ANTIBODIES TO HUMAN RESPIRATORY SYNCYTIAL VIRUS PROTEIN F PRE-FUSION CONFORMATION AND METHODS OF USE THEREFOR
20190367586 ยท 2019-12-05
Assignee
Inventors
Cpc classification
C07K16/1027
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
International classification
Abstract
The present disclosure is directed to antibodies binding to human respiratory syncytial virus F protein, including both neutralizing and non-neutralizing antibodies, and methods for use thereof.
Claims
1. A method of detecting a human respiratory syncytial virus infection in a subject comprising: (a) contacting a sample from said subject with an antibody or antibody fragment having clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively; and (b) detecting human respiratory syncytial virus in said sample by binding of said antibody or antibody fragment to a Human respiratory syncytial virus antigen in said sample.
2. The method of claim 1, wherein said sample is a body fluid.
3. The method of claim 1, wherein said sample is blood, sputum, tears, saliva, mucous or serum, urine, exudate, transudate, tissue scrapings or feces.
4. The method of claim 1, wherein detection comprises ELISA, RIA or Western blot.
5. The method of claim 1, further comprising performing steps (a) and (b) a second time and determining a change in human respiratory syncytial virus antigen levels as compared to the first assay.
6. The method of claim 1, wherein the antibody or antibody fragment is encoded by clone-paired variable sequences as set forth in Table 1.
7. The method of claim 1, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having 70%, 80%, or 90% identity to clone-paired variable sequences as set forth in Table 1.
8. The method of claim 1, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having 95% identity to clone-paired sequences as set forth in Table 1.
9. The method of claim 1, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences according to clone-paired sequences from Table 2.
10. The method of claim 1, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences having 70%, 80% or 90% identity to clone-paired sequences from Table 2.
11. The method of claim 1, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences having 95% identity to clone-paired sequences from Table 2.
12. The method of claim 1, wherein the antibody fragment is a recombinant scFv (single chain fragment variable) antibody, Fab fragment, F(ab).sub.2 fragment, or Fv fragment.
13. A method of treating a subject infected with human respiratory syncytial virus, or reducing the likelihood of infection of a subject at risk of contracting human respiratory syncytial virus, comprising delivering to said subject an antibody or antibody fragment having clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively.
14. The method of claim 13, the antibody or antibody fragment is encoded by clone-paired light and heavy chain variable sequences as set forth in Table 1.
15. The method of claim 13, the antibody or antibody fragment is encoded by clone-paired light and heavy chain variable sequences having 95% identify to as set forth in Table 1.
16. The method of claim 13, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having 70%, 80%, or 90% identity to clone-paired sequences from Table 1.
17. The method of claim 13, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences according to clone-paired sequences from Table 2.
18. The method of claim 13, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences having 70%, 80% or 90% identity to clone-paired sequences from Table 2.
19. The method of claim 13, encoded by light and heavy chain variable sequences having 95% identity to clone-paired sequences from Table 2.
20. The method of claim 13, wherein the antibody fragment is a recombinant scFv (single chain fragment variable) antibody, Fab fragment, F(ab).sub.2 fragment, or Fv fragment, a chimeric antibody and/or is an IgG.
21. The method of claim 13, wherein said antibody or antibody fragment recognizes an epitope on pre-fusion RSV F protein in antigenic site VIII, and optionally is specific for an epitope on pre-fusion RSV F protein in antigenic site VIII.
22. The method of claim 21, wherein said antibody or antibody fragment neutralizes RSV A and B subgroups, and/or binds to metapneumovirus fusion protein.
23. The method of claim 13, wherein said antibody or antibody fragment is administered prior to infection.
24. The method of claim 13, wherein said antibody or antibody fragment is administered after infection.
25. The method of claim 13, wherein delivering comprises antibody or antibody fragment administration, or genetic delivery with an RNA or DNA sequence or vector encoding the antibody or antibody fragment.
26. A monoclonal antibody, wherein the antibody or antibody fragment is characterized by clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively.
27-35. (canceled)
36. A hybridoma or engineered cell encoding an antibody or antibody fragment wherein the antibody or antibody fragment is characterized by clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively.
37. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences according to clone-paired sequences from Table 1.
38. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having at least 70%, 80%, or 90% identity to clone-paired variable sequences from Table 1.
39. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having 95% identity to clone-paired variable sequences from Table 1.
40. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences according to clone-paired sequences from Table 2.
41. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment is encoded by light and heavy chain variable sequences having at least 70%, 80%, or 90% identity to clone-paired variable sequences from Table 2.
42. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment comprises light and heavy chain variable sequences having 95% identity to clone-paired sequences from Table 2.
43. The hybridoma or engineered cell of claim 36, wherein the antibody fragment is a recombinant scFv (single chain fragment variable) antibody, Fab fragment, F(ab).sub.2 fragment, or Fv fragment.
44. The hybridoma or engineered cell of claim 36, wherein said antibody is a chimeric antibody, a bispecific antibody, and/or is an IgG.
45. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment recognizes an epitope on pre-fusion RSV F protein in antigenic site VIII, and optionally is specific for an epitope on pre-fusion RSV F protein in antigenic site VIII, and/or neutralizes RSV A and B subgroups, and/or binds to metapneumovirus fusion protein.
46. The hybridoma or engineered cell of claim 36, wherein said antibody or antibody fragment further comprises a cell penetrating peptide and/or is an intrabody.
47. A vaccine formulation comprising one or more antibodies or antibody fragments characterized by clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively.
48. The vaccine formulation of claim 47, wherein at least one of said antibodies or antibody fragments is encoded by light and heavy chain variable sequences according to clone-paired sequences from Table 1.
49. The vaccine formulation of claim 47, wherein at least one of said antibodies or antibody fragments is encoded by light and heavy chain variable sequences having at least 70%, 80%, or 90% identity to clone-paired sequences from Table 1.
50. The vaccine formulation of claim 47, wherein at least one of said antibodies or antibody fragments is encoded by light and heavy chain variable sequences having at least 95% identity to clone-paired sequences from Table 1.
51. The vaccine formulation of claim 47, wherein at least one of said antibodies or antibody fragments comprises light and heavy chain variable sequences according to clone-paired sequences from Table 2.
52. The vaccine formulation of claim 47, wherein at least one of said antibodies or antibody fragments comprises light and heavy chain variable sequences having 95% identity to clone-paired sequences from Table 2.
53. The vaccine formulation of claim 47, wherein at least one of said antibody fragments is a recombinant ScFv (single chain fragment variable) antibody, Fab fragment, F(ab).sub.2 fragment, or Fv fragment.
54. The vaccine formulation of claim 47, wherein at least one of said antibodies is a chimeric antibody, is bispecific antibody, and/or is an IgG.
55. The vaccine formulation of claim 47, wherein said antibody or antibody fragment recognizes an epitope on pre-fusion RSV F protein in antigenic site VIII, and optionally is specific for an epitope on pre-fusion RSV F protein in antigenic site VIII, and/or neutralizes RSV A and B subgroups, and/or binds to metapneumovirus fusion protein.
56. The vaccine formulation of claim 47, wherein at least one of said antibodies or antibody fragments further comprises a cell penetrating peptide and/or is an intrabody.
57. A method of identifying anti-human respiratory syncytial virus (hRSV) protein F site VIII-specific monoclonal antibody or polyclonal neutralizing antibodies comprising: (a) contacting a candidate monoclonal antibody or polyclonal serum with hRSV protein F in the presence of a known site VIII-specific neutralizing antibody or antigen binding fragment thereof; (b) assessing binding of said candidate monoclonal antibody or polyclonal serum to hRSV protein F; and (c) identifying said candidate monoclonal antibody or polyclonal serum as protein F site VIII-specific neutralizing when said known site VIII-specific neutralizing antibodies or antigen binding fragment thereof blocks binding of said candidate monoclonal antibody or polyclonal serum to hRSV protein F.
58-70. (canceled)
71. A method of identifying the presence of human respiratory syncytial virus (hRSV) protein F site VIII protective antigen in a vaccine or virus preparation using human respiratory syncytial virus (hRSV) protein F site VIII-specific monoclonal or polyclonal neutralizing antibodies comprising: (a) contacting a candidate vaccine or virus composition with a known site VIII-specific neutralizing antibody or antigen binding fragment thereof; (b) assessing binding of said candidate vaccine or virus composition to a known site VIII-specific neutralizing antibody or antigen binding fragment; and (c) identifying said candidate vaccine or virus composition as containing the protein F site VIII protective epitope when one or more known site VIII-specific neutralizing antibodies bind to the candidate vaccine or virus composition.
72. A method of determining the antigenic integrity of an antigen comprising: (a) contacting a sample comprising said antigen with a first antibody or antibody fragment having clone-paired heavy and light chain CDR sequences from Tables 3 and 4, respectively; and (b) determining antigenic integrity of said antigen by detectable binding of said antibody or antibody fragment to said antigen.
73.-92. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0018] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure. The disclosure may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0031] Respiratory syncytial virus (RSV) remains a major human pathogen, infecting the majority of infants before age two and causing reinfection throughout life. Despite decades of RSV research, there is no licensed RSV vaccine. Most candidate vaccines studied to date have incorporated the RSV fusion (F) surface glycoprotein, since the sequence of F is highly conserved among strains of RSV. In order to better define the human B cell response to RSV F, the inventors isolated from a single donor thirteen new neutralizing human monoclonal antibodies (mAbs) that recognized the RSV F protein in the pre-fusion conformation. Epitope binning studies showed that the majority of neutralizing mAbs targeted a new antigenic site on the globular head domain of F, designated here antigenic site VIII, which occupies an intermediate position between the previously defined major antigenic sites II and site . Antibodies to site VIII competed for binding with antibodies to both of those adjacent neutralizing sites. The new mAbs exhibited unusual breadth for pre-fusion F-specific antibodies, cross-reacting with F proteins from both RSV subgroups A and B viruses. The inventors solved the X-ray crystal structure of one site VIII mAb, hRSV90, in complex with pre-fusion RSV F protein. The structure revealed a large footprint of interaction for hRSV90 on RSV F, in which the heavy chain and light chain both have specific interactions mediating binding to site VIII, the heavy chain overlaps with site , and the light chain interacts partially with site II. These and other aspects of the disclosure are set forth in detail below. These and other aspects of the disclosure are described in detail below.
I. RESPIRATORY SYNCYTIAL VIRUS
[0032] Human respiratory syncytial virus (RSV) is a syncytial virus that causes respiratory tract infections. It is a major cause of lower respiratory tract infections and hospital visits during infancy and childhood. A prophylactic medication, palivizumab, can be employed to prevent human RSV in preterm (under 35 weeks gestation) infants, infants with certain congenital heart defects (CHD) or bronchopulmonary dysplasia (BPD), and infants with congenital malformations of the airway. Treatment is limited to supportive care (e.g., C-PAP), including oxygen therapy.
[0033] Human RSV is a negative-sense, single-stranded RNA virus of the family Pneumoviridae. Its name comes from the fact that F proteins on the surface of the virus cause the cell membranes on nearby cells to merge, forming syncytia. It was first isolated in 1956 from a chimpanzee, and called Chimpanzee Coryza Agent (CCA). Also in 1956, a new type of cytopathogenic myxovirus was isolated from a group of human infants with infantile croup.
[0034] In temperate climates there is an annual epidemic during the winter months. In tropical climates, infection is most common during the rainy season. In the United States, 60% of infants are infected during their first RSV season, and nearly all children will have been infected with the virus by 2-3 years of age. Of those infected with RSV, 2-3% will develop bronchiolitis, necessitating hospitalization. Natural infection with HRSV induces protective immunity which wanes over timepossibly more so than other respiratory viral infectionsand thus people can be infected multiple times. Sometimes an infant can become symptomatically infected more than once, even within a single HRSV season. Severe HRSV infections have increasingly been found among elderly patients. Young adults can be re-infected every five to seven years, with symptoms looking like a sinus infection or a cold (infections can also be asymptomatic).
[0035] The incubation time (from infection until symptoms arrive) is 4-5 days. For adults, HRSV produces mainly mild symptoms, often indistinguishable from common colds and minor illnesses. The Centers for Disease Control consider HRSV to be the most common cause of bronchiolitis (inflammation of the small airways in the lung) and pneumonia in children under 1 year of age in the United States. For some children, RSV can cause bronchiolitis, leading to severe respiratory illness requiring hospitalization and, rarely, causing death. This is more likely to occur in patients that are immunocompromised or infants born prematurely. Other HRSV symptoms common among infants include listlessness, poor or diminished appetite, and a possible fever.
[0036] Recurrent wheezing and asthma are more common among individuals who suffered severe HRSV infection during the first few months of life than among controls; whether HRSV infection sets up a process that leads to recurrent wheezing or whether those already predisposed to asthma are more likely to become severely ill with HRSV has yet to be determined.
[0037] Symptoms of pneumonia in immuno-compromised patients such as in transplant patients and especially bone marrow transplant patients should be evaluated to rule out HRSV infection. This can be done by means of polymerase chain reaction (PCR) testing for HRSV nucleic acids in peripheral blood samples if all other infectious processes have been ruled out or if it is highly suspicious for RSV such as a recent exposure to a known source of HRSV infection.
[0038] Complications include bronchiolitis or pneumonia, asthma, recurring infections, and acute otitis media.
[0039] Transmission.
[0040] The incubation period is 2-8 days, but is usually 4-6 days. RSV spreads easily by direct contact, and can remain viable for a half an hour or more on hands or for up to 5 hours on countertops. Childcare facilities allow for rapid child-to-child transmission in a short period of time. RSV can last 2-8 days, but symptoms may persist for up to three weeks.
[0041] The human RSV is virtually the same as chimpanzee coryza virus and can be transmitted from apes to humans, although transmission from humans to apes is more common. The virus has also been recovered from cattle, goats and sheep, but these are not regarded as major vectors of transmission and there is no animal reservoir of the virus.
[0042] Virology.
[0043] Human RSV is a medium-sized (120-200 nm) enveloped virus that contains a lipoprotein coat and a linear negative-sense RNA genome (must be converted to an anti-sense genome prior to translation). The former contains virally encoded F, G, and SH lipoproteins. The F and G lipoproteins are the only two that target the cell membrane, and are highly conserved among RSV isolates. HRSV is divided into two antigenic subgroups, A and B, on the basis of the reactivity of the virus with monoclonal antibodies against the attachment (G) and fusion (F) glycoproteins. Subtype B is characterized as the asymptomatic strains of the virus that the majority of the population experiences. The more severe clinical illnesses involve subtype A strains, which tend to predominate in most outbreaks.
[0044] The genome is 15,000 nucleotides in length and is composed of a single strand of RNA with negative polarity. It has 10 genes encoding 11 proteins. To date, 10 HRSV-A genotypes have been designated, GA1 to GA7, SAA1, NA1, and NA2. The HRSV-B genotypes include GB1 to GB4, SAB1 to SAB3, and BA1 to BA6. The genome of HRSV was completely sequenced in 1997.
[0045] Diagnosis.
[0046] Human respiratory syncytial virus may be suspected based on the time of year of the infection; prevalence usually coincides with the winter flu season. Tests include (a) chest X-rays to check for typical bilateral perihilar fullness of bronchiolitis induced by the virus, (b) skin monitoring to check for hypoxemia, a lower than usual level of oxygen in the bloodstream, (c) blood tests to check white cell counts or to look for the presence of viruses, bacteria or other organisms, and (d) lab testing of respiratory secretions.
[0047] Several different types of laboratory tests are commercially available for diagnosis of RSV infection. Rapid diagnostic assays performed on respiratory specimens are available commercially. Most clinical laboratories currently utilize antigen detection tests. Compared with culture, the sensitivity of antigen detection tests generally ranges from 80% to 90%. Antigen detection tests and culture are generally reliable in young children but less useful in older children and adults.
[0048] Sensitivity of virus isolation from respiratory secretions in cell culture varies among laboratories. RT-PCR assays are now commercially available. The sensitivity of these assays is equal to or exceeds the sensitivity of virus isolation and antigen detections methods. Highly sensitive RT-PCR assays should be considered when testing adults, because they may have low viral loads in their respiratory specimens.
[0049] Serologic tests are less frequently used for diagnosis. Although useful for research, a diagnosis using a collection of paired acute and convalescent sera to demonstrate a significant rise in antibody titer to HRSV cannot be made in time to guide care of the patient. On top of that, the antibody level does not always correlate with the acuteness or activity level of the infection.
[0050] RSV infection can be confirmed using tests for antigens or antibodies, or viral RNA by reverse transcription PCR. Quantification of viral load can be determined by various assay tests.
[0051] Prevention.
[0052] As the virus is ubiquitous in all parts of the world, avoidance of infection is not possible. However, palivizumab (brand name Synagis manufactured by MedImmune), a moderately effective prophylactic drug, is available for infants at high risk. Palivizumab is a monoclonal antibody directed against RSV surface fusion protein. It is given by monthly injections, which are begun just prior to the RSV season and are usually continued for five months. HRSV prophylaxis is indicated for infants that are premature or have either cardiac or lung disease, but the cost of prevention limits use in many parts of the world.
[0053] Vaccine Research.
[0054] A vaccine trial in 1960s using a formalin-inactivated vaccine (FI-RSV) increased disease severity in children who had been vaccinated. There is much active investigation into the development of a new vaccine, but at present no vaccine exists. Some of the most promising candidates are based on temperature sensitive mutants which have targeted genetic mutations to reduce virulence.
[0055] Scientists are attempting to develop a recombinant human respiratory syncytial virus vaccine that is suitable for intranasal instillation. Tests for determining the safety and level of resistance that can be achieved by the vaccine are being conducted in the chimpanzee, which is the only known animal that develops a respiratory illness similar to humans.
[0056] The development of a commercial human RSV vaccine has remained elusive. Recent breakthroughs have sparked continued interest in this highly sought after vaccine as the annual medical burden relating to human RSV has remained high, equal to Influenza and Pneumococcus.
[0057] Treatment.
[0058] To date, treatment has been limited to supportive measures. Adrenaline, bronchodilators, steroids, antibiotics, and ribavirin confer no real benefit. Studies of nebulized hypertonic saline have shown that the use of nebulized 3% HS is a safe, inexpensive, and effective treatment for infants hospitalized with moderately severe viral bronchiolitis where respiratory syncytial virus (RSV) accounts for the majority of viral bronchiolitis cases. One study noted a 26% reduction in length of stay: 2.61.9 days, compared with 3.52.9 days in the normal-saline treated group (p=0.05). Supportive care includes fluids and oxygen until the illness runs its course. Salbutamol may be used in an attempt to relieve any bronchospasm if present. Increased airflow, humidified and delivered via nasal cannula, may be supplied in order to reduce the effort required for respiration.
II. MONOCLONAL ANTIBODIES AND PRODUCTION THEREOF
[0059] A. General Methods
[0060] It will be understood that monoclonal antibodies binding to Human respiratory syncytial virus will have several applications. These include the production of diagnostic kits for use in detecting and diagnosing Human respiratory syncytial virus infection, as well as for treating the same. In these contexts, one may link such antibodies to diagnostic or therapeutic agents, use them as capture agents or competitors in competitive assays, or use them individually without additional agents being attached thereto. The antibodies may be mutated or modified, as discussed further below. Methods for preparing and characterizing antibodies are well known in the art (see, e.g., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, 1988; U.S. Pat. No. 4,196,265).
[0061] The methods for generating monoclonal antibodies (MAbs) generally begin along the same lines as those for preparing polyclonal antibodies. The first step for both these methods is immunization of an appropriate host or identification of subjects who are immune due to prior natural infection. As is well known in the art, a given composition for immunization may vary in its immunogenicity. It is often necessary therefore to boost the host immune system, as may be achieved by coupling a peptide or polypeptide immunogen to a carrier. Exemplary and preferred carriers are keyhole limpet hemocyanin (KLH) and bovine serum albumin (BSA). Other albumins such as ovalbumin, mouse serum albumin or rabbit serum albumin can also be used as carriers. Means for conjugating a polypeptide to a carrier protein are well known in the art and include glutaraldehyde, m-maleimidobenzoyl-N-hydroxysuccinimide ester, carbodiimyde and bis-biazotized benzidine. As also is well known in the art, the immunogenicity of a particular immunogen composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants. Exemplary and preferred adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants and aluminum hydroxide adjuvant.
[0062] In the case of human antibodies against natural pathogens, a suitable approach is to identify subjects that have been exposed to the pathogens, such as those who have been diagnosed as having contracted the disease, or those who have been vaccinated to generate protective immunity against the pathogen. Circulating anti-pathogen antibodies can be detected, and antibody producing B cells from the antibody-positive subject may then be obtained.
[0063] The amount of immunogen composition used in the production of polyclonal antibodies varies upon the nature of the immunogen as well as the animal used for immunization. A variety of routes can be used to administer the immunogen (subcutaneous, intramuscular, intradermal, intravenous and intraperitoneal). The production of polyclonal antibodies may be monitored by sampling blood of the immunized animal at various points following immunization. A second, booster injection, also may be given. The process of boosting and titering is repeated until a suitable titer is achieved. When a desired level of immunogenicity is obtained, the immunized animal can be bled and the serum isolated and stored, and/or the animal can be used to generate MAbs.
[0064] Following immunization, somatic cells with the potential for producing antibodies, specifically B lymphocytes (B cells), are selected for use in the MAb generating protocol. These cells may be obtained from biopsied spleens or lymph nodes, or from circulating blood. The antibody-producing B lymphocytes from the immunized animal are then fused with cells of an immortal myeloma cell, generally one of the same species as the animal that was immunized or human or human/mouse chimeric cells. Myeloma cell lines suited for use in hybridoma-producing fusion procedures preferably are non-antibody-producing, have high fusion efficiency, and enzyme deficiencies that render then incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas). Any one of a number of myeloma cells may be used, as are known to those of skill in the art (Goding, pp. 65-66, 1986; Campbell, pp. 75-83, 1984).
[0065] Methods for generating hybrids of antibody-producing spleen or lymph node cells and myeloma cells usually comprise mixing somatic cells with myeloma cells in a 2:1 proportion, though the proportion may vary from about 20:1 to about 1:1, respectively, in the presence of an agent or agents (chemical or electrical) that promote the fusion of cell membranes. Fusion methods using Sendai virus have been described by Kohler and Milstein (1975; 1976), and those using polyethylene glycol (PEG), such as 37% (v/v) PEG, by Gefter et al. (1977). The use of electrically induced fusion methods also is appropriate (Goding, pp. 71-74, 1986). Fusion procedures usually produce viable hybrids at low frequencies, about 110.sup.6 to 110.sup.8. However, this does not pose a problem, as the viable, fused hybrids are differentiated from the parental, infused cells (particularly the infused myeloma cells that would normally continue to divide indefinitely) by culturing in a selective medium. The selective medium is generally one that contains an agent that blocks the de novo synthesis of nucleotides in the tissue culture media. Exemplary and preferred agents are aminopterin, methotrexate, and azaserine. Aminopterin and methotrexate block de novo synthesis of both purines and pyrimidines, whereas azaserine blocks only purine synthesis. Where aminopterin or methotrexate is used, the media is supplemented with hypoxanthine and thymidine as a source of nucleotides (HAT medium). Where azaserine is used, the media is supplemented with hypoxanthine. Ouabain is added if the B cell source is an Epstein Barr virus (EBV) transformed human B cell line, in order to eliminate EBV transformed lines that have not fused to the myeloma.
[0066] The preferred selection medium is HAT or HAT with ouabain. Only cells capable of operating nucleotide salvage pathways are able to survive in HAT medium. The myeloma cells are defective in key enzymes of the salvage pathway, e.g., hypoxanthine phosphoribosyl transferase (HPRT), and they cannot survive. The B cells can operate this pathway, but they have a limited life span in culture and generally die within about two weeks. Therefore, the only cells that can survive in the selective media are those hybrids formed from myeloma and B cells. When the source of B cells used for fusion is a line of EBV-transformed B cells, as here, ouabain may also be used for drug selection of hybrids as EBV-transformed B cells are susceptible to drug killing, whereas the myeloma partner used is chosen to be ouabain resistant.
[0067] Culturing provides a population of hybridomas from which specific hybridomas are selected. Typically, selection of hybridomas is performed by culturing the cells by single-clone dilution in microtiter plates, followed by testing the individual clonal supernatants (after about two to three weeks) for the desired reactivity. The assay should be sensitive, simple and rapid, such as radioimmunoassays, enzyme immunoassays, cytotoxicity assays, plaque assays dot immunobinding assays, and the like. The selected hybridomas are then serially diluted or single-cell sorted by flow cytometric sorting and cloned into individual antibody-producing cell lines, which clones can then be propagated indefinitely to provide mAbs. The cell lines may be exploited for MAb production in two basic ways. A sample of the hybridoma can be injected (often into the peritoneal cavity) into an animal (e.g., a mouse). Optionally, the animals are primed with a hydrocarbon, especially oils such as pristane (tetramethylpentadecane) prior to injection. When human hybridomas are used in this way, it is optimal to inject immunocompromised mice, such as SCID mice, to prevent tumor rejection. The injected animal develops tumors secreting the specific monoclonal antibody produced by the fused cell hybrid. The body fluids of the animal, such as serum or ascites fluid, can then be tapped to provide MAbs in high concentration. The individual cell lines could also be cultured in vitro, where the MAbs are naturally secreted into the culture medium from which they can be readily obtained in high concentrations. Alternatively, human hybridoma cells lines can be used in vitro to produce immunoglobulins in cell supernatant. The cell lines can be adapted for growth in serum-free medium to optimize the ability to recover human monoclonal immunoglobulins of high purity.
[0068] MAbs produced by either means may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as FPLC or affinity chromatography. Fragments of the monoclonal antibodies of the disclosure can be obtained from the purified monoclonal antibodies by methods which include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction. Alternatively, monoclonal antibody fragments encompassed by the present disclosure can be synthesized using an automated peptide synthesizer.
[0069] It also is contemplated that a molecular cloning approach may be used to generate monoclonals. For this, RNA can be isolated from the hybridoma line and the antibody genes obtained by RT-PCR and cloned into an immunoglobulin expression vector. Alternatively, combinatorial immunoglobulin phagemid libraries are prepared from RNA isolated from the cell lines and phagemids expressing appropriate antibodies are selected by panning using viral antigens. The advantages of this approach over conventional hybridoma techniques are that approximately 10.sup.4 times as many antibodies can be produced and screened in a single round, and that new specificities are generated by H and L chain combination which further increases the chance of finding appropriate antibodies.
[0070] Other U.S. patents, each incorporated herein by reference, that teach the production of antibodies useful in the present disclosure include U.S. Pat. No. 5,565,332, which describes the production of chimeric antibodies using a combinatorial approach; U.S. Pat. No. 4,816,567 which describes recombinant immunoglobulin preparations; and U.S. Pat. No. 4,867,973 which describes antibody-therapeutic agent conjugates.
[0071] B. Antibodies of the Present Disclosure
[0072] Antibodies according to the present disclosure may be defined, in the first instance, by their binding specificity. Those of skill in the art, by assessing the binding specificity/affinity of a given antibody using techniques well known to those of skill in the art, can determine whether such antibodies fall within the scope of the instant claims. In one aspect, there are provided monoclonal antibodies having clone-paired CDR's from the heavy and light chains as illustrated in Tables 3 and 4, respectively. Such antibodies may be produced by the clones discussed below in the Examples section using methods described herein.
[0073] In particular, the antibodies of the present disclosure, in one aspect, relate to the identification, through their binding specificity, of a previously unrecognized epitope that lies within what the inventors now term antigenic site VIII. This epitope is located between sites II and , while also being close to the trimer-dependent mAb AM14 site and distant from antigenic site IV. Residues 16, 173, 174, 194, and 201 of RSV F all appear to have some involvement.
[0074] In a second aspect, the antibodies may be defined by their variable sequence, which include additional framework regions. These are provided in Tables 1 and 2 that encode or represent full variable regions. Furthermore, the antibodies sequences may vary from these sequences, optionally using methods discussed in greater detail below. For example, nucleic acid sequences may vary from those set out above in that (a) the variable regions may be segregated away from the constant domains of the light and heavy chains, (b) the nucleic acids may vary from those set out above while not affecting the residues encoded thereby, (c) the nucleic acids may vary from those set out above by a given percentage, e.g., 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, (d) the nucleic acids may vary from those set out above by virtue of the ability to hybridize under high stringency conditions, as exemplified by low salt and/or high temperature conditions, such as provided by about 0.02 M to about 0.15 M NaCl at temperatures of about 50 C. to about 70 C., (e) the amino acids may vary from those set out above by a given percentage, e.g., 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, or (0 the amino acids may vary from those set out above by permitting conservative substitutions (discussed below). Each of the foregoing applies to the nucleic acid sequences set forth as Table 1 and the amino acid sequences of Table 2.
[0075] C. Engineering of Antibody Sequences
[0076] In various embodiments, one may choose to engineer sequences of the identified antibodies for a variety of reasons, such as improved expression, improved cross-reactivity or diminished off-target binding. The following is a general discussion of relevant techniques for antibody engineering.
[0077] Hybridomas may be cultured, then cells lysed, and total RNA extracted. Random hexamers may be used with RT to generate cDNA copies of RNA, and then PCR performed using a multiplex mixture of PCR primers expected to amplify all human variable gene sequences. PCR product can be cloned into pGEM-T Easy vector, then sequenced by automated DNA sequencing using standard vector primers. Assay of binding and neutralization may be performed using antibodies collected from hybridoma supernatants and purified by FPLC, using Protein G columns.
[0078] Recombinant full length IgG antibodies were generated by subcloning heavy and light chain Fv DNAs from the cloning vector into an IgG plasmid vector, transfected into 293 Freestyle cells or CHO cells, and antibodies were collected an purified from the 293 or CHO cell supernatant.
[0079] The rapid availability of antibody produced in the same host cell and cell culture process as the final cGMP manufacturing process has the potential to reduce the duration of process development programs. Lonza has developed a generic method using pooled transfectants grown in CDACF medium, for the rapid production of small quantities (up to 50 g) of antibodies in CHO cells. Although slightly slower than a true transient system, the advantages include a higher product concentration and use of the same host and process as the production cell line. Example of growth and productivity of GS-CHO pools, expressing a model antibody, in a disposable bioreactor: in a disposable bag bioreactor culture (5 L working volume) operated in fed-batch mode, a harvest antibody concentration of 2 g/L was achieved within 9 weeks of transfection.
[0080] Antibody molecules will comprise fragments (such as F(ab), F(ab).sub.2) that are produced, for example, by the proteolytic cleavage of the mAbs, or single-chain immunoglobulins producible, for example, via recombinant means. Such antibody derivatives are monovalent. In one embodiment, such fragments can be combined with one another, or with other antibody fragments or receptor ligands to form chimeric binding molecules. Significantly, such chimeric molecules may contain substituents capable of binding to different epitopes of the same molecule.
[0081] In related embodiments, the antibody is a derivative of the disclosed antibodies, e.g., an antibody comprising the CDR sequences identical to those in the disclosed antibodies (e.g., a chimeric, or CDR-grafted antibody). Alternatively, one may wish to make modifications, such as introducing conservative changes into an antibody molecule. In making such changes, the hydropathic index of amino acids may be considered. The importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
[0082] It also is understood in the art that the substitution of like amino acids can be made effectively on the basis of hydrophilicity. U.S. Pat. No. 4,554,101, incorporated herein by reference, states that the greatest local average hydrophilicity of a protein, as governed by the hydrophilicity of its adjacent amino acids, correlates with a biological property of the protein. As detailed in U.S. Pat. No. 4,554,101, the following hydrophilicity values have been assigned to amino acid residues: basic amino acids: arginine (+3.0), lysine (+3.0), and histidine (0.5); acidic amino acids: aspartate (+3.01), glutamate (+3.01), asparagine (+0.2), and glutamine (+0.2); hydrophilic, nonionic amino acids: serine (+0.3), asparagine (+0.2), glutamine (+0.2), and threonine (0.4), sulfur containing amino acids: cysteine (1.0) and methionine (1.3); hydrophobic, nonaromatic amino acids: valine (1.5), leucine (1.8), isoleucine (1.8), proline (0.51), alanine (0.5), and glycine (0); hydrophobic, aromatic amino acids: tryptophan (3.4), phenylalanine (2.5), and tyrosine (2.3).
[0083] It is understood that an amino acid can be substituted for another having a similar hydrophilicity and produce a biologically or immunologically modified protein. In such changes, the substitution of amino acids whose hydrophilicity values are within 2 is preferred, those that are within 1 are particularly preferred, and those within 0.5 are even more particularly preferred.
[0084] As outlined above, amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like. Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
[0085] The present disclosure also contemplates isotype modification. By modifying the Fc region to have a different isotype, different functionalities can be achieved. For example, changing to IgG.sub.1 can increase antibody dependent cell cytotoxicity, switching to class A can improve tissue distribution, and switching to class M can improve valency. Modifications in the Fc region can be introduced to extend the in vivo half-life of the antibody, or to alter Fc mediated functions such as complement activation, antibody dependent cellular cytotoxicity (ADCC), and FcR mediated phagocytosis.
[0086] Other types of modifications include residue modification designed to reduce oxidation, aggregation, deamidation, and immunogenicity in humans. Other changes can lead to an increase in manufacturability or yield, or reduced tissue cross-reactivity in humans.
[0087] Modified antibodies may be made by any technique known to those of skill in the art, including expression through standard molecular biological techniques, or the chemical synthesis of polypeptides. Methods for recombinant expression are addressed elsewhere in this document.
[0088] D. Single Chain Antibodies
[0089] A Single Chain Variable Fragment (scFv) is a fusion of the variable regions of the heavy and light chains of immunoglobulins, linked together with a short (usually serine, glycine) linker. This chimeric molecule retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of a linker peptide. This modification usually leaves the specificity unaltered. These molecules were created historically to facilitate phage display where it is highly convenient to express the antigen binding domain as a single peptide. Alternatively, scFv can be created directly from subcloned heavy and light chains derived from a hybridoma. Single chain variable fragments lack the constant Fc region found in complete antibody molecules, and thus, the common binding sites (e.g., protein A/G) used to purify antibodies. These fragments can often be purified/immobilized using Protein L since Protein L interacts with the variable region of kappa light chains.
[0090] Flexible linkers generally are comprised of helix- and turn-promoting amino acid residues such as alaine, serine and glycine. However, other residues can function as well. Tang et al. (1996) used phage display as a means of rapidly selecting tailored linkers for single-chain antibodies (scFvs) from protein linker libraries. A random linker library was constructed in which the genes for the heavy and light chain variable domains were linked by a segment encoding an 18-amino acid polypeptide of variable composition. The scFv repertoire (approx. 510.sup.6 different members) was displayed on filamentous phage and subjected to affinity selection with hapten. The population of selected variants exhibited significant increases in binding activity but retained considerable sequence diversity. Screening 1054 individual variants subsequently yielded a catalytically active scFv that was produced efficiently in soluble form. Sequence analysis revealed a conserved proline in the linker two residues after the V.sub.H C terminus and an abundance of arginines and prolines at other positions as the only common features of the selected tethers.
[0091] The recombinant antibodies of the present disclosure may also involve sequences or moieties that permit dimerization or multimerization of the receptors. Such sequences include those derived from IgA, which permit formation of multimers in conjunction with the J-chain. Another multimerization domain is the Gal4 dimerization domain. In other embodiments, the chains may be modified with agents such as biotin/avidin, which permit the combination of two antibodies.
[0092] In a separate embodiment, a single-chain antibody can be created by joining receptor light and heavy chains using a non-peptide linker or chemical unit. Generally, the light and heavy chains will be produced in distinct cells, purified, and subsequently linked together in an appropriate fashion (i.e., the N-terminus of the heavy chain being attached to the C-terminus of the light chain via an appropriate chemical bridge).
[0093] Cross-linking reagents are used to form molecular bridges that tie functional groups of two different molecules, e.g., a stabilizing and coagulating agent. However, it is contemplated that dimers or multimers of the same analog or heteromeric complexes comprised of different analogs can be created. To link two different compounds in a step-wise manner, hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.
[0094] An exemplary hetero-bifunctional cross-linker contains two reactive groups: one reacting with primary amine group (e.g., N-hydroxy succinimide) and the other reacting with a thiol group (e.g., pyridyl disulfide, maleimides, halogens, etc.). Through the primary amine reactive group, the cross-linker may react with the lysine residue(s) of one protein (e.g., the selected antibody or fragment) and through the thiol reactive group, the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).
[0095] It is preferred that a cross-linker having reasonable stability in blood will be employed. Numerous types of disulfide-bond containing linkers are known that can be successfully employed to conjugate targeting and therapeutic/preventative agents. Linkers that contain a disulfide bond that is sterically hindered may prove to give greater stability in vivo, preventing release of the targeting peptide prior to reaching the site of action. These linkers are thus one group of linking agents.
[0096] Another cross-linking reagent is SMPT, which is a bifunctional cross-linker containing a disulfide bond that is sterically hindered by an adjacent benzene ring and methyl groups. It is believed that steric hindrance of the disulfide bond serves a function of protecting the bond from attack by thiolate anions such as glutathione which can be present in tissues and blood, and thereby help in preventing decoupling of the conjugate prior to the delivery of the attached agent to the target site.
[0097] The SMPT cross-linking reagent, as with many other known cross-linking reagents, lends the ability to cross-link functional groups such as the SH of cysteine or primary amines (e.g., the epsilon amino group of lysine). Another possible type of cross-linker includes the hetero-bifunctional photoreactive phenylazides containing a cleavable disulfide bond such as sulfosuccinimidyl-2-(p-azido salicylamido) ethyl-1,3-dithiopropionate. The N-hydroxy-succinimidyl group reacts with primary amino groups and the phenylazide (upon photolysis) reacts non-selectively with any amino acid residue.
[0098] In addition to hindered cross-linkers, non-hindered linkers also can be employed in accordance herewith. Other useful cross-linkers, not considered to contain or generate a protected disulfide, include SATA, SPDP and 2-iminothiolane (Wawrzynczak & Thorpe, 1987). The use of such cross-linkers is well understood in the art. Another embodiment involves the use of flexible linkers.
[0099] U.S. Pat. No. 4,680,338, describes bifunctional linkers useful for producing conjugates of ligands with amine-containing polymers and/or proteins, especially for forming antibody conjugates with chelators, drugs, enzymes, detectable labels and the like. U.S. Pat. Nos. 5,141,648 and 5,563,250 disclose cleavable conjugates containing a labile bond that is cleavable under a variety of mild conditions. This linker is particularly useful in that the agent of interest may be bonded directly to the linker, with cleavage resulting in release of the active agent. Particular uses include adding a free amino or free sulfhydryl group to a protein, such as an antibody, or a drug.
[0100] U.S. Pat. No. 5,856,456 provides peptide linkers for use in connecting polypeptide constituents to make fusion proteins, e.g., single chain antibodies. The linker is up to about 50 amino acids in length, contains at least one occurrence of a charged amino acid (preferably arginine or lysine) followed by a proline, and is characterized by greater stability and reduced aggregation. U.S. Pat. No. 5,880,270 discloses aminooxy-containing linkers useful in a variety of immunodiagnostic and separative techniques.
[0101] E. Intrabodies
[0102] In a particular embodiment, the antibody is a recombinant antibody that is suitable for action inside of a cellsuch antibodies are known as intrabodies. These antibodies may interfere with target function by a variety of mechanism, such as by altering intracellular protein trafficking, interfering with enzymatic function, and blocking protein-protein or protein-DNA interactions. In many ways, their structures mimic or parallel those of single chain and single domain antibodies, discussed above. Indeed, single-transcript/single-chain is an important feature that permits intracellular expression in a target cell, and also makes protein transit across cell membranes more feasible. However, additional features are required.
[0103] The two major issues impacting the implementation of intrabody therapeutic are delivery, including cell/tissue targeting, and stability. With respect to delivery, a variety of approaches have been employed, such as tissue-directed delivery, use of cell-type specific promoters, viral-based delivery and use of cell-permeability/membrane translocating peptides. With respect to the stability, the approach is generally to either screen by brute force, including methods that involve phage display and may include sequence maturation or development of consensus sequences, or more directed modifications such as insertion stabilizing sequences (e.g., Fc regions, chaperone protein sequences, leucine zippers) and disulfide replacement/modification.
[0104] An additional feature that intrabodies may require is a signal for intracellular targeting. Vectors that can target intrabodies (or other proteins) to subcellular regions such as the cytoplasm, nucleus, mitochondria and ER have been designed and are commercially available (Invitrogen Corp.; Persic et al., 1997).
[0105] F. Purification
[0106] In certain embodiments, the antibodies of the present disclosure may be purified. The term purified, as used herein, is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally-obtainable state. A purified protein therefore also refers to a protein, free from the environment in which it may naturally occur. Where the term substantially purified is used, this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.
[0107] Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest may be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity). Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing. Other methods for protein purification include, precipitation with ammonium sulfate, PEG, antibodies and the like or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques.
[0108] In purifying an antibody of the present disclosure, it may be desirable to express the polypeptide in a prokaryotic or eukaryotic expression system and extract the protein using denaturing conditions. The polypeptide may be purified from other cellular components using an affinity column, which binds to a tagged portion of the polypeptide. As is generally known in the art, it is believed that the order of conducting the various purification steps may be changed, or that certain steps may be omitted, and still result in a suitable method for the preparation of a substantially purified protein or peptide.
[0109] Commonly, complete antibodies are fractionated utilizing agents (i.e., protein A) that bind the Fc portion of the antibody. Alternatively, antigens may be used to simultaneously purify and select appropriate antibodies. Such methods often utilize the selection agent bound to a support, such as a column, filter or bead. The antibodies is bound to a support, contaminants removed (e.g., washed away), and the antibodies released by applying conditions (salt, heat, etc.).
[0110] Various methods for quantifying the degree of purification of the protein or peptide will be known to those of skill in the art in light of the present disclosure. These include, for example, determining the specific activity of an active fraction, or assessing the amount of polypeptides within a fraction by SDS/PAGE analysis. Another method for assessing the purity of a fraction is to calculate the specific activity of the fraction, to compare it to the specific activity of the initial extract, and to thus calculate the degree of purity. The actual units used to represent the amount of activity will, of course, be dependent upon the particular assay technique chosen to follow the purification and whether or not the expressed protein or peptide exhibits a detectable activity.
[0111] It is known that the migration of a polypeptide can vary, sometimes significantly, with different conditions of SDS/PAGE (Capaldi et al., 1977). It will therefore be appreciated that under differing electrophoresis conditions, the apparent molecular weights of purified or partially purified expression products may vary.
III. ACTIVE/PASSIVE IMMUNIZATION AND TREATMENT/PREVENTION OF HUMAN RESPIRATORY SYNCYTIAL VIRUS INFECTION
[0112] A. Formulation and Administration
[0113] The present disclosure provides pharmaceutical compositions comprising anti-human respiratory syncytial virus antibodies and antigens for generating the same. Such compositions comprise a prophylactically or therapeutically effective amount of an antibody or a fragment thereof, or a peptide immunogen, and a pharmaceutically acceptable carrier. In a specific embodiment, the term pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term carrier refers to a diluent, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a particular carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Other suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
[0114] The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. Oral formulations can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical agents are described in Remington's Pharmaceutical Sciences. Such compositions will contain a prophylactically or therapeutically effective amount of the antibody or fragment thereof, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration, which can be oral, intravenous, intraarterial, intrabuccal, intranasal, nebulized, bronchial inhalation, or delivered by mechanical ventilation.
[0115] Active vaccines are also envisioned where antibodies like those disclosed are produced in vivo in a subject at risk of Human respiratory syncytial virus infection. Such vaccines can be formulated for parenteral administration, e.g., formulated for injection via the intradermal, intravenous, intramuscular, subcutaneous, or even intraperitoneal routes. Administration by intradermal and intramuscular routes are contemplated. The vaccine could alternatively be administered by a topical route directly to the mucosa, for example by nasal drops, inhalation, or by nebulizer. Pharmaceutically acceptable salts, include the acid salts and those which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
[0116] Passive transfer of antibodies, known as artificially acquired passive immunity, generally will involve the use of intravenous or intramuscular injections. The forms of antibody can be human or animal blood plasma or serum, as pooled human immunoglobulin for intravenous (IVIG) or intramuscular (IG) use, as high-titer human IVIG or IG from immunized or from donors recovering from disease, and as monoclonal antibodies (MAb). Such immunity generally lasts for only a short period of time, and there is also a potential risk for hypersensitivity reactions, and serum sickness, especially from gamma globulin of non-human origin. However, passive immunity provides immediate protection. The antibodies will be formulated in a carrier suitable for injection, i.e., sterile and syringeable.
[0117] Generally, the ingredients of compositions of the disclosure are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0118] The compositions of the disclosure can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
IV. ANTIBODY CONJUGATES
[0119] Antibodies of the present disclosure may be linked to at least one agent to from an antibody conjugate. In order to increase the efficacy of antibody molecules as diagnostic or therapeutic agents, it is conventional to link or covalently bind or complex at least one desired molecule or moiety. Such a molecule or moiety may be, but is not limited to, at least one effector or reporter molecule. Effector molecules comprise molecules having a desired activity, e.g., cytotoxic activity. Non-limiting examples of effector molecules which have been attached to antibodies include toxins, anti-tumor agents, therapeutic enzymes, radionuclides, antiviral agents, chelating agents, cytokines, growth factors, and oligo- or polynucleotides. By contrast, a reporter molecule is defined as any moiety which may be detected using an assay. Non-limiting examples of reporter molecules which have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, photoaffinity molecules, colored particles or ligands, such as biotin.
[0120] Antibody conjugates are generally preferred for use as diagnostic agents. Antibody diagnostics generally fall within two classes, those for use in in vitro diagnostics, such as in a variety of immunoassays, and those for use in vivo diagnostic protocols, generally known as antibody-directed imaging. Many appropriate imaging agents are known in the art, as are methods for their attachment to antibodies (see, for e.g., U.S. Pat. Nos. 5,021,236, 4,938,948, and 4,472,509). The imaging moieties used can be paramagnetic ions, radioactive isotopes, fluorochromes, NMR-detectable substances, and X-ray imaging agents.
[0121] In the case of paramagnetic ions, one might mention by way of example ions such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and/or erbium (III), with gadolinium being particularly preferred. Ions useful in other contexts, such as X-ray imaging, include but are not limited to lanthanum (III), gold (III), lead (II), and especially bismuth (III).
[0122] In the case of radioactive isotopes for therapeutic and/or diagnostic application, one might mention astatine.sup.211, .sup.14carbon, .sup.51chromium, .sup.36chlorine, .sup.57cobalt, .sup.58cobalt, copper.sup.67, .sup.152Eu, gallium.sup.67, .sup.3hydrogen, iodine.sup.123, iodine.sup.125, iodine.sup.131, indium.sup.111, .sup.59iron, .sup.32phosphorus, rhenium.sup.186, rhenium.sup.188, .sup.75selenium, .sup.35sulphur, technicium.sup.99m and/or yttrium.sup.90. .sup.125I is often being preferred for use in certain embodiments, and technicium.sup.99m and/or indium.sup.111 are also often preferred due to their low energy and suitability for long range detection. Radioactively labeled monoclonal antibodies of the present disclosure may be produced according to well-known methods in the art. For instance, monoclonal antibodies can be iodinated by contact with sodium and/or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite, or an enzymatic oxidizing agent, such as lactoperoxidase. Monoclonal antibodies according to the disclosure may be labeled with technetium.sup.99m by ligand exchange process, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the antibody to this column. Alternatively, direct labeling techniques may be used, e.g., by incubating pertechnate, a reducing agent such as SNCl.sub.2, a buffer solution such as sodium-potassium phthalate solution, and the antibody. Intermediary functional groups which are often used to bind radioisotopes which exist as metallic ions to antibody are diethylenetriaminepentaacetic acid (DTPA) or ethylene diaminetetraacetic acid (EDTA).
[0123] Among the fluorescent labels contemplated for use as conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET, Tetramethylrhodamine, and/or Texas Red.
[0124] Another type of antibody conjugates contemplated in the present disclosure are those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate. Examples of suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose oxidase. Preferred secondary binding ligands are biotin and avidin and streptavidin compounds. The use of such labels is well known to those of skill in the art and are described, for example, in U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149 and 4,366,241.
[0125] Yet another known method of site-specific attachment of molecules to antibodies comprises the reaction of antibodies with hapten-based affinity labels. Essentially, hapten-based affinity labels react with amino acids in the antigen binding site, thereby destroying this site and blocking specific antigen reaction. However, this may not be advantageous since it results in loss of antigen binding by the antibody conjugate.
[0126] Molecules containing azido groups may also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter and Haley, 1983). In particular, 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al., 1985). The 2- and 8-azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al., 1989; King et al., 1989; Dholakia et al., 1989) and may be used as antibody binding agents.
[0127] Several methods are known in the art for the attachment or conjugation of an antibody to its conjugate moiety. Some attachment methods involve the use of a metal chelate complex employing, for example, an organic chelating agent such a diethylenetriaminepentaacetic acid anhydride (DTPA); ethylenetriaminetetraacetic acid; N-chloro-p-toluenesulfonamide; and/or tetrachloro-3-6-diphenylglycouril-3 attached to the antibody (U.S. Pat. Nos. 4,472,509 and 4,938,948). Monoclonal antibodies may also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate. Conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate. In U.S. Pat. No. 4,938,948, imaging of breast tumors is achieved using monoclonal antibodies and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl-3-(4-hydroxyphenyl)propionate.
[0128] In other embodiments, derivatization of immunoglobulins by selectively introducing sulfhydryl groups in the Fc region of an immunoglobulin, using reaction conditions that do not alter the antibody combining site are contemplated. Antibody conjugates produced according to this methodology are disclosed to exhibit improved longevity, specificity and sensitivity (U.S. Pat. No. 5,196,066, incorporated herein by reference). Site-specific attachment of effector or reporter molecules, wherein the reporter or effector molecule is conjugated to a carbohydrate residue in the Fc region have also been disclosed in the literature (O'Shannessy et al., 1987). This approach has been reported to produce diagnostically and therapeutically promising antibodies which are currently in clinical evaluation.
V. IMMUNODETECTION METHODS
[0129] In still further embodiments, the present disclosure concerns immunodetection methods for binding, purifying, removing, quantifying and otherwise generally detecting Human respiratory syncytial virus and its associated antigens. While such methods can be applied in a traditional sense, another use will be in quality control and monitoring of vaccine and other virus stocks, where antibodies according to the present disclosure can be used to assess the amount or integrity (i.e., long term stability) of H1 antigens in viruses. Alternatively, the methods may be used to screen various antibodies for appropriate/desired reactivity profiles.
[0130] Some immunodetection methods include enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few. In particular, a competitive assay for the detection and quantitation of human respiratory syncytial virus antibodies directed to specific viral epitopes in samples also is provided. The steps of various useful immunodetection methods have been described in the scientific literature, such as, e.g., Doolittle and Ben-Zeev (1999), Gulbis and Galand (1993), De Jager et al. (1993), and Nakamura et al. (1987). In general, the immunobinding methods include obtaining a sample suspected of containing Human respiratory syncytial virus, and contacting the sample with a first antibody in accordance with the present disclosure, as the case may be, under conditions effective to allow the formation of immunocomplexes.
[0131] These methods include methods for purifying human respiratory syncytial virus or related antigens from a sample. The antibody will preferably be linked to a solid support, such as in the form of a column matrix, and the sample suspected of containing the Human respiratory syncytial virus or antigenic component will be applied to the immobilized antibody. The unwanted components will be washed from the column, leaving the human respiratory syncytial virus antigen immunocomplexed to the immobilized antibody, which is then collected by removing the organism or antigen from the column.
[0132] The immunobinding methods also include methods for detecting and quantifying the amount of human respiratory syncytial virus or related components in a sample and the detection and quantification of any immune complexes formed during the binding process. Here, one would obtain a sample suspected of containing human respiratory syncytial virus or its antigens, and contact the sample with an antibody that binds Human respiratory syncytial virus or components thereof, followed by detecting and quantifying the amount of immune complexes formed under the specific conditions. In terms of antigen detection, the biological sample analyzed may be any sample that is suspected of containing human respiratory syncytial virus or Human respiratory syncytial virus antigen, such as a tissue section or specimen, a homogenized tissue extract, a biological fluid, including blood and serum, or a secretion, such as feces or urine.
[0133] Contacting the chosen biological sample with the antibody under effective conditions and for a period of time sufficient to allow the formation of immune complexes (primary immune complexes) is generally a matter of simply adding the antibody composition to the sample and incubating the mixture for a period of time long enough for the antibodies to form immune complexes with, i.e., to bind to Human respiratory syncytial virus or antigens present. After this time, the sample-antibody composition, such as a tissue section, ELISA plate, dot blot or Western blot, will generally be washed to remove any non-specifically bound antibody species, allowing only those antibodies specifically bound within the primary immune complexes to be detected.
[0134] In general, the detection of immunocomplex formation is well known in the art and may be achieved through the application of numerous approaches. These methods are generally based upon the detection of a label or marker, such as any of those radioactive, fluorescent, biological and enzymatic tags. Patents concerning the use of such labels include U.S. Pat. Nos. 3,817,837, 3,850,752, 3,939,350, 3,996,345, 4,277,437, 4,275,149 and 4,366,241. Of course, one may find additional advantages through the use of a secondary binding ligand such as a second antibody and/or a biotin/avidin ligand binding arrangement, as is known in the art.
[0135] The antibody employed in the detection may itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined. Alternatively, the first antibody that becomes bound within the primary immune complexes may be detected by means of a second binding ligand that has binding affinity for the antibody. In these cases, the second binding ligand may be linked to a detectable label. The second binding ligand is itself often an antibody, which may thus be termed a secondary antibody. The primary immune complexes are contacted with the labeled, secondary binding ligand, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes. The secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.
[0136] Further methods include the detection of primary immune complexes by a two-step approach. A second binding ligand, such as an antibody that has binding affinity for the antibody, is used to form secondary immune complexes, as described above. After washing, the secondary immune complexes are contacted with a third binding ligand or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes). The third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system may provide for signal amplification if this is desired.
[0137] One method of immunodetection uses two different antibodies. A first biotinylated antibody is used to detect the target antigen, and a second antibody is then used to detect the biotin attached to the complexed biotin. In that method, the sample to be tested is first incubated in a solution containing the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex. The antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex. The amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution containing the second step antibody against biotin. This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate. With suitable amplification, a conjugate can be produced which is macroscopically visible.
[0138] Another known method of immunodetection takes advantage of the immuno-PCR (Polymerase Chain Reaction) methodology. The PCR method is similar to the Cantor method up to the incubation with biotinylated DNA, however, instead of using multiple rounds of streptavidin and biotinylated DNA incubation, the DNA/biotin/streptavidin/antibody complex is washed out with a low pH or high salt buffer that releases the antibody. The resulting wash solution is then used to carry out a PCR reaction with suitable primers with appropriate controls. At least in theory, the enormous amplification capability and specificity of PCR can be utilized to detect a single antigen molecule.
[0139] A. ELISAs
[0140] Immunoassays, in their most simple and direct sense, are binding assays. Certain preferred immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful. However, it will be readily appreciated that detection is not limited to such techniques, and western blotting, dot blotting, FACS analyses, and the like may also be used.
[0141] In one exemplary ELISA, the antibodies of the disclosure are immobilized onto a selected surface exhibiting protein affinity, such as a well in a polystyrene microtiter plate. Then, a test composition suspected of containing the Human respiratory syncytial virus or Human respiratory syncytial virus antigen is added to the wells. After binding and washing to remove non-specifically bound immune complexes, the bound antigen may be detected. Detection may be achieved by the addition of another anti-Human respiratory syncytial virus antibody that is linked to a detectable label. This type of ELISA is a simple sandwich ELISA. Detection may also be achieved by the addition of a second anti-Human respiratory syncytial virus antibody, followed by the addition of a third antibody that has binding affinity for the second antibody, with the third antibody being linked to a detectable label.
[0142] In another exemplary ELISA, the samples suspected of containing the Human respiratory syncytial virus or Human respiratory syncytial virus antigen are immobilized onto the well surface and then contacted with the anti-Human respiratory syncytial virus antibodies of the disclosure. After binding and washing to remove non-specifically bound immune complexes, the bound anti-Human respiratory syncytial virus antibodies are detected. Where the initial anti-Human respiratory syncytial virus antibodies are linked to a detectable label, the immune complexes may be detected directly. Again, the immune complexes may be detected using a second antibody that has binding affinity for the first anti-Human respiratory syncytial virus antibody, with the second antibody being linked to a detectable label.
[0143] Irrespective of the format employed, ELISAs have certain features in common, such as coating, incubating and binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.
[0144] In coating a plate with either antigen or antibody, one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate will then be washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then coated with a nonspecific protein that is antigenically neutral with regard to the test antisera. These include bovine serum albumin (BSA), casein or solutions of milk powder. The coating allows for blocking of nonspecific adsorption sites on the immobilizing surface and thus reduces the background caused by nonspecific binding of antisera onto the surface.
[0145] In ELISAs, it is probably more customary to use a secondary or tertiary detection means rather than a direct procedure. Thus, after binding of a protein or antibody to the well, coating with a non-reactive material to reduce background, and washing to remove unbound material, the immobilizing surface is contacted with the biological sample to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, and a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or a third binding ligand.
[0146] Under conditions effective to allow immune complex (antigen/antibody) formation means that the conditions preferably include diluting the antigens and/or antibodies with solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline (PBS)/Tween. These added agents also tend to assist in the reduction of nonspecific background.
[0147] The suitable conditions also mean that the incubation is at a temperature or for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours or so, at temperatures preferably on the order of 25 C. to 27 C., or may be overnight at about 4 C. or so.
[0148] Following all incubation steps in an ELISA, the contacted surface is washed so as to remove non-complexed material. A preferred washing procedure includes washing with a solution such as PBS/Tween, or borate buffer. Following the formation of specific immune complexes between the test sample and the originally bound material, and subsequent washing, the occurrence of even minute amounts of immune complexes may be determined.
[0149] To provide a detecting means, the second or third antibody will have an associated label to allow detection. Preferably, this will be an enzyme that will generate color development upon incubating with an appropriate chromogenic substrate. Thus, for example, one will desire to contact or incubate the first and second immune complex with a urease, glucose oxidase, alkaline phosphatase or hydrogen peroxidase-conjugated antibody for a period of time and under conditions that favor the development of further immune complex formation (e.g., incubation for 2 hours at room temperature in a PBS-containing solution such as PBS-Tween).
[0150] After incubation with the labeled antibody, and subsequent to washing to remove unbound material, the amount of label is quantified, e.g., by incubation with a chromogenic substrate such as urea, or bromocresol purple, or 2,2-azino-di-(3-ethyl-benzothiazoline-6-sulfonic acid (ABTS), or H.sub.2O.sub.2, in the case of peroxidase as the enzyme label. Quantification is then achieved by measuring the degree of color generated, e.g., using a visible spectra spectrophotometer.
[0151] In another embodiment, the present disclosure contemplates the use of competitive formats. This is particularly useful in the detection of Human respiratory syncytial virus antibodies in sample. In competition based assays, an unknown amount of analyte or antibody is determined by its ability to displace a known amount of labeled antibody or analyte. Thus, the quantifiable loss of a signal is an indication of the amount of unknown antibody or analyte in a sample.
[0152] Here, the inventors propose the use of labeled Human respiratory syncytial virus monoclonal antibodies to determine the amount of Human respiratory syncytial virus antibodies in a sample. The basic format would include contacting a known amount of Human respiratory syncytial virus monoclonal antibody (linked to a detectable label) with Human respiratory syncytial virus antigen or particle. The Human respiratory syncytial virus antigen or organism is preferably attached to a support. After binding of the labeled monoclonal antibody to the support, the sample is added and incubated under conditions permitting any unlabeled antibody in the sample to compete with, and hence displace, the labeled monoclonal antibody. By measuring either the lost label or the label remaining (and subtracting that from the original amount of bound label), one can determine how much non-labeled antibody is bound to the support, and thus how much antibody was present in the sample.
[0153] B. Western Blot
[0154] The Western blot (alternatively, protein immunoblot) is an analytical technique used to detect specific proteins in a given sample of tissue homogenate or extract. It uses gel electrophoresis to separate native or denatured proteins by the length of the polypeptide (denaturing conditions) or by the 3-D structure of the protein (native/non-denaturing conditions). The proteins are then transferred to a membrane (typically nitrocellulose or PVDF), where they are probed (detected) using antibodies specific to the target protein.
[0155] Samples may be taken from whole tissue or from cell culture. In most cases, solid tissues are first broken down mechanically using a blender (for larger sample volumes), using a homogenizer (smaller volumes), or by sonication. Cells may also be broken open by one of the above mechanical methods. However, it should be noted that bacteria, virus or environmental samples can be the source of protein and thus Western blotting is not restricted to cellular studies only. Assorted detergents, salts, and buffers may be employed to encourage lysis of cells and to solubilize proteins. Protease and phosphatase inhibitors are often added to prevent the digestion of the sample by its own enzymes. Tissue preparation is often done at cold temperatures to avoid protein denaturing.
[0156] The proteins of the sample are separated using gel electrophoresis. Separation of proteins may be by isoelectric point (pI), molecular weight, electric charge, or a combination of these factors. The nature of the separation depends on the treatment of the sample and the nature of the gel. This is a very useful way to determine a protein. It is also possible to use a two-dimensional (2-D) gel which spreads the proteins from a single sample out in two dimensions. Proteins are separated according to isoelectric point (pH at which they have neutral net charge) in the first dimension, and according to their molecular weight in the second dimension.
[0157] In order to make the proteins accessible to antibody detection, they are moved from within the gel onto a membrane made of nitrocellulose or polyvinylidene difluoride (PVDF). The membrane is placed on top of the gel, and a stack of filter papers placed on top of that. The entire stack is placed in a buffer solution which moves up the paper by capillary action, bringing the proteins with it. Another method for transferring the proteins is called electroblotting and uses an electric current to pull proteins from the gel into the PVDF or nitrocellulose membrane. The proteins move from within the gel onto the membrane while maintaining the organization they had within the gel. As a result of this blotting process, the proteins are exposed on a thin surface layer for detection (see below). Both varieties of membrane are chosen for their non-specific protein binding properties (i.e., binds all proteins equally well). Protein binding is based upon hydrophobic interactions, as well as charged interactions between the membrane and protein. Nitrocellulose membranes are cheaper than PVDF, but are far more fragile and do not stand up well to repeated probings. The uniformity and overall effectiveness of transfer of protein from the gel to the membrane can be checked by staining the membrane with Coomassie Brilliant Blue or Ponceau S dyes. Once transferred, proteins are detected using labeled primary antibodies, or unlabeled primary antibodies followed by indirect detection using labeled protein A or secondary labeled antibodies binding to the Fc region of the primary antibodies.
[0158] C. Immunohistochemistry
[0159] The antibodies of the present disclosure may also be used in conjunction with both fresh-frozen and/or formalin-fixed, paraffin-embedded tissue blocks prepared for study by immunohistochemistry (IHC). The method of preparing tissue blocks from these particulate specimens has been successfully used in previous IHC studies of various prognostic factors, and is well known to those of skill in the art (Brown et al., 1990; Abbondanzo et al., 1990; Allred et al., 1990).
[0160] Briefly, frozen-sections may be prepared by rehydrating 50 ng of frozen pulverized tissue at room temperature in phosphate buffered saline (PBS) in small plastic capsules; pelleting the particles by centrifugation; resuspending them in a viscous embedding medium (OCT); inverting the capsule and/or pelleting again by centrifugation; snap-freezing in 70 C. isopentane; cutting the plastic capsule and/or removing the frozen cylinder of tissue; securing the tissue cylinder on a cryostat microtome chuck; and/or cutting 25-50 serial sections from the capsule. Alternatively, whole frozen tissue samples may be used for serial section cuttings.
[0161] Permanent-sections may be prepared by a similar method involving rehydration of the 50 mg sample in a plastic microfuge tube; pelleting; resuspending in 10% formalin for 4 hours fixation; washing/pelleting; resuspending in warm 2.5% agar; pelleting; cooling in ice water to harden the agar; removing the tissue/agar block from the tube; infiltrating and/or embedding the block in paraffin; and/or cutting up to 50 serial permanent sections. Again, whole tissue samples may be substituted.
[0162] D. Immunodetection Kits
[0163] In still further embodiments, the present disclosure concerns immunodetection kits for use with the immunodetection methods described above. As the antibodies may be used to detect Human respiratory syncytial virus or Human respiratory syncytial virus antigens, the antibodies may be included in the kit. The immunodetection kits will thus comprise, in suitable container means, a first antibody that binds to Human respiratory syncytial virus or Human respiratory syncytial virus antigen, and optionally an immunodetection reagent.
[0164] In certain embodiments, the Human respiratory syncytial virus antibody may be pre-bound to a solid support, such as a column matrix and/or well of a microtitre plate. The immunodetection reagents of the kit may take any one of a variety of forms, including those detectable labels that are associated with or linked to the given antibody. Detectable labels that are associated with or attached to a secondary binding ligand are also contemplated. Exemplary secondary ligands are those secondary antibodies that have binding affinity for the first antibody.
[0165] Further suitable immunodetection reagents for use in the present kits include the two-component reagent that comprises a secondary antibody that has binding affinity for the first antibody, along with a third antibody that has binding affinity for the second antibody, the third antibody being linked to a detectable label. As noted above, a number of exemplary labels are known in the art and all such labels may be employed in connection with the present disclosure.
[0166] The kits may further comprise a suitably aliquoted composition of the Human respiratory syncytial virus or Human respiratory syncytial virus antigens, whether labeled or unlabeled, as may be used to prepare a standard curve for a detection assay. The kits may contain antibody-label conjugates either in fully conjugated form, in the form of intermediates, or as separate moieties to be conjugated by the user of the kit. The components of the kits may be packaged either in aqueous media or in lyophilized form.
[0167] The container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which the antibody may be placed, or preferably, suitably aliquoted. The kits of the present disclosure will also typically include a means for containing the antibody, antigen, and any other reagent containers in close confinement for commercial sale. Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
VI. QUALITY CONTROL AND VACCINE TESTING
[0168] The present disclosure also contemplates the use of antibodies and antibody fragments as described herein for use in assessing the antigenic integrity of a viral antigen in a sample. Biological medicinal products like vaccines differ from chemical drugs in that they cannot normally be characterized molecularly; antibodies are large molecules of significant complexity, and have the capacity to vary widely from preparation to preparation. They are also administered to healthy individuals, including children at the start of their lives, and thus a strong emphasis must be placed on their quality to ensure, to the greatest extent possible, that they are efficacious in preventing or treating life-threatening disease, without themselves causing harm.
[0169] The increasing globalization in the production and distribution of vaccines has opened new possibilities to better manage public health concerns, but has also raised questions about the equivalence and interchangeability of vaccines procured across a variety of sources. International standardization of starting materials, of production and quality control testing, and the setting of high expectations for regulatory oversight on the way these products are manufactured and used, have thus been the cornerstone for continued success. But it remains a field in constant change, and continuous technical advances in the field offer a promise of developing potent new weapons against our oldest public health threats, as well as new onesmalaria, pandemic influenza, and HIV, to name a fewbut also put a great pressure on manufacturers, regulatory authorities, and the wider medical community to ensure that products continue to meet the highest standards of quality attainable.
[0170] Thus, one may obtain an antigen or vaccine from any source or at any point during a manufacturing process. The quality control processes may therefore begin with preparing a sample for an immunoassay that identifies binding of an antibody or fragment disclosed herein to a viral antigen. Such immunoassays are disclosed elsewhere in this document, and any of these may be used to assess the structural/antigenic integrity of the antigen. Standards for finding the sample to contain acceptable amounts of antigenically intact antigen may be established by regulatory agencies.
[0171] Another important embodiment where antigen integrity is assessed is in determining shelf-life and storage stability. Most medicines, including vaccines, can deteriorate over time. Therefore, it is critical to determine whether, over time, the degree to which an antigen, such as in a vaccine, degrades or destabilizes such that is it no longer antigenic and/or capable of generating an immune response when administered to a subject. Again, standards for finding the sample to contain acceptable amounts of antigenically intact antigen may be established by regulatory agencies.
[0172] In certain embodiments, viral antigens may contain more than one protective epitope. In these cases, it may prove useful to employ assays that look at the binding of more than one antibody, such as 2, 3, 4, 5 or even more antibodies. These antibodies bind to closely related epitopes, such that they are adjacent or even overlap each other. On the other hand, they may represent distinct epitopes from disparate parts of the antigen. By examining the integrity of multiple epitopes, a more complete picture of the antigen's overall integrity, and hence ability to generate a protective immune response, may be determined.
VII. EXAMPLES
[0173] The following examples are included to demonstrate preferred embodiments. It should be appreciated by those of skill in the art that the techniques disclosed in the examples that follow represent techniques discovered by the inventors to function well in the practice of embodiments, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the disclosure.
Example 1Materials and Methods
[0174] Enzyme linked immunosorbent assay (ELISA). For recombinant protein capture ELISA, 384-well plates were treated with 2 g/mL of antigen overnight at 4 C. The plates were blocked for one hour with 2% milk supplemented with 2% goat serum. Plates were washed three times with PBS-T, and primary mAbs or hybridoma cell culture supernatants were applied to wells for one hour. Plates were washed with PBS-T four times before applying 25 L secondary antibody (goat anti-human IgG Fc, Meridian Life Science) at a dilution of 1:4,000 in blocking solution. After a one-hour incubation, the plates were washed five times with PBS-T, and 25 L of phosphatase substrate solution (1 mg/mL phosphatase substrate in 1 M Tris aminomethane, Sigma) was added to each well. The plates were incubated at room temperature for approximately 30 min before reading the optical density at 405 nm on a Biotek plate reader. Experiments with the RSV F mutants were conducted similarly.
[0175] Human Hybridoma Generation.
[0176] The generation of human hybridomas has been described previously (McLellan, J. S., 2015). Briefly, PBMCs were isolated from a single human donor and were transformed with Epstein-Barr virus (EBV). After seven to ten days, culture supernatants were screened for binding to recombinant RSV A2. F SC-TM. Cells from positive wells were fused with HMMA2.5 myeloma. cells by electrofusion to generate hybridomas (Yu et al., 2008). Hybridomas were placed in HAT and ouabain selection media and screened after two weeks for mAb production by ELISA. Cells from wells with reactive supernatants were expanded to 48-well plates for one week before being screened again by ELISA, and then subjected to single-cell flow cytometric cell sorting. After cell sorting into 384-well plates containing Medium E (StemCell Technologies), hybridomas were screened by ELISA before expansion into both 48-well and 12-well plates. Hybridoma cells lines were expanded in Medium E until 80% confluent in 75-cm.sup.2 flasks. For antibody production, cells from one 75-cm.sup.2 cell culture flask were collected with a cell scraper and expanded to four 225-cm.sup.2 cell culture flasks in serum-free medium (Hybridoma-SFM, GIBCO). After 21 days, supernatants were sterile filtered using 0.45 m pore size filter devices.
[0177] RSV Plaque Neutralization Experiments.
[0178] MAbs isolated from hybridoma supernatants were incubated 1:1 with a suspension of infectious RSV strain A2, 18537 B, or Long for 1 hr. Following this, confluent HEp-2 cell culture monolayers, maintained in Opti-MEM I+GlutaMAX (Fisher) supplemented with 2% fetal bovine serum at 37 C. in a CO.sub.2 incubator, in 24-well plates were inoculated with 50 L of the antibody:virus mixture for 1 hr. After the hour, cells were overlaid with 1 mL of 0.75% methylcellulose dissolved in Opti-MEM I+GlutaMAX. Cells were incubated for four days, after which the plaques were visualized by fixing cells with 10% neutral-buffered formalin and staining with crystal violet. Plaques were counted and compared to a virus control. Data were analyzed with Prism software (GraphPad) to obtain IC.sub.50 values.
[0179] Human mAb and Fab Production and Purification.
[0180] For antibody purification from hybridoma supernates, HiTrap MabSelectSure columns (GE Healthcare Life Sciences) were used to purify antibodies using the manufacturer's protocol. To obtain Fab fragments, papain digestion was used (Pierce Fab Preparation Kit, Thermo Scientific). Fab fragments were purified by removing IgG and Fc contaminants using a HiTrap MabSelectSure column followed by purification with an anti-CH1 column (GE Healthcare Life Sciences).
[0181] Assessing Self-Reactivity of mAbs by Flow Cytometry.
[0182] Cultures of Jurkat E6-1 (ATCC) and lentivirus transducted Jurkat E6-1 cells that express Zaire Ebolavirus glycoprotein on the surface (kind gift by Carl Davis and Rafi Ahmed, Emory University School of Medicine) were grown in RPMI-1640 medium supplemented with 10% fetal bovine serum (FBS; HyClone) according to the ATCC recommendations. Cells were washed with ice-cold FACS buffer (Dulbecco's PBS containing 2% FBS and 50 nM Dasatinib), counted, seeded at approx. 50,000 viable cells per well in V-bottom 96-well plate for each mAb to be tested, and incubated 60 min at 4 C. with serial 10-fold dilutions of mAb in total volume 100 L per staining. Cells were washed with FACS buffer by centrifugation 2 min at 800g followed by incubation with 1:500 dilution of secondary goat anti-human IgG PE Ab (SouthernBiotech) in FACS buffer. After washing, 5,000-10,000 live cell events were acquired using a 3-laser LSR-II flow cytometer (BD Biosciences) and analyzed with FlowJo software (Tree Star). Dead cell population was excluded using propidium iodide staining.
[0183] Production and Purification of Recombinant RSV F Protein RSV mAbs, and Epitope Immunogens.
[0184] Plasmids encoding cDNAs for RSV subgroup A strain A2 F protein (wild-type post-fusion lacking the signal peptide and transmembrane domain), the SC-TM construct, and the subgroup B strain 18537 protein construct (wild-type post-fusion F protein lacking the signal peptide and transmembrane domain) were synthesized (Genscript). The RSV B 18537 Ds-Cav1 (pre-fusion) construct was a gift from Barney Graham (NIH). Plasmids were expanded in E. coli DH5 cells, and DNA was purified using Qiagen Plasmid Maxiprep kits (Qiagen). For each liter of protein expression, 1.3 mg of plasmid DNA was mixed with 2 mg of polyethylenimine in Opti-MEM I+GlutaMAX cell culture medium (Fisher). After 10 min, the DNA mixture was added to HEK293 cells at 110.sup.6 cells/mL. The culture supernatant was harvested after 6 days, and the protein was purified by HiTrap Talon crude (GE Healthcare Life Sciences) column for RSV F protein variants and mutants. Expression and purification of mAbs 101F, motavizumab, and D25 was previously described (Mousa et al., 2016. Commercial preparations of palivizumab (Synagis; Medimmune) were obtained from the pharmacy at Vanderbilt University Medical Center.
[0185] Crystallization and Structure Determination of 14N4-Fab and 14N4-Fab-RSV F.
[0186] To crystallize hRSV90 Fab in complex with RSV A2 F SC-TM, both Fab cleaved from hybridoma-derived IgG of hRSV90 and RSV A2 F were buffer-exchanged in excess into 50 mM Tris pH 7.5, 50 mM NaCl. hRSV90-Fab was mixed in excess with RSV A2 F SC-TM protein and incubated at 37 C. for two hours. Following this, the sample was subjected to size exclusion chromatography (S200, 16/300, GE Healthcare Life Sciences) in 50 mM Tris pH 7.5, 50 mM NaCl. The complex was concentrated to 10 mg/mL and crystals were obtained in Hampton Crystal Screen HT in various conditions. The best diffracting crystals were obtained in 30% PEG 400, 200 mM MgCl.sub.2.6H.sub.2O, and 100 mM HEPES pH 7.5. X-ray diffraction data were collected at the Advanced Photon Source LS-CAT beamline 21-ID-G. Data were indexed and scaled using XDS (Kabsch, 2010) and were significantly anisotropic. The data was submitted to the diffraction anisotropy server and the data were truncated to 3.1 along the c* axis, and to 3.6 along the a*/b* axes. A molecular replacement solution was obtained in Phaser (Emsley & Cowtan, 2004) using the RSV A2 F SC-TM structure (PDB 5C6B), and by separately searching the variable and constant regions of a poly-alanine truncated Fab structure (PDB: 4Q9Q). The structure of the complex was completed by manually building in COOT (Emsley & Cowtan, 2004) followed by subsequent rounds of manual rebuilding and refinement in Phenix (Adams et al., 2010). The data collection and refinement statistics are shown in Table 51.
[0187] RSV F Mutant Western Blot.
[0188] An SDS-PAGE gel (4-12% Bis-Tris) was run for the RSV F SC-TM protein mutants. The proteins were transferred to a PVDF membrane using the iBlot system (Thermo Fisher Scientific). The membrane was blocked in 5% non-fat milk for one hour, and then washed 3 with PBS-T. Following this, the membrane was incubated with a 1:1,000 dilution of monoclonal anti-polyhistidine-alkaline phosphatase antibody (Sigma, #A5588) in 5% nonfat milk for one hour. The membrane was washed 3 with PBS-T and incubated with BM purple chromogenic substrate.
Example 2Results
[0189] In order to further characterize the human immune response to the RSV F protein, and in particular the pre-fusion form of RSV F, the inventors used hybridoma technology (Smith & Crowe, 2015) to isolate new mAbs to RSV and identified thirteen new neutralizing human mAbs that recognized the pre-fusion conformation of RSV F protein. Peripheral blood mononuclear cells were isolated from a single 8-year-old human donor by Ficoll-gradient centrifugation, and the cells were frozen for later use. For B cell screening, thawed cells were transformed with Epstein-Barr virus and plated in 384-well plates to generate immortalized B cell clusters. Supernatants from the transformed cells were screened for antibodies binding to a highly-stable pre-fusion conformation of RSV A2 F, using single-chain triple mutant (SC-TM) construct (Krarup et al., 2015). B cells from cultures producing antibodies reactive with the pre-fusion F protein were electrofused with the HMMA2.5 myeloma cell line to generate stable hybridoma cell lines. To obtain homogeneous antibody secretions, hybridoma cells were cloned biologically by single-cell flow cytometric sorting. Hybridomas were expanded step-wise to 1 L cultures, and mAbs were purified from filtered culture supernatants. Purified mAb yields from the cultures ranged widely depending on the hybridoma clone, with the lowest being 1.5 mg/L, and the highest nearing 30 mg/L (Table 5). RSV-specific mAbs were characterized by antibody isotyping analysis. All mAbs except hRSV130 were of the IgG1 subclass, and the majority of light chains were of the kappa subtype (Table 5).
[0190] To determine neutralizing potency, the inventors tested the mAbs by plaque-reduction assay using RSV A2 (subgroup A virus), RSV 18537 B (subgroup B virus), and RSV Long (subgroup A virus). Eleven neutralizing mAbs had half-maximal inhibitory concentration (IC.sub.50) values at or less than 1 g/mL for RSV A2 (Table 5,
[0191] The transcribed antibody heavy and light chain variable genes from hybridoma cell lines were sequenced to determine if there were any common genetic features in transcripts encoding these mAbs. The inventors found remarkable genetic similarities among clones, suggesting common structural features deriving from the germline gene-encoded antibody structures. Two genetic clusters were observed among neutralizing mAbs (Table 6). Four neutralizing mAbs (hRSV90, hRSV20, hRSV130, and hRSV97) were encoded by V.sub.H3-9*01. Of these, hRSV90, hRSV20, and hRSV130 used the same J.sub.H gene. Furthermore, hRSV90, hRSV20, and hRSV131 used similar light chain variable gene segments (V.sub.L13-15*01 and J.sub.L4*01), with all mAbs having nearly identical light chain junction regions. Although hRSV90 and hRSV20 shared nearly identical gene segment usage, the two mAbs likely are not clonal siblings due to a heavy chain complementarity determining region 3 (HCDR3) insertion in hRSV20.
[0192] To determine the antigenic sites targeted by the mAbs, the inventors performed epitope binning using biolayer interferometry. RSV A2 F SC-TM protein was loaded onto anti-penta-HIS biosensor tips, and then one RSV mAb was loaded onto the F protein. Following this, a second RSV mAb was loaded, and competition was measured (
[0193] To characterize the newly identified antigenic site VIII further, the inventors determined the X-ray crystal structure of the most potently neutralizing mAb, hRSV90, in complex with pre-fusion RSV A2 F SC-TM protein. hRSV90 Fab was obtained by papain cleavage from the hybridoma-secreted IgG, complexed with pre-fusion F protein, and purified by size-exclusion chromatography. The Fab-F complex eluted in one band, and crystals formed in several conditions including: 1.5 M LiSO.sub.4.H.sub.2O/100 mM HEPES pH 7.5, and 20% PEG 550 MME/100 mM NaCl/100 mM BICINE pH 9.0. The largest and best diffracting crystals were obtained in 30% PEG 400/200 mM MgCl.sub.2.6H.sub.2O/100 mM HEPES pH 7.5. The diffraction was significantly anisotropic, so the processed data was submitted to the diffraction anisotropy server (Strong et al., 2006), which gave a=3.6, b=3.6, and c=3.1. The structure was solved to 3.1 (R.sub.work/R.sub.free=22/26%) using molecular replacement with the RSV A2 F SC-TM structure (PDB: 5C6B) and an alanine truncated Fab structure (PDB: 4Q9Q) as search models (Table 51). Density for the Fab was observed at the interface between antigenic sites 0 and II, consistent with the competition-binding data, and identified a novel antigenic site that is the target of potently neutralizing antibodies (
[0194] The asymmetric unit contained one RSV F protomer and one hRSV90 Fab molecule, and the complex crystallized in a trimer based on the position of symmetry related partners (
[0195] When comparing previously described antigenic sites to site VIII, hRSV90 is nestled between sites II and , and also in close proximity to the trimer-dependent mAb AM14 site, while being distant from 101F at antigenic site IV. While AM14 and motavizumab bind at opposite interfaces of the RSV F protein in an orientation that is approximately parallel, hRSV90 is turned nearly 90, engaging with RSV F at a perpendicular orientation. When observing the antigenic overlay from the apex, bound hRSV90 sits in between bound AM14 and motavizumab on F, while being shifted 80 downward from D25 (
[0196] In order to confirm the X-ray structure and determine critical residues responsible for hRSV90 binding to RSV F, the inventors mutated each of the contact residues observed in the X-ray structure (Table 7,
[0197] The protein sequence in the site VIII epitope is highly conserved in field isolates between RSV A and B subgroups (
TABLE-US-00001 TABLE1 NUCLEOTIDESEQUENCESFORANTIBODYVARIABLEREGIONS SEQ Clone VariableSequenceRegion IDNO: 90heavy GAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTCGCAGGTCCCTGAGAC 1 TCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATACCATACACTGGGTCCGCCA AGCTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATTACTTGGAATAGTGGTTACATT GGCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAGGAACT CCCTGTATCTGCAAATGAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGT AAGAGATGCCTATGTTTCGGGGAGTGATTACTACTACTACGGTTTGGACGTCTGGGGC CGAGGGACCCTGGTCACCGTCTCCTCA 90light GAAATAGTGATGACGTCGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGAGCCA 2 CCCTCTTTTGCAGGGCCAGTCAGAGTGTGATCAGCAACTTAGCCTGGTACCAGCAGAA ATCTGGCCAGGCTCCCAGGCTCCTCATCTATGGTGCATCCACCAGGGCCACTGGTATC CCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGAGTTCACTCTCACCATCAGCAGCC TACAGTCTGAAGATTTTGCAGTTTATTTTTGTCAGCAGTATAATAACTGGCCTCTCAC TTTCGGCGGAGGGACCCAGGTGAACGTCCAAA 20heavy CAAGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCTGGCAGGTCCCTGAGAC 3 TCTCCTGTGCAGCCTCTGGATTCACCTTTGATGATTATGCCATGCACTGGGTCCGGCA AGCTCCAGGGAGGGGCCTGGAGTGGGTCTCAGGTATTAGTTGGAATAGTGGTATCGCA GTCTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAAAT CCCTGTATCTGCAAATCAACAGTCTGAGAGCTGAGGACACGGCCTTGTATTACTGTGT AAAAGATAACTATGCTTCGGGGAGTTATTCTTCTTACTACTACTACTACGGTCTGGAC CTCTGGGGCCAAGGGACCCTGGTCACCGTCTCCTCA 20light GAAATTGTGATGACTCAGTCTCCAGCCACCCTGTCTGTGTCTCCAGGGGAAAGAGCCA 4 CCCTCTCCTGCAGGGCCAGTCAGAGTATTATCAGCAACTTAGCCTGGTACCAGCAAAA ACCTGGCCAGGCTCCCAGGCTCCTCATTTATGGTGTATCCACCAGGGCCACTGGTATC CCAGCCAGGTTCAGTGGCAGTGGGTCTGACACAGAGTTCACTCTCTCCATCAGCAGCC TGCAGTCTGAAGATTTTGCAGTTTATTACTGTCAGCAGTATAATAACTGGCCGATCAC CTTCGGCCAAGGGACACGACTGGAGATTAAAC 130heavy NNNGTGCAGCTGGTGCAGTCTGGGGGAGGCCTGGTACAGCCTGGCAGGTCCCTGAGAC 5 TCTCCTGTAGAGCCTCTGGATTTAGATTTGATGATTACGCCATGCACTGGGTCCGGCA AGTTCCAGGGAAGGGCCTGGAGTGGGTCTCAGGTATCAGTTGGCACAGTGGTCATAGA GACTATGCGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAATT CCCTGTATCTAGAAATGAACAGTTTGAGAGCTGAGGACACGGCCTTGTATTATTGTGT AAAAGACAGTCACTATTTTGATAATAGTGGTTCTTATACCTATGGTTTGGATGTCTGG GGCCAAGGGACCCTGGTCACCGTCTCCTCA 130light CAGNTTGTGATGACTCAGTCTCCAGCCACATTGTCTGTGTCTCCAGGGGAAAGAGCCA 6 CCCTCTCCTGCAGGGCCAGTCAGAGTGTTCTCAGCAACTTAGCCTGGTACCAGCAGAA ACCTAGCCAGGCTCCCAGGCTCCTCATCTATGGAGCATCTGCCAGGGCCACTGGTATC CCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTCTCACCATCAGCAGCC TGCAGTCTGAAGATTTTGCAGTCTATTACTGTCAGCAGTATAATAATTGGCCTCTCAC TTTCGGCGGAGGGACCAAGGTGGAGATCAAG 61heavy CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGCTGAAGAAGCCTGGGGCCTCAGTGAAGG 7 TCTCGTGCAAGGCTTCCGGTTACACCTTTACCAATCATGGTATCACCTGGGTGCGACA GGCCCCTGGACAAGGGCTTGAGTGGATGTCATGGATCAGCGGTTACAATGGTAACACA CAGTATGCACAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACACATCCACGAGGA CGGCCTACATGGAGTTGAGGAGCCTGACATCTGACGACACGGCCGTCTATTATTGTGC GAGAGACAATGGAGTCGTAGTGGGACCTCCCGACTACTGGGGCCAGGGAACCCTGGTC ACCGTCTCCTCAG 61light GACATCCAGATGACCCAGTCTCCTTCCACCCTGTCTGCATCCGTAGGAGACAGAGTCA 8 CCATATCTTGCCGGGCCAGTCAGAGTATTAGTAGCTGGTTGGCCTGGTATCAGCAGAA ACCAGGGAAACCCCCTAAACTCCTGATCTATAAGGCGTCCGGTTTACAAACTGGGGTC CCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACCATCAGCAGCC TGCAGCCTGATGATTTTGCAACTTATTACTGCCAATATTATCATAGTCTTTCGGCTTT CGGCCAAGGGACCAAGGTGGAAATCAAAC 7heavy GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCTTGGTACAGCCCGGGGGGTCCCTGAGAC 9 TGTCCTGTGCAGCCTCTGGATTCACTTTTAGGAACTACGCCATGAGCTGGGTCCGCCA GGCTCCAGGGAAGGGGCTGGAGTGGGTCTCAGATATCAGTAGTGGTGGTGATACCACA TACTACGCAGAGTCCCTGAAGGGCCGGATCACCATCTCCAGAGACAATTCCAAGAACA CGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACGCGGCCATTTATTTCTGTGC GAAACATTTACTATCCCCTATGTACGTTAATACCGATGTGTTTCCGGACTGGTACTTC GAAATCTGGGGCCGTGGCACCCTGGTCACCGTCTCCTCAG 7light TCCTATGAGCTGACACAGCCACCCTCGGTGTCAGTGTCCCCAGGACAGACGGCCAGGA 10 TCACCTGCTCTGGAGATGGATTGCCAAAAAAATATGCTTATTGGTACCAGCAGAAGTC AGGCCAGGCCCCTGTCTTGGTCATCTATGATGACAGTAAGCGACCCTCCGGGATCCCT GAGAGATTCTCTGGCACCAGCTCAGGGACAATGGCCACCTTGATTATCAGTGGGGCCC AGGTGGAGGATGAGGCTGACTACTACTGTTACTCAAGACACAACAGTGCTTATCAAAG GGTGTTCGGCGCAGGGACCCAGCTGACCGTCCTA 131heavy CAAGTGCAGCTGGTGCAGTCTGGAACTGAGGTGAAGAAGCCTGGGACCTCAGTGAAGG 11 TCTCCTGCAAGGCTTCTGGTTACATTTTTAGCAACTATGGAATCAGTTGGGTGCGACA GGCCCCTGGACAAGGGCTTGAGTGGATGGGGTGGATCAGCGTTTACAATGGTAACACA AACTATGCACAGAAGTTCCAGGGCAGAGTCACCTTGACCACAGACACATCCACGAACA CTGCCTACATGGAGGTGAGGAGTCTGAGCTCTGACGACACGGCCGTATATTACTGTGC GAGAGAACCCCCGAGTCTTACAGCAGCTGGGCTTCTTGACTACTGGGGCCAGGGAACC CTGGTCACCGTCTCCTCA 131light CAGGCTGTGGTGACTCAGTCTCCACTCTCCCTGCCCGTCACCCTTGGACAGCCGGCCT 12 CCATCTCCTGCAGGTCTAGTCAAAGCCCCGTATACAGTGATGGAAACACCTACTTGAG TTGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGGCGCCTCATCTATGGAGCATCTGCC AGGGCCACTGGTATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACTTCACTC TCACCATCAGCAGCCTGCAGTCTGAAAATTTTGCATTCTATTACTGTCAGCAGTATAA TAATTGGCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAG 75heavy GAGGTGCAGCTGGTGGAGTCTGGGGGAGGCCTGGTCAAGCCTGGGGGGTCCCTGAGGC 13 TCTCCTGTGCAGCCTCTGGATTCACCTTCCGTAGTTATAGCATGAACTGGGTCCGCCA GGCTCCAGGGAAGGGGCTGGAGTGGGTCTCATCCATTACTAGTAGCAGTAGTTACATA GACTACGCAGACTCAGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCCAAGAACT CACTGTATCTTCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGCGC GAGAGCATATTGTGGTGGTGACTGCTCGGTTGACCACTTCCAGCACTGGGGCCAGGGC ACCCTGGTCACCGTCTCCTCAG 75light CAGTCTGTGCTGACTCAGCCGCCCTCAGTGTCTGGGGCCCCAGGGCAGAGGGTCACCA 14 TCTCCTGCACTGGGAGCAGCTCCAACATCGGGGCAGGTTATGATGTACACTGGTACCA GCACCTTCCAGGAACAGCCCCCAAACTCCTCATCTATGTTAACAGCAATCGGCCCTCA GGGGTCCCTGACCGCTTCTCTGCCTCCAAGTCTGGCACCTCAGCCTCCCTGGCCATCA CTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCCAGTCCTATGACAAAAGCCT GAGTGGTTTTTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCTAG 12heavy CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTTAAGAAGCCTGGGACCTCAGTGAGGG 15 TCTCCTGCAAGACTTCTGGTTATAACTTTATGAACTATGGTATCTACTGGGTGCGGCA GGCCCCTGGACAGGGACTTGAGTGGGTGGGATGGATCAGCGCCTACAATGGTCAAACA GACCGTGCACAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACATATCCACGAACA CAGGTTACATGGACCTGAGGAGTCTCAGATCTGACGACACGGCCGTGTATTTTTGTGC GAGAGGGCCCCCTGTTATAGCAGCAGTGTCCTTAGAATATTGGGGCCGGGGAACCCTG GTCACCGTCTCCTCAG 12light GAGGTTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCTTGGGCAGCCGGCCT 16 CCATCTCCTGCAAGTCTAGTCAAAGTCTCGTACACAGTAATGGAGACACCTACCTGAA TTGGTTTCAGCAGAGGCCAGGCCAATCTCCAAGGCGCCTAATTTATAAGGTTTCTAAC CGGGACTCTGGGGTCCCAGATAGATTCAGCGGCAGCGGGTCAGGCACTGATTTCACAC TGAAAATCAGTAGGGTGGAGACTGAGGATGTTGGGGTTTATTACTGCATGCAAGCTAC ACACTGGCCAGGCAGTTTTGGCCAGGGGACCAAGCTGGAGATCAAAC 141heavy CAAGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAAGG 17 TCTCCTGCAAGGCTTCTGGATACACCTTCACCAACTACTATATGCACTGGGTGCGACA GGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACCCTAACAGAGGTGGCACA AACTATGCACAGAAGTTTCAGGGCAGGGTCACCATGACCCTGGACACGTCCATCAGTA CAGCCTACATAGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTATTACTGTGC GAGAGATCTGACCTTGGGGACGGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCC TCA 141light CAGGCTGTGGTGACTCAGCCTGCCTCCGTGTTTGGGTTTCCTGGACAGTCGATCACCA 18 TTTCCTGCACTGGAACCAGCAGTGACGTTGGTGGTTATAAATATGTTTCCTGGTACCA ACAGCGCCCAGGCAAAGCCCCCAAAATCATGATTTATGAGGTCAGTAATCGGCCCTCA GGGGTTTCTAATCGCTTCTCTGGCTCCAAGTCTGGCAACACGGCCTCCCTGACCATCT CTGGGCTCCAGGCTGAGGACGAGGCTGATTATTACTGCAACTCATATACAAGCAGCAA CTCTTATGTCTTCGGAACTGGGACCAAGGTCACCGTC 137heavy CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCACTGAAGG 19 TCTCCTGCAAGGCTTCTGGTTACACTTTTTCCAACTATGGTCTTAGTTGGGTGCGACA GGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCGATTACAATGGTAACACA GAGTATGCACAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACAGATCCACGAGCA CTGCCTACATGGAACTAAAGAGCCTGAGATCTGACGACACGGCCGTGTATTACTGTGC GAGAGACCCCCCTGCAGCAGCAGCTGCCACTTATGACTACTGGGGCCAGGGAACCCTG GTCACCGTCTCCTCAG 137light CAGACTGTGATGACTCAGTCTCCACCCTCCCTGTCTGCATCTATAGGAGACAGAGTCA 20 CCATCACTTGCCGGGTGAGTCAGGGCATTGCCAGTTACTTAAATTGGAATCGGCAGAA ACCAGGGAACTTTCCTAAGGTCCTGATGCAGAGTATATCCAATTTGCAATCTGGAGTC CCATCTCGCTTCAGCGGCAGTGGGTCTGGGACAGATTTCACTCGCACCATCAGCAGCC TGCAGCCTGAAGATGTTGCGACTTATTACGGTCGACGGACTTACAATGCCCCTCTTGC ACTTTTGGCCAGGGGACCAACCTGCAGATCAAAC 106heavy CAGATCACCTTGAAGGAGTCTGGTCCTACGCTGGTGAAGCCCACACAGACCCTCACGC 21 TGACTTGTACCTTCTCTGGTTTCTCACTCACCACTCGTGGAGTGGGTGTGGCCTGGAT CCGTCAGCCCCCAGGCAAGGCCCTGGAGTGGCTTGCACTCATTTATTGGGATGATGAT AAGCGCTACAGGTCATCTCCAAAGGGCAGACTCACCATCACCAAGGACAACTCCAAAA ACCAGGTGGTCCTTATAATGACCAACATGGACCCTGTGGACACAGCCACATATTACTG TGCCCACGCCATGGATGATTCGGGGAGTTATTATGTCGGATTGTCAAAGGACCCCCAC TTTGACTCCTGGGGCCACGGAACCCTGGTCACCGTCTCCTCAG 106light TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGCA 22 TTACCTGCTCTGGTGATGTATTGTTTAATAAATTTGCTTCCTGGTATCAGCAGAAGCC AGGCCAGTCTCCTGTGCTGGTCATCTATCAGGATAGTAAGCGGCCCTCAGGGATCCCT GAACGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGGGGGACCC AGGCTATGGATGAGGCCGACTATTACTGTCAGGCGCGGGGCAGCACCGCTGCACATGT GATTTTCGGCGGGGGGACCAAGGTGACCGTCCTAG 139heavy CAGGTGCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTAAAGG 23 TCTCCTGTAAGGCCTCTGGTTACGTCTTTAGCAATTATGGTATCAGTTGGGTGCGACA GGCCCCTGGACAGGGGCTTGAGTGGATGGGATGGATCAGCGCTTATAATGGCAACACA GAGTTTGCACAGAAGTTCCAGGGCAGAATCACCATGACCACAGACACATCCACGAACA CAGCCTACCTGGAGGTGAGGGGCCTGAGATCTGACGACACGGCCGTCTATTATTGTTC ACGACAATCAGGTGTTTCAGGAGTTCCAGAGTTTCAGGACTGGGGCCAGGGAACCCTG GTCACCGTCTCCTCA 139light CAGGCTGTGGTGACTCAGTCTCCGCTCTCCCTGCCCGTCACCCTTGGACAGCCGGCCT 24 CCATCTCCTGCAGGTCTAGTCAAAGCCTCGTGTACAGTAATGGAGACACCTACTTGAG TTGGTTTCAGCAGAGGCCAGGCCAGTCTCCAAGGCGCCTAATCTATAAGGTTTCTAAC CGGGACTCTGGGGTCCCAGACAGATTCAGCGCCAGTGGGTCAGGCACTGATTTCACAC TGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCATGCAGGGTAC ACACTGGCCTCCGCCCACCTTCGGCCAAGGGACACGACTGGAGATTAAA 97heavy GAAGTGCAGCTGGTGGAGTCTGGGGGAACCTTGGTGCAGCCTGGCAGGTCCCTGAGAC 25 TCTCCTGTGCCGCCTCTGGATTCAATTTTGAAGAATATGCCATGCACTGGGTCAGGCA AGTTCCAGGGAAGGGCCTGGAGTGGGTCGCACGAATTAATTGGAATGGCGGTATCATA GGCTATGCGGACTCTGTGAAGGGCCGATTTACGATCTCCAGAGACAACGCCAAGAAGT CCTTGTATCTGCAAATGAACAGTCTGAGAACTGACGATTCGGCCTTGTATTACTGTGG AAAAGATGTGTTTTGGGCAGTGGCTGGTACGGGGGGGCCTATTGACTCCTGGGGCCAG GGAACCCTGGTCACCGTCTCCTCAG 97light GACATCGTGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATAGGAGACAGAGTCA 26 CCATCTCTTGCCGGGCGAGTCGGGACATTAGTAATTATTTAGCCTGGTATCAGCAGAA ATCAGGGAAAGTCCCTAAACTCCTGATATATGCTGCATCCACTTTGGAATCAGGGGTC CCGTCTCGCTTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGCAGCC TGCAGCCTGAAGATGTTGCAACTTATTACTGTCAAAACTATAACAGTGCCCAGATGTG CAGTTTTGGCCAGGGACCAAGCTTGGAGATCAAA
TABLE-US-00002 TABLE2 PROTEINSEQUENCESFORANTIBODYVARIABLEREGIONS SEQ Clone VariableSequence IDNO: 90heavy EVQLVESGGGLVQPRRSLRLSCAASGFTFDDYTIHWVRQAPGKGLEWVSGITWNSGYIG 27 YADSVKGRFTISRDNARNSLYLQMNSLRAEDTALYYCVRDAYVSGSDYYYYGLDVWGRG TLVTVSS 90light EIVMTSSPATLSVSPGERATLFCRASQSVISNLAWYQQKSGQAPRLLIYGASTRATGIP 28 ARFSGSGSGTEFTLTISSLQSEDFAVYFCQQYNNWPLTFGGGTQVNVQ 20heavy QVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGRGLEWVSGISWNSGIAV 29 YADSVKGRFTISRDNAKKSLYLQINSLRAEDTALYYCVKDNYASGSYSSYYYYYGLDLW GQGTLVTVSS 20light EIVMTQSPATLSVSPGERATLSCRASQSIISNLAWYQQKPGQAPRLLIYGVSTRATGIP 30 ARFSGSGSDTEFTLSISSLQSEDFAVYYCQQYNNWPITFGQGTRLEIK 130heavy XVQLVQSGGGLVQPGRSLRLSCRASGFRFDDYAMHWVRQVPGKGLEWVSGISWHSGHRD 31 YADSVKGRFTISRDNAKNSLYLEMNSLRAEDTALYYCVKDSHYFDNSGSYTYGLDVWGQ GTLVTVSS 130light QXVMTQSPATLSVSPGERATLSCRASQSVLSNLAWYQQKPSQAPRLLIYGASARATGIP 32 ARFSGSGSGTDFTLTISSLQSEDFAVYYCQQYNNWPLTFGGGTKVEIK 61heavy QVQLVQSGAELKKPGASVKVSCKASGYTFTNHGITWVRQAPGQGLEWMSWISGYNGNTQ 33 YAQKFQGRVTMTTDTSTRTAYMELRSLTSDDTAVYYCARDNGVVVGPPDYWGQGTLVTV SS 61light DIQMTQSPSTLSASVGDRVTISCRASQSISSWLAWYQQKPGKPPKLLIYKASGLQTGVP 34 SRFSGSGSGTEFTLTISSLQPDDFATYYCQYYHSLSAFGQGTKVEIK 7heavy EVQLVESGGGLVQPGGSLRLSCAASGFTFRNYAMSWVRQAPGKGLEWVSDISSGGDTTY 35 YAESLKGRITISRDNSKNTLYLQMNSLRAEDAAIYFCAKHLLSPMYVNTDVFPDWYFEI WGRGTLVTVSS 7light SYELTQPPSVSVSPGQTARITCSGDGLPKKYAYWYQQKSGQAPVLVIYDDSKRPSGIPE 36 RFSGTSSGTMATLIISGAQVEDEADYYCYSRHNSAYQRVFGAGTQLTVL 131heavy QVQLVQSGTEVKKPGTSVKVSCKASGYIFSNYGISWVRQAPGQGLEWMGWISVYNGNTN 37 YAQKFQGRVTLTTDTSTNTAYMEVRSLSSDDTAVYYCAREPPSLTAAGLLDYWGQGTLV TVSS 131light QAVVTQSPLSLPVTLGQPASISCRSSQSPVYSDGNTYLSWFQQRPGQSPRRLIYKISNR 38 DSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPRTFGQGTKVEIK 75heavy EVQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSITSSSSYID 39 YADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARAYCGGDCSVDHFQHWGQGTL VTVSS 75light QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQHLPGTAPKLLIYVNSNRPSG 40 VPDRFSASKSGTSASLAITGLQAEDEADYYCQSYDKSLSGFYVFGTGTKVTVL 12heavy QVQLVQSGAEVKKPGTSVRVSCKTSGYNFMNYGIYWVRQAPGQGLEWVGWISAYNGQTD 41 RAQKFQGRVTMTTDISTNTGYMDLRSLRSDDTAVYFCARGPPVIAAVSLEYWGRGTLVT VSS 12light EVVMTQSPLSLPVTLGQPASISCKSSQSLVHSNGDTYLNWFQQRPGQSPRRLIYKVSNR 42 DSGVPDRFSGSGSGTDFTLKISRVETEDVGVYYCMQATHWPGSFGQGTKLEIK 141heavy QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYYMHWVRQAPGQGLEWMGWINPNRGGTN 43 YAQKFQGRVTMTLDTSISTAYIELSRLRSDDTAVYYCARDLTLGTDYWGQGTLVTVSSA S 141light QAVVTQPASVFGFPGQSITISCTGTSSDVGGYNYVSWYQQRPGKAPKLMIYEVSNRPSG 44 VSNRFSGSKSGNTASLTISGLQAEDEADYYCNSYTSSNSYVFGTGTKVTVL 137heavy QVQLVQSGAEVKKPGASLKVSCKASGYTFSNYGLSWVRQAPGQGLEWMGWISDYNGNTE 45 YAQKFQGRVTMTTDRSTSTAYMELKSLRSDDTAVYYCARDPPAAAAATYDYWGQGTLVT VSS 137light QTVMTQSPPSLSASIGDRVTITCRVSQGIASYLNWNRQKPGNFPKVLMQSISNLQSGVP 46 SRFSGSGSGTDFTRTISSLQPEDVATYYGRRTYNAPLALLARGPTCRSN 106heavy QITLKESGPTLVKPTQTLTLTCTFSGFSLTTRGVGVAWIRQPPGKALEWLALIYWDDDK 47 RYRSSPKGRLTITKDNSKNQVVLIMTNMDPVDTATYYCAHAMDDSGSYYVGLSKDPHFD SWGHGTLVTVSS 106light SYELTQPPSVSVSPGQTASITCSGDVLFNKFASWYQQKPGQSPVLVIYQDSKRPSGIPE 48 RFSGSNSGNTATLTIRGTQAMDEADYYCQARGSTAAHVIFGGGTKVTVL 139heavy QVQLVQSGAEVKKPGASVKVSCKASGYVFSNYGISWVRQAPGQGLEWMGWISAYNGNTE 49 FAQKFQGRITMTTDTSTNTAYLEVRGLRSDDTAVYYCSRQSGVSGVPEFQDWGQGTLVT VSS 139light QAVVTQSPLSLPVTLGQPASISCRSSQSLVYSNGDTYLSWFQQRPGQSPRRLIYKVSNR 50 DSGVPDRFSASGSGTDFTLKISRVEAEDVGVYYCMQGTHWPPPTFGQGTRLEIK 97heavy EVQLVESGGTLVQPGRSLRLSCAASGFNFEEYAMHWVRQVPGKGLEWVARINWNGGIIG 51 YADSVKGRFTISRDNAKKSLYLQMNSLRTDDSALYYCGKDVFWAVAGTGGPIDSWGQGT LVTVSS 97light DIVMTQSPSSLSASIGDRVTISCRASRDISNYLAWYQQKSGKVPKLLIYAASTLESGVP 52 SRFSGSGSGTDFTLTISSLQPEDVATYYCQNYNSAQMCSFGQGPSLEIK
TABLE-US-00003 TABLE3 CDRHEAVYCHAINSEQUENCES CDRH1 CDRH2 Anti- (SEQ (SEQ CDRH3 body IDNO:) IDNO:) (SEQIDNO:) 90 GFTFDDYT ITWNSGYI VRDAYVSGSDYYYYGLDV (53) (54) (55) 20 GFTFDDYA ISWNSGIA VKDNYASGSYSSYYYYYGLDL (56) (57) (58) 130 GFRFDDYA ISWHSGHR VKDSHYFDNSGSYTYGLDV (59) (60) (61) 61 GYTFTNHG ISGYNGNT ARDNGVVVGPPDY (62) (63) (64) 7 GFTFRNYA ISSGGDTT AKHLLSPMYVNTDVFPDWYFEI (65) (66) (67) 131 GYIFSNYG ISVYNGNT AREPPSLTAAGLLDY (68) (69) (70) 75 GFTFRSYS ITSSSSYI ARAYCGGDCSVDHFQH (71) (72) (73) 12 GYNFMNYG ISAYNGQT ARGPPVIAAVSLEY (74) (75) (76) 141 GYTFTNYY INPNRGGT ARDLTLGTDY (77) (78) (79) 137 GYTFSNYG ISDYNGNT ARDPPAAAAATYDY (80) (81) (82) 106 GFSLTTRGVG IYWDDDK AHAMDDSGSYYVGLSKDPHFDS (83) (84) (85) 109 GYVFSNYG ISAYNGNT SRQSGVSGVPEFQD (86) (87) (88) 97 GFNFEEYA INWNGGII GKDVFWAVAGTGGPIDS (89) (90) (91)
TABLE-US-00004 TABLE4 CDRLIGHTCHAINSEQUENCES CDRL1 CDRL2 CDRL3 Antibody (SEQIDNO:) (SEQIDNO:) (SEQIDNO:) 90 QSVISN GAS QQYNNWPLT (92) (93) (94) 20 QSIISN GVS QQYNNWPIT (95) (96) (97) 130 QSVLSN GAS QQYNNWPLT (98) (99) (100) 61 QSISSW KAS QYYHSLSA (101) (102) (103) 7 (104) (105) (106) 131 QSPVYSDGNTY GAS QQYNNWPLT (107) (108) (109) 75 SSNIGAGYD VNS QSYDKSLSGFYV (110) (111) (112) 12 QSLVHSNGDTY KVS MQATHWPGS (113) (114) (115) 141 SSDVGGYKY EVS NSYTSSNSYV (116) (117) (118) 137 QGIASY SIS RRTYNAPLA (119) (120) (121) 106 VLFNKF QDS QARGSTAAHVI (122) (123) (124) 109 QSLVYSNGDTY KVS MQGTHWPPPT (125) (126) (127) 97 RDISNY AAS QNYNSAQMCS (128) (129) (130)
TABLE-US-00005 TABLE 5 Expression, isotype, binding, and neutralization data for generated hRSV mAbs with controls F protein binding for indicated strain (EC.sub.50 [ng/mL]) Average Neutralization for RSV B expression indicated strain (IC.sub.50 RSV A2 RSV 18537 RSV B level IgG Light [ng/mL]) SC-TM A2 DsCav1 18537 hRSV mAb (mg/L) subclass chain A2 18537 B Long (pre) (post) (pre) (post) 90 26 1 15 45 35 28 > 31 > 20 1.5 1 34 114 14 33 > 45 > 75 30 1 129 62 19 44 > 40 > 12 23 1 141 443 16 28 285 27 > 130 6.7 2 150 58 12 710 > 820 > 61 7 1 276 90 54 27 > 26 > 137 14 1 363 185 43 27 > 22 > 106 5.5 1 451 114 43 46 > 33 > 139 5.1 1 621 216 70 40 > 41 > 141 1.9 1 626 53 28 29 > 36 > 131 3.3 1 1,180 39 23 53 370 46 92 7 11 1 1,330 22 62 82 > 64 > 97 4.7 1 2,230 65 106 53 > 40 > Control mAbs D25 1 21 > 9 95 > > > 101F 1 402 109 92 40 85 54 96 motavizumab 1 123 91 9 17 83 22 84 palivizumab 1 11,000 1270 212 19 24 46 81 AM14 1 14 58 43 106 > > 198 EC.sub.50 values correspond to the concentration at which half-maximum signal was obtained in enzyme-linked immunosorbent assay, based on optical density at 405 nm. Neutralization values were determined using a plaque-reduction assay, where the IC.sub.50 corresponds to the mAb concentration at which 50% plaque reduction was observed. > indicates signal was not detected below 1 g/mL.
TABLE-US-00006 TABLE 6 Antibody gene usage for selected neutralizing mAbs Heavy chain Light chain V.sub.H gene J.sub.H gene HCDR V.sub.L gene J.sub.L gene LCDR mAh % Identity % Identity D.sub.H gene lengths Junction % Identity % Identity lengths Junction 12 IGHV1-18*01 IGHJ4*02 IGHD6-13*01 8.8.14 CARGPPVIAAVSLEYW IGKV2-30*02 IGKJ2*04 11.3.9 CMQATHW 89% 85% (SEQ ID NO: 131) 96% 95% PGSF (SEQ ID NO: 132) 131 IGHV1-18*01 IGHJ4*02 IGHD6-13*01 8.8.15 CAREPPSLTAAGLLDYW IGKV2-30*01 IGKJ4*01 11.3.9 CQQYNNWP 93% 87% (SEQ ID NO: 133) 82% 97% LTF (SEQ ID NO: 134) 61 IGHV1-18*01 IGHJ4*02 IGHD2-15*01 8.8.13 CARDNGVVVGPPDYW IGKV1-5*03 IGKJ1*01 6.3.8 CQYYHSLS 93% 83% (SEQ ID NO: 135) 96% 94% AF (SEQ ID NO: 136) 139 IGHV1-18*01 IGHJ1*01 IGHD3-10*02 8.8.14 CSRQSGVSGVPEFQDW IGKV2-30*01 IGKJ5*01 11.3.10 CMQGTHW 92% 84% (SEQ ID NO: 137) 96% 95% PPPTF (SEQ ID NO: 138) 90 IGHV3-9*01 IGHJ6*02 IGHD3-10*01 8.8.18 CVRDAYVSGSDYYYYGL IGKV3-15*01 IGKJ4*01 6.3.9 CQQYNNWP 97% 89% DVW (SEQ ID NO: 139) 96% 83% LTF (SEQ ID NO: 140) 20 IGHV3-9*01 IGHJ6*02 IGHD3-10*01 8.8.21 CVKDNYASGSYSSYYYY IGKV3-15*01 IGKJ5*01 6.3.9 CQQYNNWP 97% 92% YGLDLW (SEQ ID NO: 141) 96% 100% ITF (SEQ ID NO: 142) 130 IGHV3-9*01 IGHJ6*02 IGHD3-22*01 8.8.19 CVKDSHYFDNSGSYTYG IGKV3-15*01 IGKJ4*01 6.3.9 CQQYNNWP 92% 77% LDVW (SEQ ID NO: 143) 94% 97% LTF (SEQ ID NO: 144) 97 IGHV3-9*01 IGHJ4*02 IGHD6-19*01 8.8.17 CGKDVFWAVAGTGGPID IGKV1-27*01 IGKJ2*04 6.3.10 CQNYNSAQ 91% 85% SW (SEQ ID NO: 145) 95% 84% MCSF (SEQ ID NO: 146) MAbs are grouped based on heavy chain V gene analysis. hRSV90, hRSV20, hRSV130, and hRSV97 use similar V.sub.H genes, and hRSV12, hRSV131, hRSV61, and hRSV139 use similar V.sub.H genes. hRSV90 and hRSV20 have nearly identical gene usage, and hRSV20 has an HCDR3 insertion. Analysis was carried out by IMGT/VQUEST.sup.18. The percent identity for each predicted gene usage based on IMGT/VQUEST predictions is also displayed for V.sub.H and J.sub.H or V.sub.L and J.sub.L genes.
TABLE-US-00007 TABLE 7 Binding characteristics for hRSV mAbs to variant F proteins mutated at residues that contact mAb hRSV90 Binding to indicated recombinant RSV F point mutant variant protein for residues contacting the indicated CDR of hRSV90 [EC.sub.50 (ng/mL)] hRSV HCDR1 HCDR2 HCDR3 LCDR1/2 LCDR3 mAb K201A K201R S169A S169R S173A S173R D194A D194R N175A N175R D263A D263R T174A T174R 90 21 18 23 19 10 > 42 32 28 11 22 18 18 > 20 20 13 15 14 365 > 20 19 50 20 16 18 16 > 75 19 15 14 16 16 17 26 22 66 20 15 23 7 12 12 25 17 24 26 29 47 33 30 24 > 17 > 23 27 130 280 160 195 201 260 > 302 344 480 > 1,074 250 270 > 61 43 47 59 65 62 98 144 105 72 48 49 > 41 > 137 31 26 34 77 29 37 99 > 22 > 29 > 40 > 106 55 45 48 50 51 83 134 197 82 116 46 124 48 39 139 34 31 37 40 43 75 54 78 56 > 36 > 41 164 141 32 30 39 196 36 41 140 > > > 44 > 271 > 131 21 15 18 18 21 18 27 28 68 22 19 23 19 14 7 92 62 79 95 71 186 748 695 158 255 62 163 86 64 97 84 65 63 62 46 173 178 286 106 106 42 145 55 37 Control mAbs D25 630 21 19 21 35 21 107 44 690 22 19 27 21 16 AM14 28 23 18 26 170 1 > 58 > > 27 26 28 18 hRSV90 CDR loops interacting with specified RSV F SC-TM amino acid residues in the X-ray structure are indicated above each mutation. Both alanine and arginine mutations were tested at each of the seven positions.
TABLE-US-00008 TABLE S1 Data collection and refinement statistics hRSV90 + RSV A2F SC-TM Data collection * Beamline LS-CAT 21-ID-G Anisotropy correction Number of crystals 1 Space group R 3 2 H Cell dimensions a, b, c () 148.2, 148.2, 538.2 , , () 90, 90, 120 Resolution () 49.23 3.14 a = 3.6, b = 3.6, (3.26 3.14) c = 3.1 0.385 (4.715) 0.266 (0.768) I/
5.2 (0.5) 6.7 (2.2) Completeness (%) 99.9 (99.8) 75.2 (4.1) Redundancy 5.9 (5.9) 4.4 (0.2) Refinement Resolution () 48.31 3.14 No. unique reflections 30527 (272)
/
0.2212 (0.2603) No. atoms Protein 7077 B-factors Protein 71.68
deviations Bond lengths () 0.012 Bond angles () 1.41 Ramachandran statistics Favored regions (%) 95 Allowed regions (%) 4.8 Outliers (%) 0.22 Values in parentheses are for the highest resolution data shell.
[0198] All of the compositions and methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this disclosure have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the compositions and methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the disclosure. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the disclosure as defined by the appended claims.
VIII. REFERENCES
[0199] The following references, to the extent that they provide exemplary procedural or other details supplementary to those set forth herein, are specifically incorporated herein by reference. [0200] Adams et al. (2010) PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Cryst 66(Pt 2):213-21. [0201] Antibodies: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988. [0202] Abbondanzo et al., Am. J. Pediatr. Hematol. Oncol., 12(4), 480-489, 1990. [0203] Allred et al., Arch. Surg., 125(1), 107-113, 1990. [0204] Anderson et al. (1985) Antigenic characterization of respiratory syncytial virus strains with monoclonal antibodies. J Infect Dis 151 (4): 626-633. [0205] Atherton et al., Biol. of Reproduction, 32, 155-171, 1985. [0206] Brown et al., J Immunol. Meth., 12; 130(1):111-121, 1990. [0207] Campbell, In: Monoclonal Antibody Technology, Laboratory Techniques in Biochemistry and Molecular Biology, Vol. 13, Burden and Von Knippenberg, Eds. pp. 75-83, Amsterdam, Elsevier, 1984. [0208] Capaldi et al., Biochem. Biophys. Res. Comm., 74(2):425-433, 1977. [0209] Corti et al., Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature 501, 439-43 (2013). [0210] Davidson, E. & Doranz, B. J., Immunology 143, 13-20, 2014. [0211] De Jager et al., Semin. Nucl. Med. 23(2), 165-179, 1993. [0212] Dholakia et al., J. Biol. Chem., 264, 20638-20642, 1989. [0213] Doolittle and Ben-Zeev, Methods Mol. Biol., 109:215-237, 1999. [0214] Emsley & Cowtan (2004) Coot: model-building tools for molecular graphics. Acta Cryst 60(Pt 12 Pt 1):2126-32. [0215] Gefter et al., Somatic Cell Genet., 3:231-236, 1977. [0216] Gilman et al. (2015) Characterization of a prefusion-specific antibody that recognizes a quaternary, cleavage-dependent epitope on the RSV fusion glycoprotein. PLoS Pathog 11(7):e1005035. [0217] Group TIm-RS (1998) Palivizumab, a humanized respiratory syncytial virus monoclonal antibody, reduces hospitalization from respiratory syncytial virus infection in high-risk infants. Pediatrics 102:531-537. [0218] Gulbis and Galand, Hum. Pathol. 24(12), 1271-1285, 1993. [0219] Hall C B, et al. (2009) The burden of respiratory syncitial virus in young children. N Engl J Med 360:588-598. [0220] Kabsch W (2010) Xds. Acta Cryst 66(2):125-132. [0221] Khatoon et al., Ann. of Neurology, 26, 210-219, 1989. [0222] King et al., J. Biol. Chem., 269, 10210-10218, 1989. [0223] Kohler and Milstein, Eur. J. Immunol., 6, 511-519, 1976. [0224] Kohler and Milstein, Nature, 256, 495-497, 1975. [0225] Krarup et al. (2015) A highly stable prefusion RSV F vaccine derived from structural analysis of the fusion mechanism. Nat Commun 6:8143. [0226] Kyte and Doolittle, J. Mol. Biol., 157(1):105-132, 1982. [0227] Lopez et al., Antigenic structure of human respiratory syncytial virus fusion glycoprotein. J. Virol. 72, 6922-6928 (1998). [0228] McLellan et al., Structure of respiratory syncytial virus fusion glycoprotein in the postfusion conformation reveals preservation of neutralizing epitopes. J. Virol. 85, 7788-7796 (2011). [0229] McLellan et al. (2013a) Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science 340:1113-1117. [0230] McLellan et al. (2013b) Structure-based design of a fusion glycoprotein vaccine for respiratory syncytial virus. Science 342(6158):592-598. [0231] McLellan, J. S. (2015) Neutralizing epitopes on the respiratory syncytial virus fusion glycoprotein. Curr Opin Virol 11:70-75. [0232] Mousa et al., Structural basis for non-neutralizing antibody competition at antigenic site II of the respiratory syncytial virus fusion protein. PNAS (2016). [0233] Nakamura et al., In: Enzyme Immunoassays: Heterogeneous and Homogeneous Systems, Chapter 27, 1987. [0234] Ngwuta et al., Prefusion Fspecific antibodies determine the magnitude of RSV neutralizing activity in human sera. Sci. Transl. Med. 7, 309ra162 (2015). [0235] O'Shannessy et al., J. Immun. Meth., 99, 153-161, 1987. [0236] Persic et al., Gene 187:1, 1997 [0237] Potter and Haley, Meth. Enzymol., 91, 613-633, 1983. [0238] Remington's Pharmaceutical Sciences, 15th Ed., 3:624-652, 1990. [0239] Smith et al., Viral entry mechanisms: the increasing diversity of paramyxovirus entry. FEBS J. 276, 7217-7227 (2009). [0240] Smith & Crowe (2015) Use of human hybridoma technology to isolate human monoclonal antibodies. Microbiol Spectr 3:1-12. [0241] Strong et al., Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. PNAS 103, 8060-8065 (2006). [0242] Tang et al., J. Biol. Chem., 271:28324-28330, 1996. [0243] U.S. Pat. No. 3,817,837 [0244] U.S. Pat. No. 3,850,752 [0245] U.S. Pat. No. 3,939,350 [0246] U.S. Pat. No. 3,996,345 [0247] U.S. Pat. No. 4,196,265 [0248] U.S. Pat. No. 4,275,149 [0249] U.S. Pat. No. 4,277,437 [0250] U.S. Pat. No. 4,366,241 [0251] U.S. Pat. No. 4,472,509 [0252] U.S. Pat. No. 4,554,101 [0253] U.S. Pat. No. 4,680,338 [0254] U.S. Pat. No. 4,816,567 [0255] U.S. Pat. No. 4,867,973 [0256] U.S. Pat. No. 4,938,948 [0257] U.S. Pat. No. 5,021,236 [0258] U.S. Pat. No. 5,141,648 [0259] U.S. Pat. No. 5,196,066 [0260] U.S. Pat. No. 5,563,250 [0261] U.S. Pat. No. 5,565,332 [0262] U.S. Pat. No. 5,856,456 [0263] U.S. Pat. No. 5,880,270 [0264] Wawrzynczak & Thorpe, In: Immunoconjugates, Antibody Conjugates In Radioimaging And Therapy Of Cancer, Vogel (Ed.), NY, Oxford University Press, 28, 1987. [0265] Wu et al. (2007a) Characterization of the epitope for anti-human respiratory syncytial virus F protein monoclonal antibody 101F using synthetic peptides and genetic approaches. J Gen Virol 88(10):2719-2723. [0266] Wu et al. (2007b) Development of motavizumab, an ultra-potent antibody for the prevention of respiratory syncytial virus infection in the upper and lower respiratory tract. J Mol Biol 368(3):652-665. [0267] Yu et al., (2008) An optimized electrofusion-based protocol for generating virus-specific human monoclonal antibodies. J Immunol Methods 336(2):142-151.