D DAP10 Fc?RI-? TIM3 NKG2D DAP10 Fc?RIII-? TIM3 NKG2D DAP10 Fc?RI? TIM3 NKG2D DAP10 Fc?RI? TIM3 NKG2D DAP10 DAP10 TIM3 NKG2D DAP10 DAP12 TIM3 NKG2D DAP10 CD32 TIM3 NKG2D DAP10 CD79a TIM3 NKG2D DAP10 CD79b TIM3 NKG2D DAP12 CD8 TIM3 NKG2D DAP12 CD3? TIM3 NKG2D DAP12 CD3? TIM3 NKG2D DAP12 CD3? TIM3 NKG2D DAP12 CD3? TIM3 NKG2D DAP12 Fc?RI-? TIM3 NKG2D DAP12 Fc?RIII-? TIM3 NKG2D DAP12 Fc?RI? TIM3 NKG2D DAP12 Fc?RI? TIM3 NKG2D DAP12 DAP10 TIM3 NKG2D DAP12 DAP12 TIM3 NKG2D DAP12 CD32 TIM3 NKG2D DAP12 CD79a TIM3 NKG2D DAP12 CD79b TIM3 NKG2D MyD88 CD8 TIM3 NKG2D MyD88 CD3? TIM3 NKG2D MyD88 CD3? TIM3 NKG2D MyD88 CD3? TIM3 NKG2D MyD88 CD3? TIM3 NKG2D MyD88 Fc?RI-? TIM3 NKG2D MyD88 Fc?RIII-? TIM3 NKG2D MyD88 Fc?RI? TIM3 NKG2D MyD88 Fc?RI? TIM3 NKG2D MyD88 DAP10 TIM3 NKG2D MyD88 DAP12 TIM3 NKG2D MyD88 CD32 TIM3 NKG2D MyD88 CD79a TIM3 NKG2D MyD88 CD79b TIM3 NKG2D CD7 CD8 TIM3 NKG2D CD7 CD3? TIM3 NKG2D CD7 CD3? TIM3 NKG2D CD7 CD3? TIM3 NKG2D CD7 CD3? TIM3 NKG2D CD7 Fc?RI-? TIM3 NKG2D CD7 Fc?RIII-? TIM3 NKG2D CD7 Fc?RI? TIM3 NKG2D CD7 Fc?RI? TIM3 NKG2D CD7 DAP10 TIM3 NKG2D CD7 DAP12 TIM3 NKG2D CD7 CD32 TIM3 NKG2D CD7 CD79a TIM3 NKG2D CD7 CD79b TIM3 NKG2D BTNL3 CD8 TIM3 NKG2D BTNL3 CD3? TIM3 NKG2D BTNL3 CD3? TIM3 NKG2D BTNL3 CD3? TIM3 NKG2D BTNL3 CD3? TIM3 NKG2D BTNL3 Fc?RI-? TIM3 NKG2D BTNL3 Fc?RIII-? TIM3 NKG2D BTNL3 Fc?RI? TIM3 NKG2D BTNL3 Fc?RI? TIM3 NKG2D BTNL3 DAP10 TIM3 NKG2D BTNL3 DAP12 TIM3 NKG2D BTNL3 CD32 TIM3 NKG2D BTNL3 CD79a TIM3 NKG2D BTNL3 CD79b TIM3 NKG2D NKG2D CD8 TIM3 NKG2D NKG2D CD3? TIM3 NKG2D NKG2D CD3? TIM3 NKG2D NKG2D CD3? TIM3 NKG2D NKG2D CD3? TIM3 NKG2D NKG2D Fc?RI-? TIM3 NKG2D NKG2D Fc?RIII-? TIM3 NKG2D NKG2D Fc?RI? TIM3 NKG2D NKG2D Fc?RI? TIM3 NKG2D NKG2D DAP10 TIM3 NKG2D NKG2D DAP12 TIM3 NKG2D NKG2D CD32 TIM3 NKG2D NKG2D CD79a TIM3 NKG2D NKG2D CD79b

    TABLE-US-00004 TABLE 4 CARs lacking Co-Simulatory Signal (for dual CAR approach) ScFv Co-stimulatory Signal Signal Domain TIM3 none CD8 TIM3 none CD3? TIM3 none CD3? TIM3 none CD3? TIM3 none CD3? TIM3 none Fc?RI-? TIM3 none Fc?RIII-? TIM3 none Fc?RI? TIM3 none Fc?RI? TIM3 none DAP10 TIM3 none DAP12 TIM3 none CD32 TIM3 none CD79a TIM3 none CD8 TIM3 none CD3? TIM3 none CD3? TIM3 none CD3? TIM3 none CD3? TIM3 none Fc?RI-?

    TABLE-US-00005 TABLE 5 CARs lacking Signal Domain (for dual CAR approach) ScFv Co-stimulatory Signal Signal Domain TIM3 CD28 none TIM3 CD8 none TIM3 CD4 none TIM3 b2c none TIM3 CD137/41BB none TIM3 ICOS none TIM3 CD27 none TIM3 CD28? none TIM3 CD80 none TIM3 CD86 none TIM3 OX40 none TIM3 DAP10 none TIM3 MyD88 none TIM3 CD7 none TIM3 DAP12 none TIM3 MyD88 none TIM3 CD7 none TIM3 BTNL3 none TIM3 NKG2D none

    TABLE-US-00006 TABLE 6 Third Generation CARs lacking Signal Domain (for dual CAR approach) Co-stimulatory Co-stimulatory Signal ScFv Signal Signal Domain TIM3 CD28 CD28 none TIM3 CD28 CD8 none TIM3 CD28 CD4 none TIM3 CD28 b2c none TIM3 CD28 CD137/41BB none TIM3 CD28 ICOS none TIM3 CD28 CD27 none TIM3 CD28 CD28? none TIM3 CD28 CD80 none TIM3 CD28 CD86 none TIM3 CD28 OX40 none TIM3 CD28 DAP10 none TIM3 CD28 MyD88 none TIM3 CD28 CD7 none TIM3 CD28 DAP12 none TIM3 CD28 MyD88 none TIM3 CD28 CD7 none TIM3 CD8 CD28 none TIM3 CD8 CD8 none TIM3 CD8 CD4 none TIM3 CD8 b2c none TIM3 CD8 CD137/41BB none TIM3 CD8 ICOS none TIM3 CD8 CD27 none TIM3 CD8 CD28? none TIM3 CD8 CD80 none TIM3 CD8 CD86 none TIM3 CD8 OX40 none TIM3 CD8 DAP10 none TIM3 CD8 MyD88 none TIM3 CD8 CD7 none TIM3 CD8 DAP12 none TIM3 CD8 MyD88 none TIM3 CD8 CD7 none TIM3 CD4 CD28 none TIM3 CD4 CD8 none TIM3 CD4 CD4 none TIM3 CD4 b2c none TIM3 CD4 CD137/41BB none TIM3 CD4 ICOS none TIM3 CD4 CD27 none TIM3 CD4 CD28? none TIM3 CD4 CD80 none TIM3 CD4 CD86 none TIM3 CD4 OX40 none TIM3 CD4 DAP10 none TIM3 CD4 MyD88 none TIM3 CD4 CD7 none TIM3 CD4 DAP12 none TIM3 CD4 MyD88 none TIM3 CD4 CD7 none TIM3 b2c CD28 none TIM3 b2c CD8 none TIM3 b2c CD4 none TIM3 b2c b2c none TIM3 b2c CD137/41BB none TIM3 b2c ICOS none TIM3 b2c CD27 none TIM3 b2c CD28? none TIM3 b2c CD80 none TIM3 b2c CD86 none TIM3 b2c OX40 none TIM3 b2c DAP10 none TIM3 b2c MyD88 none TIM3 b2c CD7 none TIM3 b2c DAP12 none TIM3 b2c MyD88 none TIM3 b2c CD7 none TIM3 CD137/41BB CD28 none TIM3 CD137/41BB CD8 none TIM3 CD137/41BB CD4 none TIM3 CD137/41BB b2c none TIM3 CD137/41BB CD137/41BB none TIM3 CD137/41BB ICOS none TIM3 CD137/41BB CD27 none TIM3 CD137/41BB CD28? none TIM3 CD137/41BB CD80 none TIM3 CD137/41BB CD86 none TIM3 CD137/41BB OX40 none TIM3 CD137/41BB DAP10 none TIM3 CD137/41BB MyD88 none TIM3 CD137/41BB CD7 none TIM3 CD137/41BB DAP12 none TIM3 CD137/41BB MyD88 none TIM3 CD137/41BB CD7 none TIM3 ICOS CD28 none TIM3 ICOS CD8 none TIM3 ICOS CD4 none TIM3 ICOS b2c none TIM3 ICOS CD137/41BB none TIM3 ICOS ICOS none TIM3 ICOS CD27 none TIM3 ICOS CD28? none TIM3 ICOS CD80 none TIM3 ICOS CD86 none TIM3 ICOS OX40 none TIM3 ICOS DAP10 none TIM3 ICOS MyD88 none TIM3 ICOS CD7 none TIM3 ICOS DAP12 none TIM3 ICOS MyD88 none TIM3 ICOS CD7 none TIM3 ICOS CD28 none TIM3 ICOS CD8 none TIM3 ICOS CD4 none TIM3 ICOS b2c none TIM3 ICOS CD137/41BB none TIM3 ICOS ICOS none TIM3 ICOS CD27 none TIM3 ICOS CD28? none TIM3 ICOS CD80 none TIM3 ICOS CD86 none TIM3 ICOS OX40 none TIM3 ICOS DAP10 none TIM3 ICOS MyD88 none TIM3 ICOS CD7 none TIM3 ICOS DAP12 none TIM3 ICOS MyD88 none TIM3 ICOS CD7 none TIM3 CD27 CD28 none TIM3 CD27 CD8 none TIM3 CD27 CD4 none TIM3 CD27 b2c none TIM3 CD27 CD137/41BB none TIM3 CD27 ICOS none TIM3 CD27 CD27 none TIM3 CD27 CD28? none TIM3 CD27 CD80 none TIM3 CD27 CD86 none TIM3 CD27 OX40 none TIM3 CD27 DAP10 none TIM3 CD27 MyD88 none TIM3 CD27 CD7 none TIM3 CD27 DAP12 none TIM3 CD27 MyD88 none TIM3 CD27 CD7 none TIM3 CD28? CD28 none TIM3 CD28? CD8 none TIM3 CD28? CD4 none TIM3 CD28? b2c none TIM3 CD28? CD137/41BB none TIM3 CD28? ICOS none TIM3 CD28? CD27 none TIM3 CD28? CD28? none TIM3 CD28? CD80 none TIM3 CD28? CD86 none TIM3 CD28? OX40 none TIM3 CD28? DAP10 none TIM3 CD28? MyD88 none TIM3 CD28? CD7 none TIM3 CD28? DAP12 none TIM3 CD28? MyD88 none TIM3 CD28? CD7 none TIM3 CD80 CD28 none TIM3 CD80 CD8 none TIM3 CD80 CD4 none TIM3 CD80 b2c none TIM3 CD80 CD137/41BB none TIM3 CD80 ICOS none TIM3 CD80 CD27 none TIM3 CD80 CD28? none TIM3 CD80 CD80 none TIM3 CD80 CD86 none TIM3 CD80 OX40 none TIM3 CD80 DAP10 none TIM3 CD80 MyD88 none TIM3 CD80 CD7 none TIM3 CD80 DAP12 none TIM3 CD80 MyD88 none TIM3 CD80 CD7 none TIM3 CD86 CD28 none TIM3 CD86 CD8 none TIM3 CD86 CD4 none TIM3 CD86 b2c none TIM3 CD86 CD137/41BB none TIM3 CD86 ICOS none TIM3 CD86 CD27 none TIM3 CD86 CD28? none TIM3 CD86 CD80 none TIM3 CD86 CD86 none TIM3 CD86 OX40 none TIM3 CD86 DAP10 none TIM3 CD86 MyD88 none TIM3 CD86 CD7 none TIM3 CD86 DAP12 none TIM3 CD86 MyD88 none TIM3 CD86 CD7 none TIM3 OX40 CD28 none TIM3 OX40 CD8 none TIM3 OX40 CD4 none TIM3 OX40 b2c none TIM3 OX40 CD137/41BB none TIM3 OX40 ICOS none TIM3 OX40 CD27 none TIM3 OX40 CD28? none TIM3 OX40 CD80 none TIM3 OX40 CD86 none TIM3 OX40 OX40 none TIM3 OX40 DAP10 none TIM3 OX40 MyD88 none TIM3 OX40 CD7 none TIM3 OX40 DAP12 none TIM3 OX40 MyD88 none TIM3 OX40 CD7 none TIM3 DAP10 CD28 none TIM3 DAP10 CD8 none TIM3 DAP10 CD4 none TIM3 DAP10 b2c none TIM3 DAP10 CD137/41BB none TIM3 DAP10 ICOS none TIM3 DAP10 CD27 none TIM3 DAP10 CD28? none TIM3 DAP10 CD80 none TIM3 DAP10 CD86 none TIM3 DAP10 OX40 none TIM3 DAP10 DAP10 none TIM3 DAP10 MyD88 none TIM3 DAP10 CD7 none TIM3 DAP10 DAP12 none TIM3 DAP10 MyD88 none TIM3 DAP10 CD7 none TIM3 DAP12 CD28 none TIM3 DAP12 CD8 none TIM3 DAP12 CD4 none TIM3 DAP12 b2c none TIM3 DAP12 CD137/41BB none TIM3 DAP12 ICOS none TIM3 DAP12 CD27 none TIM3 DAP12 CD28? none TIM3 DAP12 CD80 none TIM3 DAP12 CD86 none TIM3 DAP12 OX40 none TIM3 DAP12 DAP10 none TIM3 DAP12 MyD88 none TIM3 DAP12 CD7 none TIM3 DAP12 DAP12 none TIM3 DAP12 MyD88 none TIM3 DAP12 CD7 none TIM3 MyD88 CD28 none TIM3 MyD88 CD8 none TIM3 MyD88 CD4 none TIM3 MyD88 b2c none TIM3 MyD88 CD137/41BB none TIM3 MyD88 ICOS none TIM3 MyD88 CD27 none TIM3 MyD88 CD28? none TIM3 MyD88 CD80 none TIM3 MyD88 CD86 none TIM3 MyD88 OX40 none TIM3 MyD88 DAP10 none TIM3 MyD88 MyD88 none TIM3 MyD88 CD7 none TIM3 MyD88 DAP12 none TIM3 MyD88 MyD88 none TIM3 MyD88 CD7 none TIM3 CD7 CD28 none TIM3 CD7 CD8 none TIM3 CD7 CD4 none TIM3 CD7 b2c none TIM3 CD7 CD137/41BB none TIM3 CD7 ICOS none TIM3 CD7 CD27 none TIM3 CD7 CD28? none TIM3 CD7 CD80 none TIM3 CD7 CD86 none TIM3 CD7 OX40 none TIM3 CD7 DAP10 none TIM3 CD7 MyD88 none TIM3 CD7 CD7 none TIM3 CD7 DAP12 none TIM3 CD7 MyD88 none TIM3 CD7 CD7 none TIM3 BTNL3 CD28 none TIM3 BTNL3 CD8 none TIM3 BTNL3 CD4 none TIM3 BTNL3 b2c none TIM3 BTNL3 CD137/41BB none TIM3 BTNL3 ICOS none TIM3 BTNL3 CD27 none TIM3 BTNL3 CD28? none TIM3 BTNL3 CD80 none TIM3 BTNL3 CD86 none TIM3 BTNL3 OX40 none TIM3 BTNL3 DAP10 none TIM3 BTNL3 MyD88 none TIM3 BTNL3 CD7 none TIM3 BTNL3 DAP12 none TIM3 BTNL3 MyD88 none TIM3 BTNL3 CD7 none TIM3 NKG2D CD28 none TIM3 NKG2D CD8 none TIM3 NKG2D CD4 none TIM3 NKG2D b2c none TIM3 NKG2D CD137/41BB none TIM3 NKG2D ICOS none TIM3 NKG2D CD27 none TIM3 NKG2D CD28? none TIM3 NKG2D CD80 none TIM3 NKG2D CD86 none TIM3 NKG2D OX40 none TIM3 NKG2D DAP10 none TIM3 NKG2D MyD88 none TIM3 NKG2D CD7 none TIM3 NKG2D DAP12 none TIM3 NKG2D MyD88 none TIM3 NKG2D CD7 none

    [0077] In some embodiments, the anti-TIM3 binding agent is single chain variable fragment (scFv) antibody. The affinity/specificity of an anti-TIM3 scFv is driven in large part by specific sequences within complementarity determining regions (CDRs) in the heavy (V.sub.H) and light (V.sub.L) chain. Each V.sub.H and V.sub.L sequence will have three CDRs (CDR1, CDR2, CDR3).

    [0078] In some cases, the anti-TIM3 V.sub.H domain comprises the amino acid sequence QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSNMAVSWIRQPSGKGLEWLALIYWD DDKRYNPSLKSRLTISKDTSRNQVFLKITSVDAADTATYYCVRSQLLRFAYWGQGTL VTVSA (SEQ ID NO:1), or a fragment or variant thereof able to bind TIM3.

    [0079] In some cases, the anti-TIM3 V.sub.H domain comprises the amino acid sequence QVQLQQPGAELVKPGASVKLSCKASGYTGTSYYMYWVKQRPGQGLEWIGGINPS NGGTNFNEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCTTAYFDYWGQGTTL TVSS (SEQ ID NO:2), or a fragment or variant thereof able to bind TIM3.

    [0080] In some cases, the anti-TIM3 V.sub.L domain comprises the amino acid sequence DIQMTQSSSYLSVSLGGRVTITCKASDHINNWLAWYQQKPGNAPRLLISGATSLETG VPSRFSGRGSGKDYTLSITSLQTEDVATYYCQQYWSTPVTFGAGTKLELKAAA (SEQ ID NO:3), or a fragment or variant thereof able to bind TIM3.

    [0081] In some cases, the anti-TIM3 V.sub.L domain comprises the amino acid sequence DIVMTQSPATLSVTPGDRVSLSCRASQSISDYLHWYQQKSHESPRLLIKYASQSISGI PSRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHSFPRTFGGGTKLEIKAAA (SEQ ID NO:4), or a fragment or variant thereof able to bind TIM3.

    [0082] In some cases, the anti-TIM3 V.sub.L domain comprises the amino acid sequence EIVLTQSPAITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIYEISKLASGVP ARFSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPLYTFGGGTKLEIKAAA (SEQ ID NO:5), or a fragment or variant thereof able to bind TIM3.

    [0083] In some cases, the anti-TIM3 V.sub.L domain comprises the amino acid sequence QIVLTQSPAIMSASPGEKVTMSCSASPGEKVTMSCSASSSLTYMYWFQQKPGSSP KPWIYRTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAATYTCQQYHSYPPTFGG GTKLEIKAAA (SEQ ID NO:6), or a fragment or variant thereof able to bind TIM3.

    [0084] In some cases, the anti-TIM3 V.sub.L domain comprises the amino acid sequence XIVXTQSPAXXSXSXGXXVTXXCXASXSXXXYXXWYQQKXGXSPXXXIXXXSXLXS GVPXRFSGSGSGXXYXLXIXSXEXEDXAXYYCQXXSXPXTFGGGTKLEIKAAA (SEQ ID NO:7), wherein X is any amino acid or no amino acid, or a fragment or variant thereof able to bind TIM3. Also disclosed are other consensus sequences based on the alignments shown in FIGS. 9 and 10, e.g. based on conservative substitutions at variable residues.

    [0085] In some embodiments, the disclosed CAR comprises a hinge and/or transmembrane domain derived from CD8. For example, the CAR can comprise the amino acid sequence

    TABLE-US-00007 (SEQIDNO:8) FVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGL DFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNR.

    [0086] In some embodiments, the disclosed CAR comprises a hinge and/or transmembrane domain derived from CD28. For example, the CAR can comprise the amino acid sequence

    TABLE-US-00008 (SEQIDNO:9) VMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLAC YSLLVTVAFIIFWV.

    [0087] In some embodiments, the disclosed CAR comprises a costimulatory domain derived from CD28. For example, the CAR can comprise the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 10).

    [0088] In some embodiments, the disclosed CAR comprises a costimulatory domain derived from 4-1 BB. For example, the CAR can comprise the amino acid sequence RFSWKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO:11).

    [0089] In some embodiments, the disclosed CAR comprises an intracellular signaling domain derived from CD3 zeta (CD3?). For example, the CAR can comprise the amino acid sequence

    TABLE-US-00009 (SEQIDNO:12) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR.

    [0090] In some embodiments, the disclosed CAR comprises a linker between the V.sub.H and V.sub.L domains having the amino acid sequence GSTSGSGKPGSGEGSTKG (SEQ ID NO:13).

    [0091] In some embodiments, the disclosed CAR comprises a signal peptide having the amino acid sequence MVLLVTSLLLCELPHPAFLLIP (SEQ ID NO:14).

    [0092] In some embodiments, the anti-TIM3 binding agent is derived from natural antibodies, such as monoclonal antibodies. In some cases, the antibody is human. In some cases, the antibody has undergone an alteration to render it less immunogenic when administered to humans. For example, the alteration comprises one or more techniques selected from the group consisting of chimerization, humanization, CDR-grafting, deimmunization, and mutation of framework amino acids to correspond to the closest human germline sequence.

    [0093] Also disclosed are bi-specific CARs that target TIM3 and at least one additional tumor antigen. Also disclosed are CARs designed to work only in conjunction with another CAR that binds a different antigen, such as a tumor antigen. For example, in these embodiments, the endodomain of the disclosed CAR can contain only an signaling domain (SD) or a co-stimulatory signaling region (CSR), but not both. The second CAR (or endogenous T-cell) provides the missing signal if it is activated. For example, if the disclosed CAR contains an SD but not a CSR, then the immune effector cell containing this CAR is only activated if another CAR (or T-cell) containing a CSR binds its respective antigen. Likewise, if the disclosed CAR contains a CSR but not a SD, then the immune effector cell containing this CAR is only activated if another CAR (or T-cell) containing an SD binds its respective antigen.

    [0094] Tumor antigens are proteins that are produced by tumor cells that elicit an immune response, particularly T-cell mediated immune responses. The additional antigen binding domain can be an antibody or a natural ligand of the tumor antigen. The selection of the additional antigen binding domain will depend on the particular type of cancer to be treated. Tumor antigens are well known in the art and include, for example, a glioma-associated antigen, carcinoembryonic antigen (CEA), EGFRvIII, IL-IIRa, IL-13Ra, EGFR, FAP, B7H3, Kit, CA LX, CS-1, MUC1, BCMA, bcr-abl, HER2, ?-human chorionic gonadotropin, alphafetoprotein (AFP), ALK, CD19, CD123, cyclin BI, lectin-reactive AFP, Fos-related antigen 1, ADRB3, thyroglobulin, EphA2, RAGE-1, RUI, RU2, SSX2, AKAP-4, LCK, OY-TESI, PAX5, SART3, CLL-1, fucosyl GM1, GloboH, MN-CA IX, EPCAM, EVT6-AML, TGS5, human telomerase reverse transcriptase, plysialic acid, PLAC1, RUI, RU2 (AS), intestinal carboxyl esterase, lewisY, sLe, LY6K, mut hsp70-2, M-CSF, MYCN, RhoC, TRP-2, CYPIBI, BORIS, prostase, prostate-specific antigen (PSA), PAX3, PAP, NY-ESO-1, LAGE-la, LMP2, NCAM, p53, p53 mutant, Ras mutant, gplOO, prostein, OR51E2, PANX3, PSMA, PSCA, Her2/neu, hTERT, HMWMAA, HAVCRI, VEGFR2, PDGFR-beta, survivin and telomerase, legumain, HPV E6,E7, sperm protein 17, SSEA-4, tyrosinase, TARP, WTI, prostate-carcinoma tumor antigen-1 (PCTA-1), ML-IAP, MAGE, MAGE-AI, MAD-CT-1, MAD-CT-2, MelanA/MART 1, XAGE1, ELF2M, ERG (TMPRSS2 ETS fusion gene), NA17, neutrophil elastase, sarcoma transiocation breakpoints, NY-BR-1, ephnnB2, CD20, CD22, CD24, CD30, CD33, CD38, CD44v6, CD97, CD99, CD171, CD179a, androgen receptor, FAP, insulin growth factor (IGF)-I, IGFII, IGF-I receptor, GD2, o-acetyl-GD2, GD3, GM3, GPRC5D, GPR20, CXORF61, folate receptor (FRa), folate receptor beta, ROR1, FIt3, TAG72, TN Ag, Tie 2, TEM1, TEM7R, CLDN6, TSHR, UPK2, and mesothelin. In a preferred embodiment, the tumor antigen is selected from the group consisting of folate receptor (FRa), mesothelin, EGFRvIII, IL-13Ra, CD123, CD19, CD33, BCMA, GD2, CLL-1, CA-IX, MUCI, HER2, CD99, and any combination thereof.

    [0095] Non-limiting examples of tumor antigens include the following: Differentiation antigens such as tyrosinase, TRP-1, TRP-2 and tumor-specific multilineage antigens such as MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, pi 5; overexpressed embryonic antigens such as CEA overexpressed oncogenes and mutated tumor-suppressor genes such as p53, Ras, HER-2/neu; unique tumor antigens resulting from chromosomal translocations; such as BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR; and viral antigens, such as the Epstein Barr virus antigens EBVA and the human papillomavirus (HPV) antigens E6 and E7. Other large, protein-based antigens include TSP-180, MAGE-4, MAGE-5, MAGE-6, RAGE, NY-ESO, pI85erbB2, pI80erbB-3, c-met, nm-23H1, PSA, TIM3, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, beta-Catenin, CDK4, Mum-I, p 15, p 16, 43-9F, 5T4, 791Tgp72, alpha-fetoprotein, beta-HCG, BCA225, BTAA, CA 125, CA 15-3CA 27.29BCAA, CA 195, CA 242, CA-50, CAM43, CD68P1, CO-029, FGF-5, G250, Ga733EpCAM, HTgp-175, M344, MA-50, MG7-Ag, MOV18, NB/70K, NY-CO-1, RCASI, SDCCAGI 6, TA-90\ac-2 binding protein\cyclophilm C-associated protein, TAAL6, TAG72, TLP, TPS, GPC3, MUC16, LMP1, EBMA-1, BARF-1, CSI, CD319, HER1, B7H6, LICAM, IL6, and MET.

    [0096] Nucleic Acids and Vectors

    [0097] Also disclosed are polynucleotides and polynucleotide vectors encoding the disclosed TIM3-specific CARs that allow expression of the TIM3-specific CARs in the disclosed immune effector cells.

    [0098] Nucleic acid sequences encoding the disclosed CARs, and regions thereof, can be obtained using recombinant methods known in the art, such as, for example by screening libraries from cells expressing the gene, by deriving the gene from a vector known to include the same, or by isolating directly from cells and tissues containing the same, using standard techniques. Alternatively, the gene of interest can be produced synthetically, rather than cloned.

    [0099] Expression of nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide to a promoter, and incorporating the construct into an expression vector. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.

    [0100] The disclosed nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

    [0101] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers. In some embodiments, the polynucleotide vectors are lentiviral or retroviral vectors.

    [0102] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo.

    [0103] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1? (EF-1?). However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, MND (myeloproliferative sarcoma virus) promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. The promoter can alternatively be an inducible promoter. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.

    [0104] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another.

    [0105] In order to assess the expression of a CAR polypeptide or portions thereof, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes.

    [0106] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene. Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5 flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.

    [0107] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.

    [0108] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York).

    [0109] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells.

    [0110] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).

    [0111] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a collapsed structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes. Lipids suitable for use can be obtained from commercial sources. For example, dimyristyl phosphatidyicholine (DMPC) can be obtained from Sigma, St. Louis, Mo.; dicetyl phosphate (DCP) can be obtained from K & K Laboratories (Plainview, N.Y.); cholesterol (Choi) can be obtained from Calbiochem-Behring; dimyristyl phosphatidylglycerol (DMPG) and other lipids may be obtained from Avanti Polar Lipids, Inc, (Birmingham, Ala.).

    [0112] Immune Effector Cells

    [0113] Also disclosed are immune effector cells that are engineered to express the disclosed CARs (also referred to herein as CAR-T cells. These cells are preferably obtained from the subject to be treated (i.e. are autologous). However, in some embodiments, immune effector cell lines or donor effector cells (allogeneic) are used. Immune effector cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. Immune effector cells can be obtained from blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll? separation. For example, cells from the circulating blood of an individual may be obtained by apheresis. In some embodiments, immune effector cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL? gradient or by counterflow centrifugal elutriation. A specific subpopulation of immune effector cells can be further isolated by positive or negative selection techniques. For example, immune effector cells can be isolated using a combination of antibodies directed to surface markers unique to the positively selected cells, e.g., by incubation with antibody-conjugated beads for a time period sufficient for positive selection of the desired immune effector cells. Alternatively, enrichment of immune effector cells population can be accomplished by negative selection using a combination of antibodies directed to surface markers unique to the negatively selected cells.

    [0114] In some embodiments, the immune effector cells comprise any leukocyte involved in defending the body against infectious disease and foreign materials. For example, the immune effector cells can comprise lymphocytes, monocytes, macrophages, dentritic cells, mast cells, neutrophils, basophils, eosinophils, or any combinations thereof. For example, the immune effector cells can comprise T lymphocytes.

    [0115] T cells or T lymphocytes can be distinguished from other lymphocytes, such as B cells and natural killer cells (NK cells), by the presence of a T-cell receptor (TCR) on the cell surface. They are called T cells because they mature in the thymus (although some also mature in the tonsils). There are several subsets of T cells, each with a distinct function.

    [0116] T helper cells (T.sub.H cells) assist other white blood cells in immunologic processes, including maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages. These cells are also known as CD4+ T cells because they express the CD4 glycoprotein on their surface. Helper T cells become activated when they are presented with peptide antigens by MHC class II molecules, which are expressed on the surface of antigen-presenting cells (APCs). Once activated, they divide rapidly and secrete small proteins called cytokines that regulate or assist in the active immune response. These cells can differentiate into one of several subtypes, including T.sub.H1, T.sub.H2, T.sub.H3, T.sub.H17, T.sub.H9, or T.sub.FH, which secrete different cytokines to facilitate a different type of immune response.

    [0117] Cytotoxic T cells (T.sub.C cells, or CTLs) destroy virally infected cells and tumor cells, and are also implicated in transplant rejection. These cells are also known as CD8.sup.+ T cells since they express the CD8 glycoprotein at their surface. These cells recognize their targets by binding to antigen associated with MHC class I molecules, which are present on the surface of all nucleated cells. Through IL-10, adenosine and other molecules secreted by regulatory T cells, the CD8+ cells can be inactivated to an anergic state, which prevents autoimmune diseases.

    [0118] Memory T cells are a subset of antigen-specific T cells that persist long-term after an infection has resolved. They quickly expand to large numbers of effector T cells upon re-exposure to their cognate antigen, thus providing the immune system with memory against past infections. Memory cells may be either CD4.sup.+ or CD8.sup.+. Memory T cells typically express the cell surface protein CD45RO.

    [0119] Regulatory T cells (To cells), formerly known as suppressor T cells, are crucial for the maintenance of immunological tolerance. Their major role is to shut down T cell-mediated immunity toward the end of an immune reaction and to suppress auto-reactive T cells that escaped the process of negative selection in the thymus. Two major classes of CD4.sup.+ T.sub.reg cells have been describednaturally occurring T.sub.reg cells and adaptive T.sub.reg cells.

    [0120] Natural killer T (NKT) cells (not to be confused with natural killer (NK) cells) bridge the adaptive immune system with the innate immune system. Unlike conventional T cells that recognize peptide antigens presented by major histocompatibility complex (MHC) molecules, NKT cells recognize glycolipid antigen presented by a molecule called CD1d.

    [0121] In some embodiments, the T cells comprise a mixture of CD4+ cells. In other embodiments, the T cells are enriched for one or more subsets based on cell surface expression. For example, in some cases, the T comprise are cytotoxic CD8.sup.+ T lymphocytes. In some embodiments, the T cells comprise ?? T cells, which possess a distinct T-cell receptor (TCR) having one ? chain and one ? chain instead of a and ? chains.

    [0122] Natural-killer (NK) cells are CD56.sup.+CD3.sup.? large granular lymphocytes that can kill virally infected and transformed cells, and constitute a critical cellular subset of the innate immune system (Godfrey J, et al. Leuk Lymphoma 2012 53:1666-1676).

    [0123] Unlike cytotoxic CD8.sup.+ T lymphocytes, NK cells launch cytotoxicity against tumor cells without the requirement for prior sensitization, and can also eradicate MHC-I-negative cells (Nami-Mancinelli E, et al. Int Immunol 2011 23:427-431). NK cells are safer effector cells, as they may avoid the potentially lethal complications of cytokine storms (Morgan R A, et al. Mol Ther 2010 18:843-851), tumor lysis syndrome (Porter D L, et al. N Engl J Med 2011 365:725-733), and on-target, off-tumor effects. Although NK cells have a well-known role as killers of cancer cells, and NK cell impairment has been extensively documented as crucial for progression of MM (Godfrey J, et al. Leuk Lymphoma 2012 53:1666-1676; Fauriat C, et al. Leukemia 2006 20:732-733), the means by which one might enhance NK cell-mediated anti-MM activity has been largely unexplored prior to the disclosed CARs.

    [0124] Therapeutic Methods

    [0125] Immune effector cells expressing the disclosed CARs can elicit an anti-tumor immune response against TIM3-expressing cancer cells. The anti-tumor immune response elicited by the disclosed CAR-modified immune effector cells may be an active or a passive immune response. In addition, the CAR-mediated immune response may be part of an adoptive immunotherapy approach in which CAR-modified immune effector cells induce an immune response specific to TIM3.

    [0126] Adoptive transfer of immune effector cells expressing chimeric antigen receptors is a promising anti-cancer therapeutic. Following the collection of a patient's immune effector cells, the cells may be genetically engineered to express the disclosed TIM3-specific CARs, then infused back into the patient.

    [0127] The disclosed CAR-modified immune effector cells may be administered either alone, or as a pharmaceutical composition in combination with diluents and/or with other components such as IL-2, IL-15, or other cytokines or cell populations. Briefly, pharmaceutical compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions for use in the disclosed methods are in some embodiments formulated for intravenous administration. Pharmaceutical compositions may be administered in any manner appropriate treat MM. The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the severity of the patient's disease, although appropriate dosages may be determined by clinical trials.

    [0128] When an immunologically effective amount, an anti-tumor effective amount, an tumor-inhibiting effective amount, or therapeutic amount is indicated, the precise amount of the compositions of the present invention to be administered can be determined by a physician with consideration of individual differences in age, weight, tumor size, extent of infection or metastasis, and condition of the patient (subject). It can generally be stated that a pharmaceutical composition comprising the T cells described herein may be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, such as 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. T cell compositions may also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988). The optimal dosage and treatment regime for a particular patient can readily be determined by one skilled in the art of medicine by monitoring the patient for signs of disease and adjusting the treatment accordingly.

    [0129] In certain embodiments, it may be desired to administer activated T cells to a subject and then subsequently re-draw blood (or have an apheresis performed), activate T cells therefrom according to the disclosed methods, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain embodiments, T cells can be activated from blood draws of from 10 cc to 400 cc. In certain embodiments, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc. Using this multiple blood draw/multiple reinfusion protocol may serve to select out certain populations of T cells.

    [0130] The administration of the disclosed compositions may be carried out in any convenient manner, including by injection, transfusion, or implantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, by intravenous (i.v.) injection, or intraperitoneally. In some embodiments, the disclosed compositions are administered to a patient by intradermal or subcutaneous injection. In some embodiments, the disclosed compositions are administered by i.v. injection. The compositions may also be injected directly into a tumor, lymph node, or site of infection.

    [0131] In certain embodiments, the disclosed CAR-modified immune effector cells are administered to a patient in conjunction with (e.g., before, simultaneously or following) any number of relevant treatment modalities, including but not limited to thalidomide, dexamethasone, bortezomib, and lenalidomide. In further embodiments, the CAR-modified immune effector cells may be used in combination with chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAM PATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludaribine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, and irradiation. In some embodiments, the CAR-modified immune effector cells are administered to a patient in conjunction with (e.g., before, simultaneously or following) bone marrow transplantation, T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide, or antibodies such as OKT3 or CAMPATH. In another embodiment, the cell compositions of the present invention are administered following B-cell ablative therapy such as agents that react with CD20, e.g., Rituxan. For example, in some embodiments, subjects may undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. In certain embodiments, following the transplant, subjects receive an infusion of the expanded immune cells of the present invention. In an additional embodiment, expanded cells are administered before or following surgery.

    [0132] The cancer of the disclosed methods can be any TIM3-expressing cell in a subject undergoing unregulated growth, invasion, or metastasis. Cancers that express TIM3 include hematological cancers, such as acute myeloid leukemia (AML), myelodysplasia, cervical cancer, gastric cancer, melanoma, and lung cancer.

    [0133] In some aspects, the cancer can be any neoplasm or tumor for which radiotherapy is currently used. Alternatively, the cancer can be a neoplasm or tumor that is not sufficiently sensitive to radiotherapy using standard methods. Thus, the cancer can be a sarcoma, lymphoma, leukemia, carcinoma, blastoma, or germ cell tumor. A representative but non-limiting list of cancers that the disclosed compositions can be used to treat include lymphoma, B cell lymphoma, T cell lymphoma, mycosis fungoides, Hodgkin's Disease, myeloid leukemia, bladder cancer, brain cancer, nervous system cancer, head and neck cancer, squamous cell carcinoma of head and neck, kidney cancer, lung cancers such as small cell lung cancer and non-small cell lung cancer, neuroblastoma/glioblastoma, ovarian cancer, pancreatic cancer, prostate cancer, skin cancer, liver cancer, melanoma, squamous cell carcinomas of the mouth, throat, larynx, and lung, endometrial cancer, cervical cancer, cervical carcinoma, breast cancer, epithelial cancer, renal cancer, genitourinary cancer, pulmonary cancer, esophageal carcinoma, head and neck carcinoma, large bowel cancer, hematopoietic cancers; testicular cancer; colon and rectal cancers, prostatic cancer, and pancreatic cancer.

    [0134] The disclosed CARs can be used in combination with any compound, moiety or group which has a cytotoxic or cytostatic effect. Drug moieties include chemotherapeutic agents, which may function as microtubulin inhibitors, mitosis inhibitors, topoisomerase inhibitors, or DNA intercalators, and particularly those which are used for cancer therapy.

    [0135] The disclosed CARs can be used in combination with a checkpoint inhibitor. The two known inhibitory checkpoint pathways involve signaling through the cytotoxic T-lymphocyte antigen-4 (CTLA-4) and programmed-death 1 (PD-1) receptors. These proteins are members of the CD28-B7 family of cosignaling molecules that play important roles throughout all stages of T cell function. The PD-1 receptor (also known as CD279) is expressed on the surface of activated T cells. Its ligands, PD-L1 (B7-H1; CD274) and PD-L2 (B7-DC; CD273), are expressed on the surface of APCs such as dendritic cells or macrophages. PD-L1 is the predominant ligand, while PD-L2 has a much more restricted expression pattern. When the ligands bind to PD-1, an inhibitory signal is transmitted into the T cell, which reduces cytokine production and suppresses T-cell proliferation. Checkpoint inhibitors include, but are not limited to antibodies that block PD-1 (Nivolumab (BMS-936558 or MDX1106), CT-011, MK-3475), PD-L1 (MDX-1105 (BMS-936559), MPDL3280A, MSB0010718C), PD-L2 (rHIgM12B7), CTLA-4 (Ipilimumab (MDX-010), Tremelimumab (CP-675,206)), IDO, B7-H3 (MGA271), B7-H4, TIM3, LAG-3 (BMS-986016).

    [0136] Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics are described in U.S. Pat. No. 8,008,449, which is incorporated by reference for these antibodies. Anti-PD-L1 antibodies and uses therefor are described in U.S. Pat. No. 8,552,154, which is incorporated by reference for these antibodies. Anticancer agent comprising anti-PD-1 antibody or anti-PD-L1 antibody are described in U.S. Pat. No. 8,617,546, which is incorporated by reference for these antibodies.

    [0137] In some embodiments, the PDL1 inhibitor comprises an antibody that specifically binds PDL1, such as BMS-936559 (Bristol-Myers Squibb) or MPDL3280A (Roche). In some embodiments, the PD1 inhibitor comprises an antibody that specifically binds PD1, such as lambrolizumab (Merck), nivolumab (Bristol-Myers Squibb), or MED14736 (AstraZeneca). Human monoclonal antibodies to PD-1 and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics are described in U.S. Pat. No. 8,008,449, which is incorporated by reference for these antibodies. Anti-PD-L1 antibodies and uses therefor are described in U.S. Pat. No. 8,552,154, which is incorporated by reference for these antibodies. Anticancer agent comprising anti-PD-1 antibody or anti-PD-L1 antibody are described in U.S. Pat. No. 8,617,546, which is incorporated by reference for these antibodies.

    [0138] The disclosed CARs can be used in combination with other cancer immunotherapies. There are two distinct types of immunotherapy: passive immunotherapy uses components of the immune system to direct targeted cytotoxic activity against cancer cells, without necessarily initiating an immune response in the patient, while active immunotherapy actively triggers an endogenous immune response. Passive strategies include the use of the monoclonal antibodies (mAbs) produced by B cells in response to a specific antigen. The development of hybridoma technology in the 1970s and the identification of tumor-specific antigens permitted the pharmaceutical development of mAbs that could specifically target tumor cells for destruction by the immune system. Thus far, mAbs have been the biggest success story for immunotherapy; the top three best-selling anticancer drugs in 2012 were mAbs. Among them is rituximab (Rituxan, Genentech), which binds to the CD20 protein that is highly expressed on the surface of B cell malignancies such as non-Hodgkin's lymphoma (NHL). Rituximab is approved by the FDA for the treatment of NHL and chronic lymphocytic leukemia (CLL) in combination with chemotherapy. Another important mAb is trastuzumab (Herceptin; Genentech), which revolutionized the treatment of HER2 (human epidermal growth factor receptor 2)-positive breast cancer by targeting the expression of HER2.

    [0139] Generating optimal killer CD8 T cell responses also requires T cell receptor activation plus co-stimulation, which can be provided through ligation of tumor necrosis factor receptor family members, including OX40 (CD134) and 4-1 BB (CD137). OX40 is of particular interest as treatment with an activating (agonist) anti-OX40 mAb augments T cell differentiation and cytolytic function leading to enhanced anti-tumor immunity against a variety of tumors.

    [0140] In some embodiments, such an additional therapeutic agent may be selected from an antimetabolite, such as methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, fludarabine, 5-fluorouracil, decarbazine, hydroxyurea, asparaginase, gemcitabine or cladribine.

    [0141] In some embodiments, such an additional therapeutic agent may be selected from an alkylating agent, such as mechlorethamine, thioepa, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, dacarbazine (DTIC), procarbazine, mitomycin C, cisplatin and other platinum derivatives, such as carboplatin.

    [0142] In some embodiments, such an additional therapeutic agent may be selected from an anti-mitotic agent, such as taxanes, for instance docetaxel, and paclitaxel, and vinca alkaloids, for instance vindesine, vincristine, vinblastine, and vinorelbine.

    [0143] In some embodiments, such an additional therapeutic agent may be selected from a topoisomerase inhibitor, such as topotecan or irinotecan, or a cytostatic drug, such as etoposide and teniposide.

    [0144] In some embodiments, such an additional therapeutic agent may be selected from a growth factor inhibitor, such as an inhibitor of ErbBl (EGFR) (such as an EGFR antibody, e.g. zalutumumab, cetuximab, panitumumab or nimotuzumab or other EGFR inhibitors, such as gefitinib or erlotinib), another inhibitor of ErbB2 (HER2/neu) (such as a HER2 antibody, e.g. trastuzumab, trastuzumab-DM 1 or pertuzumab) or an inhibitor of both EGFR and HER2, such as lapatinib).

    [0145] In some embodiments, such an additional therapeutic agent may be selected from a tyrosine kinase inhibitor, such as imatinib (Glivec, Gleevec STI571) or lapatinib.

    [0146] Therefore, in some embodiments, a disclosed antibody is used in combination with ofatumumab, zanolimumab, daratumumab, ranibizumab, nimotuzumab, panitumumab, hu806, daclizumab (Zenapax), basiliximab (Simulect), infliximab (Remicade), adalimumab (Humira), natalizumab (Tysabri), omalizumab (Xolair), efalizumab (Raptiva), and/or rituximab.

    [0147] In some embodiments, a therapeutic agent for use in combination with a CARs for treating the disorders as described above may be an anti-cancer cytokine, chemokine, or combination thereof. Examples of suitable cytokines and growth factors include IFNy, IL-2, IL-4, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, IL-18, IL-23, IL-24, IL-27, IL-28a, IL-28b, IL-29, KGF, IFNa (e.g., INFa2b), IFN, GM-CSF, CD40L, Flt3 ligand, stem cell factor, ancestim, and TNFa. Suitable chemokines may include Glu-Leu-Arg (ELR)-negative chemokines such as IP-10, MCP-3, MIG, and SDF-1a from the human CXC and CC chemokine families. Suitable cytokines include cytokine derivatives, cytokine variants, cytokine fragments, and cytokine fusion proteins.

    [0148] In some embodiments, a therapeutic agent for use in combination with a CARs for treating the disorders as described above may be a cell cycle control/apoptosis regulator (or regulating agent). A cell cycle controllapoptosis regulator may include molecules that target and modulate cell cycle controllapoptosis regulators such as (i) cdc-25 (such as NSC 663284), (ii) cyclin-dependent kinases that overstimulate the cell cycle (such as flavopiridol (L868275, HMR1275), 7-hydroxystaurosporine (UCN-01, KW-2401), and roscovitine (R-roscovitine, CYC202)), and (iii) telomerase modulators (such as BIBR1532, SOT-095, GRN163 and compositions described in for instance U.S. Pat. Nos. 6,440,735 and 6,713,055). Non-limiting examples of molecules that interfere with apoptotic pathways include TNF-related apoptosis-inducing ligand (TRAIL)/apoptosis-2 ligand (Apo-2L), antibodies that activate TRAIL receptors, IFNs, and anti-sense Bcl-2.

    [0149] In some embodiments, a therapeutic agent for use in combination with a CARs for treating the disorders as described above may be a hormonal regulating agent, such as agents useful for anti-androgen and anti-estrogen therapy. Examples of such hormonal regulating agents are tamoxifen, idoxifene, fulvestrant, droloxifene, toremifene, raloxifene, diethylstilbestrol, ethinyl estradiol/estinyl, an antiandrogene (such as flutaminde/eulexin), a progestin (such as such as hydroxyprogesterone caproate, medroxy-progesterone/provera, megestrol acepate/megace), an adrenocorticosteroid (such as hydrocortisone, prednisone), luteinizing hormone-releasing hormone (and analogs thereof and other LHRH agonists such as buserelin and goserelin), an aromatase inhibitor (such as anastrazole/arimidex, aminoglutethimide/cytraden, exemestane) or a hormone inhibitor (such as octreotide/sandostatin).

    [0150] In some embodiments, a therapeutic agent for use in combination with an CARs for treating the disorders as described above may be an anti-cancer nucleic acid or an anti-cancer inhibitory RNA molecule.

    [0151] Combined administration, as described above, may be simultaneous, separate, or sequential. For simultaneous administration the agents may be administered as one composition or as separate compositions, as appropriate.

    [0152] In some embodiments, the disclosed CARs is administered in combination with radiotherapy. Radiotherapy may comprise radiation or associated administration of radiopharmaceuticals to a patient is provided. The source of radiation may be either external or internal to the patient being treated (radiation treatment may, for example, be in the form of external beam radiation therapy (EBRT) or brachytherapy (BT)). Radioactive elements that may be used in practicing such methods include, e.g., radium, cesium-137, iridium-192, americium-241, gold-198, cobalt-57, copper-67, technetium-99, iodide-123, iodide-131, and indium-111.

    [0153] In some embodiments, the disclosed CARs is administered in combination with surgery.

    [0154] CAR-T cells may be designed in several ways that enhance tumor cytotoxicity and specificity, evade tumor immunosuppression, avoid host rejection, and prolong their therapeutic half-life. TRUCK (T-cells Redirected for Universal Cytokine Killing) T cells for example, possess a CAR but are also engineered to release cytokines such as IL-12 that promote tumor killing. Because these cells are designed to release a molecular payload upon activation of the CAR once localized to the tumor environment, these CAR-T cells are sometimes also referred to as armored CARs. Several cytokines as cancer therapies are being investigated both pre-clinically and clinically, and may also prove useful when similarly incorporated into a TRUCK form of CAR-T therapy. Among these include IL-2, IL-3. IL-4, IL-5, IL-6, IL-7, IL-10, IL-12, IL-13, IL-15, IL-18, M-CSF, GM-CSF, IFN-?, IFN-?, TNF-?, TRAIL, FLT3 ligand, Lymphotactin, and TGF-? (Dranoff 2004). Self-driving or homing CAR-T cells are engineered to express a chemokine receptor in addition to their CAR. As certain chemokines can be upregulated in tumors, incorporation of a chemokine receptor aids in tumor trafficking to and infiltration by the adoptive T-cell, thereby enhancing both specificity and functionality of the CAR-T (Moon 2011). Universal CAR-T cells also possess a CAR, but are engineered such that they do not express endogenous TCR (T-cell receptor) or MHC (major histocompatibility complex) proteins. Removal of these two proteins from the signaling repertoire of the adoptive T-cell therapy prevents graft-versus-host-disease and rejection, respectively. Armored CAR-T cells are additionally so named for their ability to evade tumor immunosuppression and tumor-induced CAR-T hypofunction. These particular CAR-Ts possess a CAR, and may be engineered to not express checkpoint inhibitors. Alternatively, these CAR-Ts can be co-administered with a monoclonal antibody (mAb) that blocks checkpoint signaling. Administration of an anti-PDL1 antibody significantly restored the killing ability of CAR TILs (tumor infiltrating lymphocytes). While PD1-PDL1 and CTLA-4-CD80/CD86 signaling pathways have been investigated, it is possible to target other immune checkpoint signaling molecules in the design of an armored CAR-T including LAG-3, Tim-3, IDO-1, 2B4, and KIR. Other intracellular inhibitors of TILs include phosphatases (SHP1), ubiquitin-ligases (i.e., cbl-b), and kinases (i.e., diacyiglycerol kinase). Armored CAR-Ts may also be engineered to express proteins or receptors that protect them against or make them resistant to the effects of tumor-secreted cytokines. For example, CTLs (cytotoxic T lymphocytes) transduced with the double negative form of the TGF-? receptor are resistant to the immunosuppression by lymphoma secreted TGF-?. These transduced cells showed notably increased antitumor activity in vivo when compared to their control counterparts.

    [0155] Tandem and dual CAR-T cells are unique in that they possess two distinct antigen binding domains. A tandem CAR contains two sequential antigen binding domains facing the extracellular environment connected to the intracellular costimulatory and stimulatory domains. A dual CAR is engineered such that one extracellular antigen binding domain is connected to the intracellular costimulatory domain and a second, distinct extracellular antigen binding domain is connected to the intracellular stimulatory domain. Because the stimulatory and costimulatory domains are split between two separate antigen binding domains, dual CARs are also referred to as split CARs. In both tandem and dual CAR designs, binding of both antigen binding domains is necessary to allow signaling of the CAR circuit in the T-cell. Because these two CAR designs have binding affinities for different, distinct antigens, they are also referred to as bi-specific CARs.

    [0156] One primary concern with CAR-T cells as a form of living therapeutic is their manipulability in vivo and their potential immune-stimulating side effects. To better control CAR-T therapy and prevent against unwanted side effects, a variety of features have been engineered including off-switches, safety mechanisms, and conditional control mechanisms. Both self-destruct and marked/tagged CAR-T cells for example, are engineered to have an off-switch that promotes clearance of the CAR-expressing T-cell. A self-destruct CAR-T contains a CAR, but is also engineered to express a pro-apoptotic suicide gene or elimination gene inducible upon administration of an exogenous molecule. A variety of suicide genes may be employed for this purpose, including HSV-TK (herpes simplex virus thymidine kinase), Fas, iCasp9 (inducible caspase 9), CD20, MYC tag, and truncated EGFR (endothelial growth factor receptor). HSK for example, will convert the prodrug ganciclovir (GCV) into GCV-triphosphate that incorporates itself into replicating DNA, ultimately leading to cell death. iCasp9 is a chimeric protein containing components of FK506-binding protein that binds the small molecule AP1903, leading to caspase 9 dimerization and apoptosis. A marked/tagged CAR-T cell however, is one that possesses a CAR but also is engineered to express a selection marker. Administration of a mAb against this selection marker will promote clearance of the CAR-T cell. Truncated EGFR is one such targetable antigen by the anti-EGFR mAb, and administration of cetuximab works to promotes elimination of the CAR-T cell. CARs created to have these features are also referred to as sCARs for switchable CARs, and RCARs for regulatable CARs. A safety CAR, also known as an inhibitory CAR (iCAR), is engineered to express two antigen binding domains. One of these extracellular domains is directed against a tumor related antigen and bound to an intracellular costimulatory and stimulatory domain. The second extracellular antigen binding domain however is specific for normal tissue and bound to an intracellular checkpoint domain such as CTLA4, PD1, or CD45. Incorporation of multiple intracellular inhibitory domains to the iCAR is also possible. Some inhibitory molecules that may provide these inhibitory domains include B7-H1, B7-1, CD160, PIH, 2B4, CEACAM (CEACAM-1. CEACAM-3, and/or CEACAM-5), LAG-3, TIGIT, BTLA, LAIR1, and TGF?-R. In the presence of normal tissue, stimulation of this second antigen binding domain will work to inhibit the CAR. It should be noted that due to this dual antigen specificity, iCARs are also a form of bi-specific CAR-T cells. The safety CAR-T engineering enhances specificity of the CAR-T cell for tumor tissue, and is advantageous in situations where certain normal tissues may express very low levels of a tumor associated antigen that would lead to off target effects with a standard CAR (Morgan 2010). A conditional CAR-T cell expresses an extracellular antigen binding domain connected to an intracellular costimulatory domain and a separate, intracellular costimulator. The costimulatory and stimulatory domain sequences are engineered in such a way that upon administration of an exogenous molecule the resultant proteins will come together intracellularly to complete the CAR circuit. In this way, CAR-T activation can be modulated, and possibly even fine-tuned or personalized to a specific patient. Similar to a dual CAR design, the stimulatory and costimulatory domains are physically separated when inactive in the conditional CAR; for this reason these too are also referred to as a split CAR.

    [0157] In some embodiments, two or more of these engineered features may be combined to create an enhanced, multifunctional CAR-T. For example, it is possible to create a CAR-T cell with either dual- or conditional-CAR design that also releases cytokines like a TRUCK. In some embodiments, a dual-conditional CAR-T cell could be made such that it expresses two CARs with two separate antigen binding domains against two distinct cancer antigens, each bound to their respective costimulatory domains. The costimulatory domain would only become functional with the stimulatory domain after the activating molecule is administered. For this CAR-T cell to be effective the cancer must express both cancer antigens and the activating molecule must be administered to the patient; this design thereby incorporating features of both dual and conditional CAR-T cells.

    [0158] Typically, CAR-T cells are created using ?-? T cells, however ?-? T cells may also be used. In some embodiments, the described CAR constructs, domains, and engineered features used to generate CAR-T cells could similarly be employed in the generation of other types of CAR-expressing immune cells including NK (natural killer) cells, B cells, mast cells, myeloid-derived phagocytes, and NKT cells. Alternatively, a CAR-expressing cell may be created to have properties of both T-cell and NK cells. In an additional embodiment, the transduced with CARs may be autologous or allogeneic.

    [0159] Several different methods for CAR expression may be used including retroviral transduction (including ?-retroviral), lentiviral transduction, transposon/transposases (Sleeping Beauty and PiggyBac systems), and messenger RNA transfer-mediated gene expression. Gene editing (gene insertion or gene deletion/disruption) has become of increasing importance with respect to the possibility for engineering CAR-T cells as well. CRISPR-Cas9, ZFN (zinc finger nuclease), and TALEN (transcription activator like effector nuclease) systems are three potential methods through which CAR-T cells may be generated.

    Definitions

    [0160] The term amino acid sequence refers to a list of abbreviations, letters, characters or words representing amino acid residues. The amino acid abbreviations used herein are conventional one letter codes for the amino acids and are expressed as follows: A, alanine; B, asparagine or aspartic acid; C, cysteine; D aspartic acid; E, glutamate, glutamic acid; F, phenylalanine; G, glycine; H histidine; I isoleucine; K, lysine; L, leucine; M, methionine; N, asparagine; P, proline; Q, glutamine; R, arginine; S, serine; T, threonine; V, valine; W, tryptophan; Y, tyrosine; Z, glutamine or glutamic acid.

    [0161] The term antibody refers to an immunoglobulin, derivatives thereof which maintain specific binding ability, and proteins having a binding domain which is homologous or largely homologous to an immunoglobulin binding domain. These proteins may be derived from natural sources, or partly or wholly synthetically produced. An antibody may be monoclonal or polyclonal. The antibody may be a member of any immunoglobulin class from any species, including any of the human classes: IgG, IgM, IgA, IgD, and IgE. In exemplary embodiments, antibodies used with the methods and compositions described herein are derivatives of the IgG class. In addition to intact immunoglobulin molecules, also included in the term antibodies are fragments or polymers of those immunoglobulin molecules, and human or humanized versions of immunoglobulin molecules that selectively bind the target antigen.

    [0162] The term aptamer refers to oligonucleic acid or peptide molecules that bind to a specific target molecule. These molecules are generally selected from a random sequence pool. The selected aptamers are capable of adapting unique tertiary structures and recognizing target molecules with high affinity and specificity. A nucleic acid aptamer is a DNA or RNA oligonucleic acid that binds to a target molecule via its conformation, and thereby inhibits or suppresses functions of such molecule. A nucleic acid aptamer may be constituted by DNA, RNA, or a combination thereof. A peptide aptamer is a combinatorial protein molecule with a variable peptide sequence inserted within a constant scaffold protein. Identification of peptide aptamers is typically performed under stringent yeast dihybrid conditions, which enhances the probability for the selected peptide aptamers to be stably expressed and correctly folded in an intracellular context.

    [0163] The term carrier means a compound, composition, substance, or structure that, when in combination with a compound or composition, aids or facilitates preparation, storage, administration, delivery, effectiveness, selectivity, or any other feature of the compound or composition for its intended use or purpose. For example, a carrier can be selected to minimize any degradation of the active ingredient and to minimize any adverse side effects in the subject.

    [0164] The term chimeric molecule refers to a single molecule created by joining two or more molecules that exist separately in their native state. The single, chimeric molecule has the desired functionality of all of its constituent molecules. One type of chimeric molecules is a fusion protein.

    [0165] The term fusion protein refers to a polypeptide formed by the joining of two or more polypeptides through a peptide bond formed between the amino terminus of one polypeptide and the carboxyl terminus of another polypeptide. The fusion protein can be formed by the chemical coupling of the constituent polypeptides or it can be expressed as a single polypeptide from nucleic acid sequence encoding the single contiguous fusion protein. A single chain fusion protein is a fusion protein having a single contiguous polypeptide backbone. Fusion proteins can be prepared using conventional techniques in molecular biology to join the two genes in frame into a single nucleic acid, and then expressing the nucleic acid in an appropriate host cell under conditions in which the fusion protein is produced.

    [0166] The term identity refers to sequence identity between two nucleic acid molecules or polypeptides. Identity can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base, then the molecules are identical at that position. A degree of similarity or identity between nucleic acid or amino acid sequences is a function of the number of identical or matching nucleotides at positions shared by the nucleic acid sequences. Various alignment algorithms and/or programs may be used to calculate the identity between two sequences, including FASTA, or BLAST which are available as a part of the GCG sequence analysis package (University of Wisconsin, Madison, Wis.), and can be used with, e.g., default setting. For example, polypeptides having at least 70%, 85%, 90%, 95%, 98% or 99% identity to specific polypeptides described herein and preferably exhibiting substantially the same functions, as well as polynucleotide encoding such polypeptides, are contemplated. Unless otherwise indicated a similarity score will be based on use of BLOSUM62. When BLASTP is used, the percent similarity is based on the BLASTP positives score and the percent sequence identity is based on the BLASTP identities score. BLASTP Identities shows the number and fraction of total residues in the high scoring sequence pairs which are identical; and BLASTP Positives shows the number and fraction of residues for which the alignment scores have positive values and which are similar to each other. Amino acid sequences having these degrees of identity or similarity or any intermediate degree of identity of similarity to the amino acid sequences disclosed herein are contemplated and encompassed by this disclosure. The polynucleotide sequences of similar polypeptides are deduced using the genetic code and may be obtained by conventional means, in particular by reverse translating its amino acid sequence using the genetic code.

    [0167] The term nucleic acid refers to a natural or synthetic molecule comprising a single nucleotide or two or more nucleotides linked by a phosphate group at the 3 position of one nucleotide to the 5 end of another nucleotide. The nucleic acid is not limited by length, and thus the nucleic acid can include deoxyribonucleic acid (DNA) or ribonucleic acid (RNA).

    [0168] The term operably linked to refers to the functional relationship of a nucleic acid with another nucleic acid sequence. Promoters, enhancers, transcriptional and translational stop sites, and other signal sequences are examples of nucleic acid sequences operably linked to other sequences. For example, operable linkage of DNA to a transcriptional control element refers to the physical and functional relationship between the DNA and promoter such that the transcription of such DNA is initiated from the promoter by an RNA polymerase that specifically recognizes, binds to and transcribes the DNA.

    [0169] The terms peptide, protein, and polypeptide are used interchangeably to refer to a natural or synthetic molecule comprising two or more amino acids linked by the carboxyl group of one amino acid to the alpha amino group of another.

    [0170] The term pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.

    [0171] The term protein domain refers to a portion of a protein, portions of a protein, or an entire protein showing structural integrity; this determination may be based on amino acid composition of a portion of a protein, portions of a protein, or the entire protein.

    [0172] A spacer as used herein refers to a peptide that joins the proteins comprising a fusion protein. Generally a spacer has no specific biological activity other than to join the proteins or to preserve some minimum distance or other spatial relationship between them. However, the constituent amino acids of a spacer may be selected to influence some property of the molecule such as the folding, net charge, or hydrophobicity of the molecule.

    [0173] The term specifically binds, as used herein, when referring to a polypeptide (including antibodies) or receptor, refers to a binding reaction which is determinative of the presence of the protein or polypeptide or receptor in a heterogeneous population of proteins and other biologics. Thus, under designated conditions (e.g. immunoassay conditions in the case of an antibody), a specified ligand or antibody specifically binds to its particular target (e.g. an antibody specifically binds to an endothelial antigen) when it does not bind in a significant amount to other proteins present in the sample or to other proteins to which the ligand or antibody may come in contact in an organism. Generally, a first molecule that specifically binds a second molecule has an affinity constant (Ka) greater than about 10.sup.s M.sup.?1 (e.g., 10.sup.8 M.sup.?1, 10.sup.7 M.sup.?1, 10.sup.8 M.sup.?1, 10.sup.9 M.sup.?1, 10.sup.10 M.sup.?1, 10.sup.11 M.sup.?1, and 10.sup.12 M.sup.?1 or more) with that second molecule.

    [0174] The term specifically deliver as used herein refers to the preferential association of a molecule with a cell or tissue bearing a particular target molecule or marker and not to cells or tissues lacking that target molecule. It is, of course, recognized that a certain degree of non-specific interaction may occur between a molecule and a non-target cell or tissue. Nevertheless, specific delivery, may be distinguished as mediated through specific recognition of the target molecule. Typically specific delivery results in a much stronger association between the delivered molecule and cells bearing the target molecule than between the delivered molecule and cells lacking the target molecule.

    [0175] The term subject refers to any individual who is the target of administration or treatment. The subject can be a vertebrate, for example, a mammal. Thus, the subject can be a human or veterinary patient. The term patient refers to a subject under the treatment of a clinician, e.g., physician.

    [0176] The term therapeutically effective refers to the amount of the composition used is of sufficient quantity to ameliorate one or more causes or symptoms of a disease or disorder. Such amelioration only requires a reduction or alteration, not necessarily elimination.

    [0177] The terms transformation and transfection mean the introduction of a nucleic acid, e.g., an expression vector, into a recipient cell including introduction of a nucleic acid to the chromosomal DNA of said cell.

    [0178] The term treatment refers to the medical management of a patient with the intent to cure, ameliorate, stabilize, or prevent a disease, pathological condition, or disorder. This term includes active treatment, that is, treatment directed specifically toward the improvement of a disease, pathological condition, or disorder, and also includes causal treatment, that is, treatment directed toward removal of the cause of the associated disease, pathological condition, or disorder. In addition, this term includes palliative treatment, that is, treatment designed for the relief of symptoms rather than the curing of the disease, pathological condition, or disorder; preventative treatment, that is, treatment directed to minimizing or partially or completely inhibiting the development of the associated disease, pathological condition, or disorder; and supportive treatment, that is, treatment employed to supplement another specific therapy directed toward the improvement of the associated disease, pathological condition, or disorder.

    [0179] The term variant refers to an amino acid or peptide sequence having conservative amino acid substitutions, non-conservative amino acid subsitutions (i.e. a degenerate variant), substitutions within the wobble position of each codon (i.e. DNA and RNA) encoding an amino acid, amino acids added to the C-terminus of a peptide, or a peptide having 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% sequence identity to a reference sequence.

    [0180] The term vector refers to a nucleic acid sequence capable of transporting into a cell another nucleic acid to which the vector sequence has been linked. The term expression vector includes any vector, (e.g., a plasmid, cosmid or phage chromosome) containing a gene construct in a form suitable for expression by a cell (e.g., linked to a transcriptional control element).

    [0181] A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.

    EXAMPLES

    Example 1

    [0182] Mice were immunized, sacrificed, and spleens isolated. Splenocytes were prepared as single cell suspensions and used to isolate RNA. The RNA was submitted for Genewiz IgH and IgL sequencing. Bioinformatics was performed to determine the most frequenct rearrangements, which presumably would encode for anti-TIM3 reactivity. The sequences were then used to develop scFv and design CARs with different pairs of IgH scFv and IgL scFv. These scFv were cloned into a retroviral construct and used to make virus and transduce T cells for validation

    Example 2

    [0183] Retrovirus was used to transduce T cells and used for a cytotoxicity assay (Real Time Cell Anlaysis) by incubating adherent targets and CAR T cells. A similar assay was used to detect secretion of Interferon-gamma. But after 4 hours of stimulation the cells were fixed and analyzed for intracellular IFNgamma. Cytokines were also analyzed by secretion assays. Targets were mixed with CAR T cells and after an overnight incubated the supernatant was collected and assayed by Luminx for the cytokines noted tin the figures. For the in vivo study immune-deficient NSG mice were injected with primary AML. After engraftment of the AML the mice were treated with anti-TIM3 CAR T cells and blood was monitored for CAR T cell expansion and AML killing.

    [0184] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.

    [0185] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.