METHODS OF TREATING CANCER
20190367613 ยท 2019-12-05
Inventors
- Christopher HARVEY (Boston, MA, US)
- Deborah LAW (Hillsborough, CA, US)
- Amanda Elizabeth HANSON (Newton, MA, US)
- Martin Yu FAN (Boston, MA, US)
Cpc classification
C07K2317/33
CHEMISTRY; METALLURGY
G01N2800/52
PHYSICS
A61K2039/507
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2317/70
CHEMISTRY; METALLURGY
G01N33/57492
PHYSICS
C07K16/2896
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
International classification
Abstract
The invention provides methods of treating cancer and methods for selecting treatment approaches for cancer.
Claims
1. A method of treating cancer in a subject in need thereof, the method comprising (i) administering one or more dosages of one or more anti-cancer therapies to the subject, (ii) after the administration, obtaining one or more peripheral blood test samples from the subject, (iii) measuring ICOS and/or T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, (iv) determining if there is a population of CD4+ T cells having elevated ICOS and/or T-bet levels in any of the one or more peripheral blood test samples when compared to a control, and (v) administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels.
2. The method of claim 1, wherein: (a) step (iii) comprises measuring ICOS levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated ICOS levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS levels; (b) step (iii) comprises measuring T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated T-bet levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated T-bet levels; (c) step (iii) comprises measuring ICOS and T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated ICOS and T-bet levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels; (d) step (iii) comprises measuring ICOS and T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated ICOS and T-bet levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises (a) administering one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and T-bet levels; or (e) step (v) comprises administration of an anti-ICOS antibody agonist to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels.
3-5. (canceled)
6. A method for determining whether a subject may benefit from (a) continued treatment with one or more anti-cancer therapies or (b) treatment with an anti-ICOS agonist, the method comprising determining ICOS and/or T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS and/or T-bet levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment.
7. The method of claim 6, wherein: (a) the method comprises determining ICOS levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment; (b) the method comprises determining T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased T-bet levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment; or (c) the method comprises determining ICOS and T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS or T-bet levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment.
8-9. (canceled)
10. The method of claim 1, wherein: (a) the one or more anti-cancer therapies comprises an immunotherapy, an anti-CTLA-4 antagonist antibody, an anti-PD-1 or anti-PD-L1 antagonist antibody, one or more of the therapies listed in Table 2, a chemotherapy, or radiation therapy, or (b) the one or more anti-cancer therapies, or the anti-ICOS agonist, comprises an anti-ICOS agonist antibody.
11. (canceled)
12. The method of claim 10, wherein: (a) the one or more anti-cancer therapies comprises an anti-CTLA-4 antagonist antibody is selected from the group consisting of ipilimumab, tremelimumab, and BMS-986249; (b) the one or more anti-cancer therapies comprises an anti-PD-1 or anti-PD-L1 antagonist antibody selected from the group consisting of avelumab, atezolizumab, CX-072, pembrolizumab, nivolumab, cemiplimab, spartalizumab, tislelizumab, JNJ-63723283, genolimzumab, AMP-514, AGEN2034, durvalumab, and JNC-1; (c) the one or more anti-cancer therapies, or the anti-ICOS agonist, comprises an antibody selected from the group consisting of JTX-2011, BMS-986226, and GSK3359609; (d) the one or more anti-cancer therapies comprises a chemotherapy selected from the group consisting of capecitabine, cyclophosphamide, dacarbazine, temozolomide, cyclophosphamide, docetaxel, doxorubicin, daunorubicin, cisplatin, carboplatin, epirubicin, eribulin, 5-FU, gemcitabine, irinotecan, ixabepilone, methotrexate, mitoxantrone, oxaliplatin, paclitaxel, nab-paclitaxel, pemetrexed, vinorelbine, vincristine, erlotinib, afatinib, gefitinib, crizotinib, dabrafenib, trametinib, vemurafenib, and cobimetanib; or (e) the one or more anti-cancer therapies comprises any combination of at least two or three of: (i) an anti-CTLA-4 antagonist antibody, (ii) an anti-PD-1 or anti-PD-L1 antagonist antibody, (iii) an anti-ICOS agonist antibody, (iv) a therapy of Table 2, (v) a chemotherapy, and (vi) radiation therapy.
13-23. (canceled)
24. The method of claim 1, wherein the anti-ICOS antibody agonist comprises: (i) at least one CDR selected from the group consisting of: (a) an HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) an HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; (c) an HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; (d) an LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) an LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) an LCDR3 comprising the amino acid sequence of SEQ ID NO: 10, wherein one or more of the CDRs comprises 1 or 2 amino acid substitutions; (ii)(a) an HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) an HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; (c) an HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; (d) an LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) an LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) an LCDR3 comprising the amino acid sequence of SEQ ID NO: 10; or (iii)(a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and/or (b) a light chain comprising the amino acid sequence of SEQ ID NO: 2.
25-28. (canceled)
29. The method of claim 1, wherein the one or more anti-cancer therapies is administered two, three, four, five, or more times prior to obtaining the one or more peripheral blood test samples.
30-32. (canceled)
33. The method of claim 1, wherein the obtaining of the one or more peripheral blood test samples is performed fewer than 4, 3, 2, or 1 weeks after the one or more administrations of the dosages of the one or more anti-cancer therapies.
34-36. (canceled)
37. The method of claim 1, wherein the dosage of the one or more anti-cancer therapies is administered multiple times at regular intervals.
38. The method of claim 37, wherein: (a) the regular intervals are selected from the group consisting of a dosage every week, a dosage every two weeks, a dosage every three weeks, a dosage every four weeks, a dosage every six weeks, a dosage every nine weeks, and a dosage every twelve weeks; (b) the obtaining of the one or more peripheral blood test samples comprises the obtaining of multiple peripheral blood test samples, with test samples being obtained concurrent with one or more of the administrations; (c) the obtaining of the one or more peripheral blood test samples comprises the obtaining of multiple peripheral blood test samples, with test samples being obtained during a time intervening the multiple administrations; or (d) the method further comprises halting the administration of the one or more anti-cancer therapies if, after the one or more anti-cancer therapies is administered for four or more intervals, a population of CD4+ T cells having elevated ICOS and/or T-bet levels compared to a control is not detected in any one of the peripheral blood test samples, and optionally further comprises halting the administration of the one or more anti-cancer therapies if, after of the one or more anti-cancer therapies is administered for five or more, six or more, seven or more, eight or more, nine or more, or ten or more intervals, a peripheral blood test sample is obtained based on which it is determined that there is not a population of CD4+ T cells having elevated ICOS and/or T-bet levels compared to a control.
39-42. (canceled)
43. The method of claim 1, wherein the method further comprises storing a portion of one or more of the peripheral blood test samples.
44. The method of claim 1, wherein a portion of the CD4+ T cells having elevated ICOS and/or T-bet levels is isolated from one or more of the peripheral blood test samples and stored under conditions suitable for maintaining the viability of the CD4+ T cells, and optionally: (a) the stored CD4+ T cells are stored in a cell culture medium; (b) the stored CD4+ T cells are stored at a concentration of greater than 100,000 cells/mL; or (c) the stored CD4+ T cells are stored at a concentration between 100,000 cells/mL and 100 million cells/mL.
45-47. (canceled)
48. A suspension of CD4+ T cells obtained according to the method of claim 44.
49. The method of claim 1, wherein the control comprises a peripheral blood test sample, which is optionally obtained from the subject before one or more of the administrations of the one or more anti-cancer therapies to the subject, or the control comprises a peripheral blood sample obtained from a healthy individual not receiving the one or more anti-cancer therapies.
50. (canceled)
51. The method of claim 1, wherein determining of ICOS and/or T-bet levels comprises the use of an immunoassay, and optionally the immunoassay comprises the use of an antibody that binds to an intracellular domain of ICOS to detect ICOS, wherein the antibody optionally: (a) comprises a heavy chain variable region sequence of SEQ ID NO: 27 and a light chain variable region sequence of SEQ ID NO: 31; (b) comprises a heavy chain variable region sequence of SEQ ID NO: 35 and a light chain variable region sequence of SEQ ID NO: 39; (c) cross-competes with an antibody comprising a heavy chain variable region sequence of SEQ ID NO: 27 and a light chain variable region sequence of SEQ ID NO: 31; or (d) cross-competes with an antibody comprising a heavy chain variable region sequence of SEQ ID NO: 35 and a light chain variable region sequence of SEQ ID NO: 39.
52-54. (canceled)
55. The method of claim 1, further comprising measuring ICOS and/or T-bet levels of CD8+ T cells present in the one or more peripheral blood test samples, wherein a population of CD8+ T cells having elevated ICOS and/or T-bet levels relative to a control is not detected in the samples.
56. The method of claim 1, wherein the cancer is selected from gastric cancer, breast cancer, which optionally is triple negative breast cancer (TNBC), non-small cell lung cancer (NSCLC), melanoma, renal cell carcinoma (RCC), bladder cancer, endometrial cancer, diffuse large B-cell lymphoma (DLBCL), Hodgkin's lymphoma, ovarian cancer, and head and neck squamous cell cancer (HNSCC).
57. The method of claim 1, wherein the subject is a human patient.
58. The method of claim 1, wherein the population of CD4+ T cells having elevated ICOS and/or T-bet levels comprises a new, separate population of CD4+ T cells, which was induced by the one or more anti-cancer therapies.
59. A method of generating an expanded population of CD4+ T cells having elevated ICOS expression, said method comprising culturing the suspension of CD4+ T cells of claim 48 under initial culture conditions suitable for expanding said population of CD4+ T cells.
60. The method of claim 59, wherein said initial conditions suitable for expanding said population of CD4+ T cells comprise contacting said suspension of CD4+ T cells with a CD3 agonist, wherein optionally: (a) said CD3 agonist is an anti-CD3 antibody, which optionally is OKT3; (b) said initial conditions suitable for expanding said population of CD4+ T cells comprise contacting said suspension with one or more of an anti-PD-1 antibody antagonist, an anti-CTLA-4 antibody, and an ICOS agonist; (c) said initial conditions suitable for expanding said population of CD4+ T cells comprise contacting said suspension with one, two, or three compounds selected from the group consisting of IL-2, IL-12 and anti-IL-4; (d) said initial conditions suitable for expanding said population of CD4+ T cells comprise contacting said suspension with an anti-CD28 antibody agonist; (e) said CD3 agonist is present in a tetrameric antibody complex with an anti-CD28 agonist; or (f) said suspension of CD4+ T cells are incubated under said initial culture conditions for a period of 1, 2, 3, 4, or 5 days, and optionally the method further comprises incubating said suspension of CD4+ T cells under a second culture condition suitable for expanding said population of CD4+ T cells.
61-67. (canceled)
68. The method of claim 60, wherein said suspension of CD4+ T cells are incubated under said initial culture conditions for a period of 1, 2, 3, 4, or 5 days; the method further comprises incubating said suspension of CD4+ T cells under a second culture condition suitable for expanding said population of CD4+ T cells; and said cells are washed prior to the application of said second culture condition, wherein optionally: (a) said second culture condition comprises contacting said suspension of cells with one or more of an anti-PD-1 antibody antagonist, an anti-CTLA-4 antibody, and an ICOS agonist; (b) said second culture condition comprises contacting said suspension of cells with one, two, or three compounds selected from the group consisting of IL-2, IL-12, and anti-IL-4; (c) said second culture condition comprises contacting said suspension of cells with an anti-CD28 antibody agonist; (d) said second culture conditions does not comprise contacting said suspension of cells with a CD3 agonist and/or CD28 agonist; or (e) said second culture condition is maintained for between 1 and 5 days (e.g., for 1, 2, 3, 4, or 5 days).
69-73. (canceled)
74. A suspension of cells generated by the method of claim 59.
75. A method of treating cancer in a subject in need thereof, the method comprising administering to said patient the suspension of cells of claim 74, wherein optionally the suspension of T-cells was isolated from said subject.
76. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
DETAILED DESCRIPTION
[0082] Methods of treating cancer are provided. The methods include treating subjects with one or more anti-cancer therapies and then determining whether peripheral blood samples of the subjects include CD4+ T cells with elevated ICOS and/or T-bet levels. If they do, then either (a) treatment with the one or more anti-cancer therapies is continued, optionally in combination with treatment with an anti-ICOS agonist antibody, or (b) the subject is treated with an anti-ICOS agonist (e.g., an anti-ICOS agonist antibody) in the absence of further treatment with the one or more anti-cancer therapies. Also provided are methods for determining whether a subject may benefit from continued treatment with one or more anti-cancer therapies, or treatment with an anti-ICOS agonist (e.g., an anti-ICOS agonist antibody), based on detection of elevated ICOS and/or T-bet levels in CD4+ T cells from peripheral blood samples. If a population of such cells is identified in a sample, then the subject may benefit from either (a) continued treatment with the one or more anti-cancer therapies, optionally in combination with an anti-ICOS agonist antibody, or (b) treatment with an anti-ICOS agonist (e.g., an anti-ICOS agonist antibody) in the absence of further treatment with the one or more anti-cancer therapies.
[0083] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.
[0084] All references cited herein, including patent applications, patent publications, and Genbank Accession numbers are herein incorporated by reference, as if each individual reference were specifically and individually indicated to be incorporated by reference in its entirety.
I. Definitions
[0085] Unless otherwise defined, scientific and technical terms used in connection with the present disclosure shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context or expressly indicated, singular terms shall include pluralities and plural terms shall include the singular. For any conflict in definitions between various sources or references, the definition provided herein will control.
[0086] It is understood that embodiments of the invention described herein include consisting and/or consisting essentially of embodiments.
[0087] As used herein, the singular form a, an, and the includes plural references unless indicated otherwise.
[0088] Use of the term or herein is not meant to imply that alternatives are mutually exclusive.
[0089] In this application, the use of or means and/or unless expressly stated or understood by one skilled in the art. In the context of a multiple dependent claim, the use of or refers back to more than one preceding independent or dependent claim.
[0090] As is understood by one skilled in the art, reference to about a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to about X includes description of X.
[0091] The terms nucleic acid molecule, nucleic acid, and polynucleotide may be used interchangeably, and refer to a polymer of nucleotides. Such polymers of nucleotides may contain natural and/or non-natural nucleotides, and include, but are not limited to, DNA, RNA, and PNA. Nucleic acid sequence refers to the linear sequence of nucleotides that comprise the nucleic acid molecule or polynucleotide.
[0092] The terms polypeptide and protein are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. Furthermore, for purposes of the present disclosure, a polypeptide refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.
[0093] As used herein, percent (%) amino acid sequence identity and homology with respect to a peptide, polypeptide or antibody sequence are defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or MEGALIGN (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
[0094] An amino acid substitution may include but are not limited to the replacement of one amino acid in a polypeptide with another amino acid. Exemplary substitutions are shown in Table 1. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, for example, retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
TABLE-US-00001 TABLE 1 Original Residue Exemplary Substitutions Ala (A) Val; Leu; Ile Arg (R) Lys; Gln; Asn Asn (N) Gln; His; Asp, Lys; Arg Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn; Glu Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln; Lys; Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Lys (K) Arg; Gln; Asn Met (M) Leu; Phe; Ile Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ser (S) Thr Thr (T) Val; Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe; Thr; Ser Val (V) Ile; Leu; Met; Phe; Ala; Norleucine
[0095] Amino acids may be grouped according to common side-chain properties: [0096] (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; [0097] (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; [0098] (3) acidic: Asp, Glu; [0099] (4) basic: His, Lys, Arg; [0100] (5) residues that influence chain orientation: Gly, Pro; [0101] (6) aromatic: Trp, Tyr, Phe.
[0102] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0103] ICOS and inducible T-cell costimulatory as used herein refer to any native ICOS that results from expression and processing of ICOS in a cell. The term includes ICOS from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus monkeys) and rodents (e.g., mice and rats), unless otherwise indicated. The term also includes naturally occurring variants of ICOS, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human ICOS precursor protein, with signal sequence (amino acids 1-20) is shown in SEQ ID NO: 11. The amino acid sequence of an exemplary mature human ICOS is shown in SEQ ID NO: 12. The intracellular portion of ICOS is indicated in Table 3 by underlining within SEQ ID NOs: 11 and 12. The amino acid sequence of an exemplary mouse ICOS precursor protein, with signal sequence (amino acids 1-20) is shown in SEQ ID NO: 13. The amino acid sequence of an exemplary mature mouse ICOS is shown in SEQ ID NO: 14. The amino acid sequence of an exemplary rat ICOS precursor protein, with signal sequence (amino acids 1-20) is shown in SEQ ID NO: 15. The amino acid sequence of an exemplary mature rat ICOS is shown in SEQ ID NO: 16. The amino acid sequence of an exemplary cynomolgus monkey ICOS precursor protein, with signal sequence (amino acids 1-20) is shown in SEQ ID NO: 17. The amino acid sequence of an exemplary mature cynomolgus monkey ICOS is shown in SEQ ID NO: 18.
[0104] T-bet, T-cell-Specific T-Box Transcription Factor T-Bet, or T-Box 21 as used herein refer to any native T-bet, encoded by the TBX21 gene, that results from expression and processing of T-bet in a cell. The term includes T-bet from any vertebrate source, including mammals such as primates (e.g., humans and cynomolgus monkeys) and rodents (e.g., mice and rats), unless otherwise indicated. The term also includes naturally occurring variants of T-bet, e.g., splice variants or allelic variants. The amino acid sequence of an exemplary human T-bet protein is shown in SEQ ID NO: 43. The amino acid sequence of an exemplary mouse T-bet is shown in SEQ ID NO: 44.
[0105] The term specifically binds to an antigen or epitope is a term that is well-understood in the art, and methods to determine such specific binding are also well known in the art. A molecule is said to exhibit specific binding or preferential binding if it reacts or associates more frequently, more rapidly, with greater duration, and/or with greater affinity with a particular cell or substance than it does with alternative cells or substances. An antibody specifically binds or preferentially binds to a target if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. For example, an antibody that specifically or preferentially binds to an ICOS epitope is an antibody that binds this epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other ICOS epitopes or non-ICOS epitopes. It is also understood by reading this definition that, for example, an antibody (or moiety or epitope) that specifically or preferentially binds to a first target may or may not specifically or preferentially bind to a second target. As such, specific binding or preferential binding does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding. Specificity refers to the ability of a binding protein to selectively bind an antigen.
[0106] As used herein, substantially pure refers to material which is at least 50% pure (that is, free from contaminants), more preferably, at least 90% pure, more preferably, at least 95% pure, yet more preferably, at least 98% pure, and most preferably, at least 99% pure.
[0107] As used herein, the term epitope refers to a site on a target molecule (for example, an antigen, such as a protein, nucleic acid, carbohydrate, or lipid) to which an antigen-binding molecule (for example, an antibody, antibody fragment, or scaffold protein containing antibody binding regions) binds. Epitopes often include a chemically active surface grouping of molecules such as amino acids, polypeptides, or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics. Epitopes can be formed both from contiguous and/or juxtaposed noncontiguous residues (for example, amino acids, nucleotides, sugars, or lipid moieties) of the target molecule. Epitopes formed from contiguous residues, also called linear epitopes (for example, amino acids, nucleotides, sugars, or lipid moieties), typically are retained on exposure to denaturing solvents whereas epitopes formed from non-contiguous residues, also called non-linear or conformational epitopes, are formed by tertiary folding, and typically are lost on treatment with denaturing solvents. An epitope may include, but is not limited to, at least 3, at least 5, or 8-10 residues (for example, amino acids or nucleotides). In some examples, an epitope is less than 20 residues (for example, amino acids or nucleotides) in length, less than 15 residues, or less than 12 residues.
[0108] Two antibodies may bind to the same epitope within an antigen, or to overlapping epitopes, if they exhibit competitive binding for the antigen. Accordingly, in some embodiments, an antibody is said to cross-compete with another antibody if it specifically interferes with the binding of the antibody to the same or an overlapping epitope.
[0109] The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to, monoclonal antibodies, polyclonal antibodies, multispecific antibodies (for example, bispecific (such as Bi-specific T-cell engagers) and trispecific antibodies), and antibody fragments as long as they exhibit a desired antigen-binding activity.
[0110] The term antibody includes, but is not limited to, fragments that are capable of binding to an antigen, such as Fv, single-chain Fv (scFv), Fab, Fab, di-scFv, sdAb (single domain antibody), and (Fab)2 (including a chemically linked F(ab)2). Papain digestion of antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab)2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen. The term antibody also includes, but is not limited to, chimeric antibodies, humanized antibodies, and antibodies of various species such as mouse, human, cynomolgus monkey, etc. Furthermore, for all antibody constructs provided herein, variants having the sequences from other organisms are also contemplated. Thus, if a human version of an antibody is disclosed, one of skill in the art will appreciate how to transform the human sequence based antibody into a mouse, rat, cat, dog, horse, etc. sequence. Antibody fragments also include either orientation of single chain scFvs, tandem di-scFv, diabodies, tandem tri-sdcFv, minibodies, etc. Antibody fragments also include nanobodies (sdAb, an antibody having a single, monomeric domain, such as a pair of variable domains of heavy chains, without a light chain). An antibody fragment can be referred to as being a specific species in some embodiments (for example, human scFv or a mouse scFv). This denotes the sequences of at least part of the non-CDR regions, rather than the source of the construct.
[0111] The term monoclonal antibody refers to an antibody of a substantially homogeneous population of antibodies, that is, the individual antibodies comprising the population are identical except for possible naturally-occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. Thus, a sample of monoclonal antibodies can bind to the same epitope on the antigen. The modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies may be made by the hybridoma method first described by Kohler and Milstein, 1975, Nature 256:495, or may be made by recombinant DNA methods such as described in U.S. Pat. No. 4,816,567. The monoclonal antibodies may also be isolated from phage libraries generated using the techniques described in McCafferty et al., 1990, Nature 348:552-554, for example.
[0112] The term CDR denotes a complementarity determining region as defined by at least one manner of identification to one of skill in the art. In some embodiments, CDRs can be defined in accordance with any of the Chothia numbering schemes, the Kabat numbering scheme, a combination of Kabat and Chothia, the AbM definition, the contact definition, and/or a combination of the Kabat, Chothia, AbM, and/or contact definitions. Exemplary CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) occur at amino acid residues 24-34 of L1, 50-56 of L2, 89-97 of L3, 31-35B of H1, 50-65 of H2, and 95-102 of H3. (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). The AbM definition can include, for example, CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) at amino acid residues 24-34 of L1, 50-56 of L2, 89-97 of L3, H26-H35B of H1, 50-58 of H2, and 95-102 of H3. The Contact definition can include, for example, CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) at amino acid residues 30-36 of L1, 46-55 of L2, 89-96 of L3, 30-35 of H1, 47-58 of H2, and 93-101 of H3. The Chothia definition can include, for example, CDRs (CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3) at amino acid residues 24-34 of L1, 50-56 of L2, 89-97 of L3, 26-32 . . . 34 of H1, 52-56 of H2, and 95-102 of H3. With the exception of CDR1 in V.sub.H, CDRs generally comprise the amino acid residues that form the hypervariable loops. The various CDRs within an antibody can be designated by their appropriate number and chain type, including, without limitation as: a) CDR-L1, CDR-L2, CDR-L3, CDR-H1, CDR-H2, and CDR-H3; b) CDRL1, CDRL2, CDRL3, CDRH1, CDRH2, and CDRH3; c) LCDR-1, LCDR-2, LCDR-3, HCDR-1, HCDR-2, and HCDR-3; or d) LCDR1, LCDR2, LCDR3, HCDR1, HCDR2, and HCDR3; etc. The term CDR is used herein to also encompass HVR or a hyper variable region, including hypervariable loops. Exemplary hypervariable loops occur at amino acid residues 26-32 (L1), 50-52 (L2), 91-96 (L3), 26-32 (H1), 53-55 (H2), and 96-101 (H3) (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)).
[0113] The term heavy chain variable region as used herein refers to a region comprising at least three heavy chain CDRs. In some embodiments, the heavy chain variable region includes the three CDRs and at least FR2 and FR3. In some embodiments, the heavy chain variable region includes at least heavy chain HCDR1, framework (FR) 2, HCDR2, FR3, and HCDR3. In some embodiments, a heavy chain variable region also comprises at least a portion of an FR1 and/or at least a portion of an FR4.
[0114] The term heavy chain constant region as used herein refers to a region comprising at least three heavy chain constant domains, CH1, CH2, and CH3. Of course, non-function-altering deletions and alterations within the domains are encompassed within the scope of the term heavy chain constant region, unless designated otherwise. Non-limiting exemplary heavy chain constant regions include , , and . Non-limiting exemplary heavy chain constant regions also include and . Each heavy constant region corresponds to an antibody isotype. For example, an antibody comprising a constant region is an IgG antibody, an antibody comprising a constant region is an IgD antibody, and an antibody comprising an constant region is an IgA antibody. Further, an antibody comprising a constant region is an IgM antibody, and an antibody comprising an c constant region is an IgE antibody. Certain isotypes can be further subdivided into subclasses. For example, IgG antibodies include, but are not limited to, IgG1 (comprising a .sub.1 constant region), IgG2 (comprising a .sub.2 constant region), IgG3 (comprising a .sub.3 constant region), and IgG4 (comprising a .sub.4 constant region) antibodies; IgA antibodies include, but are not limited to, IgA1 (comprising an .sub.1 constant region) and IgA2 (comprising an .sub.2 constant region) antibodies; and IgM antibodies include, but are not limited to, IgM1 and IgM2.
[0115] The term heavy chain as used herein refers to a polypeptide comprising at least a heavy chain variable region, with or without a leader sequence. In some embodiments, a heavy chain comprises at least a portion of a heavy chain constant region. The term full-length heavy chain as used herein refers to a polypeptide comprising a heavy chain variable region and a heavy chain constant region, with or without a leader sequence.
[0116] The term light chain variable region as used herein refers to a region comprising at least three light chain CDRs. In some embodiments, the light chain variable region includes the three CDRs and at least FR2 and FR3. In some embodiments, the light chain variable region includes at least light chain LCR1, framework (FR) 2, LCD2, FR3, and LCD3. For example, a light chain variable region may comprise light chain CDR1, framework (FR) 2, CDR2, FR3, and CDR3. In some embodiments, a light chain variable region also comprises at least a portion of an FR1 and/or at least a portion of an FR4.
[0117] The term light chain constant region as used herein refers to a region comprising a light chain constant domain, C.sub.L. Non-limiting exemplary light chain constant regions include and K. Of course, non-function-altering deletions and alterations within the domains are encompassed within the scope of the term light chain constant region, unless designated otherwise.
[0118] The term light chain as used herein refers to a polypeptide comprising at least a light chain variable region, with or without a leader sequence. In some embodiments, a light chain comprises at least a portion of a light chain constant region. The term full-length light chain as used herein refers to a polypeptide comprising a light chain variable region and a light chain constant region, with or without a leader sequence.
[0119] An acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a light chain variable domain (V.sub.L) framework or a heavy chain variable domain (V.sub.H) framework derived from a human immunoglobulin framework or a human consensus framework, as defined below. An acceptor human framework derived from a human immunoglobulin framework or a human consensus framework can comprise the same amino acid sequence thereof, or it can contain amino acid sequence changes. In some embodiments, the number of amino acid changes are 10 or less, 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, or 2 or less. In some embodiments, the V.sub.L acceptor human framework is identical in sequence to the V.sub.L human immunoglobulin framework sequence or human consensus framework sequence.
[0120] Affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (for example, an antibody) and its binding partner (for example, an antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (KD). Affinity can be measured by common methods known in the art (such as, for example, ELISA KD, KinExA, bio-layer interferometry (BLI), and/or surface plasmon resonance devices (such as a BIAcore device), including those described herein).
[0121] The term KD, Kd, Kd, or Kd value as used herein, refers to the equilibrium dissociation constant of an antibody-antigen interaction.
[0122] The term biological activity refers to any one or more biological properties of a molecule (whether present naturally as found in vivo, or provided or enabled by recombinant means). Biological properties include, but are not limited to, binding a receptor, inducing cell proliferation, inhibiting cell growth, inducing other cytokines, inducing apoptosis, and enzymatic activity. In some embodiments, biological activity of an ICOS protein includes, for example, costimulation of T cell proliferation and cytokine secretion associated with Th1 and Th2 cells; modulation of Treg cells; effects on T cell differentiation including modulation of transcription factor gene expression; induction of signaling through PI3K and AKT pathways; and mediating ADCC.
[0123] The term substantially similar or substantially the same, as used herein, denotes a sufficiently high degree of similarity between two or more numeric values such that one of skill in the art would consider the difference between the two or more values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said value. In some embodiments the two or more substantially similar values differ by no more than about any one of 5%, 10%, 15%, 20%, 25%, or 50%.
[0124] The phrase substantially different, as used herein, denotes a sufficiently high degree of difference between two numeric values such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by said values. In some embodiments, the two substantially different numeric values differ by greater than about any one of 10%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%.
[0125] The phrase substantially reduced, as used herein, denotes a sufficiently high degree of reduction between a numeric value and a reference numeric value such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by said values. In some embodiments, the substantially reduced numeric values is reduced by greater than about any one of 10%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100% compared to the reference value.
[0126] The phrase substantially increased, as used herein, denotes a sufficiently high degree of increase between a numeric value and a reference numeric value such that one of skill in the art would consider the difference between the two values to be of statistical significance within the context of the biological characteristic measured by said values. In some embodiments, the substantially increased numeric values is increased by greater than about any one of 10%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100% compared to the reference value.
[0127] The term isolated as used herein refers to a molecule that has been separated from at least some of the components with which it is typically found in nature or produced. For example, a polypeptide is referred to as isolated when it is separated from at least some of the components of the cell in which it was produced. Where a polypeptide is secreted by a cell after expression, physically separating the supernatant containing the polypeptide from the cell that produced it is considered to be isolating the polypeptide. Similarly, a polynucleotide is referred to as isolated when it is not part of the larger polynucleotide (such as, for example, genomic DNA or mitochondrial DNA, in the case of a DNA polynucleotide) in which it is typically found in nature, or is separated from at least some of the components of the cell in which it was produced, for example, in the case of an RNA polynucleotide. Thus, a DNA polynucleotide that is contained in a vector inside a host cell may be referred to as isolated.
[0128] The terms individual, patient, or subject are used interchangeably herein to refer to an animal, for example, a mammal. In some embodiments, methods of treating mammals, including, but not limited to, humans, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are provided. In some examples, an individual or subject refers to an individual or subject in need of treatment for a disease or disorder. In some embodiments, the subject to receive the treatment can be a patient, designating the fact that the subject has been identified as having a disorder of relevance to the treatment, or being at adequate risk of contracting the disorder.
[0129] The term sample or patient sample as used herein, refers to a composition that is obtained or derived from a subject of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example, based on physical, biochemical, chemical, and/or physiological characteristics. For example, the phrase test sample, and variations thereof, refers to any sample obtained from a subject of interest that would be expected or is known to contain a cellular and/or molecular entity that is to be characterized. By tissue or cell sample is meant a collection of similar cells obtained from a tissue of a subject or patient. The source of the tissue or cell sample may be blood (e.g., peripheral blood) or any blood constituents; solid tissue as from a fresh, frozen, and/or preserved organ or tissue sample or biopsy or aspirate; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the subject. The tissue sample may also be primary or cultured cells or cell lines. Optionally, the tissue or cell sample is obtained from a disease tissue/organ. The tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like. In some embodiments, a sample includes peripheral blood obtained from a subject or patient, which includes CD4+ cells. In some embodiments, a sample includes CD4+ cells isolated from peripheral blood.
[0130] A control, control sample, reference, or reference sample as used herein, refers to any sample, standard, or level that is used for comparison purposes. A control or reference may be obtained from a healthy and/or non-diseased sample. In some examples, a control or reference may be obtained from an untreated sample or patient. In some examples, a reference is obtained from a non-diseased or non-treated sample of a subject individual. In some examples, a reference is obtained from one or more healthy individuals who are not the subject or patient. In some embodiments, a control sample, reference sample, reference cell, or reference tissue is obtained from the patient or subject at a time point prior to one or more administrations of a treatment (e.g., one or more anti-cancer treatments), or prior to being subjected to any of the methods of the invention.
[0131] A disease or disorder as used herein refers to a condition where treatment is needed and/or desired. In some embodiments, the disease or disorder is cancer.
[0132] Cancer and tumor, as used herein, are interchangeable terms that refer to any abnormal cell or tissue growth or proliferation in an animal. As used herein, the terms cancer and tumor encompass solid and hematological/lymphatic cancers and also encompass malignant, pre-malignant, and benign growth, such as dysplasia. Examples of cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia. More particular non-limiting examples of such cancers include gastric cancer, breast cancer (e.g., triple negative breast cancer (TNBC)), non-small cell lung cancer (NSCLC), squamous cell cancer, small-cell lung cancer, pituitary cancer, esophageal cancer, astrocytoma, soft tissue sarcoma, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, colon cancer, colorectal cancer, endometrial or uterine carcinoma (including uterine corpus endometrial carcinoma), salivary gland carcinoma, kidney cancer, renal cancer, liver cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, brain cancer, testis cancer, cholangiocarcinoma, gallbladder carcinoma, melanoma, and various types of head and neck cancer. These cancers, and others, can be treated or analyzed according to the methods of the invention.
[0133] As used herein, treatment is an approach for obtaining beneficial or desired clinical results. Treatment as used herein, covers any administration or application of a therapeutic for disease in a mammal, including a human. For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, any one or more of: alleviation of one or more symptoms, diminishment of extent of disease, preventing or delaying spread (for example, metastasis, for example, metastasis to the lung or to the lymph node) of disease, preventing or delaying recurrence of disease, delay or slowing of disease progression, amelioration of the disease state, inhibiting the disease or progression of the disease, inhibiting or slowing the disease or its progression, arresting its development, and remission (whether partial or total). Also encompassed by treatment is a reduction of pathological consequence of a proliferative disease. The methods provided herein contemplate any one or more of these aspects of treatment. In-line with the above, the term treatment does not require one-hundred percent removal of all aspects of the disorder.
[0134] Ameliorating means a lessening or improvement of one or more symptoms as compared to not administering an anti-cancer therapy. Ameliorating also includes shortening or reduction in duration of a symptom.
[0135] In the context of cancer, the term treating includes any or all of: inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden, and ameliorating one or more symptoms associated with the disease.
[0136] Preventing, as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease. Unless otherwise specified, the terms reduce, inhibit, or prevent do not denote or require complete prevention over all time.
[0137] Predetermined cutoff and predetermined level refer generally to an assay cutoff value that is used to assess diagnostic/prognostic/therapeutic efficacy results by comparing the assay results against the predetermined cutoff/level, where the predetermined cutoff/level already has been linked or associated with various clinical parameters (for example, severity of disease, progression/non-progression/improvement, etc.). While the present disclosure may provide exemplary predetermined levels, it is well-known that cutoff values may vary depending on the nature of the immunoassay (for example, antibodies employed, etc.). It further is well within the skill of one of ordinary skill in the art to adapt the disclosure herein for other immunoassays to obtain immunoassay-specific cutoff values for those other immunoassays based on this disclosure. Whereas the precise value of the predetermined cutoff/level may vary between assays, correlations as described herein (if any) may be generally applicable.
[0138] In some embodiments, the terms elevated levels of ICOS, elevated ICOS levels, ICOS at an elevated level, ICOS.sup.HIGH, and ICOS.sup.hi refer to increased levels of ICOS in cells (e.g., CD4+ T cells) of a subject, e.g., in a peripheral blood sample of the subject, after treatment of the subject with one or more anti-cancer therapies. The increased levels can be determined relative to a control which may be, e.g., a peripheral blood sample from the subject being treated, but either before any treatment with the one or more anti-cancer therapies at all, or before treatment with a second or further cycle of the one or more anti-cancer therapies. Alternatively, the control can be a level from a matched sample (e.g., a peripheral blood sample) of a healthy individual. In some embodiments, the level of ICOS is determined at the level of expressed protein, which may be detected in some embodiments using an antibody directed to an intracellular portion of ICOS. In some embodiments, the detection using such an antibody is done by use of flow cytometry. In some embodiments, an increase of at least 2-fold (e.g., at least 3-fold, 4-fold, 5-fold, 7.5-fold, 10-fold, or 15-fold) in mean fluorescence intensity (MFI), relative to a control, indicates detection of elevated ICOS levels. In some embodiments, detection of an increase in ICOS levels in at least 5% (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) of CD4+ T cells in a peripheral blood sample indicates a subject having an ICOS hi sample. In some embodiments, an increase of at least 2-fold (e.g., at least 3-fold, 4-fold, 5-fold, 7.5-fold, 10-fold, or 15-fold) in mean fluorescence intensity (MFI), relative to a control, in at least 5% (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) of CD4+ T cells in a peripheral blood sample indicates detection of elevated ICOS levels. In some embodiments, elevated ICOS levels refer to an increase in total ICOS expression levels (e.g., mRNA levels or protein levels) in CD4+ T cells in the peripheral blood test sample of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 100%, or greater relative to a control sample. In some embodiments, elevated ICOS levels refers to an increase in total ICOS expression levels (e.g., mRNA levels or protein levels) in the CD4+ T cells in a peripheral blood sample of about at least 1.1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 100, 500, 1000, or greater relative to a control sample.
[0139] In some embodiments, the terms elevated levels of T-bet, elevated T-bet levels, T-bet at an elevated level, T-bet.sup.HIGH, and T-bet.sup.hi refer to increased levels of T-bet in cells (e.g., CD4+ T cells) of a subject, e.g., in a peripheral blood sample of the subject, after treatment of the subject with one or more anti-cancer therapies. The increased levels can be determined relative to a control which may be, e.g., a peripheral blood sample from the subject being treated, but either before any treatment with the one or more anti-cancer therapies at all, or before treatment with a second or further cycle of the one or more anti-cancer therapies. Alternatively, the control can be a level from a matched sample (e.g., a peripheral blood sample) of a healthy individual. In some embodiments, the level of T-bet is determined at the level of expressed protein, which may be detected in some embodiments using an antibody directed to T-bet. In some embodiments, the detection using such an antibody is done by use of flow cytometry. In some embodiments, an increase of at least 2-fold (e.g., at least 3-fold, 4-fold, 5-fold, 7.5-fold, 10-fold, or 15-fold) in mean fluorescence intensity (MFI), relative to a control, indicates detection of elevated T-bet levels. In some embodiments, detection of an increase in T-bet levels in at least 5% (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) of CD4+ T cells in a peripheral blood sample indicates a subject having a T-bet hi sample. In some embodiments, an increase of at least 2-fold (e.g., at least 3-fold, 4-fold, 5-fold, 7.5-fold, 10-fold, or 15-fold) in mean fluorescence intensity (MFI), relative to a control, in at least 5% (e.g., at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90%) of CD4+ T cells in a peripheral blood sample indicates detection of elevated T-bet levels. In some embodiments, elevated T-bet levels refer to an increase in total T-bet expression levels (e.g., mRNA levels or protein levels) in CD4+ T cells in the peripheral blood test sample of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 85%, 90%, 95%, 100%, or greater relative to a control sample. In some embodiments, elevated T-bet levels refers to an increase in total T-bet expression levels (e.g., mRNA levels or protein levels) in the CD4+ T cells in a peripheral blood sample of about at least 1.1, 2, 3, 4, 5, 10, 15, 20, 30, 40, 50, 100, 500, 1000, or greater relative to a control sample.
[0140] The terms inhibition or inhibit refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To reduce or inhibit is to decrease, reduce, or arrest an activity, function, and/or amount as compared to a reference. In some embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 20% or greater. In some embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 50% or greater. In some embodiments, by reduce or inhibit is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater. In some embodiments, the amount noted above is inhibited or decreased over a period of time, relative to a control dose (such as a placebo) over the same period of time.
[0141] As used herein, delaying development of a disease means to defer, hinder, slow, retard, stabilize, suppress, and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
[0142] As used herein, to suppress a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition. For example, an antibody which suppresses tumor growth reduces the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the antibody.
[0143] A therapeutically effective amount of a substance/molecule, agonist, or antagonist may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance/molecule, agonist, or antagonist to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance/molecule, agonist, or antagonist are outweighed by the therapeutically beneficial effects. A therapeutically effective amount may be delivered in one or more administrations. A therapeutically effective amount refers to an amount effective, at dosages, and for periods of time necessary, to achieve the desired therapeutic and/or prophylactic result. The therapeutically effective amount of the treatment of the invention can be measured by various endpoints commonly used in evaluating cancer treatments, including, but not limited to: extending survival (including OS and PFS); resulting in an objective response (including a CR or a PR); tumor regression, tumor weight or size shrinkage, longer time to disease progression, increased duration of survival, longer PFS, improved OS rate, increased duration of response, and improved quality of life and/or improving signs or symptoms of cancer.
[0144] As used herein, the term progressive disease (PD) refers to least a 20% increase in the sum of diameters of target lesions, taking as reference the smallest sum on study (this includes the baseline sum if that is the smallest on study). In addition to the relative increase of 20%, the sum must also demonstrate an absolute increase of at least 5 mm. The appearance of one or more new lesions is also considered progression.
[0145] As used herein, the term partial response (PR) refers to at least a 30% decrease in the sum of diameters of target lesions, taking as reference the baseline sum diameters.
[0146] As used herein, the term complete response (CR) refers to the disappearance of all target lesions with the short axes of any target lymph nodes reduced to <10 mm.
[0147] As used herein, the term stable disease (SD) refers to neither sufficient shrinkage to qualify for PR nor sufficient increase to qualify for PD, taking as reference the smallest sum of diameters while on study.
[0148] As used herein, the term best overall response (BOR) is the best response recorded from the start of the study treatment until the earliest of objective progression or start of new anti-cancer therapy, taking into account any requirement for confirmation. The patient's best overall response assignment will depend on the findings of both target and non-target disease and will also take into consideration the appearance of new lesions. The best overall response is calculated via an algorithm using the assessment responses provided by an investigator over the course of a trial.
[0149] As used herein, the term not evaluable (NE) refers to when an incomplete radiologic assessment of target lesions is performed or there is a change in the method of measurement from baseline that impacts the ability to make a reliable evaluation of response.
[0150] As used herein, the term objective response rate (ORR) is equal to the proportion of patients achieving a best overall response of partial or complete response (PR+CR) according to RECIST 1.1.
[0151] As used herein, the term overall survival (OS) refers to the percentage of patients remaining alive for a defined period of time, such as 1 year, 5 years, etc. from the time of diagnosis or treatment. Overall survival is evaluated by the Kaplan-Meier method, and a 95% confidence interval (CI) is provided for the median OS in each treatment arm.
[0152] As used herein, the term progression-free survival (PFS) refers to the patient remaining alive without the cancer progressing or getting worse. PFS may be defined as the time from selection for treatment until the first radiographic documentation of objective progression as defined by RECIST (Version 1.1), or death from any cause.
[0153] A pharmaceutically acceptable carrier refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a pharmaceutical composition for administration to a subject. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed.
[0154] A sterile formulation is aseptic or essentially free from living microorganisms and their spores.
[0155] Administration in combination with one or more further therapeutic agents includes simultaneous (concurrent) and consecutive or sequential administration in any order.
[0156] The term concurrently is used herein to refer to administration of two or more therapeutic agents, where at least part of the administration overlaps in time, or where the administration of one therapeutic agent falls within a short period of time (e.g., within one day) relative to administration of the other therapeutic agent. For example, the two or more therapeutic agents are administered with a time separation of no more than about a specified number of minutes.
[0157] The term sequentially is used herein to refer to administration of two or more therapeutic agents where the administration of one or more agent(s) continues after discontinuing the administration of one or more other agent(s), or wherein administration of one or more agent(s) begins before the administration of one or more other agent(s). For example, administration of the two or more therapeutic agents are administered with a time separation of more than about a specified number of minutes.
[0158] As used herein, in conjunction with refers to administration of one treatment modality in addition to another treatment modality. As such, in conjunction with refers to administration of one treatment modality before, during, or after administration of the other treatment modality to the individual.
[0159] The terms label and detectable label mean a moiety attached to a polynucleotide or polypeptide to render a reaction (for example, polynucleotide amplification or antibody binding) detectable. The polynucleotide or polypeptide comprising the label may be referred to as detectably labeled. Thus, the term labeled binding protein refers to a protein with a label incorporated that provides for the identification of the binding protein. The term labeled oligonucleotide, labeled primer, labeled probe, etc. refers to a polynucleotide with a label incorporated that provides for the identification of nucleic acids that comprise or are hybridized to the labeled oligonucleotide, primer, or probe. In some embodiments, the label is a detectable marker that can produce a signal that is detectable by visual or instrumental means, for example, incorporation of a radiolabeled amino acid or attachment to a polypeptide of biotinyl moieties that can be detected by marked avidin (for example, streptavidin containing a fluorescent marker or enzymatic activity that can be detected by optical or colorimetric methods). Examples of labels include, but are not limited to, the following: radioisotopes or radionuclides (for example, .sup.3H, .sup.14C, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I, .sup.177Lu, .sup.166Ho, or .sup.153Sm); chromogens, fluorescent labels (for example, FITC, rhodamine, lanthanide phosphors), enzymatic labels (for example, horseradish peroxidase, luciferase, alkaline phosphatase); chemiluminescent markers; biotinyl groups; predetermined polypeptide epitopes recognized by a secondary reporter (for example, leucine zipper pair sequences, binding sites for secondary antibodies, metal binding domains, epitope tags); and magnetic agents, such as gadolinium chelates. Representative examples of labels commonly employed for immunoassays include moieties that produce light, for example, acridinium compounds, and moieties that produce fluorescence, for example, fluorescein. In some embodiments, the moiety itself may not be detectably labeled but may become detectable upon reaction with yet another moiety.
[0160] The term conjugate refers to an antibody that is chemically linked to a second chemical moiety, such as a therapeutic or cytotoxic agent. The term agent includes a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials. In some embodiments, the therapeutic or cytotoxic agents include, but are not limited to, pertussis toxin, taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof. When employed in the context of an immunoassay, the conjugate antibody may be a detectably labeled antibody used as the detection antibody.
[0161] As used herein, the term flow cytometry generally refers to a technique for characterizing biological particles, such as whole cells or cellular constituents, by flow cytometry. Methods for performing flow cytometry on samples of immune cells are well known in the art (see e.g., Jaroszeski et al., Method in Molecular Biology (1998), vol. 91: Flow Cytometry Protocols, Humana Press; Longobanti Givan, (1992) Flow Cytometry, First Principles, Wiley Liss). All known forms of flow cytometry are intended to be included, particularly fluorescence activated cell sorting (FACS), in which fluorescent labeled molecules are evaluated by flow cytometry.
[0162] The term amplification refers to the process of producing one or more copies of a nucleic acid sequence or its complement. Amplification may be linear or exponential (e.g., PCR).
[0163] The technique of polymerase chain reaction or PCR as used herein generally refers to a procedure wherein a specific region of nucleic acid, such as RNA and/or DNA, is amplified as described, for example, in U.S. Pat. No. 4,683,195. Generally, oligonucleotide primers are designed to hybridize to opposite strands of the template to be amplified, a desired distance apart. PCR can be used to amplify specific RNA sequences, specific DNA sequences from total genomic DNA, and cDNA transcribed from total cellular RNA, bacteriophage or plasmid sequences, etc.
[0164] Quantitative real time PCR or qRT-PCR refers to a form of PCR wherein the PCR is performed such that the amounts, or relative amounts of the amplified product can be quantified. This technique has been described in various publications including Cronin et al., Am. J. Pathol. 164(1):35-42 (2004); and Ma et al., Cancer Cell 5:607-616 (2004).
[0165] The term target sequence, target nucleic acid, or target nucleic acid sequence refers generally to a polynucleotide sequence of interest, e.g., a polynucleotide sequence that is targeted for amplification using, for example, qRT-PCR.
[0166] The term detection includes any means of detecting, including direct and indirect detection.
II. Therapeutic Methods
[0167] The invention provides methods of treating cancer in patients in need of such treatment. The methods include (i) administering one or more dosages of one or more anti-cancer therapies to the patients, (ii) obtaining one or more peripheral blood test samples from the patients, (iii) measuring ICOS and/or T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, (iv) determining if there is a population of the CD4+ T cells in any of the one or more peripheral blood test samples having elevated ICOS and/or T-bet levels when compared to a control, and (v) administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist (e.g., an anti-ICOS agonist antibody) in the absence of one or more additional dosages of the one or more anti-cancer therapies, to the patients if any of the one or more peripheral blood test samples is determined to include a population of CD4+ T cells having elevated ICOS and/or T-bet levels. Optionally, anti-ICOS agonist antibodies are also administered to patients determined to have CD4+ T cells having elevated ICOS and/or T-bet levels, and who are being administered one or more additional dosages of the one or more anti-cancer therapies, when the one or more anti-cancer therapies is not anti-ICOS agonist antibody therapy.
[0168] The invention also provides methods for determining whether a subject may benefit from continued treatment with one or more anti-cancer therapies. The methods include determining ICOS and/or T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS and/or T-bet levels relative to a control indicates that the subject may benefit from (a) the continued treatment, optionally in combination with treatment with an anti-ICOS antibody agonist when the one or more anti-cancer therapies does not include anti-ICOS antibody agonist treatment, or (b) anti-ICOS agonist (e.g., anti-ICOS agonist antibody) treatment in the absence of continued treatment with the one or more anti-cancer therapies.
[0169] Patients that can be treated as described herein are patients having a cancer. The type of cancer can be any type of cancer listed herein or otherwise known in the art. Exemplary types of cancer include, but are not limited to, gastric cancer, breast cancer (e.g., triple negative breast cancer (TNBC)), lung cancer (e.g., non-small cell lung cancer (NSCLC)), melanoma, renal cell carcinoma (RCC), bladder cancer, endometrial cancer, diffuse large B-cell lymphoma (DLBCL), Hodgkin's lymphoma, ovarian cancer, and head and neck squamous cell cancer (HNSCC). Also see the definition of cancer, above, for additional cancer types that can be treated according to the methods of the invention.
[0170] Patients that can be treated as described herein include patients who have not previously received an anti-cancer therapy and patients who have received previous (e.g., 1, 2, 3, 4, 5, or more) doses or cycles of one or more (e.g., 1, 2, 3, 4, 5, or more) anti-cancer therapies.
[0171] Any of the anti-cancer therapies listed herein and others known in the art can be used in connection with the methods of the invention. In some embodiments, the one or more anti-cancer therapies is two or more anti-cancer therapies. In some embodiments, the one or more anti-cancer therapies is three or more anti-cancer therapies. Specific, non-limiting examples of anti-cancer therapies that can be used in the invention including, e.g., immunotherapies, chemotherapies, and cancer vaccines, among others, are provided below.
[0172] In some embodiments, the one or more anti-cancer therapies is administered one time prior to obtaining the one or more peripheral blood test samples from the patient. In some embodiments, the one or more anti-cancer therapies is administered more than once prior to obtaining the one or more peripheral blood test samples from the patient. In some embodiments, the one or more anti-cancer therapies is administered two or more (e.g., three or more, four or more, or five or more) times prior to obtaining the one or more peripheral blood test samples from the patient.
[0173] In some embodiments, the one or more anti-cancer therapies is administered to the patient multiple times at regular intervals. These multiple administrations can also be referred to as administration cycles or therapy cycles. In some embodiments, the one or more anti-cancer therapies is administered to the patient for more than two cycles, more than three cycles, more than four cycles, more than five cycles, more than ten cycles, more than fifteen cycles, or more than twenty cycles.
[0174] In some embodiments, the regular interval is a dosage every week, a dosage every two weeks, a dosage every three weeks, a dosage every four weeks, a dosage every five weeks, a dosage every six weeks, a dosage every seven weeks, a dosage every eight weeks, a dosage every nine weeks, a dosage every ten weeks, a dosage every eleven weeks, or a dosage every twelve weeks.
[0175] In some instances the one or more peripheral blood test samples is obtained from the patient fewer than four weeks (e.g., fewer than three weeks, fewer than two weeks, or less than one week) after the administration of the one or more anti-cancer therapies.
[0176] In some embodiments, the one or more peripheral blood test samples are obtained as multiple samples obtained at a time concurrent with one or more of the administrations. In some embodiments, the one or more peripheral blood test samples are obtained as multiple samples obtained during a time intervening the multiple administrations.
[0177] In some embodiments, the control sample is a peripheral blood sample obtained from the same patient prior to the administration of a first dosage (e.g., the prior to the first cycle) of the one or more anti-cancer therapies. In some embodiments, the control sample is a peripheral blood sample obtained from the same patient prior to the administration of a second or further (e.g., third, fourth, fifth, or further) dosage of the one or more anti-cancer therapies preceding collection of the peripheral blood test sample. In some embodiments, the control sample is a peripheral blood sample obtained from a healthy patient not receiving anti-cancer therapies. In some embodiments, the control is a level known or determined to correspond to the level in a control sample as described herein.
[0178] In some embodiments, the method further includes storing a portion of the one or more peripheral blood test samples. In some embodiments, wherein a portion of the CD4+ T cells from the peripheral blood test sample is determined to have elevated ICOS and/or T-bet levels relative to CD4+ T cells from a control sample, the method further involves isolating the CD4+ T cells having elevated ICOS and/or T-bet levels and storing the CD4+ T cells under conditions suitable for maintaining the viability of the CD4+ T cells. Any method of storage known in the art suitable for maintaining viability of CD4+ T cells may be used. In some embodiments, the stored CD4+ T cells are stored in a cell culture medium. In some embodiments, the stored CD4+ T cells are stored at a concentration of greater than 100,000 cells/mL. In some embodiments, the stored CD4+ T cells are stored at a concentration between 100,000 cells/mL and 100 million cells/mL. In some embodiments, the invention provides a suspension of stored CD4+ T cells obtained, accordingly.
[0179] In some embodiments, the method further includes administering a therapeutic anti-ICOS agonist antibody to the patient if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels. In some embodiments, a detected population of CD4+ T cells having elevated ICOS and/or T-bet levels is or includes a new, separate CD4+ T cell population, which was induced by the one or more anti-cancer therapies. Information regarding therapeutic anti-ICOS agonist antibodies is provided below.
[0180] In some embodiments, the method further includes halting the administration of the one or more anti-cancer therapies if a population of CD4+ T cells having elevated ICOS and/or T-bet levels relative to a control sample is not observed after a pre-determined number of administration cycles. The predetermined number of administration cycles may be four or more cycles (e.g., five or more cycles, six or more cycles, or seven or more cycles, eight or more cycles, nine or more cycles, or ten or more cycles). In some embodiments, the method further includes halting the administration of the one or more anti-cancer therapies before the pre-determined number of administration cycles (e.g., four or more cycles) if a population of CD4+ T cells having elevated ICOS and/or T-bet levels relative to a control sample is not observed and, optionally, the patient is determined to have progressive disease by a routine method known in the art (e.g., progressive disease identified by radiographic progression per RECIST 1.1 criteria; see, e.g., the criteria listed above).
III. Exemplary Anti-Cancer Therapies for Use in the Methods of the Invention
[0181] As examples, any anti-cancer therapy listed herein or otherwise known in the art, can be used in connection with the methods described herein. Exemplary anti-cancer therapies are described below.
[0182] a. Immunotherapies
[0183] In some embodiments, the one or more anti-cancer therapies is an immunotherapy. The interaction between cancer and the immune system is complex and multifaceted. See de Visser et al., Nat. Rev. Cancer (2006) 6:24-37. While many cancer patients appear to develop an anti-tumor immune response, cancers also develop strategies to evade immune detection and destruction. Recently, immunotherapy has been developed for the treatment and prevention of cancer and other disorders. Immunotherapy provides the advantage of cell specificity that other treatment modalities lack. As such, methods for enhancing the efficacy of immune based therapies can be clinically beneficial.
[0184] i. Therapeutic Anti-ICOS Antibodies
[0185] Therapeutic anti-ICOS antibodies that can be used in the invention include, but are not limited to, humanized antibodies, chimeric antibodies, human antibodies, and antibodies comprising any of the heavy chain and/or light chain CDRs discussed herein. In some embodiments, the antibody is an isolated antibody. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the anti-ICOS antibody is an anti-ICOS agonist antibody. See WO 2016/154177 and WO 2017/070423, which are each specifically incorporated herein by reference.
[0186] In some embodiments, the therapeutic anti-ICOS agonist antibody includes at least one, two, there, four, five, or all six CDRs selected from (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 10. In various embodiments, one or more of the CDRs includes a substitution or deletion that does not destroy specific binding to ICOS. In some embodiments, one or more of the CDRs includes 1, 2, 3, or more substitutions, which may optionally comprise substitutions with conservative amino acids. In some embodiments, one or more of the CDRs includes 1, 2, 3, or more deletions.
[0187] In some embodiments, the therapeutic anti-ICOS antibody comprises six CDRs including (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 10.
[0188] In some embodiments, a therapeutic anti-ICOS antibody comprises a heavy chain variable region and a light chain variable region. In some embodiments, a therapeutic anti-ICOS antibody comprises at least one heavy chain comprising a heavy chain variable region and at least a portion of a heavy chain constant region, and at least one light chain comprising a light chain variable region and at least a portion of a light chain constant region. In some embodiments, a therapeutic anti-ICOS antibody comprises two heavy chains, wherein each heavy chain comprises a heavy chain variable region and at least a portion of a heavy chain constant region, and two light chains, wherein each light chain comprises a light chain variable region and at least a portion of a light chain constant region. As used herein, a single-chain Fv (scFv), or any other antibody that comprises, for example, a single polypeptide chain comprising all six CDRs (three heavy chain CDRs and three light chain CDRs) is considered to have a heavy chain and a light chain. In some embodiments, the heavy chain is the region of the anti-ICOS antibody that comprises the three heavy chain CDRs. In some embodiments, the light chain is the region of the therapeutic anti-ICOS antibody that comprises the three light chain CDRs.
[0189] In some embodiments, the therapeutic anti-ICOS antibody comprises at least one, at least two, or all three VH CDR sequences selected from (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; and (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 7.
[0190] In some embodiments, the therapeutic antibody comprises at least one, at least two, or all three VL CDR sequences selected from (a) LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (b) LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (c) LCDR3 comprising the amino acid sequence of SEQ ID NO: 10.
[0191] In some embodiments, the therapeutic anti-ICOS antibody comprises (I) a VH domain comprising at least one, at least two, or all three VH CDR sequences selected from (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; and (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; and (II) a VL domain comprising at least one, at least two, or all three VL CDR sequences selected from (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 10.
[0192] In some embodiments, a therapeutic anti-ICOS antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 3. In some embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (for example, conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-ICOS antibody comprising that sequence retains the ability to bind to ICOS. In some embodiments, a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 3. In some embodiments, substitutions, insertions, or deletions occur in regions outside the CDRs (that is, in the FRs). Optionally, the therapeutic anti-ICOS antibody comprises the VH sequence in SEQ ID NO: 3, including post-translational modifications of that sequence.
[0193] In some embodiments, the VH comprises: (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; and (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 7.
[0194] In some embodiments, a therapeutic anti-ICOS antibody is provided, wherein the antibody comprises a light chain variable domain (VL) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 4. In some embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (for example, conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-ICOS antibody comprising that sequence retains the ability to bind to ICOS. In some embodiments, a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 4. In some embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (that is, in the FRs). Optionally, the therapeutic anti-ICOS antibody comprises the V.sub.L sequence in SEQ ID NO: 4, including post-translational modifications of that sequence.
[0195] In some embodiments, the VL comprises: (a) LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (b) LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (c) LCDR3 comprising the amino acid sequence of SEQ ID NO: 10.
[0196] In some embodiments, a therapeutic anti-ICOS antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 3 and a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 4. In some embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (for example, conservative substitutions), insertions, or deletions relative to the reference sequence, and a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (for example, conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-ICOS antibody comprising that sequence retains the ability to bind to ICOS. In some embodiments, a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 3. In some embodiments, a total of 1 to 10 amino acids have been substituted, inserted, and/or deleted in SEQ ID NO: 4. In some embodiments, substitutions, insertions, or deletions occur in regions outside the CDRs (that is, in the FRs). Optionally, the therapeutic anti-ICOS antibody comprises the VH sequence in SEQ ID NO: 3 and the VL sequence of SEQ ID NO: 4, including post-translational modifications of one or both sequence.
[0197] In some embodiments, the therapeutic anti-ICOS antibody comprises (I) a VH domain comprising: (a) HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; and (c) HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; and (II) a VL domain comprising: (d) LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) LCDR3 comprising the amino acid sequence of SEQ ID NO: 10.
[0198] In some embodiments, a therapeutic anti-ICOS antibody comprises a VH as in any of the embodiments provided herein, and a VL as in any of the embodiments provided herein. In some embodiments, the antibody comprises the VH and VL sequences in SEQ ID NO: 3 and SEQ ID NO: 4, respectively, including post-translational modifications of those sequences.
[0199] In some embodiments, a therapeutic anti-ICOS antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1, or a variant thereof.
[0200] In some embodiments, a therapeutic anti-ICOS antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 2, or a variant thereof.
[0201] In some embodiments, a therapeutic anti-ICOS antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and a light chain comprising the amino acid sequence of SEQ ID NO: 2, or variants thereof.
[0202] In some embodiments, the therapeutic anti-ICOS antibody comprises the six CDRs as described above and binds to ICOS. In some embodiments, the therapeutic anti-ICOS antibody comprises the six CDRs as described above, binds to ICOS and increases the number of Teff cells and/or activates Teff cells and/or decreases the number of Treg cells and/or increases the ratio of Teff cells to Treg cells in a mammal, such as a human. In some embodiments, the Treg cells are CD4+ FoxP3+ T cells. In some embodiments, the Teff cells are CD8+ T cells. In some embodiments, the Teff cells are CD4+ FoxP3 T cells and/or CD8+ T cells.
[0203] Exemplary therapeutic anti-ICOS antibodies include, but are not limited to, JTX-2011 (vopratelimab; Jounce Therapeutics; US 2016/0304610; WO 2016/154177; WO 2017/070423) and BMS-986226 (Bristol-Myers Squibb).
[0204] In general, therapeutic anti-ICOS antibodies can be administered in an amount in the range of about 10 g/kg body weight to about 100 mg/kg body weight per dose. In some embodiments, therapeutic anti-ICOS antibodies may be administered in an amount in the range of about 50 g/kg body weight to about 5 mg/kg body weight per dose. In some embodiments, therapeutic anti-ICOS antibodies may be administered in an amount in the range of about 100 g/kg body weight to about 10 mg/kg body weight per dose. In some embodiments, therapeutic anti-ICOS antibodies may be administered in an amount in the range of about 100 g/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, therapeutic anti-ICOS antibodies may be administered in an amount in the range of about 0.5 mg/kg body weight to about 20 mg/kg body weight per dose. In some embodiments, anti-ICOS antibodies may be administered in an amount in the range of about 0.05 mg/kg body weight to about 10 mg/kg body weight per dose. In some embodiments, anti-ICOS antibodies may be administered in an amount in the range of about 5 mg/kg body weight or lower, for example less than 4, less than 3, less than 2, or less than 1 mg/kg of the antibody. In specific examples, therapeutic anti-ICOS antibodies are administered at 0.1 mg/kg, 0.3 mg/kg, or 1.0 mg/kg, once every 3, 6, 9, or 12 weeks.
[0205] ii. Anti-CTLA-4 Antagonist Antibodies
[0206] In some embodiments, the one or more anti-cancer therapies is an anti-CTLA-4 antagonist antibody. An anti-CTLA-4 antagonist antibody refers to an agent capable of inhibiting the activity of cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), thereby activating the immune system. The CTLA-4 antagonist may bind to CTLA-4 and reverse CTLA-4-mediated immunosuppression. A non-limiting exemplary anti-CTLA-4 antibody is ipilimumab (YERVOY, BMS), which may be administered according to methods known in the art, e.g., as approved by the US FDA. For example, ipilimumab may be administered in the amount of 3 mg/kg intravenously over 90 minutes every three weeks for a total of 4 doses (unresectable or metastatic melanoma); or at 10 mg/kg intravenously over 90 minutes every three weeks for a total of 4 doses, followed by 10 mg/kg every 12 weeks for up to 3 years or until documented recurrence or unacceptable toxicity (adjuvant melanoma).
[0207] iii. OX40 Agonist Antibodies
[0208] In some embodiments, the one or more anti-cancer therapies is an agonist anti-OX40 antibody. An OX40 agonist antibody refers to an agent that induces the activity of OX40, thereby activating the immune system and enhancing anti-tumor activity. Non-limiting, exemplary agonist anti-OX40 antibodies are Medi6469, MedImmune, and MOXR0916/RG7888, Roche. These antibodies may be administered according to methods and in regimens determined to be appropriate by those of skill in the art.
[0209] iv. PD-1 Therapies
[0210] In some embodiments, the one or more anti-cancer therapies is a PD-1 therapy. A PD-1 therapy encompasses any therapy that modulates PD-1 binding to PD-L1 and/or PD-L2. PD-1 therapies may, for example, directly interact with PD-1 and/or PD-L1. In some embodiments, a PD-1 therapy includes a molecule that directly binds to and/or influences the activity of PD-1. In some embodiments, a PD-1 therapy includes a molecule that directly binds to and/or influences the activity of PD-L1. Thus, an antibody that binds to PD-1 or PD-L1 and blocks the interaction of PD-1 to PD-L1 is a PD-1 therapeutic. When a desired subtype of PD-1 therapy is intended, it will be designated by the phrase PD-1 specific for a therapy involving a molecule that interacts directly with PD-1, or PD-L1 specific for a molecule that interacts directly with PD-L1, as appropriate. Unless designated otherwise, all disclosure contained herein regarding PD-1 therapy applies to PD-1 therapy generally, as well as PD-1 specific and/or PD-L1 specific therapies.
[0211] Non-limiting, exemplary PD-1 therapies include nivolumab (OPDIVO, BMS-936558, MDX-1106, ONO-4538); pidilizumab, lambrolizumab/pembrolizumab (KEYTRUDA, MK-3475); BGB-A317, tislelizumab (BeiGene/Celgene); durvalumab (anti-PD-L1 antibody, MEDI-4736; AstraZeneca/MedImmune); RG-7446; avelumab (anti-PD-L1 antibody; MSB-0010718C; Pfizer); AMP-224; BMS-936559 (anti-PD-L1 antibody); AMP-514; MDX-1105; A B-011; anti-LAG-3/PD-1; spartalizumab (CoStim/Novartis); anti-PD-1 antibody (Kadmon Pharm.); anti-PD-1 antibody (Immunovo); anti-TEVI-3/PD-I antibody (AnaptysBio); anti-PD-L1 antibody (CoStim/Novartis); RG7446/MPDL3280A (anti-PD-L1 antibody, Genentech/Roche); KD-033 (Kadmon Pharm.); AGEN-2034 (Agenus); STI-A1010; STI-A1110; TSR-042; atezolizumab (TECENTRIQ); and other antibodies that are directed against programmed death-1 (PD-1) or programmed death ligand 1 (PD-L1).
[0212] PD-1 therapies are administered according to regimens that are known in the art, e.g., US FDA-approved regimens. In one example, nivolumab is administered as an intravenous infusion over 60 minutes in the amount of 240 mg every two weeks (unresectable or metastatic melanoma, adjuvant treatment for melanoma, non-small cell lung cancer (NSCLC), advanced renal cell carcinoma, locally advanced renal cell carcinoma, MSI-H or dMMR metastatic colorectal cancer, and hepatocellular carcinoma) or in the amount of 3 mg/kg every three weeks (classical Hodgkin lymphoma; recurrent or metastatic squamous cell carcinoma of the head and neck). In another example, pembrolizumab is administered by intravenous infusion over 30 minutes in the amount of 200 mg, once every three weeks. In another example, atezolizumab is administered by intravenous infusion over 60 minutes in the amount of 1200 mg every three weeks. In another example, avelumab is administered by intravenous infusion over 60 minutes in the amount of 10 mg/kg every two weeks. In another example, durvalumab is administered by intravenous infusion over 60 minutes in the amount of 10 mg/kg every two weeks.
[0213] v. TIGIT Antagonists
[0214] In some embodiments, the one or more anti-cancer therapies is TIGIT antagonist. A TIGIT antagonist refers to an agent capable of antagonizing or inhibiting the activity of T-cell immunoreceptor with Ig and ITIM domains (TIGIT), thereby reversing TIGIT-mediated immunosuppression. A non-limiting exemplary TIGIT antagonist is BMS-986207 (Bristol-Myers Squibb/Ono Pharmaceuticals). These agents may be administered according to methods and in regimens determined to be appropriate by those of skill in the art.
[0215] vi. IDO Inhibitors
[0216] In some embodiments, the one or more anti-cancer therapies is an IDO inhibitor. An IDO inhibitor refers to an agent capable of inhibiting the activity of indoleamine 2,3-dioxygenase (IDO) and thereby reversing IDO-mediated immunosuppression. The IDO inhibitor may inhibit IDO1 and/or IDO2 (INDOL1). An IDO inhibitor may be a reversible or irreversible IDO inhibitor. A reversible IDO inhibitor is a compound that reversibly inhibits IDO enzyme activity either at the catalytic site or at a non-catalytic site while an irreversible IDO inhibitor is a compound that irreversibly inhibits IDO enzyme activity by forming a covalent bond with the enzyme. Non-limiting exemplary IDO inhibitors are described, e.g., in US 2016/0060237; and US 2015/0352206. Non-limiting exemplary IDO inhibitors include Indoximod (New Link Genetics), INCB024360 (Incyte Corp), 1-methyl-D-tryptophan (New Link Genetics), and GDC-0919/navoximod (Genentech/New Link Genetics). These agents may be administered according to methods and in regimens determined to be appropriate by those of skill in the art.
[0217] vii. ROR Agonists
[0218] In some embodiments, the one or more anti-cancer therapies is a ROR agonist. ROR agonists refer to an agent capable of inducing the activity of retinoic acid-related orphan receptor gamma (ROR), thereby decreasing immunosuppressive mechanisms. Non-limiting exemplary ROR agonists include, but are not limited to, LYC-55716 (Lycera/Celgene) and INV-71 (Innovimmune). These agents may be administered according to methods and in regimens determined to be appropriate by those of skill in the art.
[0219] b. Chemotherapies
[0220] In some embodiments, the one or more anti-cancer therapies is a chemotherapeutic agent. Exemplary chemotherapeutic agents that can be used include, but are not limited to, capecitabine, cyclophosphamide, dacarbazine, temozolomide, cyclophosphamide, docetaxel, doxorubicin, daunorubicin, cisplatin, carboplatin, epirubicin, eribulin, 5-FU, gemcitabine, irinotecan, ixabepilone, methotrexate, mitoxantrone, oxaliplatin, paclitaxel, nab-paclitaxel, ABRAXA E (protein-bound paclitaxel), pemetrexed, vinorelbine, vincristine, erlotinib, afatinib, gefitinib, crizotinib, dabrafenib, trametinib, vemurafenib, and cobimetanib. These agents may be administered according to methods and in regimens determined to be appropriate by those of skill in the art.
[0221] c. Cancer Vaccines
[0222] In some embodiments, the one or more anti-cancer therapies is a cancer vaccine. Cancer vaccines have been investigated as a potential approach for antigen transfer and activation of dendritic cells. In particular, vaccination in combination with immunologic checkpoints or agonists for co-stimulatory pathways have shown evidence of overcoming tolerance and generating increased anti-tumor response. A range of cancer vaccines have been tested that employ different approaches to promoting an immune response against the tumor (see, e.g., Emens L A, Expert Opin Emerg Drugs 13(2): 295-308 (2008)). Approaches have been designed to enhance the response of B cells, T cells, or professional antigen-presenting cells against tumors. Exemplary types of cancer vaccines include, but are not limited to, peptide-based vaccines that employ targeting distinct tumor antigens, which may be delivered as peptides/proteins or as genetically-engineered DNA vectors, viruses, bacteria, or the like; and cell biology approaches, for example, for cancer vaccine development against less well-defined targets, including, but not limited to, vaccines developed from patient-derived dendritic cells, autologous tumor cells or tumor cell lysates, allogeneic tumor cells, and the like.
[0223] Exemplary cancer vaccines include, but are not limited to, dendritic cell vaccines, oncolytic viruses, tumor cell vaccines, etc. In some embodiments, such vaccines augment the anti-tumor response. Examples of cancer vaccines also include, but are not limited to, MAGES vaccine (e.g., for melanoma and bladder cancer), MUC1 vaccine (e.g., for breast cancer), EGFRv3 (such as Rindopepimut, e.g., for brain cancer, including glioblastoma multiforme), or ALVAC-CEA (e.g., for CEA+ cancers).
[0224] Non-limiting exemplary cancer vaccines also include Sipuleucel-T, which is derived from autologous peripheral-blood mononuclear cells (PBMCs) that include antigen-presenting cells (see, e.g., Kantoff P W et al., N Engl J Med. 363:411-22 (2010)). In Sipuleucel-T generation, the patient's PBMCs are activated ex vivo with PA2024, a recombinant fusion protein of prostatic acid phosphatase (a prostate antigen) and granulocyte-macrophage colony-stimulating factor (an immune-cell activator). Another approach to a candidate cancer vaccine is to generate an immune response against specific peptides mutated in tumor tissue, such as melanoma (see, e.g., Carreno et al., Science 348:6236, 2015). Such mutated peptides may, in some embodiments, be referred to as neoantigens. As a non-limiting example of the use of neoantigens in tumor vaccines, neoantigens in the tumor predicted to bind the major histocompatibility complex protein HLA-A*02:01 are identified for individual patients with a cancer, such as melanoma. Dendritic cells from the patient are matured ex vivo, then incubated with neoantigens. The activated dendritic cells are then administered to the patient. In some embodiments, following administration of the cancer vaccine, robust T-cell immunity against the neoantigen is detectable.
[0225] In some such embodiments, the cancer vaccine is developed using a neoantigen. In some embodiments, the cancer vaccine is a DNA vaccine. In some embodiments, the cancer vaccine is an engineered virus comprising a cancer antigen, such as PROSTVAC (rilimogene galvacirepvec/rilimogene glafolivec). In some embodiments, the cancer vaccine comprises engineered tumor cells, such as GVAX, which is a granulocyte-macrophage colony-stimulating factor (GM-CSF) gene-transfected tumor cell vaccine (see, e.g., Nemunaitis, Expert Rev. Vaccines 4:259-274, 2005).
[0226] The vaccines may be administered according to methods and in regimens determined to be appropriate by those of skill in the art.
[0227] d. Additional Exemplary Anti-Cancer Therapies
[0228] Further non-limiting, exemplary anti-cancer therapies include Luspatercept (Acceleron Pharma/Celgene); Motolimod (Array BioPharma/CelgeneNentiRx Pharmaceuticals/Ligand); GI-6301 (Globelmmune/Celgene/NantWorks); GI-6200 (Globelmmune/Celgene/NantWorks); BLZ-945 (Celgene/Novartis); ARRY-382 (Array BioPharma/Celgene), or any of the anti-cancer therapies provided in Table 2. These agents may be administered according to methods and in regimens determined to be appropriate by those of skill in the art. In some embodiments, the one or more anti-cancer therapies includes surgery and/or radiation therapy. Accordingly, the anti-cancer therapies can optionally be utilized in the adjuvant or neoadjuvant setting.
[0229] e. Combinations
[0230] In various embodiments, the anti-cancer treatment administered to a patient is a combination of one or more (e.g., two, three, or more) anti-cancer treatments including, e.g., one or more of the anti-cancer treatments listed above or elsewhere herein.
[0231] In various examples, an anti-ICOS agonist antibody (e.g., an antibody described above, such as JTX-2011) is administered in combination with another immunotherapy (see, e.g., above). In one example, an anti-ICOS agonist antibody (e.g., an antibody described above, such as JTX-2011) is administered in combination with a PD-1 therapy (e.g., a PD-1 therapy listed above). Thus, the invention includes, in various examples, administration of an anti-ICOS agonist antibody (e.g., JTX-2011) in combination with one or more of nivolumab, pidilizumab, lambrolizumab/pembrolizumab, BGB-A317, tislelizumab, durvalumab, RG-7446, avelumab, AMP-224, BMS-936559, AMP-514, MDX-1105, A B-011, anti-LAG-3/PD-1, spartalizumab (CoStim/Novartis); anti-PD-1 antibody (Kadmon Pharm.); anti-PD-1 antibody (Immunovo); anti-TEVI-3/PD-1 antibody (AnaptysBio); anti-PD-L1 antibody (CoStim/Novartis); RG7446/MPDL3280A, KD-033 (Kadmon Pharm.); AGEN-2034 (Agenus), STI-A1010, STI-A1110, TSR-042, atezolizumab, and other antibodies that are directed against programmed death-1 (PD-1) or programmed death ligand 1 (PD-L1). In one specific example, JTX-2011 is administered with nivolumab.
[0232] Optionally, the combinations noted above further include one or more additional anti-cancer agents (e.g., immunotherapies). Accordingly, the combinations noted above can optionally include one or more of an anti-CTLA-4 antagonist antibody (e.g., ipilimumab), an anti-OX40 antibody (e.g., Medi6469), or MOXR0916/RG7888), a TIGIT antagonist (e.g., BMS-986207), an IDO inhibitor (e.g., indoximod, INCB024360, 1-methyl-D-tryptophan, or GDC-0919/navoximod), an ROR agonist (e.g., LYC-55716 and INV-71), or a chemotherapeutic agent (see, e.g., above), or a cancer vaccine (see, e.g., above).
[0233] In other examples, a combination of the invention includes an anti-ICOS agonist antibody (e.g., an antibody described above, such as JTX-2011) and one or more of an anti-CTLA-4 antagonist antibody (e.g., ipilimumab), an anti-OX40 antibody (e.g., Medi6469), or MOXR0916/RG7888), a TIGIT antagonist (e.g., BMS-986207), an IDO inhibitor (e.g., indoximod, INCB024360, 1-methyl-D-tryptophan, or GDC-0919/navoximod), an ROR agonist (e.g., LYC-55716 and INV-71), or a chemotherapeutic agent (see, e.g., above), or a cancer vaccine (see, e.g., above).
[0234] In various examples, the components of a combination are administered according to dosing regimens described herein (e.g., US FDA-approved dosing regimens; see above), or using other regimens determined to be appropriate by those of skill in the art.
IV. Pharmaceutical Compositions and Dosing
[0235] Compositions including one or more anti-cancer therapies are provided in formulations with a wide variety of pharmaceutically acceptable carriers, as determined to be appropriate by those of skill in the art (see, for example, Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel et al., Pharmaceutical Dosage Forms and Drug Delivery Systems, 7.sup.th ed., Lippincott, Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3.sup.rd ed., Pharmaceutical Press (2000)). Various pharmaceutically acceptable carriers, which include vehicles, adjuvants, and diluents, are available. Moreover, various pharmaceutically acceptable auxiliary substances, such as pH adjusting and buffering agents, tonicity adjusting agents, stabilizers, wetting agents and the like, are also available. Non-limiting exemplary carriers include saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
[0236] Anti-cancer therapies are administered in the practice of the methods of the present invention as is known in the art (e.g., according to FDA-approved regimens) or as indicated elsewhere herein (see, e.g., above). In some embodiments, anti-cancer therapies of the invention are administered in amounts effective for treatment of cancer. The therapeutically effective amount is typically dependent on the weight of the subject being treated, his or her physical or health condition, the extensiveness of the condition to be treated, the age of the subject being treated, pharmaceutical formulation methods, and/or administration methods (e.g., administration time and administration route).
[0237] In some embodiments, anti-cancer therapies can be administered in vivo by various routes, including, but not limited to, intravenous, intra-arterial, parenteral, intratumoral, intraperitoneal, or subcutaneous. The appropriate formulation and route of administration can be selected by those of skill in the art according to the intended application.
V. Exemplary Methods for Detection of Total ICOS and/or T-Bet Expression Levels
[0238] Provided herein are methods of assessing patient responsiveness to one or more anti-cancer therapies. In some embodiments, methods of identifying a subject who may benefit from continued treatment with one or more anti-cancer therapies, optionally in combination with an anti-ICOS agonist antibody, are provided.
[0239] a. Exemplary Antibody-Based Detection Methods
[0240] In some embodiments, the methods include determining whether a patient treated with one or more anti-cancer therapies has CD4+ T cells in peripheral blood that have elevated expression of ICOS and/or T-bet using, e.g., an anti-ICOS and/or anti-T-bet antibody, polypeptide, or polynucleotide. In some embodiments, the methods of detection include contacting a patient sample (e.g., a peripheral blood sample, or a fraction thereof) with an antibody, polypeptide, or polynucleotide, and determining whether the level of binding differs from that of a control. In some embodiments, CD4+ T cells from the peripheral blood test sample are contacted with an anti-ICOS detection antibody and/or an anti-T-bet detection antibody and binding between the antibody (or antibodies) and the CD4+ T cells is determined. When CD4+ T cells from a test sample are shown to have an increase in binding activity to the antibody (or antibodies), as compared to CD4+ T cells from a control sample, continued treatment with the one or more anti-cancer therapies is indicated, optionally in combination with anti-ICOS agonist antibody treatment, as described herein.
[0241] Various methods known in the art for detecting specific antibody-antigen binding can be used. These assays include, but are not limited to, flow cytometry (including, for example, fluorescent activating cell sorting (FACS)), indirect immune-fluorescence, solid phase enzyme-linked immunosorbent assay (ELISA), ELISpot assays, fluorescence polarization immunoassay (FPIA), fluorescence immunoassay (FIA), enzyme immunoassay (EIA), nephelometric inhibition immunoassay (NIA), enzyme linked immunosorbent assay (ELISA), and radioimmunoassay (RIA), western blotting (including in cell western), immunofluorescent staining, microengraving (see Han et al., Lab Chip 10(11):1391-1400, 2010), Quant-iT and Qubit protein assay kits, NanoOrange protein quantitation kit, CBQCA protein quantitation kits, EZQ protein quantitation kit, Click-iT reagents, Pro-Q Diamond phosphoprotein stain, Pro-Q glycoprotein stain kits, peptide and protein sequencing, N-terminal amino acid analysis (LifeScience Technologies, Grand Island, N.Y.), chemiluminescence or colorimetric based ELISA cytokine Arrays (Signosis) Intracellular Cytokine Staining (ICS), BD Phosflow and BD Cytometric Bead Arrays (BD Sciences, San Jose, Calif.); CyTOF Mass Cytometer (DVS Sciences, Sunnyvale Calif.); Mass Spectrometry, Microplate capture and detection assay (Thermo Scientific, Rockland, Ill.), Multiplex Technologies (for example Luminex, Austin, Tex.); FlowCellect T-cell Activation Kit (EMD Millipore); Surface Plasmon Resonance (SPR)-based technologies (for example Biacore, GE Healthcare Life Sciences, Uppsala, Sweden); CD4+ Effector Memory T-cell Isolation Kit and CD8+ CD45RA+ Effector T-cell Isolation Kit (Miltenyi Biotec Inc., CA); The EasySep Human T-cell Enrichment Kit (StemCells, Inc., Vancouver, Canada); HumanThl/Th2/Thl7 Phenotyping Kit (BD Biosciences, CA); immunofluorescent staining of incorporated bromodeoxyuridine (BrdU) or 7-aminoactinomycin D. See also, Current Protocols in Immunology (2004) sections 3.12.1-3.12.20 by John Wiley & Sons, Inc., or Current Protocols in Immunology (2013) or by John Wiley & Sons, Inc., the contents of which are herein incorporated by reference in their entirety.
[0242] An indicator moiety, or label group, can be attached to the subject antibodies and is selected so as to meet the needs of various uses of the method which are often dictated by the availability of assay equipment and compatible immunoassay procedures.
[0243] Appropriate labels include, without limitation, radionuclides (for example .sup.125I, .sup.131I, .sup.35S, .sup.3H, or .sup.32P), enzymes (for example, alkaline phosphatase, horseradish peroxidase, luciferase, or -galactosidase), fluorescent moieties or proteins (for example, fluorescein, rhodamine, phycoerythrin, GFP, or BFP), or luminescent moieties (for example, Qdot nanoparticles supplied by the Quantum Dot Corporation, Palo Alto, Calif.). General techniques to be used in performing the various immunoassays noted above are known to those of ordinary skill in the art.
[0244] In some instances, the anti-ICOS detection antibodies need not be labeled, and the presence thereof can be detected using a second labeled antibody which binds to the first anti-ICOS antibody.
[0245] In some instances, the anti-T-bet detection antibodies need not be labeled, and the presence thereof can be detected using a second labeled antibody which binds to the first anti-T-bet antibody.
[0246] In some embodiments, the CD4+ cells from the peripheral blood test sample are contacted with an anti-ICOS detection antibody and/or an anti-T-bet detection antibody and the binding between the antibody (or antibodies) and the CD4+ cells is determined. In some embodiments, the level of total ICOS and/or T-bet expression in CD4+ T cells is determined using a fluorescence activated cell sorter. Fluorescence activated cell sorters can have varying degrees of sophistication, such as multiple color channels, low angle and obtuse light scattering detecting channels, impedance channels, etc. Cells may be selected against dead cells by employing dyes associated with dead cells (e.g., propidium iodide). The FACS apparatus commonly includes a light source, usually a laser, and several detectors for the detection of cell particles or subpopulations of cells in a mixture using light scatter or light emission parameters. The underlying mechanisms of FACS are well known in the art, and essentially involve scanning (e.g., counting, sorting by size or fluorescent label) single particles are they flow in a liquid medium past an excitation light source. Light is scattered and fluorescence is emitted as light from the excitation source strikes the moving particle. Forward scatter (FSC, light scattered in the forward direction, i.e., the same direction as the beam) provides basic morphological information about the particles, such as cell size and morphology. Light that is scattered at 90 to the incident beam is due to refracted or reflected light, and is referred to as side angle scatter (SSC). This parameter measures the granularity and cell surface topology of the particles. Collectively, scatter signals in both the forward and wide angle direction are used to identify subpopulations of cells based on cell size, morphology, and granularity. This information is used to distinguish various cellular populations in a heterogeneous sample.
[0247] Exemplary anti-ICOS antibodies for use in the detection aspects of the methods described herein are antibodies that recognize an internal (i.e., intracellular) epitope of ICOS. While ICOS can be expressed on the surface of T cells, it is estimated that a large proportion of total cellular ICOS (e.g., about 80%) is present in intracellular stores. While exemplary therapeutic anti-ICOS antibodies, such as JTX-2011, recognize extracellular epitopes of ICOS, the use of an anti-ICOS detection antibody that specifically binds to an intracellular ICOS epitope allows for the determination of total ICOS expression levels. Examples of antibodies that recognize intracellular ICOS epitopes, and thus which can be used in methods to detect total ICOS, include 2M13 and 2M19 (see WO 2017/070423; also see Table 3, below), and variants thereof. In addition, antibodies that compete with 2M13 and 2M19 for binding to ICOS can be used to detect ICOS according to the methods of the invention.
[0248] b. Exemplary Nucleic Acid-Based Detection Methods
[0249] In some embodiments, the methods provided herein include measuring an mRNA level. In some embodiments, the methods provided herein comprise measuring an ICOS and/or T-bet mRNA.
[0250] Any suitable method of determining mRNA levels may be used. Methods for the evaluation of mRNAs include, for example, hybridization assays using complementary DNA probes (such as in situ hybridization using labeled riboprobes specific for target sequences, Northern blot and related techniques) and various nucleic acid amplification assays (such as RT-PCR using complementary primers specific for target sequences and other amplification type detection methods, such as, for example, branched DNA, SISB A, TMA and the like).
[0251] In some embodiments, the mRNA level is determined by quantitative RT-PCR. In some embodiments, the mRNA level is determined by digital PCR. In some embodiments, the mRNA level is determined by RNA-Seq. In some embodiments, the mRNA level is determined by RNase Protection Assay (RPA). In some embodiments, the mRNA level is determined by Northern blot. In some embodiments, the mRNA level is determined by in situ hybridization (ISH). In some embodiments, the mRNA level is determined by a method selected from quantitative RT-PCR, microarray, digital PCR, RNA-Seq, RNase Protection Assay (RPA), Northern blot, and in situ hybridization (ISH).
[0252] In some embodiments, for example when quantitative RT-PCR is used, the threshold cycle number is compared between two mRNAs, and the lower threshold indicates a higher level of the respective mRNA. As a non-limiting example, in some embodiments, if levels of ICOS mRNA and at least one reference mRNA are analyzed and the threshold cycle number (Ct) for ICOS is 28 and the Ct for the reference mRNA is 30, then ICOS is at a higher level compared to the reference. In various embodiments, similar comparisons may be carried out for any type of quantitative or semi-quantitative analytical method.
[0253] In some embodiments, the level of at least one mRNA is normalized. In some embodiments, the level of at least two mRNAs are normalized and compared to each other. In some embodiments, such normalization may allow comparison of mRNA levels when the levels are not determined simultaneously and/or in the same assay reaction. One skilled in the art can select a suitable basis for normalization, such as at least one reference mRNA or other factor, depending on the assay.
[0254] In some embodiments, the at least one reference mRNA comprises a housekeeping gene. In some embodiments, the at least one reference mRNA comprises one or more of RPLPO, PPIA, TUBB, ACTB, YMHAZ, B2M, UBC, TBP, GUSB, HPRT1, or GAPDH.
VI. Examples
[0255] The examples discussed below are intended to be purely exemplary of the invention and should not be considered to limit the invention in any way. The examples are not intended to represent that the experiments below are all or the only experiments performed. Efforts have been made to ensure accuracy with respect to numbers used (for example, amounts, temperature, etc.) but some experimental errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, molecular weight is weight average molecular weight, temperature is in degrees Centigrade, and pressure is at or near atmospheric.
Example 1: Examination of Total ICOS Expression in CD4+ T Cells of Cancer Patients Receiving JTX-2011 Monotherapy or Combination Therapy of JTX-2011 and Nivolumab
[0256] Study Design
[0257] Total ICOS expression in CD4+ T cells from 44 patients with gastric cancer, non-small cell lung cancer (NSCLC), or triple negative breast cancer (TNBC) receiving a JTX-2011 monotherapy (at 0.3 mg/kg q3w) or a combination therapy of JTX-2011 (at 0.1 mg/kg or 0.3 mg/kg q3w) and nivolumab (at 240 mg q3w) was evaluated using multi-color flow cytometry as described below. Of these patients, 4 had a confirmed partial response (cPR), 3 had an unconfirmed partial response (PR), 17 had stable disease (SD), and 20 had progressive disease (PD) as the best overall response (BOR) in response to the therapies.
[0258] Assessment of Total ICOS Expression in CD4+ T Cells by Flow Cytometry
[0259] Peripheral blood mononuclear cells (PBMCs) were obtained from patient whole blood samples through a density gradient separation using BD Vacutainer CPT Mononuclear Cell Preparation. Isolated PBMC samples were then frozen and stored at 80 C. until use in a flow cytometry application. At the time of analysis, PBMC sample tubes were thawed in a 37 C. water bath for approximately 2 minutes. Each sample was then transferred to a 15 mL conical tube with FACS buffer (1PBS, 2% FBS, 0.01% sodium azide, 2 mM EDTA), and the cells enumerated. Staining was performed on 110.sup.6 PBMCs per sample. Following enumeration, PBMCs were centrifuged at 500g for 3 minutes to obtain a cell pellet. Excess buffer was aspirated and the cell pellet was re-suspended in FACS buffer. The cell pellet re-suspension was divided equally into the wells of a 96-well round bottom plate, and each well was then Fc blocked using 5 L of Fc block (Human TruStain FcX, BioLegend Cat #422302) per 110.sup.5 PBMCs for 20 minutes at room temperature. Following blocking, the plate was centrifuged at 500g for 3 minutes and excess buffer was removed.
[0260] Wells designated for the primary staining cocktail to assess total ICOS levels received 100 L of master staining mix containing anti-human CD3 (clone: UCHT1), anti-human CD4 (clone: OKT4), and JTX-2011 Dylight 650. Wells designated for the isotype staining cocktail received 100 L of master staining mix containing anti-human CD-3 (clone: UCHT1), anti-human CD4 (clone: OKT4), and anti-RSV Dylight 650. Staining cocktails were incubated at 4 C. for 30 minutes and then were centrifuged at 500g for 3 minutes, two times with FACS buffer to wash. All wells were then fixed and permeabilized for 30 minutes (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies). Following permeabilization, the plate was centrifuged at 500g for 3 minutes and excess buffer was removed. Wells designated for the primary staining cocktail received 100 L of master staining mix diluted in 1 permeabilization buffer (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies) containing anti-T-bet (clone: 4610), streptavidin PE (BioLegend Cat 405204), and biotinylated M13 anti-ICOS detection antibody (Jounce Therapeutics), which recognizes an internal epitope of ICOS (see
[0261] Wells designated for the isotype control staining cocktail received 100 L of master staining mix prepared in 1 permeabilization buffer (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies) containing Streptavidin PE alone.
[0262] Staining cocktails were incubated at 4 C. for 30 minutes. The plate was then centrifuged at 500g for 3 minutes, two times with 1 permeabilization buffer to wash. The contents of the wells were then re-suspended in 150 L of FACS buffer. Stained samples were immediately analyzed using a BD FACS Canto flow cytometer, with resulting data analyzed using FlowJo analysis software.
[0263] Analysis of a sample to determine whether it includes an ICOS.sup.hi population of CD4+ T cells is shown in
[0264] Results
[0265] The emergence and stabilization of an ICOS.sup.hi CD4+ T cell population was observed in a gastric cancer patient with a cPR to JTX-2011 (0.3 mg/kg, q3w) monotherapy. The population was detected as early as following cycle 3, expanded, and was stable following cycle 15 (
[0266] The emergence of a population of CD4+ T cells with elevated ICOS expression levels (ICOS.sup.hi) was also observed in a sample from a gastric cancer patient with a cPR to a combination therapy of JTX-2011 (0.1 mg/kg, q3w) and nivolumab (240 mg, q3w). This population was detected following cycle 7, and there was a subsequent stabilization of the population through at least cycle 11 (
[0267] Transient populations of ICOS.sup.hi CD4+ T cells were observed in a sample from a gastric cancer patient who presented with stable disease in response to combination therapy of JTX-2011 (0.3 mg/kg, q3w) and nivolumab (240 mg, q3w) (
[0268] Populations of ICOS.sup.hi CD4+ T cells were not observed in TNBC patients who exhibited SD or PD in response to combination therapy of JTX-2011 (0.3 mg/kg, q3w) and nivolumab (240 mg, q3w) (
[0269] Conclusion
[0270] An ICOS.sup.hi CD4+ T cell population was observed in all patients with cPR and PR, and in 11 out of 17 patients with stable disease as BOR in response to therapy. This population was not observed in the remaining 6 patients with stable disease, nor in the 20 patients with progressive disease in response to therapy (
Example 2: Examination of Total ICOS Expression in CD4+ T Cells in Sa1/N Tumor-Bearing Mice Receiving JTX-1011-mG2a
[0271] Study Design
[0272] Mice bearing Sa1/N fibrosarcomas (Ostrand-Rosenberg, 2001, Curr. Protoc. Immunol., Chapter 20) received a once weekly dose of 0.25 mg/kg JTX-1011-mG2a. Whole blood samples were collected 1 hour and 48 hours following administration of the second dose of the antibody, and were analyzed for total ICOS expression in CD4+ T cell as described below.
[0273] Assessment of Total ICOS Expression in CD4+ T Cells by Flow Cytometry
[0274] Peripheral blood samples were collected via tail vein into BD NaEDTA Microtainer tubes and were stained fresh for flow analysis. 100 L of whole blood was allocated to an appropriate well in a 96-well round bottom plate, and each well was then Fc blocked for 15 minutes at 4 C. Fc blocking was performed using TruStain fcX (anti-mouse CD16/32) antibody (BioLegend, Cat#101320).
[0275] Wells designated for the primary staining cocktail to assess total ICOS levels received 100 L of master staining mix containing anti-CD3 (clone 145-2C11), anti-CD4 (clone GK1.5), anti-CD8 (clone 53-6.7), anti-ICOS (JTX-2011 DyLight650, Jounce Therapeutics). Wells designated for the isotype staining cocktail received 100 L of master staining mix containing species and fluorochrome-specific isotype controls. Staining cocktails were incubated at 4 C. for 30 minutes, and then centrifuged at 500g for 3 minutes, two times with FACS buffer to wash. All wells were then fixed and permeabilized for 30 minutes (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies). Following permeabilization, the plate was centrifuged at 500g, for 3 min, and excess buffer was removed. Wells designated for primary staining cocktail received 100 L of master staining mix prepared in 1 permeabilization buffer (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref.#00-5523-00 Life Technologies) containing anti-FoxP3 (clone FJK-16s).
[0276] Wells designated for the isotype control staining cocktail received 100 L of master staining mix prepared in 1 permeabilization buffer (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref.#00-5523-00 Life Technologies) containing a rat IgG2a, kappa isotype control antibody.
[0277] Staining cocktails were incubated at 4 C. for 30 minutes. The plate was then centrifuged at 500g for 3 minutes, two times with 1 permeabilization buffer to wash. Wells were then re-suspended in 150 L of FACS buffer. Stained samples were immediately analyzed on a BD FACS Canto flow cytometer, with resulting data analyzed using FlowJo analysis software.
[0278] Results and Conclusion
[0279] An increase in ICOS staining was observed at 48 hours post-dose of the second cycle of JTX-1011-mG2a relative to 1 hour post-dose (
Example 3: Examination of Total ICOS and T-Bet Expression in CD4+ T Cells of Cancer Patients Receiving JTX-2011 Monotherapy or Combination Therapy of JTX-2011 and Nivolumab
[0280] Study Design
[0281] Total ICOS and T-bet expression in CD4+ T cells from patients with gastric cancer, triple negative breast cancer (TNBC), or endometrial cancer receiving a JTX-2011 monotherapy (at 0.3 mg/kg q3w) or a combination therapy of JTX-2011 (at 0.1 mg/kg or 0.3 mg/kg, q3w) and nivolumab (at 240 mg q3w) was evaluated using multi-color flow cytometry as described below.
[0282] Assessment of Total ICOS and T-bet Expression in CD4+ T Cells by Flow Cytometry
[0283] Peripheral blood mononuclear cells (PBMCs) were obtained from patient whole blood samples through a density gradient separation using BD Vacutainer CPT Mononuclear Cell Preparation. At the time of analysis, PBMC sample tubes were thawed in a 37 C. water bath for approximately 2 minutes.
[0284] Each sample was then transferred to a 15 mL conical tube with FACS buffer (1PBS, 2% FBS, 0.01% sodium azide, 2 mM EDTA), and the cells enumerated. Staining was performed on 110.sup.6 PBMCs per sample. Following enumeration, PBMCs were centrifuged at 500g for 3 minutes to obtain a cell pellet. Excess buffer was aspirated and the cell pellet was re-suspended in FACS buffer. The cell pellet re-suspension was divided equally into the wells of a 96-well round bottom plate, and each well was then Fc blocked using 5 L of Fc block (Human TruStain FcX, BioLegend Cat #422302) per 110.sup.5 PBMCs for 20 minutes at room temperature. Following blocking, the plate was centrifuged at 500g for 3 minutes and excess buffer was removed.
[0285] Wells designated for the primary staining cocktail to assess total ICOS levels received 100 L of master staining mix containing anti-human CD3 (clone: UCHT1), anti-human CD4 (clone: OKT4), and JTX-2011 Dylight 650. Wells designated for the isotype staining cocktail received 100 L of master staining mix containing anti-human CD-3 (clone: UCHT1), anti-human CD4 (clone: OKT4), and anti-RSV Dylight 650. Staining cocktails were incubated at 4 C. for 30 minutes and were then centrifuged at 500g for 3 minutes, two times, with FACS buffer to wash. All wells were then fixed and permeabilized for 30 minutes (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies). Following permeabilization, the plate was centrifuged at 500g for 3 minutes and excess buffer was removed. Wells designated for the primary staining cocktail received 100 L of master staining mix diluted in 1 permeabilization buffer (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies) containing anti-T-bet (clone: 4610), streptavidin PE, and biotinylated M13 anti-ICOS detection antibody, which recognizes an internal epitope of ICOS (see
[0286] Wells designated for the isotype control staining cocktail received 100 L of master staining mix prepared in 1 permeabilization buffer (eBioscience FOXP3/Transcription Factor Staining Buffer Set ref. #00-5523-00 Life Technologies) containing Streptavidin PE alone.
[0287] Staining cocktails were incubated at 4 C. for 30 minutes. The plate was then centrifuged at 500g for 3 minutes, two times, with 1 permeabilization buffer to wash. The contents of the wells were then re-suspended in 150 L of FACS buffer. Stained samples were immediately analyzed using a BD FACS Canto flow cytometer, with resulting data analyzed using FlowJo analysis software.
[0288] Results and Conclusion
[0289] The emergence and stabilization of an ICOS.sup.hi CD4+ T cell population was observed in a PBMC sample from a gastric cancer patient with a cPR to a combination therapy of JTX-2011 (0.1 mg/kg, q3w) and nivolumab (240 mg, q3w). This population was detected as early as cycle 10, and was further identified to contain a sub-population of ICOS.sup.hi CD4+ T cells with elevated T-bet levels (T-bet.sup.hi) (
[0290] The emergence of a population of ICOS.sup.hi/T-bet.sup.hi CD4+ T cells was also observed in a sample from a gastric cancer patient with a cPR to a JTX-2011 (0.3 mg/kg, q3w) monotherapy. This population was detected following cycle 3, and there was a subsequent stabilization of the population through at least cycle 15 (
[0291] Populations of ICOS.sup.hi/T-bet.sup.hi CD4+ T cells were not observed in TNBC and endometrial cancer patients who exhibited SD in response to combination therapy of JTX-2011 (0.3 mg/kg, q3w) and nivolumab (240 mg, q3w) (
Example 4: Expansion of ICOS.SUP.hi .CD4+ T Cell Populations
[0292] 4.1
[0293] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0294] Culture media was further supplemented by OKT-3+IL-2 to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format.
[0295] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Nivolumab (anti-PD-1) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format.
[0296] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0297] 4.2
[0298] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0299] Culture media was further supplemented by OKT-3+IL-2+ICOS-L to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0300] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Nivolumab (anti-PD-1) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0301] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0302] 4.3
[0303] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0304] Culture media was further supplemented by IL-2+IL-12+anti-IL-4+Stemcell ImmunoCult human CD3/CD28 T cell activator (Cat#10971) to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format.
[0305] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Nivolumab (anti-PD-1) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format.
[0306] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0307] 4.4
[0308] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0309] Culture media was further supplemented by IL-2+IL-12+anti-IL-4+Stemcell ImmunoCult human CD3/CD28 T cell activator (Cat#10971)+ICOS-L to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0310] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Nivolumab (anti-PD-1) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0311] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0312] 4.5
[0313] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0314] Culture media was further supplemented by OKT-3+IL-2 to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format.
[0315] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Ipilimumab (anti-CTLA-4) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format.
[0316] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0317] 4.6
[0318] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0319] Culture media was further supplemented by OKT-3+IL-2+ICOS-L to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0320] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Ipilimumab (anti-CTLA-4) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0321] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0322] 4.7
[0323] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0324] Culture media was further supplemented by IL-2+IL-12+anti-IL-4+Stemcell ImmunoCult human CD3/CD28 T cell activator (Cat#10971) to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format.
[0325] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Ipilimumab (anti-CTLA-4) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format.
[0326] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0327] 4.8
[0328] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0329] Culture media was further supplemented by IL-2+IL-12+anti-IL-4+Stemcell ImmunoCult human CD3/CD28 T cell activator (Cat#10971)+ICOS-L to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0330] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation. Media was further supplemented by Ipilimumab (anti-CTLA-4) to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0331] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0332] 4.9
[0333] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0334] Culture media was further supplemented by OKT-3+IL-2 to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format.
[0335] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation, except OKT-3, to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format.
[0336] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance, including OKT-3. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0337] 4.10
[0338] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0339] Culture media was further supplemented by OKT-3+IL-2+ICOS-L to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0340] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation, except OKT-3, to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0341] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance, including OKT-3. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0342] 4.11
[0343] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0344] Culture media was further supplemented by IL-2+IL-12+anti-IL-4+Stemcell ImmunoCult human CD3/CD28 T cell activator (Cat#10971) to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format.
[0345] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation, except Stemcell ImmunoCult human CD3/CD28 T cell activator, to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format.
[0346] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance, including Stemcell ImmunoCult human CD3/CD28 T cell activator. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
[0347] 4.12
[0348] Healthy donor PBMCs were distributed to the wells of a 48-well plate at a density of approximately 310.sup.5 cells per well in 500 uL AIM-V medium (Thermo A3830801) supplemented with 5% human AB serum (Sigma H4522) and 1% antibiotic antimycotic solution (Sigma A5955).
[0349] Culture media was further supplemented by IL-2+IL-12+anti-IL-4+Stemcell ImmunoCult human CD3/CD28 T cell activator (Cat#10971)+ICOS-L to induce ICOS expression among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0350] Cells were incubated for 3 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation, except Stemcell ImmunoCult human CD3/CD28 T cell activator, to maintain ICOS expression and prevent exhaustion among CD4+ T cells. All supplements were delivered in soluble format, with the exception of ICOS-L which was previously coated onto the culture plate (plate-bound format).
[0351] Cells were incubated for another 4 days at 37 C., then transferred to new wells containing fresh media and all supplements used for initial stimulation and ICOS maintenance, including Stemcell ImmunoCult human CD3/CD28 T cell activator. Cells were then incubated for another 3 days at 37 C., then stained and fixed. At the end of 10 total days of incubation, cells had expanded by a minimum of 24-fold.
Example 5: Evaluation of the Cytokine Response in Antigen-Specific ICOS.SUP.hi .and ICOS.SUP.lo .CD4+ T Cells
[0352] Study Design
[0353] PBMCs from healthy donors were stimulated to induce an ICOS.sup.hi CD4+ T cell population using tetanus toxoid as a model recall antigen. Following 24 hours of stimulation with antigen, cells were washed to remove stimulus and to rest the CD4+ T cells. Following washing, soluble JTX-2011 was added and intracellular cytokine production was assessed by flow cytometry following a 6 hour incubation in the presence of brefeldin A.
[0354] Results and Conclusion
[0355] Ex vivo stimulation by soluble JTX-2011 was active only if ICOS.sup.hi CD4+ T cells were already present. JTX-2011 induced potent polyfunctional cytokine responses characterized by a 4-fold average increase in both IFN and TNF in antigen-specific ICOS.sup.hi, but not in ICOS.sup.lo CD4+ T cells (
Example 6: Evaluation of the Effect of PD-1 Inhibition on the Emergence of ICOS.SUP.hi .CD4+ T Cells
[0356] Study Design
[0357] Samples from subjects receiving standard of care PD-1 inhibitor treatment were obtained from a commercial biorepository. In total, PBMCs from 77 subjects, primarily those with lung cancer or melanoma, were assessed for the emergence of a population of CD4+ T cells by flow cytometry profiling (
[0358] Results and Conclusion
[0359] Longitudinal flow profiles of a NSCLC subject who responded to nivolumab and a NSCLC subject who responded to pembrolizumab showed no induction of ICOS.sup.hi CD4+ T cells (
Example 7: Transcriptional and Phenotypic Profiling of ICOS.SUP.hi .and ICOS.SUP.lo .CD4+ T Cells
[0360] Study Design
[0361] Transcriptional analysis of purified CD4+ T cells from subjects with treatment-emergent ICOS.sup.hi cells vs CD4+ T cells from reference cancer patients not displaying the cell population was performed using a Nanostring human immunology panel. In addition, the immunophenotype of peripheral blood T cells was assessed by flow cytometry at various time points pre- and post-treatment with JTX-2011 alone, or in combination with nivolumab.
[0362] Results and Conclusion
[0363] ICOS.sup.hi CD4+ T cells were found to be distinct from ICOS.sup.lo cells as demonstrated by both transcriptional profiling and immunophenotype assessment by flow cytometry. Patient and donor CD4+ T cell samples formed distinct clusters when applying unsupervised clustering using Pearson's correlation coefficient (
[0364] Evaluation of lineage and activation markers in a subject with a late-cycle uniform ICOS.sup.hi population revealed ICOS.sup.hi CD4+ T cells as T effector cells of primarily the Th1 lineage (
[0365] Longitudinal analysis of average Ki-67 staining in subjects with confirmed PRs to JTX-2011 treatment demonstrate early and late proliferation of CD8+ and CD4+ T cells, respectively, characterized by bi-phasic proliferation in subjects with an emergent ICOS.sup.hi population (
Example 8: Examination of T Cell Receptor Repertoire Clonality Following Treatment with JTX-2011
[0366] Study Design
[0367] T cell receptor repertoire clonality was assessed on peripheral T cells and archival tumor tissue using the Adaptive Biotechnologies ImmunoSeq assay.
[0368] Results and Conclusion
[0369] Analysis of changes in clonal abundance in the peripheral blood T cell receptor (TCR) repertoire identified significant on-treatment expansion of clones in 18/22 (82%) of subjects following JTX-2011 treatment, including those from monotherapy. Longitudinal profiling of JTX-2011-induced changes in peripheral clonality demonstrate bi-phasic expansion of the circulating repertoire (
[0370] Overall, TCR clonality assessment on-treatment demonstrates clonal expansion, with greater expansion of tumor associated clones in subjects displaying an ICOS.sup.hi CD4+ T cell phenotype, while JTX-2011 treatment results in expansion of de novo T cell clones regardless of ICOS.sup.hi CD4+ T cell emergence.
Example 9: Analysis of Responding Patient PBMCs
[0371] Study Design
[0372] PBMCs from a subject with a confirmed PR with a uniform ICOS.sup.hi CD4+ T cell population were selected for assessment of antigen-specificity. Stimulation of PBMCs was performed, with IFN secretion detected using an ELISPOT reader. Peptides were tested as a pool containing 2 g/mL of each mutant peptide.
[0373] Results and Conclusion
[0374] Flow cytometric analysis demonstrated uniformity of an ICOS.sup.hi CD4+ T cell population at a selected time point (
Example 10: Examination of ICOS.SUP.hi .Emergence and Survival
[0375] Study Design
[0376] Ad hoc flow cytometry phenotyping on PBMCs from a subset of 50 patients from the ICONIC study with evaluable samples was performed. Clinical characteristics and outcomes were analyzed, including unadjusted p-values for post-hoc statistical analyses.
[0377] Results and Conclusion
[0378] Emergence of a distinct and persistent population of ICOS.sup.hi peripheral CD4+ T cells was associated with improved survival, both with JTX-2011 monotherapy and combination therapy with nivolumab, with improved PFS (
TABLE-US-00002 TABLE 2 Anti-Cancer Anti-Cancer Therapeutic Target Name Therapeutic Target Name BMS-986179 5-nucleotidase, ecto imalumab macrophage migration (CD73) inhibitory factor (glycosylation-inhibiting factor) pTVG-HP acid phosphatase, prostate OSE-2101 major histocompatibility complex, class I, A sipuleucel-T acid phosphatase, prostate andecaliximab matrix metallopeptidase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) CX-2009 activated leukocyte cell anti-MAGE-A3 melanoma antigen family A, 3 adhesion molecule TOR, Kite Pharma luspatercept activin A receptor type II- KITE-718 melanoma antigen family A, 3 like 1 CPI-444 adenosine A2a receptor biropepimut-S melanoma antigen family A, 3 NGR-TNF alanyl (membrane) rituximab membrane-spanning 4- aminopeptidase biosimilar, Pfizer domains, subfamily A, member 1 CB-1158 arginase 1 rituximab membrane-spanning 4- arginase 2 biosimilar, Dr. domains, subfamily A, Reddys member 1 BA3011 AXL receptor tyrosine rituximab membrane-spanning 4- kinase biosimilar, Sandoz domains, subfamily A, member 1 AXL-107-MMAE AXL receptor tyrosine rituximab membrane-spanning 4- kinase biosimilar, Celltrion domains, subfamily A, member 1 CCT301-38 AXL receptor tyrosine rituximab membrane-spanning 4- kinase biosimilar, Archigen domains, subfamily A, RAR-related orphan Biotech member 1 receptor A SurVaxM baculoviral IAP repeat rituximab membrane-spanning 4- containing 5 biosimilar, Innovent domains, subfamily A, Biologics member 1 NY-ESO-1 TOR, cancer/testis antigen 1 MB-106 membrane-spanning 4- Adaptimmune domains, subfamily A, member 1 CDX-1401 cancer/testis antigen 1 ibritumomab membrane-spanning 4- lymphocyte antigen 75 tiuxetan domains, subfamily A, member 1 ETBX-011 carcinoembryonic antigen- rituximab membrane-spanning 4- related cell adhesion domains, subfamily A, molecule 5 member 1 GI-6207 carcinoembryonic antigen- ublituximab membrane-spanning 4- related cell adhesion domains, subfamily A, molecule 5 member 1 falimarev + carcinoembryonic antigen- rituximab membrane-spanning 4- inalimarev related cell adhesion biosimilar, domains, subfamily A, molecule 5 Allergan/Amgen member 1 mucin 1, cell surface associated labetuzumab carcinoembryonic antigen- ofatumumab membrane-spanning 4- govitecan related cell adhesion domains, subfamily A, molecule 5 member 1 topoisomerase (DNA) I coltuximab CD19 molecule ocaratuzumab membrane-spanning 4- ravtansine domains, subfamily A, member 1 denintuzumab CD19 molecule veltuzumab membrane-spanning 4- mafodotin domains, subfamily A, member 1 axicabtagene CD19 molecule obinutuzumab membrane-spanning 4- ciloleucel domains, subfamily A, member 1 CIK-CAR.CD19 CD19 molecule rituximab and membrane-spanning 4- hyaluronidase domains, subfamily A, human member 1 JCAR014 CD19 molecule anetumab mesothelin ravtansine lisocabtagene CD19 molecule amatuximab mesothelin maraleucel tisagenlecleucel CD19 molecule emibetuzumab met proto-oncogene MOR-208 CD19 molecule binimetinib mitogen-activated protein kinase kinase 1 mitogen-activated protein kinase kinase 2 inebilizumab CD19 molecule SAR566658 mucin 1, cell surface associated AUTO3, Autolus CD19 molecule Cvac, Prima mucin 1, cell surface CD22 molecule Biomed associated DT2219ARL CD19 molecule TG4010 mucin 1, cell surface CD22 molecule associated interleukin 2 receptor, alpha blinatumomab CD19 molecule oregovomab mucin 16, cell surface CD3e molecule, epsilon associated (CD3-TCR complex) samalizumab CD200 molecule methionine opioid growth factor receptor enkephalin based immunotherapy inotuzumab CD22 molecule olaratumab platelet-derived growth factor ozogamicin receptor, alpha polypeptide 90Y- CD22 molecule enfortumab vedotin poliovirus receptor-related 4 epratuzumab tetraxetan epratuzumab CD22 molecule ProstAtak, polymerase (DNA directed), Advantagene alpha 1, catalytic subunit ontuxizumab CD248 molecule, PancAtak, polymerase (DNA directed), endosialin Advantagene alpha 1, catalytic subunit varlilumab CD27 molecule aglatimagene polymerase (DNA directed), besadenovec alpha 1, catalytic subunit durvalumab CD274 molecule IMC-gp100 premelanosome protein avelumab CD274 molecule cemiplimab programmed cell death 1 atezolizumab CD274 molecule AGEN2034 programmed cell death 1 CX-072 CD274 molecule nivolumab programmed cell death 1 enoblituzumab CD276 molecule pembrolizumab programmed cell death 1 omburtamab CD276 molecule spartalizumab programmed cell death 1 AlloStim, CD28 molecule BGB-A317 programmed cell death 1 Immunovative Therapies gemtuzumab CD33 molecule genolimzumab programmed cell death 1 ozogamicin lintuzumab- CD33 molecule JNJ-63723283 programmed cell death 1 Ac225 BI 836858 CD33 molecule MEDI0680 programmed cell death 1 naratuximab CD37 molecule thymalfasin prothymosin, alpha emtansine lutetium (177Lu) CD37 molecule LYC-55716 RAR-related orphan receptor lilotomab C satetraxetan otlertuzumab CD37 molecule cirmtuzumab receptor tyrosine kinase-like orphan receptor 1 daratumumab CD38 molecule VX15/2503 sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D isatuximab CD38 molecule elotuzumab SLAM family member 7 TAK-573 CD38 molecule indatuximab syndecan 1 ravtansine A-dmDT390- CD3e molecule, epsilon BMS-986207 T-cell immunoreceptor with Ig bisFv (UCHT1) (CD3-TCR complex) and ITIM domains APX005M CD40 molecule, TNF tertomotide telomerase reverse receptor superfamily transcriptase member 5 Hu5F9-G4 CD47 molecule Toca 511 + Toca thymidylate synthetase FC TI-061 CD47 molecule APS001F thymidylate synthetase milatuzumab CD74 molecule, major JCARH125 TNF receptor superfamily histocompatibility complex, member 17 class II invariant chain polatuzumab CD79b molecule, bb2121 TNF receptor superfamily vedotin immunoglobulin-associated member 17 beta mogamulizumab chemokine (C-C motif) AUTO2, Autolus TNF receptor superfamily receptor 4 member 17 TNF receptor superfamily member 13B BL-8040 chemokine (C-X-C motif) OPN-305 toll-like receptor 2 receptor 4 X4P-001 chemokine (C-X-C motif) rintatolimod toll-like receptor 3 receptor 4 ulocuplumab chemokine (C-X-C motif) poly-ICLC toll-like receptor 3 receptor 4 claudiximab claudin 18 ID-G100 toll-like receptor 4 ALT-836 coagulation factor III ID-CMB305 toll-like receptor 4 (thromboplastin, tissue cancer/testis antigen 1 factor) MCS110 colony stimulating factor 1 imiquimod toll-like receptor 7 (macrophage) (intravesical), Telormedix ARRY-382 colony stimulating factor 1 NKTR-262 toll-like receptor 7 (macrophage) toll-like receptor 8 colony stimulating factor 1 receptor BLZ-945 colony stimulating factor 1 motolimod toll-like receptor 8 receptor AMG 820 colony stimulating factor 1 tilsotolimod toll-like receptor 9 receptor cabiralizumab colony stimulating factor 1 sacituzumab topoisomerase (DNA) I receptor govitecan tumor-associated calcium signal transducer 2 gemogenovatucel-T colony stimulating factor 2 HPV-16 E6 TCR, transforming protein E6, (granulocyte-macrophage) Bluebird Bio/Kite human papilloma virus-16 Pharma GVAX colony stimulating factor 2 VGX-3100 transforming protein E6, (granulocyte-macrophage) human papilloma virus-16 transforming protein E7, human papilloma virus-16 E6 protein, human papilloma virus-18 E7 protein, human papilloma virus-18 talimogene colony stimulating factor 2 MEDI0457 transforming protein E6, laherparepvec (granulocyte-macrophage) human papilloma virus-16 transforming protein E7, human papilloma virus-16 E7 protein, human papilloma virus-18 E6 protein, human papilloma virus-18 pexastimogene colony stimulating factor 2 TVGV-1 transforming protein E7, devacirepvec (granulocyte-macrophage) human papilloma virus-16 sargramostim colony stimulating factor 2 KITE-439 transforming protein E7, receptor, alpha, low-affinity human papilloma virus-16 (granulocyte-macrophage) SV-BR-1-GM colony stimulating factor 2 ADXS-DUAL transforming protein E7, cancer vaccine receptor, alpha, low-affinity human papilloma virus-16 (granulocyte-macrophage) pamrevlumab connective tissue growth axalimogene transforming protein E7, factor filolisbac human papilloma virus-16 ipilimumab cytotoxic T-lymphocyte- MVA-5T4 trophoblast glycoprotein associated protein 4 tremelimumab cytotoxic T-lymphocyte- oportuzumab tumor-associated calcium associated protein 4 monatox signal transducer 2 BMS-986249 cytotoxic T-lymphocyte- denosumab tumour necrosis factor associated protein 4 (ligand) superfamily, member 11 rovalpituzumab delta-like 3 (Drosophila) BION-1301 tumour necrosis factor tesirine (ligand) superfamily, member 13 ABT-165 delta-like 4 (Drosophila) belimumab tumour necrosis factor vascular endothelial growth (ligand) superfamily, member factor A 13b BHQ880 dickkopf WNT signaling INCAGN1876 tumour necrosis factor pathway inhibitor 1 receptor superfamily, member 18 DKN-01 dickkopf WNT signaling BMS-986156 tumour necrosis factor pathway inhibitor 1 receptor superfamily, member 18 Ad-REIC vaccine, dickkopf WNT signaling INCAGN1949 tumour necrosis factor Momotaro-Gene pathway inhibitor 3 receptor superfamily, member 4 AGS-16C3F ectonucleotide PF-04518600 tumour necrosis factor pyrophosphatase/phosphod receptor superfamily, member iesterase 3 4 carotuximab endoglin BMS-986178 tumour necrosis factor receptor superfamily, member 4 ifabotuzumab EPH receptor A3 brentuximab tumour necrosis factor vedotin receptor superfamily, member 8 CimaVax EGF epidermal growth factor urelumab tumour necrosis factor (beta-urogastrone) receptor superfamily, member 9 depatuxizumab epidermal growth factor utomilumab tumour necrosis factor mafodotin receptor receptor superfamily, member 9 RM-1929 epidermal growth factor VBI-1901 UL83, cytomegalovirus receptor UL55, cytomegalovirus AVID100 epidermal growth factor bevacizumab vascular endothelial growth receptor biosimilar, factor A Boehringer Ingelheim trastuzumab epidermal growth factor bevacizumab-awwb vascular endothelial growth biosimilar, receptor factor A Henlius cetuximab epidermal growth factor bevacizumab vascular endothelial growth receptor biosimilar, Pfizer factor A panitumumab epidermal growth factor bevacizumab vascular endothelial growth receptor biosimilar, factor A Oncobiologics necitumumab epidermal growth factor bevacizumab vascular endothelial growth receptor biosimilar, Henlius factor A Biopharmaceuticals nimotuzumab epidermal growth factor bevacizumab vascular endothelial growth receptor biosimilar, Fujifilm factor A Kyowa Kirin Biologies futuximab epidermal growth factor aflibercept vascular endothelial growth receptor factor A tomuzotuximab epidermal growth factor bevacizumab vascular endothelial growth receptor factor A doxorubicin, EDV epidermal growth factor pritumumab vimentin nanocells, receptor EnGeneIC pan-HER epidermal growth factor pexidartinib v-kit Hardy-Zuckerman 4 receptor feline sarcoma viral oncogene erb-b2 receptor tyrosine homologue kinase 2 colony stimulating factor 1 erb-b2 receptor tyrosine receptor kinase 3 fms-related tyrosine kinase 3 trastuzumab erb-b2 receptor tyrosine galinpepimut-S Wilms tumour 1 deruxtecan kinase 2 trastuzumab erb-b2 receptor tyrosine adegramotide/nelati Wilms tumour 1 emtansine kinase 2 motide (vic-)trastuzumab erb-b2 receptor tyrosine JTCR016 Wilms tumour 1 duocarmazine kinase 2 nelipepimut-S erb-b2 receptor tyrosine levamisole Unknown kinase 2 trastuzumab erb-b2 receptor tyrosine ladiratuzumab Unknown biosimilar, Merck kinase 2 vedotin & Co./Samsung Bioepis trastuzumab erb-b2 receptor tyrosine NSC-631570 Unknown biosimilar, kinase 2 Celltrion trastuzumab erb-b2 receptor tyrosine LN-145 Unknown biosimilar, Biocon kinase 2 trastuzumab erb-b2 receptor tyrosine INO-5401 Unknown biosimilar, kinase 2 Allergan/Amgen trastuzumab erb-b2 receptor tyrosine AN01, Anson Unknown biosimilar, Pfizer kinase 2 Pharma AU101, Aurora erb-b2 receptor tyrosine GALE-302 Unknown Biopharma kinase 2 AU105, Aurora erb-b2 receptor tyrosine MAGE-A3 TCR, Unknown BioPharma kinase 2 Adaptimmune AE37 erb-b2 receptor tyrosine BTH-1677 Unknown kinase 2 trastuzumab erb-b2 receptor tyrosine lentinan Unknown kinase 2 pertuzumab erb-b2 receptor tyrosine Polysaccharide-K Unknown kinase 2 margetuximab erb-b2 receptor tyrosine Tice BCG, Organon Unknown kinase 2 ADXS31-164 erb-b2 receptor tyrosine IGEM-F Unknown kinase 2 ETBX-021 erb-b2 receptor tyrosine PV-10, Provectus Unknown kinase 2 seribantumab erb-b2 receptor tyrosine vitespen Unknown kinase 3 patritumab erb-b2 receptor tyrosine mifamurtide Unknown kinase 3 CDX-3379 erb-b2 receptor tyrosine melanoma vaccine, Unknown kinase 3 GSK elgemtumab erb-b2 receptor tyrosine Bacille Calmette- Unknown kinase 3 Guerin vaccine, ID Biomedical moxetumomab eukaryotic translation seviprotimut-I Unknown pasudotox elongation factor 2 CD22 molecule denileukin diftitox eukaryotic translation in situ autologous Unknown elongation factor 2 cancer vaccine, interleukin 2 receptor, alpha Immunophotonics MDNA55 eukaryotic translation IMA901 Unknown elongation factor 2 interleukin 4 receptor bemarituzumab fibroblast growth factor adagloxad Unknown receptor 2 simolenin DCVax-prostate, folate hydrolase (prostate- PVX-410 Unknown Northwest specific membrane antigen) Biotherapeutics 1 177Lu-J591 folate hydrolase (prostate- viagenpumatucel-L Unknown specific membrane antigen) 1 tuberculosis folate hydrolase (prostate- GALE-301 Unknown vaccine (Mw), specific membrane antigen) Cadila; Cadi-05 1 mirvetuximab folate receptor 1 (adult) EP-302, EpiThany Unknown soravtansine TPIV200 folate receptor 1 (adult) BI 1361849 Unknown farletuzumab folate receptor 1 (adult) DPV-001 Unknown IGEM-FR folate receptor 1 (adult) Bacille Calmette- Unknown Guerin vaccine, Sanofi G17DT gastrin LAMP-Vax + pp65 Unknown DC, Immunomic Therapeutics codrituzumab glypican 3 NKG2D-CAR Unknown EP-100, gonadotropin-releasing BPX-501 Unknown EpiThany hormone 1 (luteinizing- releasing hormone) luteinizing hormone/chorio- gonadotropin receptor naxitamab growth differentiation factor NK-92 cells Unknown 2 CDX-014 hepatitis A virus cellular LN-144 Unknown receptor 1 MBG453 hepatitis A virus cellular CLBS-23 Unknown receptor 2 histamine histamine receptor H2 DCVax-Direct, Unknown dihydrochloride Northwest Biotherapeutics entinostat histone deacetylase 1 melanoma vaccine, Unknown AVAX indoximod indoleamine-pyrrole 2,3 stapuldencel-T Unknown dioxygenase epacadostat indoleamine-pyrrole 2,3 dendritic cancer Unknown dioxygenase vaccine, DanDrit Biotech BMS-986205 indoleamine-pyrrole 2,3 DCVax-Brain Unknown dioxygenase brain cancer vaccine, Northwest Biotherapeutics JTX-2011 inducible T-cell co- tumor lysate Unknown stimulator particle-loaded dendritic cell vaccine, Perseus BMS-986226 inducible T-cell co- ERC1671 Unknown stimulator ADC W0101 insulin-like growth factor 1 BSK01 Unknown receptor TAPA pulsed DC vaccine ganitumab insulin-like growth factor 1 Oncoquest-CLL Unknown receptor vaccine istiratumab insulin-like growth factor 1 rocapuldencel-T Unknown receptor erb-b2 receptor tyrosine kinase 3 dusigitumab insulin-like growth factor 1 ATIR-101 Unknown receptor insulin-like growth factor 2 receptor EP-201, insulin-like growth factor TVI-Kidney-1 Unknown EpiThany binding protein 2, 36 kDa citoplurikin interferon gamma receptor TVAX cancer Unknown 1 vaccine, TVAX tumor necrosis factor Biomedical receptor superfamily, member 1A MABp1 interleukin 1, alpha atezolizumab, Unknown companion diagnostic pegilodecakin interleukin 10 tumour infiltrating Unknown lymphocytes, lovance Biotherapeutics-2 Ad-RTS-hIL-12 + interleukin 12 receptor, MAGE A-10 TCR, Unknown veledimex beta 1 Adaptimmune tavokinogene interleukin 12 receptor, IMA101 Unknown telsaplasmid beta 1 interleukin 12 receptor, beta 2 EGEN-001 interleukin 12A (natural algenpantucel-L Unknown killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40) SL-701 interleukin 13 receptor, Tumor Necrosis Unknown alpha 2 Therapy, Peregrine EPH receptor A2 baculoviral IAP repeat containing 5 ALT-803 interleukin 15 receptor, imiquimod Unknown alpha Multikine, Cel-Sci interleukin 2 receptor, alpha LOAd703 Unknown ALT-801 interleukin 2 receptor, alpha CG0070 Unknown high-affinity interleukin 2 receptor, alpha dinutuximab Unknown Natural Killer (haNK) cells, NantKwest interleukin-2, interleukin 2 receptor, alpha bavituximab Unknown Roche aldesleukin interleukin 2 receptor, alpha ensituximab Unknown NKTR-214 interleukin 2 receptor, beta pidilizumab Unknown talacotuzumab interleukin 3 receptor, alpha BMS-986218 Unknown (low affinity) SL-401 interleukin 3 receptor, alpha BMS-986012 Unknown (low affinity) siltuximab interleukin 6 (interferon, ADXS31-142 Unknown beta 2) HuMax-IL8 interleukin 8 GI-6301 Unknown PSA/IL-2/GM- kallikrein-related peptidase GI-4000 Unknown CSF 3 rilimogene kallikrein-related peptidase JNJ-64041757 Unknown galvacirepvec 3 CD80 molecule intercellular adhesion molecule 1 CD58 molecule monalizumab killer cell lectin-like receptor HPV vaccine Unknown subfamily C, member 1 (Cervarix), GSK ramucirumab kinase insert domain HPV vaccine Unknown receptor (Gardasil), CSL ubenimex leucotriene A4 hydrolase Sym015 Unknown leucotriene B4 receptor IMP321 lymphocyte-activation gene diphenylcycloprope Unknown 3 none LAG525 lymphocyte-activation gene ISA101 Unknown 3 relatlimab lymphocyte-activation gene 3
TABLE-US-00003 TABLE3 Sequences Name SEQ (Target,if ID applicable) Region NO Sequence JTX-2011 Heavy 1 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMDWVRQAPGKGLVWVSNI (ICOS) Chain DEDGSITEYSPFVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRWGRF GFDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH KPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG JTX-2011 Light 2 DIVMTQSPDSLAVSLGERATINCKSSQSLLSGSFNYLTWYQQKPGQ (ICOS) Chain PPKLLIFYASTRHTGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYC HHHYNAPPTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVC LLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC JTX-2011 Heavy 3 EVQLVESGGGLVQPGGSLRLSCAASGFTFSDYWMDWVRQAPGKGLVWVSNI (ICOS) Chain DEDGSITEYSPFVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCTRWGRF Variable GFDSWGQGTLVTVSS Region JTX-2011 Light 4 DIVMTQSPDSLAVSLGERATINCKSSQSLLSGSFNYLTWYQQKPGQPPKLL (ICOS) Chain IFYASTRHTGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCHHHYNAPPTF Variable GPGTKVDIK Region JTX-2011 HCDR1 5 GFTFSDYWMD (ICOS) JTX-2011 HCDR2 6 NIDEDGSITEYSPFVK (ICOS) JTX-2011 HCDR3 7 WGRFGFDS (ICOS) JTX-2011 LCDR1 8 KSSQSLLSGSFNYLT (ICOS) JTX-2011 LCDR2 9 YASTRHT (ICOS) JTX-2011 LCDR3 10 HHHYNAPPT (ICOS) HumanICOS 11 MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQF precursor KMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHS withsignal HANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVV sequence CILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL (IntracellarRegionisunderlined) HumanICOS, 12 EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGS mature GNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVT LTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSV HDPNGEYMFMRAVNTAKKSRLTDVTL (IntracellarRegionisunderlined) Mouse(Mus 13 MKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKYPE musculus) TVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSV ICOS SFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCC precursor QLKLWLPVGCAAFVVVLLFGCILIIWFSKKKYGSSVHDPNSEYMFM AAVNTNKKSRLAGVTS Mouse(Mus 14 EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELT musculus) KTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLS ICOS,mature IFDPPPFQERNLSGGYLHIYESQLCCQLKLWLPVGCAAFVVVLLFG CILIIWFSKKKYGSSVHDPNSEYMFMAAVNTNKKSRLAGVTS Rat(Rattus 15 MKPYFSCVFVFCFLIKLLTGELNDLANHRMFSFHDGGVQISCNYPE norvegicus) TVQQLKMQLFKDREVLCDLIKTKGSGNIVSIKNPMSCPYQLSNNSV ICOS SFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCC precursor QLKLWLPVGCAAFVAALLFGCIFIVWFAKKKYRSSVHDPNSEYMFM AAVNTNKKSRLAGMTS Rat(Rattus 16 ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGS norvegicus) GNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEK ICOS,mature NLSGGYLLIYESQLCCQLKLWLPVGCAAFVAALLFGCIFIVWFAKKKYRSS VHDPNSEYMFMAAVNTNKKSRLAGMTS Cynomolgus 17 MKSGLWYFFLFCLHMKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQF monkey KMQLLKGGQILCDLTKTKGSGNKVSIKSLKFCHSQLSNNSVSFFLYNLDRS (Macaca HANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCATFVVV fascicularis) CIFGCILICWLTKKKYSSTVHDPNGEYMFMRAVNTAKKSRLTGTTP ICOS, precursor Cynomolgus 18 EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLT monkey KTKGSGNKVSIKSLKFCHSQLSNNSVSFFLYNLDRSHANYYFCNLS (Macaca IFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCATFVVVCIFGC fascicularis) ILICWLTKKKYSSTVHDPNGEYMFMRAVNTAKKSRLTGTTP ICOS,mature JNC-1(PD-1) Heavy 19 QVQLVQSGAEVKKPGASVKVSCKASGYTFPSYYMHWVRQAPGQGLEWMGII Chain NPEGGSTAYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARGGTY Variable YDYTYWGQGTLVTVSS Region JNC-1(PD-1) HCDR1 20 YTFPSYYMH JNC-1(PD-1) HCDR2 21 IINPEGGSTAYAQKFQG JNC-1(PD-1) HCDR3 22 ARGGTYYDYTY JNC-1(PD-1) Light 23 DIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYEA Chain SSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSFPPTFGGGT Variable KVEIK Region JNC-1(PD-1) LCDR1 24 RASQSISSWLA JNC-1(PD-1) LCDR2 25 EASSLES JNC-1(PD-1) LCDR3 26 QQYNSFPPT 2M13(ICOS Heavy 27 EVQLQQSGAELVRPGAVVKLSCKASGFDIKDYYMHWVQQRPEQGLEWIGWI intra- Chain DPENGNAVYDPQFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCASDYYG cellular) Variable SKGYLDVWGAGTTVTVSS Region 2M13(ICOS HCDR1 28 DYYMH intra- cellular) 2M13(ICOS HCDR2 29 WIDPENGNAVYDPQFQG intra- cellular) 2M13(ICOS HCDR3 30 DYYGSKGYLDV intra- cellular) 2M13(ICOS Light 31 QIVLTQSPTIMSASPGEKVTITCSASSSVSYMHWFQQKPGTSPKLWIYSTS intra- Chain NLASGVPARFGGSRSGTSYSLTISRMEAEDAATYYCQQRSSYPFTFGSGTK cellular) Variable LEIK Region 2M13(ICOS LCDR1 32 SASSSVSYMH intra- cellular) 2M13(ICOS LCDR2 33 STSNLAS intra- cellular) 2M13(ICOS LCDR3 34 QQRSSYPFT intra- cellular) 2M19(ICOS Heavy 35 EVQLQQSGAELVRSGASVKLSCTTSAFNIIDYYMHWVIQRPEQGLEWIAWI intra- Chain DPENGDPEYAPKFQDKATMTTDTSSNTAYLQLSSLTSEDTAVYYCTAWRGF cellular) Variable AYWGQGTLVTVSA Region 2M19(ICOS HCDR1 36 DYYMH intra- cellular) 2M19(ICOS HCDR2 37 WIDPENGDPEYAPKFQD intra- cellular) 2M19(ICOS HCDR3 38 WRGFAY intra- cellular) 2M19(ICOS Light 39 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKL intra- Chain LIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSIHVPPT cellular) Variable FGGGTKLEIK Region 2M19(ICOS LCDR1 40 RSSQSLVHSNGNTYLH intra- cellular) 2M19(ICOS LCDR2 41 KVSNRFS intra- cellular) 2M19(ICOS LCDR3 42 SQSIHVPPT intra- cellular) HumanT-bet 43 MGIVEPGCGDMLTGTEPMPGSDEGRAPGADPQHRYFYPEPGAQDADERRGG GSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAGFPGAGESFPPPADAEGY QPGEGYAAPDPRAGLYPGPREDYALPAGLEVSGKLRVALNNHLLWSKFNQH QTEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKW VQCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVT QMIVLQSLHKYQPRLHIVEVNDGEPEAACNASNTHIFTFQETQFIAVTAYQ NAEITQLKIDNNPFAKGFRENFESMYTSVDTSIPSPPGPNCQFLGGDHYSP LLPNQYPVPSRFYPDLPGQAKDVVPQAYWLGAPRDHSYEAEFRAVSMKPAF LPSAPGPTMSYYRGQEVLAPGAGWPVAPQYPPKMGPASWFRPMRTLPMEPG PGGSEGRGPEDQGPPLVWTEIAPIRPESSDSGLGEGDSKRRRVSPYPSSGD SSSPAGAPSPFDKEAEGQFYNYFPN Mouse(Mus 44 MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPTDRRAGS musculus) SLGTPYSGGALVPAAPGRFLGSFAYPPRAQVAGFPGPGEFFPPPAGAEGYP T-bet PVDGYPAPDPRAGLYPGPREDYALPAGLEVSGKLRVALSNHLLWSKFNQHQ TEMIITKQGRRMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWV QCGKAEGSMPGNRLYVHPDSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQ MIVLQSLHKYQPRLHIVEVNDGEPEAACSASNTHVFTFQETQFIAVTAYQN AEITQLKIDNNPFAKGFRENFESMYASVDTSVPSPPGPNCQLLGGDPFSPL LSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFRAVSMKPTLL PSAPGPTVPYYRGQDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPGL GSSEEQGSSPSLWPEVTSLQPEPSDSGLGEGDTKRRRISPYPSSGDSSSPA GAPSPFDKETEGQFYNYFPN
[0379] The disclosure may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting of the disclosure. Scope of the disclosure is thus indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are therefore intended to be embraced herein. Some embodiments of the invention are within the following numbered paragraphs.
[0380] 1. A method of treating cancer in a subject in need thereof, the method comprising (i) administering one or more dosages of one or more anti-cancer therapies to the subject, (ii) after the administration, obtaining one or more peripheral blood test samples from the subject, (iii) measuring ICOS and/or T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, (iv) determining if there is a population of CD4+ T cells having elevated ICOS and/or T-bet levels in any of the one or more peripheral blood test samples when compared to a control, and (v) administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels.
[0381] 2. The method of paragraph 1, wherein step (iii) comprises measuring ICOS levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated ICOS levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS levels.
[0382] 3. The method of paragraph 1 or 2, wherein step (iii) comprises measuring T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated T-bet levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated T-bet levels.
[0383] 4. The method of paragraph 1, wherein step (iii) comprises measuring ICOS and T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated ICOS and T-bet levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises administering (a) one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels.
[0384] 5. The method of paragraph 1, wherein step (iii) comprises measuring ICOS and T-bet levels of CD4+ T cells present in the one or more peripheral blood test samples, step (iv) comprises determining if there is a population of CD4+ T cells having elevated ICOS and T-bet levels in any one of the one or more peripheral blood test samples when compared to a control, and step (v) comprises (a) administering one or more additional dosages of the one or more anti-cancer therapies, or (b) an anti-ICOS agonist, to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and T-bet levels.
[0385] 6. A method for determining whether a subject may benefit from (a) continued treatment with one or more anti-cancer therapies or (b) treatment with an anti-ICOS agonist, the method comprising determining ICOS and/or T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS and/or T-bet levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment.
[0386] 7. The method of paragraph 6, wherein the method comprises determining ICOS levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment.
[0387] 8. The method of paragraph 6 or 7, wherein the method comprises determining T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased T-bet levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment.
[0388] 9. The method of paragraph 6, wherein the method comprises determining ICOS and T-bet levels of peripheral CD4+ T cells of a sample of blood of the subject, wherein detection of increased ICOS or T-bet levels relative to a control indicates that the subject may benefit from the continued treatment, optionally in combination with an anti-ICOS antibody agonist, or treatment with an anti-ICOS agonist, when the one or more anti-cancer therapies does not comprise anti-ICOS antibody agonist treatment.
[0389] 10. The method of any one of paragraphs 1 to 9, wherein the one or more anti-cancer therapies comprises an immunotherapy.
[0390] 11. The method of any one of paragraphs 1 to 10, wherein the one or more anti-cancer therapies comprises an anti-CTLA-4 antagonist antibody.
[0391] 12. The method of paragraph 11, wherein the anti-CTLA-4 antagonist antibody is selected from the group consisting of ipilimumab, tremelimumab, and BMS-986249.
[0392] 13. The method of paragraph 12, wherein the anti-CTLA-4 antagonist antibody is ipilimumab.
[0393] 14. The method of any one of paragraphs 1 to 13, wherein the one or more anti-cancer therapies comprises an anti-PD-1 or anti-PD-L1 antagonist antibody.
[0394] 15. The method of paragraph 14, wherein the anti-PD-1 or anti-PD-L1 antagonist antibody is selected from the group consisting of avelumab, atezolizumab, CX-072, pembrolizumab, nivolumab, cemiplimab, spartalizumab, tislelizumab, JNJ-63723283, genolimzumab, AMP-514, AGEN2034, durvalumab, and JNC-1.
[0395] 16. The method of paragraph 15, wherein the anti-PD-1 or anti-PD-L1 antagonist antibody is selected from the group consisting of pembrolizumab, nivolumab, atezolizumab, avelumab, and duravalumab.
[0396] 17. The method of any one of paragraphs 1 to 16, wherein the one or more anti-cancer therapies, or the anti-ICOS agonist, comprises an anti-ICOS agonist antibody.
[0397] 18. The method of paragraph 17, wherein the anti-ICOS agonist antibody is selected from the group consisting of JTX-2011, BMS-986226, and GSK3359609.
[0398] 19. The method of any one of paragraphs 1 to 18, wherein the one or more anti-cancer therapies comprises one or more of the therapies listed in Table 2.
[0399] 20. The method of any one of paragraphs 1 to 19, wherein the one or more anti-cancer therapies comprises a chemotherapy.
[0400] 21. The method of paragraph 20, wherein the chemotherapy is selected from the group consisting of capecitabine, cyclophosphamide, dacarbazine, temozolomide, cyclophosphamide, docetaxel, doxorubicin, daunorubicin, cisplatin, carboplatin, epirubicin, eribulin, 5-FU, gemcitabine, irinotecan, ixabepilone, methotrexate, mitoxantrone, oxaliplatin, paclitaxel, nab-paclitaxel, pemetrexed, vinorelbine, vincristine, erlotinib, afatinib, gefitinib, crizotinib, dabrafenib, trametinib, vemurafenib, and cobimetanib.
[0401] 22. The method of any one of paragraphs 1 to 21, wherein the one or more anti-cancer therapies comprises radiation therapy.
[0402] 23. The method of any one of paragraphs 1 to 5 and 10 to 22, wherein step (v) comprises administration of an anti-ICOS antibody agonist to the subject if any of the one or more peripheral blood test samples is determined to comprise a population of CD4+ T cells having elevated ICOS and/or T-bet levels.
[0403] 24. The method of any one of paragraphs 6 to 23, wherein the anti-ICOS antibody agonist comprises at least one CDR selected from the group consisting of: (a) an HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) an HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; (c) an HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; (d) an LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) an LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) an LCDR3 comprising the amino acid sequence of SEQ ID NO: 10, wherein one or more of the CDRs comprises 1 or 2 amino acid substitutions.
[0404] 25. The method of paragraph 24, wherein the anti-ICOS antibody agonist comprises (a) an HCDR1 comprising the amino acid sequence of SEQ ID NO: 5; (b) an HCDR2 comprising the amino acid sequence of SEQ ID NO: 6; (c) an HCDR3 comprising the amino acid sequence of SEQ ID NO: 7; (d) an LCDR1 comprising the amino acid sequence of SEQ ID NO: 8; (e) an LCDR2 comprising the amino acid sequence of SEQ ID NO: 9; and (f) an LCDR3 comprising the amino acid sequence of SEQ ID NO: 10.
[0405] 26. The method of any one of paragraphs 6 to 25, wherein the anti-ICOS antibody agonist comprises (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 1 and/or (b) a light chain comprising the amino acid sequence of SEQ ID NO: 2.
[0406] 27. The method of any one of paragraphs 1 to 26, wherein the one or more anti-cancer therapies comprises any combination of at least two of: (i) an anti-CTLA-4 antagonist antibody, (ii) an anti-PD-1 or anti-PD-L1 antagonist antibody, (iii) an anti-ICOS agonist antibody, (iv) a therapy of Table 2, (v) a chemotherapy, and (vi) radiation therapy.
[0407] 28. The method of any one of paragraphs 1 to 27, wherein the one or more anti-cancer therapies comprises any combination of at least three of: (i) an anti-CTLA-4 antagonist antibody, (ii) an anti-PD-1 or anti-PD-L1 antagonist antibody, (iii) an anti-ICOS agonist antibody, (iv) a therapy of Table 2, (v) a chemotherapy, and (vi) radiation therapy.
[0408] 29. The method of any one of paragraphs 1 to 5 and 10 to 28, wherein the one or more anti-cancer therapies is administered two or more times prior to obtaining the one or more peripheral blood test samples.
[0409] 30. The method of paragraph 29, wherein the one or more anti-cancer therapies is administered three or more times prior to obtaining the one or more peripheral blood test samples.
[0410] 31. The method of paragraph 30, wherein the one or more anti-cancer therapies is administered four or more times prior to obtaining the one or more peripheral blood test samples.
[0411] 32. The method of paragraph 31, wherein the one or more anti-cancer therapies is administered five or more times prior to obtaining the one or more peripheral blood test samples.
[0412] 33. The method of any one of paragraphs 1 to 5 and 10 to 32, wherein the obtaining of the one or more peripheral blood test samples is performed fewer than 4 weeks after the one or more administrations of the dosages of the one or more anti-cancer therapies.
[0413] 34. The method of paragraph 33, wherein the obtaining of the one or more peripheral blood test samples is performed fewer than 3 weeks after the one or more administrations of the dosages of the one or more anti-cancer therapies.
[0414] 35. The method of paragraph 34, wherein the obtaining of the one or more peripheral blood test samples is performed fewer than 2 weeks after the one or more administrations of the dosages of the one or more anti-cancer therapies.
[0415] 36. The method of paragraph 35, wherein the obtaining of the one or more peripheral blood test samples is performed less than one week after the one or more administrations of the dosages of the one or more anti-cancer therapies.
[0416] 37. The method of any one of paragraphs 1 to 5 and 10 to 36, wherein the dosage of the one or more anti-cancer therapies is administered multiple times at regular intervals.
[0417] 38. The method of paragraph 37, wherein the regular intervals are selected from the group consisting of a dosage every week, a dosage every two weeks, a dosage every three weeks, a dosage every four weeks, a dosage every six weeks, a dosage every nine weeks, and a dosage every twelve weeks.
[0418] 39. The method of paragraph 37 or 38, wherein the obtaining of the one or more peripheral blood test samples comprises the obtaining of multiple peripheral blood test samples, with test samples being obtained concurrent with one or more of the administrations.
[0419] 40. The method of paragraph 37 or 38, wherein the obtaining of the one or more peripheral blood test samples comprises the obtaining of multiple peripheral blood test samples, with test samples being obtained during a time intervening the multiple administrations.
[0420] 41. The method of any one of paragraphs 37 to 40, wherein the method further comprises halting the administration of the one or more anti-cancer therapies if, after the one or more anti-cancer therapies is administered for four or more intervals, a population of CD4+ T cells having elevated ICOS and/or T-bet levels compared to a control is not detected in any one of the peripheral blood test samples.
[0421] 42. The method of paragraph 41, wherein the method further comprises halting the administration of the one or more anti-cancer therapies if, after of the one or more anti-cancer therapies is administered for five or more, six or more, seven or more, eight or more, nine or more, or ten or more intervals, a peripheral blood test sample is obtained based on which it is determined that there is not a population of CD4+ T cells having elevated ICOS and/or T-bet levels compared to a control.
[0422] 43. The method of any one of paragraphs 1 to 42, wherein the method further comprises storing a portion of one or more of the peripheral blood test samples.
[0423] 44. The method of any one of paragraphs 1 to 43, wherein a portion of the CD4+ T cells having elevated ICOS and/or T-bet levels is isolated from one or more of the peripheral blood test samples and stored under conditions suitable for maintaining the viability of the CD4+ T cells.
[0424] 45. The method of paragraph 44, wherein the stored CD4+ T cells are stored in a cell culture medium.
[0425] 46. The method of paragraph 44 or 45, wherein the stored CD4+ T cells are stored at a concentration of greater than 100,000 cells/mL.
[0426] 47. The method of paragraph 46, wherein the stored CD4+ T cells are stored at a concentration between 100,000 cells/mL and 100 million cells/mL.
[0427] 48. A suspension of CD4+ T cells obtained according to the method of any one of paragraphs 44 to 47.
[0428] 49. The method of any one of paragraphs 1 to 47, wherein the control comprises a peripheral blood test sample, which is optionally obtained from the subject before one or more of the administrations of the one or more anti-cancer therapies to the subject.
[0429] 50. The method of any one of paragraphs 1 to 47, wherein the control comprises a peripheral blood sample obtained from a healthy individual not receiving the one or more anti-cancer therapies.
[0430] 51. The method of any one of paragraphs 1 to 47, 49, and 50, wherein determining of ICOS and/or T-bet levels comprises the use of an immunoassay.
[0431] 52. The method of paragraph 51, wherein the immunoassay comprises the use of an antibody that binds to an intracellular domain of ICOS to detect ICOS.
[0432] 53. The method of paragraph 52, wherein the antibody comprises a heavy chain variable region sequence of SEQ ID NO: 27 and a light chain variable region sequence of SEQ ID NO: 31; or the antibody comprises a heavy chain variable region sequence of SEQ ID NO: 35 and a light chain variable region sequence of SEQ ID NO: 39.
[0433] 54. The method of paragraph 52, wherein the antibody cross-competes with an antibody comprising a heavy chain variable region sequence of SEQ ID NO: 27 and a light chain variable region sequence of SEQ ID NO: 31; or cross-competes with an antibody comprising a heavy chain variable region sequence of SEQ ID NO: 35 and a light chain variable region sequence of SEQ ID NO: 39.
[0434] 55. The method of any one of paragraphs 1 to 47 and 49 to 54, further comprising measuring ICOS and/or T-bet levels of CD8+ T cells present in the one or more peripheral blood test samples, wherein a population of CD8+ T cells having elevated ICOS and/or T-bet levels relative to a control is not detected in the samples.
[0435] 56. The method of any one of paragraphs 1 to 47 and 49 to 55, wherein the cancer is selected from gastric cancer, breast cancer, which optionally is triple negative breast cancer (TNBC), non-small cell lung cancer (NSCLC), melanoma, renal cell carcinoma (RCC), bladder cancer, endometrial cancer, diffuse large B-cell lymphoma (DLBCL), Hodgkin's lymphoma, ovarian cancer, and head and neck squamous cell cancer (HNSCC).
[0436] 57. The method of any one of paragraphs 1 to 47 and 49 to 56, wherein the subject is a human patient.
[0437] 58. The method of any one of paragraphs 1 to 5, 10 to 47, and 49 to 57, wherein the population of CD4+ T cells having elevated ICOS and/or T-bet levels comprises a new, separate population of CD4+ T cells, which was induced by the one or more anti-cancer therapies.
[0438] 59. A method of generating an expanded population of CD4+ T cells having elevated ICOS expression, said method comprising culturing the suspension of CD4+ T cells of paragraph 48 under initial culture conditions suitable for expanding said population of CD4+ T cells.
[0439] 60. The method of paragraph 59, wherein said initial conditions suitable for expanding said population of CD4+ T cells comprises contacting said suspension of CD4+ T cells with a CD3 agonist.
[0440] 61. The method of paragraph 60, wherein said CD3 agonist is an anti-CD3 antibody (e.g., OKT3).
[0441] 62. The method of any one of paragraphs 59-61, wherein said initial conditions suitable for expanding said population of CD4+ T cells comprises contacting said suspension with one or more of an anti-PD-1 antibody antagonist, an anti-CTLA-4 antibody, and an ICOS agonist.
[0442] 63. The method of any one of paragraphs 59-62, wherein said initial conditions suitable for expanding said population of CD4+ T cells comprises contacting said suspension with one or more compounds (e.g., two or more, or all three) selected from the group consisting of IL-2, IL-12 and anti-IL-4.
[0443] 64. The method of any one of paragraphs 59-62, wherein said initial conditions suitable for expanding said population of CD4+ T cells comprises contacting said suspension with an anti-CD28 antibody agonist.
[0444] 65. The method of any one of paragraphs 61-64, wherein said CD3 agonist and anti-CD28 agonist are present in a tetrameric antibody complex.
[0445] 66. The method of any one of paragraphs 59-65, wherein said suspension of CD4+ T cells are incubated under said initial culture conditions for a period between one and five days (e.g., approximately 1, 2, 3, 4, or five days).
[0446] 67. The method of paragraph 66, further comprising incubating said suspension of CD4+ T cells under a second culture condition suitable for expanding said population of CD4+ T cells.
[0447] 68. The method of paragraph 67, wherein said cells are washed prior to the application of said second culture condition.
[0448] 69. The method of paragraph 67 or 68, wherein said second culture condition comprises contacting said suspension of cells with one or more of an anti-PD-1 antibody antagonist, an anti-CTLA-4 antibody, and an ICOS agonist.
[0449] 70. The method of any one of paragraphs 67-69, wherein said second culture condition comprises contacting said suspension of cells with one or more compounds (e.g., two or more, or all three) selected from the group consisting of IL-2, IL-12 and anti-IL-4.
[0450] 71. The method of any one of paragraphs 67-70, wherein said second culture condition comprises contacting said suspension of cells with an anti-CD28 antibody agonist.
[0451] 72. The method of any one of paragraphs 67-70, wherein said second culture conditions does not comprise contacting said suspension of cells with a CD3 agonist and/or CD28 agonist.
[0452] 73. The method of any one of paragraphs 67-72, wherein said second culture condition is maintained for between 1 and 5 days (e.g., for 1, 2, 3, 4, or 5 days).
[0453] 74. A suspension of cells generated by any one of the methods of paragraphs 59-73.
[0454] 75. A method of treating cancer in a subject in need thereof, the method comprising administering to said patient the suspension of cells of paragraph 74, wherein optionally the suspension of T-cells of paragraph 48 were isolated from said subject.
[0455] Other embodiments are within the following claims.