Methods and Compositions for Diagnosis and Prognosis of Renal Injury and Renal Failure

20190353667 ยท 2019-11-21

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to methods and compositions for monitoring, diagnosis, prognosis, and determination of treatment regimens in subjects suffering from or suspected of having a renal injury. In particular, the invention relates to using assays that detect one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 1 IB as diagnostic and prognostic biomarker assays in renal injuries.

Claims

1. A method for evaluating renal status in a subject, comprising: performing one or more of an assay method configured to detect Angiopoietin-related protein 6, an assay method configured to detect Complement C5, an assay method configured to detect Fibroblast growth factor 21, an assay method configured to detect Fibroblast growth factor 23, an assay method configured to detect Pro-interleukin-16, an assay method configured to detect CXC motif chemokine 9, an assay method configured to detect Hepatocyte growth factor-like protein, and/or an assay method configured to detect Tumor necrosis factor receptor superfamily member 11B, on a body fluid sample obtained from the subject to provide one or more assay result(s); and correlating the assay result(s) to the renal status of the subject.

2. A method according to claim 1, wherein said correlation step comprises correlating the assay result(s) to one or more of risk stratification, diagnosis, staging, prognosis, classifying and monitoring of the renal status of the subject.

3. A method according to claim 1, wherein said correlating step comprises assigning a likelihood of one or more future changes in renal status to the subject based on the assay result(s).

4. A method according to claim 3, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, future acute renal failure (ARF), and future persistence of existing ARF.

5. A method according to one of claims 1-4, wherein said assay result(s) comprise one or more of a measured concentration of Angiopoietin-related protein 6, a measured concentration of Complement C5, a measured concentration of Fibroblast growth factor 21, a measured concentration of Fibroblast growth factor 23, a measured concentration of Pro-interleukin-16, a measured concentration of CXC motif chemokine 9, a measured concentration of Hepatocyte growth factor-like protein, and/or a measured concentration of Tumor necrosis factor receptor superfamily member 11B.

6. A method according to one of claims 1-5, wherein said correlating step comprises combining a plurality of assay results using a function that converts the plurality of assay results into a single composite result.

7. A method according to claim 3, wherein said one or more future changes in renal status comprise a clinical outcome related to a renal injury suffered by the subject.

8. A method according to claim 3, wherein the likelihood of one or more future changes in renal status is that an event of interest is more or less likely to occur within 30 days of the time at which the body fluid sample is obtained from the subject.

9. A method according to claim 8, wherein the likelihood of one or more future changes in renal status is that an event of interest is more or less likely to occur within a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours.

10. A method according to one of claims 1-5, wherein the subject is selected for evaluation of renal status based on the pre-existence in the subject of one or more known risk factors for prerenal, intrinsic renal, or postrenal ARF.

11. A method according to one of claims 1-5, wherein the subject is selected for evaluation of renal status based on an existing diagnosis of one or more of congestive heart failure, preeclampsia, eclampsia, diabetes mellitus, hypertension, coronary artery disease, proteinuria, renal insufficiency, glomerular filtration below the normal range, cirrhosis, serum creatinine above the normal range, sepsis, injury to renal function, reduced renal function, or ARF, or based on undergoing or having undergone major vascular surgery, coronary artery bypass, or other cardiac surgery, or based on exposure to NSAIDs, cyclosporines, tacrolimus, aminoglycosides, foscarnet, ethylene glycol, hemoglobin, myoglobin, ifosfamide, heavy metals, methotrexate, radiopaque contrast agents, or streptozotocin.

12. A method according to one of claims 1-5, wherein said correlating step comprises assigning a diagnosis of the occurrence or nonoccurrence of one or more of an injury to renal function, reduced renal function, or ARF to the subject based on the assay result.

13. A method according to one of claims 1-5, wherein said correlating step comprises assessing whether or not renal function is improving or worsening in a subject who has suffered from an injury to renal function, reduced renal function, or ARF based on the assay result.

14. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of an injury to renal function in said subject.

15. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of reduced renal function in said subject.

16. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of acute renal failure in said subject.

17. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of a need for renal replacement therapy in said subject.

18. A method according to one of claims 1-5, wherein said method is a method of diagnosing the occurrence or nonoccurrence of a need for renal transplantation in said subject.

19. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of an injury to renal function in said subject.

20. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of reduced renal function in said subject.

21. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of acute renal failure in said subject.

22. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of a need for renal replacement therapy in said subject.

23. A method according to one of claims 1-5, wherein said method is a method of assigning a risk of the future occurrence or nonoccurrence of a need for renal transplantation in said subject.

24. A method according to one of claims 1-5, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, and future acute renal failure (ARF) within 72 hours of the time at which the body fluid sample is obtained.

25. A method according to one of claims 1-5, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, and future acute renal failure (ARF) within 48 hours of the time at which the body fluid sample is obtained.

26. A method according to one of claims 1-5, wherein said one or more future changes in renal status comprise one or more of a future injury to renal function, future reduced renal function, future improvement in renal function, and future acute renal failure (ARF) within 24 hours of the time at which the body fluid sample is obtained.

27. A method according to one of claims 1-5, wherein the subject is in RIFLE stage 0 or R.

28. A method according to claim 27, wherein the subject is in RIFLE stage 0, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage R, I or F within 72 hours.

29. A method according to claim 28, wherein the subject is in RIFLE stage 0, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 72 hours.

30. A method according to claim 28, wherein the subject is in RIFLE stage 0, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

31. A method according to claim 27, wherein the subject is in RIFLE stage 0 or R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 72 hours.

32. A method according to claim 31, wherein the subject is in RIFLE stage 0 or R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

33. A method according to claim 27, wherein the subject is in RIFLE stage R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 72 hours.

34. A method according to claim 33, wherein the subject is in RIFLE stage R, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

35. A method according to one of claims 1-5, wherein the subject is in RIFLE stage 0, R, or I, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

36. A method according to claim 35, wherein the subject is in RIFLE stage I, and said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 72 hours.

37. A method according to claim 28, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage R, I or F within 48 hours.

38. A method according to claim 29, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 48 hours.

39. A method according to claim 30, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

40. A method according to claim 31, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 48 hours.

41. A method according to claim 32, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

42. A method according to claim 33, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 48 hours.

43. A method according to claim 34, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

44. A method according to claim 35, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

45. A method according to claim 36, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 48 hours.

46. A method according to claim 28, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage R, I or F within 24 hours.

47. A method according to claim 29, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 24 hours.

48. A method according to claim 30, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

49. A method according to claim 31, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 24 hours.

50. A method according to claim 32, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

51. A method according to claim 33, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage I or F within 24 hours.

52. A method according to claim 34, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

53. A method according to claim 35, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

54. A method according to claim 36, wherein said correlating step comprises assigning a likelihood that the subject will reach RIFLE stage F within 24 hours.

55. A method according to one of claims 1-5, wherein the subject is not in acute renal failure.

56. A method according to one of claims 1-5, wherein the subject has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

57. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.5 ml/kg/hr over the 6 hours preceding the time at which the body fluid sample is obtained.

58. A method according to one of claims 1-5, wherein the subject has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

59. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.5 ml/kg/hr over the 6 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

60. A method according to one of claims 1-5, wherein the subject has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

61. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.5 ml/kg/hr over the 6 hours preceding the time at which the body fluid sample is obtained.

62. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 1.5-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.5 ml/kg/hr over the 12 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

63. A method according to one of claims 1-5, wherein said correlating step comprises assigning one or more of: a likelihood that within 72 hours the subject will (i) experience a 1.5-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

64. A method according to claim 63, wherein said correlating step comprises assigning one or more of: a likelihood that within 48 hours the subject will (i) experience a 1.5-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

65. A method according to claim 63, wherein said correlating step comprises assigning one or more of: a likelihood that within 24 hours the subject will (i) experience a 1.5-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

66. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience a 1.5-fold or greater increase in serum creatinine.

67. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

68. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience an increase of 0.3 mg/dL or greater in serum creatinine.

69. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience a 1.5-fold or greater increase in serum creatinine.

70. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

71. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience an increase of 0.3 mg/dL or greater in serum creatinine.

72. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience a 1.5-fold or greater increase in serum creatinine.

73. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

74. A method according to claim 63, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience an increase of 0.3 mg/dL or greater in serum creatinine.

75. A method according to one of claims 1-5, wherein the subject has not experienced a 2-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

76. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.5 ml/kg/hr over the 12 hours preceding the time at which the body fluid sample is obtained.

77. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 2-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.5 ml/kg/hr over the 2 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

78. A method according to one of claims 1-5, wherein the subject has not experienced a 3-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

79. A method according to one of claims 1-5, wherein the subject has a urine output of at least 0.3 ml/kg/hr over the 24 hours preceding the time at which the body fluid sample is obtained, or anuria over the 12 hours preceding the time at which the body fluid sample is obtained.

80. A method according to one of claims 1-5, wherein the subject (i) has not experienced a 3-fold or greater increase in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained, (ii) has a urine output of at least 0.3 ml/kg/hr over the 24 hours preceding the time at which the body fluid sample is obtained, or anuria over the 12 hours preceding the time at which the body fluid sample is obtained, and (iii) has not experienced an increase of 0.3 mg/dL or greater in serum creatinine over a baseline value determined prior to the time at which the body fluid sample is obtained.

81. A method according to one of claims 1-5, wherein said correlating step comprises assigning one or more of: a likelihood that within 72 hours the subject will (i) experience a 2-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 12 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

82. A method according to claim 81, wherein said correlating step comprises assigning one or more of: a likelihood that within 48 hours the subject will (i) experience a 2-fold or greater increase in serum creatinine (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period, or (iii) experience an increase of 0.3 mg/dL or greater in serum creatinine.

83. A method according to claim 81, wherein said correlating step comprises assigning one or more of: a likelihood that within 24 hours the subject will (i) experience a 2-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

84. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience a 2-fold or greater increase in serum creatinine.

85. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

86. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience a 2-fold or greater increase in serum creatinine.

87. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

88. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience a 2-fold or greater increase in serum creatinine.

89. A method according to claim 81, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will have a urine output of less than 0.5 ml/kg/hr over a 6 hour period.

90. A method according to one of claims 1-5, wherein said correlating step comprises assigning one or more of: a likelihood that within 72 hours the subject will (i) experience a 3-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

91. A method according to claim 90, wherein said correlating step comprises assigning one or more of: a likelihood that within 48 hours the subject will (i) experience a 3-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

92. A method according to claim 90, wherein said correlating step comprises assigning one or more of: a likelihood that within 24 hours the subject will (i) experience a 3-fold or greater increase in serum creatinine, or (ii) have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

93. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will experience a 3-fold or greater increase in serum creatinine.

94. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 72 hours the subject will have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

95. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will experience a 3-fold or greater increase in serum creatinine.

96. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 48 hours the subject will have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

97. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will experience a 3-fold or greater increase in serum creatinine.

98. A method according to claim 90, wherein said correlating step comprises assigning a likelihood that within 24 hours the subject will have a urine output of less than 0.3 ml/kg/hr over a 24 hour period or anuria over a 12 hour period.

99. A method according to one of claims 1-98, wherein the body fluid sample is a urine sample.

100. A method according to one of claims 1-98, wherein the body fluid sample is a blood, serum, or plasma sample.

101. A method according to one of claims 1-100, wherein the assay method comprises introducing the body fluid sample obtained from the subject into an assay instrument which (i) contacts the body fluid sample with one or more reagents which specifically bind for detection one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B, (ii) generates one or more assay results indicative of one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B in the urine sample, and (iii) uses the assay result(s) to assign the subject to a predetermined subpopulation of individuals having a known predisposition of a current or future acute renal injury or current or future acute renal failure.

102. A method according to claim 101, further comprising treating the subject based on the predetermined subpopulation of individuals to which the patient is assigned, wherein the treatment comprises one or more of initiating renal replacement therapy, withdrawing delivery of compounds that are known to be damaging to the kidney, delaying or avoiding procedures that are known to be damaging to the kidney, and modifying diuretic administration.

103. A method according to claim 101 or 102, wherein the subject does not have a current acute renal injury or acute renal failure, and the assay result is used to assign the subject to a predetermined subpopulation of individuals having a known predisposition of a future acute renal injury or future acute renal failure.

104. A method according to claim 103, wherein the future acute renal injury or future acute renal failure is within a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours

105. A method according to claim 101 or 102, wherein the subject has a current acute renal injury or acute renal failure, and the assay result is used to assign the subject to a predetermined subpopulation of individuals having a known predisposition of future recovery from acute renal injury or acute renal failure.

106. A method according to claim 105, wherein the future recovery from acute renal injury or acute renal failure is within a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours

107. A method according to claim 101 or 102, wherein the assay result is used to assign the subject to a predetermined subpopulation of individuals having a known predisposition of future persistence of an acute renal injury or acute renal failure.

108. A method according to claim 107, wherein the future persistence is over a period selected from the group consisting of 21 days, 14 days, 7 days, 5 days, 96 hours, 72 hours, 48 hours, 36 hours, 24 hours, and 12 hours.

109. A method according to claim 107 or 108, wherein the subject has an acute renal injury or acute renal failure at the time the body fluid sample is obtained.

110. Measurement of one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B for the evaluation of renal injury, particularly acute renal injury, and most particularly persistent acute renal injury.

111. A kit, comprising: reagents for performing one or more assays configured to detect one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B, and a device which contains one or more encoded calibration curves for correlating results from performing said assay(s) to a concentration of one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B, wherein the concentration range of said calibration curve(s) comprise a normal concentration of one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B, and a threshold concentration of one or more of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B that indicates persistent acute renal injury in a human.

Description

DETAILED DESCRIPTION OF THE INVENTION

[0051] The present invention relates to methods and compositions for diagnosis, differential diagnosis, risk stratification, monitoring, classifying and determination of treatment regimens in subjects suffering or at risk of suffering from injury to renal function, reduced renal function and/or acute renal failure through measurement of one or more kidney injury markers. In various embodiments, a measured concentration of one or more markers selected from the group consisting of Angiopoietin-related protein 6, Complement C5, Fibroblast growth factor 21, Fibroblast growth factor 23, Pro-interleukin-16, CXC motif chemokine 9, Hepatocyte growth factor-like protein, and/or Tumor necrosis factor receptor superfamily member 11B or one or more markers related thereto, and optionally one or more additional kidney injury markers known in the art, are correlated to the renal status of the subject.

[0052] For purposes of this document, the following definitions apply:

As used herein, an injury to renal function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) measurable reduction in a measure of renal function. Such an injury may be identified, for example, by a decrease in glomerular filtration rate or estimated GFR, a reduction in urine output, an increase in serum creatinine, an increase in serum cystatin C, a requirement for renal replacement therapy, etc. Improvement in Renal Function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) measurable increase in a measure of renal function. Preferred methods for measuring and/or estimating GFR are described hereinafter.

[0053] As used herein, reduced renal function is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) reduction in kidney function identified by an absolute increase in serum creatinine of greater than or equal to 0.1 mg/dL (8.8 mol/L), a percentage increase in serum creatinine of greater than or equal to 20% (1.2-fold from baseline), or a reduction in urine output (documented oliguria of less than 0.5 ml/kg per hour).

[0054] As used herein, acute renal failure or ARF is an abrupt (within 14 days, preferably within 7 days, more preferably within 72 hours, and still more preferably within 48 hours) reduction in kidney function identified by an absolute increase in serum creatinine of greater than or equal to 0.3 mg/dl (26.4 mol/l), a percentage increase in serum creatinine of greater than or equal to 50% (1.5-fold from baseline), or a reduction in urine output (documented oliguria of less than 0.5 ml/kg per hour for at least 6 hours). This term is synonymous with acute kidney injury or AKI.

[0055] In this regard, the skilled artisan will understand that the signals obtained from an immunoassay are a direct result of complexes formed between one or more antibodies and the target biomolecule (i.e., the analyte) and polypeptides containing the necessary epitope(s) to which the antibodies bind. While such assays may detect the full length biomarker and the assay result be expressed as a concentration of a biomarker of interest, the signal from the assay is actually a result of all such immunoreactive polypeptides present in the sample. Expression of biomarkers may also be determined by means other than immunoassays, including protein measurements (such as dot blots, western blots, chromatographic methods, mass spectrometry, etc.) and nucleic acid measurements (mRNA quatitation). This list is not meant to be limiting.

[0056] As used herein, the term Angiopoietin-related protein 6 refers to one or more polypeptides present in a biological sample that are derived from the Angiopoietin-related protein 6 precursor (Swiss-Prot Q8NI99 (SEQ ID NO: 1)).

TABLE-US-00002 10203040 MGKPWLRALQLLLLLGASWARAGAPRCTYTFVLPPQKFTG 50607080 AVCWSGPASTRATPEAANASELAALRMRVGRHEELLRELQ 90100110120 RLAAADGAVAGEVRALRKESRGLSARLGQLRAQLQHEAGP 130140150160 GAGPGADLGAEPAAALALLGERVLNASAEAQRAAARFHQL 170180190200 DVKFRELAQLVTQQSSLIARLERLCPGGAGGQQQVLPPPP 210220230240 LVPVVPVRLVGSTSDTSRMLDPAPEPQRDQTQRQQEPMAS 250260270280 PMPAGHPAVPTKPVGPWQDCAEARQAGHEQSGVYELRVGR 290300310320 HVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGF 330340350360 GRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAH 370380390400 YDGFSLEPESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVD 410420430440 RDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGGHYRS 450460470 RYQDGVYWAEFRGGAYSLRKAAMLIRPLKL

[0057] The following domains have been identified in Angiopoietin-related protein 6:

TABLE-US-00003 Residues Length Domain ID 1-20 20 Signal peptide 21-470 450 Angiopoietin-related protein 6

[0058] As used herein, the term Complement C5 refers to one or more polypeptides present in a biological sample that are derived from the Complement C5 precursor (Swiss-Prot P01031 (SEQ ID NO: 1))

TABLE-US-00004 10203040 MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIV 50607080 IQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENKFQ 90100110120 NSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT 130140150160 YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETV 170180190200 LTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGMWT 210220230240 IKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY 250260270280 KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQK 290300310320 EMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDLNN 330340350360 KYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP 370380390400 LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQE 410420430440 TSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTDAP 450460470480 DLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE 490500510520 HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSD 530540550560 ASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDSVW 570580590600 LNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV 610620630640 ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGL 650660670680 NNANVFHLAGLTFLTNANADDSQENDEPCKEILRPRRTLQ 690700710720 KKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL 730740750760 GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPV 770780790800 SKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWEIQ 810820830840 GVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ 850860870880 LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKS 890900910920 SKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWFGK 930940950960 EILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP 9709809901000 YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINIL 1010102010301040 THLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLI 1050106010701080 EKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA 1090110011101120 FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKE 1130114011501160 NSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICP 1170118011901200 LVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK 1210122012301240 THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVP 1250126012701280 NTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQRY 1290130013101320 GGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK 1330134013501360 GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVH 1370138013901400 VTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYK 1410142014301440 RIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK 1450146014701480 ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIF 1490150015101520 ELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVC 1530154015501560 EGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA 1570158015901600 YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITF 1610162016301640 IKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLD 165016601670 SLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

[0059] The following domains have been identified in Complement C5:

TABLE-US-00005 Residues Length Domain ID 1-18 18 signal peptide 19-673 655 Complement C5 beta chain 674-677 4 Propeptide 678-1676 999 Complement C5 alpha chain 678-751 74 Complement C5a anaphlatoxin 752-1676 925 Complement C5 alpha' chain

[0060] As used herein, the term Fibroblast growth factor 21 refers to one or more polypeptides present in a biological sample that are derived from the Fibroblast growth factor 21 precursor (Swiss-Prot Q9NSA1 (SEQ ID NO: 1))

TABLE-US-00006 10203040 MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQF 50607080 GGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESL 90100110120 LQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEA 130140150160 CSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRG 170180190200 PARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPS QGRSPSYAS

[0061] The following domains have been identified in Fibroblast growth factor 21:

TABLE-US-00007 Residues Length Domain ID 1-28 28 Signal peptide 29-209 181 Fibroblast growth factor 21

[0062] As used herein, the term Fibroblast growth factor 23 refers to one or polypeptides present in a biological sample that are derived from the Fibroblast growth factor 23 precursor (Swiss-Prot Q9GZV9 (SEQ ID NO: 1)).

TABLE-US-00008 10203040 MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLI 50607080 HLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDA 90100110120 GFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTL 130140150160 ENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSR 170180190200 RNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMT 210220230240 PAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTG 250 PEGCRPFAKFI

[0063] The following domains have been identified in Fibroblast growth factor 23:

TABLE-US-00009 Residues Length Domain ID 1-24 24 Signal sequence 25-251 227 Fibroblast growth factor 23 25-179 155 Fibroblast growth factor 23 N-terminal peptide 180-251 72 Fibroblast growth factor 23 C-terminal peptide

[0064] As used herein, the term Pro-Interleukin-16 refers to one or more polypeptides present in a biological sample that are derived from the Interleukin-16 precursor (Swiss-Prot Q14005 (SEQ ID NO: 1)).

TABLE-US-00010 10203040 MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEK 50607080 YPDPFEISLAQGKEGIFHSSVQLADTSEAGPSSVPDLALA 90100110120 SEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEA 130140150160 QSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAA 170180190200 PTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTA 210220230240 QLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYG 250260270280 PIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTH 290300310320 QDALQKFKQAKKGLLTLTVRTRLTAPPSLCSHLSPPLCRS 330340350360 LSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQK 370380390400 EAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLR 410420430440 CGDEIVEISDSPVHCLTLNEVYTILSHCDPGPVPIIVSRH 450460470480 PDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLES 490500510520 SWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGS 530540550560 PGGSPGSGSAEKPSSDVDISTHSPSLPLAREPVVLSIASS 570580590600 RLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPP 610620630640 PRKYFKSDSDPQKSLEERENSSCSSGHTPPTCGQEARELL 650660670680 PLLLPQEDTAGRSPSASAGCPGPGIGPQTKSSTEGEPGWR 690700710720 RASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDC 730740750760 IKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPK 770780790800 LDTANGTPKVYKSADSSTVKKGPPVAPKPAWFRQSLKGLR 810820830840 NRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR 850860870880 QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEE 890900910920 GRFSGLLGRGAAPTLVPQQPEQVLSSGSPAASEARDPGVS 930940950960 ESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMP 9709809901000 SQRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMK 1010102010301040 SLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAET 1050106010701080 SALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQS 1090110011101120 VISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEE 1130114011501160 GAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGN 1170118011901200 EVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTP 1210122012301240 EAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKM 1250126012701280 SAGLGFSLEGGKGSLHGDKPLTINRIFKGAASEQSETVQP 1290130013101320 GDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKS 1330 LQSKETTAAGDS

[0065] The following domains have been identified in Pro-Interleukin-16:

TABLE-US-00011 Residues Length DomainID 1-1332 1332 Pro-Inter1eukin-16 1212-1332 121 Inter1eukin-16 1228 Missinginisoform2 1-701 Missinginisoform3 1-701 Missinginisoform4 1228 Missinginisoform4 1239-1332 .fwdarw.DVGRAGLQPGRREGLPTRRQASHH (SEQIDNO:)

[0066] As used herein, the term CXC motif chemokine 9 refers to one or polypeptides present in a biological sample that are derived from the CXC motif chemokine 9 precursor (Swiss-Prot Q07325 (SEQ ID NO: 1)).

TABLE-US-00012 10203040 MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGT 50607080 IHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSA 90100110120 DVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

[0067] The following domains have been identified in CXC motif chemokine 9 precursor:

TABLE-US-00013 Residues Length Domain ID 1-22 22 Signal sequence 23-125 103 C-X-C motif chemokine 9

[0068] As used herein, the term Hepatocyte growth factor-like protein refers to one or polypeptides present in a biological sample that are derived from the Hepatocyte growth factor-like protein precursor (Swiss-Prot P26927 (SEQ ID NO: 1)).

TABLE-US-00014 10203040 MGWLPLLLLLTQCLGVPGQRSPLNDFQVLRGTELQHLLHA 50607080 VVPGPWQEDVADAEECAGRCGPLMDCRAFHYNVSSHGCQL 90100110120 LPWTQHSPHTRLRRSGRCDLFQKKDYVRTCIMNNGVGYRG 130140150160 TMATTVGGLPCQAWSHKFPNDHKYTPTLRNGLEENFCRNP 170180190200 DGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYR 210220230240 GAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYC 250260270280 RNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATT 290300310320 VSCFRGKGEGYRGTANTTTAGVPCQRWDAQIPHQHRFTPE 330340350360 KYACKDLRENFCRNPDGSEAPWCFTLRPGMRAAFCYQIRR 370380390400 CTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPH 410420430440 KPQFTFTSEPHAQLEENFCRNPDGDSHGPWCYTMDPRTPF 450460470480 DYCALRRCADDQPPSILDPPDQVQFEKCGKRVDRLDQRRS 490500510520 KLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWILTA 530540550560 RQCFSSCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKM 570580590600 VCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGT 610620630640 KCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRV 650660670680 RESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLEGIII 690700710 PNRVCARSRWPAVFTRVSVFVDWIHKVMRLG

[0069] The following domains have been identified in Hepatocyte growth factor-like protein:

TABLE-US-00015 Residues Length Domain ID 1-18 18 Signal sequence 19-711 693 Hepatocyte growth factor-like protein 19-483 465 Hepatocyte growth factor-like protein alpha chain 484-711 228 Hepatocyte growth factor-like protein beta chain

[0070] As used herein, the term Tumor necrosis factor receptor superfamily member 11B refers to one or polypeptides present in a biological sample that are derived from the Tumor necrosis factor receptor superfamily member 11B precursor (Swiss-Prot O00300 (SEQ ID NO: 1)).

TABLE-US-00016 10203040 MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLL 50607080 CDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDEC 90100110120 LYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLK 130140150160 HRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPC 170180190200 RKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVT 210220230240 LCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI 250260270280 KRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENS 290300310320 VQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACK 330340350360 PSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKT 370380390400401 VTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

[0071] The following domains have been identified in Tumor necrosis factor receptor superfamily member 11B:

TABLE-US-00017 Residues Length Domain ID 1-21 21 Signal sequence 22-401 380 Tumor necrosis factor receptor superfamily member 11B

[0072] As used herein, the term relating a signal to the presence or amount of an analyte reflects this understanding. Assay signals are typically related to the presence or amount of an analyte through the use of a standard curve calculated using known concentrations of the analyte of interest. As the term is used herein, an assay is configured to detect an analyte if an assay can generate a detectable signal indicative of the presence or amount of a physiologically relevant concentration of the analyte. Because an antibody epitope is on the order of 8 amino acids, an immunoassay configured to detect a marker of interest will also detect polypeptides related to the marker sequence, so long as those polypeptides contain the epitope(s) necessary to bind to the antibody or antibodies used in the assay.

[0073] The term related marker as used herein with regard to a biomarker such as one of the kidney injury markers described herein refers to one or more fragments, variants, etc., of a particular marker or its biosynthetic parent that may be detected as a surrogate for the marker itself or as independent biomarkers. The term also refers to one or more polypeptides present in a biological sample that are derived from the biomarker precursor complexed to additional species, such as binding proteins, receptors, heparin, lipids, sugars, etc.

[0074] The term positive going marker as that term is used herein refer to a marker that is determined to be elevated in subjects suffering from a disease or condition, relative to subjects not suffering from that disease or condition. The term negative going marker as that term is used herein refer to a marker that is determined to be reduced in subjects suffering from a disease or condition, relative to subjects not suffering from that disease or condition.

[0075] The term subject as used herein refers to a human or non-human organism. Thus, the methods and compositions described herein are applicable to both human and veterinary disease. Further, while a subject is preferably a living organism, the invention described herein may be used in post-mortem analysis as well. Preferred subjects are humans, and most preferably patients, which as used herein refers to living humans that are receiving medical care for a disease or condition. This includes persons with no defined illness who are being investigated for signs of pathology.

[0076] Preferably, an analyte is measured in a sample. Such a sample may be obtained from a subject, or may be obtained from biological materials intended to be provided to the subject. For example, a sample may be obtained from a kidney being evaluated for possible transplantation into a subject, and an analyte measurement used to evaluate the kidney for preexisting damage. Preferred samples are body fluid samples.

[0077] The term body fluid sample as used herein refers to a sample of bodily fluid obtained for the purpose of diagnosis, prognosis, classification or evaluation of a subject of interest, such as a patient or transplant donor. In certain embodiments, such a sample may be obtained for the purpose of determining the outcome of an ongoing condition or the effect of a treatment regimen on a condition. Preferred body fluid samples include blood, serum, plasma, cerebrospinal fluid, urine, saliva, sputum, and pleural effusions. In addition, one of skill in the art would realize that certain body fluid samples would be more readily analyzed following a fractionation or purification procedure, for example, separation of whole blood into serum or plasma components.

[0078] The term diagnosis as used herein refers to methods by which the skilled artisan can estimate and/or determine the probability (a likelihood) of whether or not a patient is suffering from a given disease or condition. In the case of the present invention, diagnosis includes using the results of an assay, most preferably an immunoassay, for a kidney injury marker of the present invention, optionally together with other clinical characteristics, to arrive at a diagnosis (that is, the occurrence or nonoccurrence) of an acute renal injury or ARF for the subject from which a sample was obtained and assayed. That such a diagnosis is determined is not meant to imply that the diagnosis is 100% accurate. Many biomarkers are indicative of multiple conditions. The skilled clinician does not use biomarker results in an informational vacuum, but rather test results are used together with other clinical indicia to arrive at a diagnosis. Thus, a measured biomarker level on one side of a predetermined diagnostic threshold indicates a greater likelihood of the occurrence of disease in the subject relative to a measured level on the other side of the predetermined diagnostic threshold.

[0079] Similarly, a prognostic risk signals a probability (a likelihood) that a given course or outcome will occur. A level or a change in level of a prognostic indicator, which in turn is associated with an increased probability of morbidity (e.g., worsening renal function, future ARF, or death) is referred to as being indicative of an increased likelihood of an adverse outcome in a patient.

[0080] Marker Assays

[0081] In general, immunoassays involve contacting a sample containing or suspected of containing a biomarker of interest with at least one antibody that specifically binds to the biomarker. A signal is then generated indicative of the presence or amount of complexes formed by the binding of polypeptides in the sample to the antibody. The signal is then related to the presence or amount of the biomarker in the sample. Numerous methods and devices are well known to the skilled artisan for the detection and analysis of biomarkers. See, e.g., U.S. Pat. Nos. 6,143,576; 6,113,855; 6,019,944; 5,985,579; 5,947,124; 5,939,272; 5,922,615; 5,885,527; 5,851,776; 5,824,799; 5,679,526; 5,525,524; and 5,480,792, and The Immunoassay Handbook, David Wild, ed. Stockton Press, New York, 1994, each of which is hereby incorporated by reference in its entirety, including all tables, figures and claims.

[0082] The assay devices and methods known in the art can utilize labeled molecules in various sandwich, competitive, or non-competitive assay formats, to generate a signal that is related to the presence or amount of the biomarker of interest. Suitable assay formats also include chromatographic, mass spectrographic, and protein blotting methods. Additionally, certain methods and devices, such as biosensors and optical immunoassays, may be employed to determine the presence or amount of analytes without the need for a labeled molecule. See, e.g., U.S. Pat. Nos. 5,631,171; and 5,955,377, each of which is hereby incorporated by reference in its entirety, including all tables, figures and claims. One skilled in the art also recognizes that robotic instrumentation including but not limited to Beckman ACCESS, Abbott AXSYM, Roche ELECSYS, Dade Behring STRATUS systems are among the immunoassay analyzers that are capable of performing immunoassays. But any suitable immunoassay may be utilized, for example, enzyme-linked immunoassays (ELISA), radioimmunoassays (RIAs), competitive binding assays, and the like.

[0083] Antibodies or other polypeptides may be immobilized onto a variety of solid supports for use in assays. Solid phases that may be used to immobilize specific binding members include include those developed and/or used as solid phases in solid phase binding assays. Examples of suitable solid phases include membrane filters, cellulose-based papers, beads (including polymeric, latex and paramagnetic particles), glass, silicon wafers, microparticles, nanoparticles, TentaGels, AgroGels, PEGA gels, SPOCC gels, and multiple-well plates. An assay strip could be prepared by coating the antibody or a plurality of antibodies in an array on solid support. This strip could then be dipped into the test sample and then processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot. Antibodies or other polypeptides may be bound to specific zones of assay devices either by conjugating directly to an assay device surface, or by indirect binding. In an example of the later case, antibodies or other polypeptides may be immobilized on particles or other solid supports, and that solid support immobilized to the device surface.

[0084] Biological assays require methods for detection, and one of the most common methods for quantitation of results is to conjugate a detectable label to a protein or nucleic acid that has affinity for one of the components in the biological system being studied. Detectable labels may include molecules that are themselves detectable (e.g., fluorescent moieties, electrochemical labels, metal chelates, etc.) as well as molecules that may be indirectly detected by production of a detectable reaction product (e.g., enzymes such as horseradish peroxidase, alkaline phosphatase, etc.) or by a specific binding molecule which itself may be detectable (e.g., biotin, digoxigenin, maltose, oligohistidine, 2,4-dintrobenzene, phenylarsenate, ssDNA, dsDNA, etc.).

[0085] Preparation of solid phases and detectable label conjugates often comprise the use of chemical cross-linkers. Cross-linking reagents contain at least two reactive groups, and are divided generally into homofunctional cross-linkers (containing identical reactive groups) and heterofunctional cross-linkers (containing non-identical reactive groups). Homobifunctional cross-linkers that couple through amines, sulfhydryls or react non-specifically are available from many commercial sources. Maleimides, alkyl and aryl halides, alpha-haloacyls and pyridyl disulfides are thiol reactive groups. Maleimides, alkyl and aryl halides, and alpha-haloacyls react with sulfhydryls to form thiol ether bonds, while pyridyl disulfides react with sulfhydryls to produce mixed disulfides. The pyridyl disulfide product is cleavable. Imidoesters are also very useful for protein-protein cross-links. A variety of heterobifunctional cross-linkers, each combining different attributes for successful conjugation, are commercially available.

[0086] In certain aspects, the present invention provides kits for the analysis of the described kidney injury markers. The kit comprises reagents for the analysis of at least one test sample which comprise at least one antibody that a kidney injury marker. The kit can also include devices and instructions for performing one or more of the diagnostic and/or prognostic correlations described herein. Preferred kits will comprise an antibody pair for performing a sandwich assay, or a labeled species for performing a competitive assay, for the analyte. Preferably, an antibody pair comprises a first antibody conjugated to a solid phase and a second antibody conjugated to a detectable label, wherein each of the first and second antibodies that bind a kidney injury marker. Most preferably each of the antibodies are monoclonal antibodies. The instructions for use of the kit and performing the correlations can be in the form of labeling, which refers to any written or recorded material that is attached to, or otherwise accompanies a kit at any time during its manufacture, transport, sale or use. For example, the term labeling encompasses advertising leaflets and brochures, packaging materials, instructions, audio or video cassettes, computer discs, as well as writing imprinted directly on kits.

[0087] Antibodies

[0088] The term antibody as used herein refers to a peptide or polypeptide derived from, modeled after or substantially encoded by an immunoglobulin gene or immunoglobulin genes, or fragments thereof, capable of specifically binding an antigen or epitope. See, e.g. Fundamental Immunology, 3rd Edition, W. E. Paul, ed., Raven Press, N.Y. (1993); Wilson (1994; J. Immunol. Methods 175:267-273; Yarmush (1992) J. Biochem. Biophys. Methods 25:85-97. The term antibody includes antigen-binding portions, i.e., antigen binding sites, (e.g., fragments, subsequences, complementarity determining regions (CDRs)) that retain capacity to bind antigen, including (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CH1 domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., (1989) Nature 341:544-546), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR). Single chain antibodies are also included by reference in the term antibody.

[0089] Antibodies used in the immunoassays described herein preferably specifically bind to a kidney injury marker of the present invention. The term specifically binds is not intended to indicate that an antibody binds exclusively to its intended target since, as noted above, an antibody binds to any polypeptide displaying the epitope(s) to which the antibody binds. Rather, an antibody specifically binds if its affinity for its intended target is about 5-fold greater when compared to its affinity for a non-target molecule which does not display the appropriate epitope(s). Preferably the affinity of the antibody will be at least about 5 fold, preferably 10 fold, more preferably 25-fold, even more preferably 50-fold, and most preferably 100-fold or more, greater for a target molecule than its affinity for a non-target molecule. In preferred embodiments, Preferred antibodies bind with affinities of at least about 10.sup.7 M.sup.1, and preferably between about 10.sup.8 M.sup.1 to about 10.sup.9 M.sup.1, about 10.sup.9 M.sup.1 to about 10.sup.10 M.sup.1, or about 10.sup.10 M.sup.1 to about 10.sup.12 M.sup.1.

[0090] Affinity is calculated as K.sub.d=k.sub.off/k.sub.on (k.sub.off is the dissociation rate constant, K.sub.on is the association rate constant and K.sub.d is the equilibrium constant). Affinity can be determined at equilibrium by measuring the fraction bound (r) of labeled ligand at various concentrations (c). The data are graphed using the Scatchard equation: r/c=K(nr): where r=moles of bound ligand/mole of receptor at equilibrium; c=free ligand concentration at equilibrium; K=equilibrium association constant; and n=number of ligand binding sites per receptor molecule. By graphical analysis, r/c is plotted on the Y-axis versus r on the X-axis, thus producing a Scatchard plot. Antibody affinity measurement by Scatchard analysis is well known in the art. See, e.g., van Erp et al., J. Immunoassay 12: 425-43, 1991; Nelson and Griswold, Comput. Methods Programs Biomed. 27: 65-8, 1988.

[0091] The term epitope refers to an antigenic determinant capable of specific binding to an antibody. Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and nonconformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.

[0092] Numerous publications discuss the use of phage display technology to produce and screen libraries of polypeptides for binding to a selected analyte. See, e.g, Cwirla et al., Proc. Natl. Acad. Sci. USA 87, 6378-82, 1990; Devlin et al., Science 249, 404-6, 1990, Scott and Smith, Science 249, 386-88, 1990; and Ladner et al., U.S. Pat. No. 5,571,698. A basic concept of phage display methods is the establishment of a physical association between DNA encoding a polypeptide to be screened and the polypeptide. This physical association is provided by the phage particle, which displays a polypeptide as part of a capsid enclosing the phage genome which encodes the polypeptide. The establishment of a physical association between polypeptides and their genetic material allows simultaneous mass screening of very large numbers of phage bearing different polypeptides. Phage displaying a polypeptide with affinity to a target bind to the target and these phage are enriched by affinity screening to the target. The identity of polypeptides displayed from these phage can be determined from their respective genomes. Using these methods a polypeptide identified as having a binding affinity for a desired target can then be synthesized in bulk by conventional means. See, e.g., U.S. Pat. No. 6,057,098, which is hereby incorporated in its entirety, including all tables, figures, and claims.

[0093] The antibodies that are generated by these methods may then be selected by first screening for affinity and specificity with the purified polypeptide of interest and, if required, comparing the results to the affinity and specificity of the antibodies with polypeptides that are desired to be excluded from binding. The screening procedure can involve immobilization of the purified polypeptides in separate wells of microtiter plates. The solution containing a potential antibody or groups of antibodies is then placed into the respective microtiter wells and incubated for about 30 min to 2 h. The microtiter wells are then washed and a labeled secondary antibody (for example, an anti-mouse antibody conjugated to alkaline phosphatase if the raised antibodies are mouse antibodies) is added to the wells and incubated for about 30 min and then washed. Substrate is added to the wells and a color reaction will appear where antibody to the immobilized polypeptide(s) are present.

[0094] The antibodies so identified may then be further analyzed for affinity and specificity in the assay design selected. In the development of immunoassays for a target protein, the purified target protein acts as a standard with which to judge the sensitivity and specificity of the immunoassay using the antibodies that have been selected. Because the binding affinity of various antibodies may differ; certain antibody pairs (e.g., in sandwich assays) may interfere with one another sterically, etc., assay performance of an antibody may be a more important measure than absolute affinity and specificity of an antibody.

[0095] Assay Correlations

[0096] The term correlating as used herein in reference to the use of biomarkers refers to comparing the presence or amount of the biomarker(s) in a patient to its presence or amount in persons known to suffer from, or known to be at risk of, a given condition; or in persons known to be free of a given condition. Often, this takes the form of comparing an assay result in the form of a biomarker concentration to a predetermined threshold selected to be indicative of the occurrence or nonoccurrence of a disease or the likelihood of some future outcome.

[0097] Selecting a diagnostic threshold involves, among other things, consideration of the probability of disease, distribution of true and false diagnoses at different test thresholds, and estimates of the consequences of treatment (or a failure to treat) based on the diagnosis. For example, when considering administering a specific therapy which is highly efficacious and has a low level of risk, few tests are needed because clinicians can accept substantial diagnostic uncertainty. On the other hand, in situations where treatment options are less effective and more risky, clinicians often need a higher degree of diagnostic certainty. Thus, cost/benefit analysis is involved in selecting a diagnostic threshold.

[0098] Suitable thresholds may be determined in a variety of ways. For example, one recommended diagnostic threshold for the diagnosis of acute myocardial infarction using cardiac troponin is the 97.5.sup.th percentile of the concentration seen in a normal population. Another method may be to look at serial samples from the same patient, where a prior baseline result is used to monitor for temporal changes in a biomarker level.

[0099] Population studies may also be used to select a decision threshold. Reciever Operating Characteristic (ROC) arose from the field of signal dectection therory developed during World War II for the analysis of radar images, and ROC analysis is often used to select a threshold able to best distinguish a diseased subpopulation from a nondiseased subpopulation. A false positive in this case occurs when the person tests positive, but actually does not have the disease. A false negative, on the other hand, occurs when the person tests negative, suggesting they are healthy, when they actually do have the disease. To draw a ROC curve, the true positive rate (TPR) and false positive rate (FPR) are determined as the decision threshold is varied continuously. Since TPR is equivalent with sensitivity and FPR is equal to 1-specificity, the ROC graph is sometimes called the sensitivity vs (1-specificity) plot. A perfect test will have an area under the ROC curve of 1.0; a random test will have an area of 0.5. A threshold is selected to provide an acceptable level of specificity and sensitivity.

[0100] In this context, diseased is meant to refer to a population having one characteristic (the presence of a disease or condition or the occurrence of some outcome) and nondiseased is meant to refer to a population lacking the characteristic. While a single decision threshold is the simplest application of such a method, multiple decision thresholds may be used. For example, below a first threshold, the absence of disease may be assigned with relatively high confidence, and above a second threshold the presence of disease may also be assigned with relatively high confidence. Between the two thresholds may be considered indeterminate. This is meant to be exemplary in nature only.

[0101] In addition to threshold comparisons, other methods for correlating assay results to a patient classification (occurrence or nonoccurrence of disease, likelihood of an outcome, etc.) include decision trees, rule sets, Bayesian methods, and neural network methods. These methods can produce probability values representing the degree to which a subject belongs to one classification out of a plurality of classifications.

[0102] Measures of test accuracy may be obtained as described in Fischer et al., Intensive Care Med. 29: 1043-51, 2003, and used to determine the effectiveness of a given biomarker. These measures include sensitivity and specificity, predictive values, likelihood ratios, diagnostic odds ratios, and ROC curve areas. The area under the curve (AUC) of a ROC plot is equal to the probability that a classifier will rank a randomly chosen positive instance higher than a randomly chosen negative one. The area under the ROC curve may be thought of as equivalent to the Mann-Whitney U test, which tests for the median difference between scores obtained in the two groups considered if the groups are of continuous data, or to the Wilcoxon test of ranks.

[0103] As discussed above, suitable tests may exhibit one or more of the following results on these various measures: a specificity of greater than 0.5, preferably at least 0.6, more preferably at least 0.7, still more preferably at least 0.8, even more preferably at least 0.9 and most preferably at least 0.95, with a corresponding sensitivity greater than 0.2, preferably greater than 0.3, more preferably greater than 0.4, still more preferably at least 0.5, even more preferably 0.6, yet more preferably greater than 0.7, still more preferably greater than 0.8, more preferably greater than 0.9, and most preferably greater than 0.95; a sensitivity of greater than 0.5, preferably at least 0.6, more preferably at least 0.7, still more preferably at least 0.8, even more preferably at least 0.9 and most preferably at least 0.95, with a corresponding specificity greater than 0.2, preferably greater than 0.3, more preferably greater than 0.4, still more preferably at least 0.5, even more preferably 0.6, yet more preferably greater than 0.7, still more preferably greater than 0.8, more preferably greater than 0.9, and most preferably greater than 0.95; at least 75% sensitivity, combined with at least 75% specificity; a ROC curve area of greater than 0.5, preferably at least 0.6, more preferably 0.7, still more preferably at least 0.8, even more preferably at least 0.9, and most preferably at least 0.95; an odds ratio different from 1, preferably at least about 2 or more or about 0.5 or less, more preferably at least about 3 or more or about 0.33 or less, still more preferably at least about 4 or more or about 0.25 or less, even more preferably at least about 5 or more or about 0.2 or less, and most preferably at least about 10 or more or about 0.1 or less; a positive likelihood ratio (calculated as sensitivity/(1-specificity)) of greater than 1, at least 2, more preferably at least 3, still more preferably at least 5, and most preferably at least 10; and or a negative likelihood ratio (calculated as (1-sensitivity)/specificity) of less than 1, less than or equal to 0.5, more preferably less than or equal to 0.3, and most preferably less than or equal to 0.1

[0104] Additional clinical indicia may be combined with the kidney injury marker assay result(s) of the present invention. These include other biomarkers related to renal status. Examples include the following, which recite the common biomarker name, followed by the Swiss-Prot entry number for that biomarker or its parent: Actin (P68133); Adenosine deaminase binding protein (DPP4, P27487); Alpha-1-acid glycoprotein 1 (P02763); Alpha-1-microglobulin (P02760); Albumin (P02768); Angiotensinogenase (Renin, P00797); Annexin A2 (P07355); Beta-glucuronidase (P08236); B-2-microglobulin (P61769); Beta-galactosidase (P16278); BMP-7 (P18075); Brain natriuretic peptide (proBNP, BNP-32, NTproBNP; P16860); Calcium-binding protein Beta (S100-beta, P04271); Carbonic anhydrase 9 (Q16790); Casein Kinase 2 (P68400); Clusterin (P10909); Complement C3 (P01024); Cysteine-rich protein (CYR61, O00622); Cytochrome C (P99999); Epidermal growth factor (EGF, P01133); Endothelin-1 (P05305); Exosomal Fetuin-A (P02765); Fatty acid-binding protein, heart (FABP3, P05413); Fatty acid-binding protein, liver (P07148); Ferritin (light chain, P02792; heavy chain P02794); Fructose-1,6-biphosphatase (P09467); GRO-alpha (CXCL1, (P09341); Growth Hormone (P01241); Hepatocyte growth factor (P14210); Insulin-like growth factor I (P05019); Immunoglobulin G; Immunoglobulin Light Chains (Kappa and Lambda); Interferon gamma (P01579); Lysozyme (P61626); Interleukin-1alpha (P01583); Interleukin-2 (P60568); Interleukin-4 (P05112); Interleukin-9 (P15248); Interleukin-12p40 (P29460); Interleukin-13 (P35225); Interleukin-16 (Q14005); L1 cell adhesion molecule (P32004); Lactate dehydrogenase (P00338); Leucine Aminopeptidase (P28838); Meprin A-alpha subunit (Q16819); Meprin A-beta subunit (Q16820); Midkine (P21741); MIP2-alpha (CXCL2, P19875); MMP-2 (P08253); MMP-9 (P14780); Netrin-1 (095631); Neutral endopeptidase (P08473); Osteopontin (P10451); Renal papillary antigen 1 (RPA1); Renal papillary antigen 2 (RPA2); Retinol binding protein (P09455); Ribonuclease; S100 calcium-binding protein A6 (P06703); Serum Amyloid P Component (P02743); Sodium/Hydrogen exchanger isoform (NHE3, P48764); Spermidine/spermine N1-acetyltransferase (P21673); TGF-Beta1 (P01137); Transferrin (P02787); Trefoil factor 3 (TFF3, Q07654); Toll-Like protein 4 (000206); Total protein; Tubulointerstitial nephritis antigen (Q9UJW2); Uromodulin (Tamm-Horsfall protein, P07911).

[0105] For purposes of risk stratification, Adiponectin (Q15848); Alkaline phosphatase (P05186); Aminopeptidase N (P15144); CalbindinD28k (P05937); Cystatin C (P01034); 8 subunit of FIFO ATPase (P03928); Gamma-glutamyltransferase (P19440); GSTa (alpha-glutathione-S-transferase, P08263); GSTpi (Glutathione-S-transferase P; GST class-pi; P09211); IGFBP-1 (P08833); IGFBP-2 (P18065); IGFBP-6 (P24592); Integral membrane protein 1 (Itm1, P46977); Interleukin-6 (P05231); Interleukin-8 (P10145); Interleukin-18 (Q14116); IP-10 (10 kDa interferon-gamma-induced protein, P02778); IRPR (IFRD1, O00458); Isovaleryl-CoA dehydrogenase (IVD, P26440); I-TAC/CXCL11 (014625); Keratin 19 (P08727); Kim-1 (Hepatitis A virus cellular receptor 1, Q96D42); L-arginine:glycine amidinotransferase (P50440); Leptin (P41159); Lipocalin2 (NGAL, P80188); MCP-1 (P13500); MIG (Gamma-interferon-induced monokine Q07325); MIP-1a (P10147); MIP-3a (P78556); MIP-1beta (P13236); MIP-1d (Q16663); NAG (N-acetyl-beta-D-glucosaminidase, P54802); Organic ion transporter (OCT2, 015244); Osteoprotegerin (000300); P8 protein (060356); Plasminogen activator inhibitor 1 (PAI-1, P05121); ProANP(1-98) (P01160); Protein phosphatase 1-beta (PPI-beta, P62140); Rab GDI-beta (P50395); Renal kallikrein (P06870); RT1.B-1 (alpha) chain of the integral membrane protein (Q5Y7A8); soluble tumor necrosis factor receptor superfamily member 1A (sTNFR-I, P19438); soluble tumor necrosis factor receptor superfamily member 1B (sTNFR-II, P20333); Tissue inhibitor of metalloproteinases 3 (TIMP-3, P35625); uPAR (Q03405) may be combined with the kidney injury marker assay result(s) of the present invention.

[0106] Other clinical indicia which may be combined with the kidney injury marker assay result(s) of the present invention includes demographic information (e.g., weight, sex, age, race), medical history (e.g., family history, type of surgery, pre-existing disease such as aneurism, congestive heart failure, preeclampsia, eclampsia, diabetes mellitus, hypertension, coronary artery disease, proteinuria, renal insufficiency, or sepsis, type of toxin exposure such as NSAIDs, cyclosporines, tacrolimus, aminoglycosides, foscarnet, ethylene glycol, hemoglobin, myoglobin, ifosfamide, heavy metals, methotrexate, radiopaque contrast agents, or streptozotocin), clinical variables (e.g., blood pressure, temperature, respiration rate), risk scores (APACHE score, PREDICT score, TIMI Risk Score for UA/NSTEMI, Framingham Risk Score), a urine total protein measurement, a glomerular filtration rate, an estimated glomerular filtration rate, a urine production rate, a serum or plasma creatinine concentration, a renal papillary antigen 1 (RPA1) measurement; a renal papillary antigen 2 (RPA2) measurement; a urine creatinine concentration, a fractional excretion of sodium, a urine sodium concentration, a urine creatinine to serum or plasma creatinine ratio, a urine specific gravity, a urine osmolality, a urine urea nitrogen to plasma urea nitrogen ratio, a plasma BUN to creatnine ratio, and/or a renal failure index calculated as urine sodium/(urine creatinine/plasma creatinine). Other measures of renal function which may be combined with the kidney injury marker assay result(s) are described hereinafter and in Harrison's Principles of Internal Medicine, 17.sup.th Ed., McGraw Hill, New York, pages 1741-1830, and Current Medical Diagnosis & Treatment 2008, 47.sup.th Ed, McGraw Hill, New York, pages 785-815, each of which are hereby incorporated by reference in their entirety.

[0107] Combining assay results/clinical indicia in this manner can comprise the use of multivariate logistical regression, loglinear modeling, neural network analysis, n-of-m analysis, decision tree analysis, etc. This list is not meant to be limiting.

[0108] Diagnosis of Acute Renal Failure

[0109] As noted above, the terms acute renal (or kidney) injury and acute renal (or kidney) failure as used herein are defined in part in terms of changes in serum creatinine from a baseline value. Most definitions of ARF have common elements, including the use of serum creatinine and, often, urine output. Patients may present with renal dysfunction without an available baseline measure of renal function for use in this comparison. In such an event, one may estimate a baseline serum creatinine value by assuming the patient initially had a normal GFR. Glomerular filtration rate (GFR) is the volume of fluid filtered from the renal (kidney) glomerular capillaries into the Bowman's capsule per unit time. Glomerular filtration rate (GFR) can be calculated by measuring any chemical that has a steady level in the blood, and is freely filtered but neither reabsorbed nor secreted by the kidneys. GFR is typically expressed in units of ml/min:

[00001] GFR = Urine .Math. .Math. Concentration Urine .Math. .Math. Flow Plasma .Math. .Math. Concentration

[0110] By normalizing the GFR to the body surface area, a GFR of approximately 75-100 ml/min per 1.73 m.sup.2 can be assumed. The rate therefore measured is the quantity of the substance in the urine that originated from a calculable volume of blood.

[0111] There are several different techniques used to calculate or estimate the glomerular filtration rate (GFR or eGFR). In clinical practice, however, creatinine clearance is used to measure GFR. Creatinine is produced naturally by the body (creatinine is a metabolite of creatine, which is found in muscle). It is freely filtered by the glomerulus, but also actively secreted by the renal tubules in very small amounts such that creatinine clearance overestimates actual GFR by 10-20%. This margin of error is acceptable considering the ease with which creatinine clearance is measured.

[0112] Creatinine clearance (CCr) can be calculated if values for creatinine's urine concentration (U.sub.Cr), urine flow rate (V), and creatinine's plasma concentration (P.sub.Cr) are known. Since the product of urine concentration and urine flow rate yields creatinine's excretion rate, creatinine clearance is also said to be its excretion rate (U.sub.CrV) divided by its plasma concentration. This is commonly represented mathematically as:

[00002] C Cr = U Cr V P Cr

[0113] Commonly a 24 hour urine collection is undertaken, from empty-bladder one morning to the contents of the bladder the following morning, with a comparative blood test then taken:

[00003] C Cr = U Cr 24 .Math. - .Math. hour .Math. .Math. volume P Cr 24 60 .Math. mins

[0114] To allow comparison of results between people of different sizes, the CCr is often corrected for the body surface area (BSA) and expressed compared to the average sized man as ml/min/1.73 m2. While most adults have a BSA that approaches 1.7 (1.6-1.9), extremely obese or slim patients should have their CCr corrected for their actual BSA:

[00004] C Cr .Math. - .Math. corrected = C Cr 1.73 BSA

[0115] The accuracy of a creatinine clearance measurement (even when collection is complete) is limited because as glomerular filtration rate (GFR) falls creatinine secretion is increased, and thus the rise in serum creatinine is less. Thus, creatinine excretion is much greater than the filtered load, resulting in a potentially large overestimation of the GFR (as much as a twofold difference). However, for clinical purposes it is important to determine whether renal function is stable or getting worse or better. This is often determined by monitoring serum creatinine alone. Like creatinine clearance, the serum creatinine will not be an accurate reflection of GFR in the non-steady-state condition of ARF. Nonetheless, the degree to which serum creatinine changes from baseline will reflect the change in GFR. Serum creatinine is readily and easily measured and it is specific for renal function.

[0116] For purposes of determining urine output on a Urine output on a mL/kg/hr basis, hourly urine collection and measurement is adequate. In the case where, for example, only a cumulative 24-h output was available and no patient weights are provided, minor modifications of the RIFLE urine output criteria have been described. For example, Bagshaw et al., Nephrol. Dial. Transplant. 23: 1203-1210, 2008, assumes an average patient weight of 70 kg, and patients are assigned a RIFLE classification based on the following: <35 mL/h (Risk), <21 mL/h (Injury) or <4 mL/h (Failure).

[0117] Selecting a Treatment Regimen

[0118] Once a diagnosis is obtained, the clinician can readily select a treatment regimen that is compatible with the diagnosis, such as initiating renal replacement therapy, withdrawing delivery of compounds that are known to be damaging to the kidney, kidney transplantation, delaying or avoiding procedures that are known to be damaging to the kidney, modifying diuretic administration, initiating goal directed therapy, etc. The skilled artisan is aware of appropriate treatments for numerous diseases discussed in relation to the methods of diagnosis described herein. See, e.g., Merck Manual of Diagnosis and Therapy, 17th Ed. Merck Research Laboratories, Whitehouse Station, N J, 1999. In addition, since the methods and compositions described herein provide prognostic information, the markers of the present invention may be used to monitor a course of treatment. For example, improved or worsened prognostic state may indicate that a particular treatment is or is not efficacious.

[0119] One skilled in the art readily appreciates that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those inherent therein. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention.

Example 1: Contrast-Induced Nephropathy Sample Collection

[0120] The objective of this sample collection study is to collect samples of plasma and urine and clinical data from patients before and after receiving intravascular contrast media. Approximately 250 adults undergoing radiographic/angiographic procedures involving intravascular administration of iodinated contrast media are enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

Inclusion Criteria

[0121] males and females 18 years of age or older;
undergoing a radiographic/angiographic procedure (such as a CT scan or coronary intervention) involving the intravascular administration of contrast media;
expected to be hospitalized for at least 48 hours after contrast administration.
able and willing to provide written informed consent for study participation and to comply with all study procedures.

Exclusion Criteria

[0122] renal transplant recipients;
acutely worsening renal function prior to the contrast procedure;
already receiving dialysis (either acute or chronic) or in imminent need of dialysis at enrollment;
expected to undergo a major surgical procedure (such as involving cardiopulmonary bypass) or an additional imaging procedure with contrast media with significant risk for further renal insult within the 48 hrs following contrast administration;
participation in an interventional clinical study with an experimental therapy within the previous 30 days;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus.

[0123] Immediately prior to the first contrast administration (and after any pre-procedure hydration), an EDTA anti-coagulated blood sample (10 mL) and a urine sample (10 mL) are collected from each patient. Blood and urine samples are then collected at 4 (0.5), 8 (1), 24 (2) 48 (2), and 72 (2) hrs following the last administration of contrast media during the index contrast procedure. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are processed to plasma at the clinical site, frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

[0124] Serum creatinine is assessed at the site immediately prior to the first contrast administration (after any pre-procedure hydration) and at 4 (0.5), 8 (1), 24 (2) and 48 (2)), and 72 (2) hours following the last administration of contrast (ideally at the same time as the study samples are obtained). In addition, each patient's status is evaluated through day 30 with regard to additional serum and urine creatinine measurements, a need for dialysis, hospitalization status, and adverse clinical outcomes (including mortality).

[0125] Prior to contrast administration, each patient is assigned a risk based on the following assessment: systolic blood pressure <80 mm Hg=5 points; intra-arterial balloon pump=5 points; congestive heart failure (Class III-IV or history of pulmonary edema)=5 points; age >75 yrs=4 points; hematocrit level <39% for men, <35% for women=3 points; diabetes=3 points; contrast media volume=1 point for each 100 mL; serum creatinine level >1.5 g/dL=4 points OR estimated GFR 40-60 mL/min/1.73 m.sup.2=2 points, 20-40 mL/min/1.73 m.sup.2=4 points, <20 mL/min/1.73 m.sup.2=6 points. The risks assigned are as follows: risk for CIN and dialysis: 5 or less total points=risk of CIN7.5%, risk of dialysis0.04%; 6-10 total points=risk of CIN14%, risk of dialysis0.12%; 11-16 total points=risk of CIN26.1%, risk of dialysis1.09%; >16 total points=risk of CIN57.3%, risk of dialysis12.8%.

Example 2: Cardiac Surgery Sample Collection

[0126] The objective of this sample collection study is to collect samples of plasma and urine and clinical data from patients before and after undergoing cardiovascular surgery, a procedure known to be potentially damaging to kidney function. Approximately 900 adults undergoing such surgery are enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

Inclusion Criteria

[0127] males and females 18 years of age or older;
undergoing cardiovascular surgery;
Toronto/Ottawa Predictive Risk Index for Renal Replacement risk score of at least 2 (Wijeysundera et al., JAMA 297: 1801-9, 2007); and
able and willing to provide written informed consent for study participation and to comply with all study procedures.

Exclusion Criteria

[0128] known pregnancy;
previous renal transplantation;
acutely worsening renal function prior to enrollment (e.g., any category of RIFLE criteria);
already receiving dialysis (either acute or chronic) or in imminent need of dialysis at enrollment;
currently enrolled in another clinical study or expected to be enrolled in another clinical study within 7 days of cardiac surgery that involves drug infusion or a therapeutic intervention for AKI;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus.

[0129] Within 3 hours prior to the first incision (and after any pre-procedure hydration), an EDTA anti-coagulated blood sample (10 mL), whole blood (3 mL), and a urine sample (35 mL) are collected from each patient. Blood and urine samples are then collected at 3 (0.5), 6 (0.5), 12 (1), 24 (2) and 48 (2) hrs following the procedure and then daily on days 3 through 7 if the subject remains in the hospital. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

Example 3: Acutely Ill Subject Sample Collection

[0130] The objective of this study is to collect samples from acutely ill patients. Approximately 2200 adults expected to be in the ICU for at least 48 hours will be enrolled. To be enrolled in the study, each patient must meet all of the following inclusion criteria and none of the following exclusion criteria:

Inclusion Criteria

[0131] males and females 18 years of age or older;
Study population 1: approximately 300 patients that have at least one of:
shock (SBP <90 mmHg and/or need for vasopressor support to maintain MAP >60 mmHg and/or documented drop in SBP of at least 40 mmHg); and
sepsis;
Study population 2: approximately 300 patients that have at least one of:
IV antibiotics ordered in computerized physician order entry (CPOE) within 24 hours of enrollment;
contrast media exposure within 24 hours of enrollment;
increased Intra-Abdominal Pressure with acute decompensated heart failure; and
severe trauma as the primary reason for ICU admission and likely to be hospitalized in the ICU for 48 hours after enrollment;
Study population 3: approximately 300 patients expected to be hospitalized through acute care setting (ICU or ED) with a known risk factor for acute renal injury (e.g. sepsis, hypotension/shock (Shock=systolic BP <90 mmHg and/or the need for vasopressor support to maintain a MAP >60 mmHg and/or a documented drop in SBP >40 mmHg), major trauma, hemorrhage, or major surgery); and/or expected to be hospitalized to the ICU for at least 24 hours after enrollment;
Study population 4: approximately 1000 patients that are 21 years of age or older, within 24 hours of being admitted into the ICU, expected to have an indwelling urinary catheter for at least 48 hours after enrollment, and have at least one of the following acute conditions within 24 hours prior to enrollment:
(i) respiratory SOFA score of 2 (PaO2/FiO2 <300), (ii) cardiovascular SOFA score of 1 (MAP <70 mm Hg and/or any vasopressor required).
Study population 5: approximately 300 patients that are 21 years of age or older, receiving care in the ICU, have an indwelling urinary catheter as standard care at the time of enrollment, have acute kidney injury (KDIGO stage 2 or stage 3) at the time of the first sample collection, and have their first sample collected within 36 hours of meeting KDIGO stage 2 criteria

Exclusion Criteria

[0132] known pregnancy;
prisoners or institutionalized individuals;
previous renal transplantation;
comfort-measures-only status for study population 5;
known acutely worsening renal function prior to enrollment (e.g., any category of RIFLE criteria) for study populations 1, 2, 3, and 4;
received dialysis (either acute or chronic) within 5 days prior to enrollment or in imminent need of dialysis at the time of enrollment;
known infection with human immunodeficiency virus (HIV) or a hepatitis virus;
meets any of the following in study populations 4 and 5: [0133] (i) active bleeding with an anticipated need for >4 units PRBC in a day; [0134] (ii) hemoglobin <7 g/dL; [0135] (iii) any other condition that in the physician's opinion would contraindicate drawing serial blood samples for clinical study purposes;
meets only the SBP <90 mmHg inclusion criterion set forth above, and does not have shock in the attending physician's or principal investigator's opinion.
After obtaining informed consent, an EDTA anti-coagulated blood sample (10 mL) and a urine sample (25-50 mL) are collected from each patient. Blood and urine samples are then collected at 4 (0.5) and 8 (1) hours after contrast administration (if applicable); at 12 (1), 24 (2), 36 (2), 48 (2), 60 (2), 72 (2), and 84 (2) hours after enrollment, and thereafter daily up to day 7 to day 14 while the subject is hospitalized. Blood is collected via direct venipuncture or via other available venous access, such as an existing femoral sheath, central venous line, peripheral intravenous line or hep-lock. These study blood samples are processed to plasma at the clinical site, frozen and shipped to Astute Medical, Inc., San Diego, Calif. The study urine samples are frozen and shipped to Astute Medical, Inc.

Example 4. Immunoassay Format

[0136] Analytes are measured using standard sandwich enzyme immunoassay techniques.

[0137] A first antibody which binds the analyte is immobilized in wells of a 96 well polystyrene microplate. Analyte standards and test samples are pipetted into the appropriate wells and any analyte present is bound by the immobilized antibody. After washing away any unbound substances, a horseradish peroxidase-conjugated second antibody which binds the analyte is added to the wells, thereby forming sandwich complexes with the analyte (if present) and the first antibody. Following a wash to remove any unbound antibody-enzyme reagent, a substrate solution comprising tetramethylbenzidine and hydrogen peroxide is added to the wells. Color develops in proportion to the amount of analyte present in the sample. The color development is stopped and the intensity of the color is measured at 540 nm or 570 nm. An analyte concentration is assigned to the test sample by comparison to a standard curve determined from the analyte standards.

[0138] Table of Swiss-Prot numbers, preferred names and units for the analytes in the examples below.

TABLE-US-00018 Swiss-Prot Number Preferred Name Units Q8NI99 Angiopoietin-related protein ng/ml 6 P01031 Complement C5 ng/ml Q9NSA1 Fibroblast growth factor 21 ng/ml Q9GZV9 Fibroblast growth factor 23 ng/ml Q14005 Pro-interleukin-16 pg/ml Q07325 C-X-C motif chemokine 9, pg/ml Hepatocyte growth factor-like protein P26927 Hepatocyte growth factor-like ng/ml protein O00300 Tumor necrosis factor pg/ml receptor superfamily member 11B

Example 5. Apparently Healthy Donor and Chronic Disease Patient Samples

[0139] Human urine samples from donors with no known chronic or acute disease (Apparently Healthy Donors) were purchased from two vendors (Golden West Biologicals, Inc., 27625 Commerce Center Dr., Temecula, Calif. 92590 and Virginia Medical Research, Inc., 915 First Colonial Rd., Virginia Beach, Va. 23454). The urine samples were shipped and stored frozen at less than 20 C. The vendors supplied demographic information for the individual donors including gender, race (Black/White), smoking status and age.

[0140] Human urine samples from donors with various chronic diseases (Chronic Disease Patients) including congestive heart failure, coronary artery disease, chronic kidney disease, chronic obstructive pulmonary disease, diabetes mellitus and hypertension were purchased from Virginia Medical Research, Inc., 915 First Colonial Rd., Virginia Beach, Va. 23454. The urine samples were shipped and stored frozen at less than 20 degrees centigrade. The vendor provided a case report form for each individual donor with age, gender, race (Black/White), smoking status and alcohol use, height, weight, chronic disease(s) diagnosis, current medications and previous surgeries.

Example 6. Use of Angiopoietin-Related Protein 6 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0141] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Angiopoietin-related protein 6 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0142] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0143] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00019 TABLE 6.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00270 0.00302 0.00270 0.00302 Average 1.25 6.11 0.676 6.08 0.295 6.05 Stdev 3.63 15.9 2.13 15.7 1.24 15.6 p (t-test) 0.15 0.13 0.12 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 15.2 128 8.21 128 5.26 128 n (Patient) 23 108 20 111 18 113 sCr only Median 0.00270 0.00302 0.00302 0.00302 0.00302 0.00302 Average 0.451 6.75 0.467 6.68 0.483 6.62 Stdev 1.75 16.4 1.78 16.4 1.81 16.3 p (t-test) 0.039 0.044 0.050 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 8.21 128 8.21 128 8.21 128 n (Patient) 30 100 29 101 28 102 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.94 4.15 5.18 5.46 3.60 7.15 Stdev 17.0 9.26 16.9 10.9 9.66 18.6 p (t-test) 0.51 0.91 0.17 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 47.1 62.1 128 n (Patient) 83 47 76 54 68 62 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.63 0.69 0.47 0.65 0.68 0.53 0.67 0.66 0.55 SE 0.060 0.051 0.053 0.061 0.052 0.052 0.062 0.054 0.051 p Value 0.025 2.9E4 0.53 0.012 8.4E4 0.57 0.0074 0.0022 0.31 nCohort Recovered 23 30 83 20 29 76 18 28 68 nCohort Non- 108 100 47 111 101 54 113 102 62 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 69% 72% 66% 69% 71% 70% 69% 71% 71% Specificity 48% 50% 33% 50% 48% 36% 50% 46% 37% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 28% 31% 19% 28% 31% 24% 28% 30% 26% Specificity 87% 93% 71% 90% 93% 74% 94% 93% 75% OR Quartile 2 4.62 3.30 0.569 5.44 3.44 0.712 6.14 3.60 0.912 p Value 0.45 0.55 0.78 0.40 0.54 0.87 0.37 0.52 0.96 Lower limit of 95% 0.0893 0.0640 0.0111 0.105 0.0668 0.0139 0.118 0.0698 0.0178 CI Upper limit of 95% 239 170 29.1 282 177 36.5 319 185 46.7 CI OR Quartile 3 2.08 2.57 0.934 2.26 2.32 1.31 2.23 2.08 1.42 p Value 0.12 0.027 0.86 0.097 0.052 0.48 0.12 0.094 0.35 Lower limit of 95% 0.835 1.11 0.438 0.863 0.994 0.618 0.815 0.884 0.680 CI Upper limit of 95% 5.20 5.95 1.99 5.94 5.40 2.77 6.10 4.90 2.97 CI OR Quartile 4 2.56 6.29 0.582 3.49 5.98 0.888 6.72 5.68 1.04 p Value 0.15 0.016 0.22 0.11 0.019 0.77 0.070 0.023 0.92 Lower limit of 95% 0.710 1.41 0.244 0.764 1.34 0.396 0.858 1.27 0.473 CI Upper limit of 95% 9.26 28.1 1.39 15.9 26.7 1.99 52.6 25.4 2.30 CI

TABLE-US-00020 TABLE 6.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00238 0.00302 0.00238 0.00302 0.00238 0.00302 Average 0.479 7.00 0.508 6.85 0.285 6.73 Stdev 1.69 16.7 1.74 16.6 1.11 16.4 p (t-test) 0.023 0.031 0.033 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 8.21 128 8.21 128 5.26 128 n (Patient) 35 96 33 98 30 101 sCr only Median 0.00238 0.00302 0.00238 0.00302 0.00238 0.00302 Average 0.409 7.46 0.420 7.38 0.430 7.30 Stdev 1.57 17.2 1.59 17.1 1.61 17.0 p (t-test) 0.0099 0.012 0.013 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 8.21 128 8.21 128 8.21 128 n (Patient) 41 90 40 91 39 92 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.19 5.53 5.27 5.34 3.87 7.30 Stdev 16.3 10.4 16.7 10.1 10.3 19.2 p (t-test) 0.90 0.98 0.19 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 62.1 128 n (Patient) 89 41 84 46 76 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.73 0.52 0.70 0.72 0.52 0.70 0.72 0.55 SE 0.048 0.044 0.055 0.049 0.045 0.053 0.050 0.046 0.052 p Value 1.6E5 1.2E7 0.78 3.7E5 5.9E7 0.64 6.7E5 2.5E6 0.36 nCohort Recovered 35 41 89 33 40 84 30 39 76 nCohort Non- 96 90 41 98 91 46 101 92 54 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 74% 77% 68% 73% 76% 70% 72% 75% 70% Specificity 54% 56% 34% 55% 55% 35% 53% 54% 36% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 31% 33% 24% 31% 33% 24% 31% 33% 26% Specificity 91% 93% 74% 91% 92% 74% 93% 92% 75% OR Quartile 2 2.72 2.18 0.464 2.94 2.26 0.550 3.33 2.34 0.712 p Value 0.62 0.70 0.70 0.59 0.68 0.77 0.55 0.67 0.87 Lower limit of 95% 0.0529 0.0425 0.00904 0.0572 0.0441 0.0107 0.0647 0.0456 0.0139 CI Upper limit of 95% 140 112 23.8 151 116 28.2 171 120 36.5 CI OR Quartile 3 3.37 4.20 1.10 3.32 3.83 1.21 2.98 3.50 1.31 p Value 0.0031 3.5E4 0.82 0.0041 8.1E4 0.64 0.011 0.0018 0.48 Lower limit of 95% 1.51 1.91 0.496 1.47 1.75 0.557 1.29 1.59 0.618 CI Upper limit of 95% 7.55 9.22 2.42 7.54 8.42 2.61 6.90 7.69 2.77 CI OR Quartile 4 4.85 6.33 0.926 4.41 6.07 0.886 6.20 5.81 1.05 p Value 0.014 0.0039 0.86 0.021 0.0049 0.78 0.017 0.0060 0.90 Lower limit of 95% 1.38 1.81 0.393 1.25 1.73 0.385 1.39 1.65 0.472 CI Upper limit of 95% 17.1 22.2 2.18 15.6 21.3 2.04 27.7 20.4 2.34 CI

TABLE-US-00021 TABLE 6.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.84 7.23 1.92 7.06 1.91 6.84 Stdev 5.91 17.6 6.02 17.4 6.21 17.0 p (t-test) 0.041 0.054 0.071 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 48 83 46 85 42 89 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.82 7.59 1.85 7.50 1.93 7.31 Stdev 5.75 18.0 5.80 17.9 5.90 17.7 p (t-test) 0.026 0.030 0.040 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 53 78 52 79 50 81 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 4.91 6.17 5.14 5.60 3.61 7.82 Stdev 16.2 10.7 16.5 10.4 10.0 19.5 p (t-test) 0.65 0.86 0.11 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 62.1 128 n (Patient) 90 40 86 44 78 52 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.63 0.67 0.56 0.63 0.66 0.53 0.61 0.64 0.55 SE 0.049 0.047 0.055 0.050 0.047 0.054 0.051 0.049 0.052 p Value 0.0062 3.7E4 0.32 0.011 8.9E4 0.58 0.035 0.0043 0.38 nCohort Recovered 48 53 90 46 52 86 42 50 78 nCohort Non- 83 78 40 85 79 44 89 81 52 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 73% 77% 72% 73% 76% 70% 71% 74% 69% Specificity 46% 49% 36% 46% 48% 35% 43% 46% 35% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 31% 32% 28% 31% 32% 25% 30% 31% 29% Specificity 85% 85% 76% 85% 85% 74% 86% 84% 77% OR Quartile 2 1.72 1.47 0.448 1.84 1.51 0.514 2.11 1.61 0.669 p Value 0.79 0.85 0.69 0.76 0.84 0.74 0.71 0.81 0.84 Lower limit of 95% 0.0336 0.0287 0.00873 0.0359 0.0296 0.0100 0.0411 0.0315 0.0131 CI Upper limit of 95% 88.2 75.1 23.0 94.2 77.5 26.4 108 82.6 34.2 CI OR Quartile 3 2.35 3.21 1.45 2.26 2.92 1.28 1.82 2.43 1.19 p Value 0.026 0.0024 0.37 0.033 0.0050 0.54 0.12 0.019 0.65 Lower limit of 95% 1.11 1.51 0.642 1.07 1.38 0.583 0.847 1.15 0.562 CI Upper limit of 95% 4.96 6.82 3.29 4.80 6.19 2.80 3.90 5.13 2.52 CI OR Quartile 4 2.67 2.65 1.17 2.46 2.55 0.970 2.61 2.34 1.35 p Value 0.038 0.032 0.71 0.058 0.040 0.94 0.054 0.061 0.46 Lower limit of 95% 1.06 1.09 0.504 0.971 1.05 0.420 0.985 0.961 0.608 CI Upper limit of 95% 6.74 6.46 2.73 6.21 6.20 2.24 6.93 5.71 3.00 CI

TABLE-US-00022 TABLE 6.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.63 7.80 1.76 7.41 1.78 7.08 Stdev 5.59 18.1 5.80 17.7 6.02 17.3 p (t-test) 0.017 0.031 0.049 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 54 77 50 81 45 86 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.72 7.89 1.75 7.79 1.78 7.69 Stdev 5.60 18.3 5.65 18.2 5.70 18.1 p (t-test) 0.016 0.019 0.022 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 56 75 55 76 54 77 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.02 5.87 5.26 5.36 3.66 7.68 Stdev 16.3 10.5 16.7 10.2 10.1 19.4 p (t-test) 0.76 0.97 0.13 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 62.1 128 n (Patient) 88 42 84 46 77 53 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.67 0.55 0.64 0.66 0.53 0.61 0.65 0.55 SE 0.047 0.047 0.055 0.048 0.047 0.053 0.050 0.047 0.052 p Value 8.1E4 1.8E4 0.32 0.0033 4.7E4 0.57 0.023 0.0011 0.38 nCohort Recovered 54 56 88 50 55 84 45 54 77 nCohort Non- 77 75 42 81 76 46 86 77 53 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 75% 77% 74% 74% 76% 72% 71% 75% 70% Specificity 46% 48% 36% 46% 47% 36% 42% 46% 35% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 34% 33% 26% 32% 33% 24% 31% 32% 28% Specificity 87% 86% 75% 86% 85% 74% 87% 85% 77% OR Quartile 2 1.42 1.34 0.480 1.61 1.38 0.550 1.90 1.42 0.690 p Value 0.86 0.89 0.71 0.81 0.87 0.77 0.75 0.86 0.85 Lower limit of 95% 0.0278 0.0261 0.00937 0.0315 0.0269 0.0107 0.0371 0.0278 0.0135 CI Upper limit of 95% 72.8 68.4 24.6 82.6 70.5 28.2 97.4 72.8 35.3 CI OR Quartile 3 2.63 3.18 1.61 2.43 2.89 1.41 1.78 2.63 1.25 p Value 0.011 0.0026 0.25 0.019 0.0055 0.39 0.13 0.011 0.56 Lower limit of 95% 1.25 1.50 0.714 1.15 1.37 0.645 0.840 1.25 0.590 CI Upper limit of 95% 5.54 6.74 3.63 5.13 6.11 3.08 3.79 5.54 2.64 CI OR Quartile 4 3.42 3.00 1.06 2.90 2.88 0.886 2.97 2.76 1.29 p Value 0.0090 0.015 0.88 0.024 0.020 0.78 0.028 0.025 0.53 Lower limit of 95% 1.36 1.23 0.459 1.15 1.18 0.385 1.12 1.14 0.583 CI Upper limit of 95% 8.62 7.30 2.47 7.32 7.01 2.04 7.87 6.73 2.87 CI

TABLE-US-00023 TABLE 6.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.53 7.96 3.62 7.66 3.62 7.66 Stdev 9.97 19.7 10.1 19.3 10.1 19.3 p (t-test) 0.091 0.12 0.12 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 80 51 78 53 78 53 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.96 8.71 1.96 8.71 1.96 8.71 Stdev 5.60 19.6 5.60 19.6 5.60 19.6 p (t-test) 0.0078 0.0078 0.0078 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 67 64 67 64 67 64 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.59 8.74 3.68 8.35 3.72 8.17 Stdev 9.66 21.3 9.76 20.9 9.81 20.7 p (t-test) 0.060 0.084 0.099 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 87 43 85 45 84 46 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.56 0.65 0.57 0.55 0.65 0.56 0.55 0.65 0.55 SE 0.052 0.048 0.054 0.052 0.048 0.054 0.052 0.048 0.053 p Value 0.24 0.0018 0.18 0.33 0.0018 0.27 0.33 0.0018 0.37 nCohort Recovered 80 67 87 78 67 85 78 67 84 nCohort Non- 51 64 43 53 64 45 53 64 46 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 71% 77% 74% 70% 77% 73% 70% 77% 72% Specificity 36% 43% 37% 36% 43% 36% 36% 43% 36% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 29% 33% 28% 28% 33% 27% 28% 33% 26% Specificity 78% 82% 76% 77% 82% 75% 77% 82% 75% OR Quartile 2 0.640 0.956 0.497 0.682 0.956 0.532 0.682 0.956 0.550 p Value 0.82 0.98 0.73 0.85 0.98 0.75 0.85 0.98 0.77 Lower limit of 95% 0.0125 0.0187 0.00970 0.0133 0.0187 0.0104 0.0133 0.0187 0.0107 CI Upper limit of 95% 32.7 48.9 25.5 34.9 48.9 27.3 34.9 48.9 28.2 CI OR Quartile 3 1.36 2.49 1.69 1.30 2.49 1.58 1.30 2.49 1.41 p Value 0.42 0.018 0.20 0.50 0.018 0.26 0.50 0.018 0.39 Lower limit of 95% 0.641 1.17 0.752 0.614 1.17 0.713 0.614 1.17 0.645 CI Upper limit of 95% 2.90 5.30 3.81 2.73 5.30 3.50 2.73 5.30 3.08 CI OR Quartile 4 1.44 2.24 1.22 1.32 2.24 1.11 1.32 2.24 1.06 p Value 0.38 0.052 0.64 0.50 0.052 0.81 0.50 0.052 0.89 Lower limit of 95% 0.646 0.992 0.532 0.593 0.992 0.486 0.593 0.992 0.465 CI Upper limit of 95% 3.19 5.05 2.78 2.92 5.05 2.53 2.92 5.05 2.41 CI

TABLE-US-00024 TABLE 6.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 196 243 183 243 168 245 Average 226 266 224 265 203 267 Stdev 114 136 122 135 107 135 p (t-test) 0.17 0.19 0.050 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 551 667 551 667 551 667 n (Patient) 25 126 21 130 19 132 sCr only Median 216 228 220 227 211 229 Average 262 259 266 258 259 259 Stdev 134 134 135 134 133 134 p (t-test) 0.90 0.76 0.99 Min 85.4 1.83 85.4 1.83 85.4 1.83 Max 562 667 562 667 562 667 n (Patient) 29 121 28 122 26 124 UO only Median 219 253 211 254 208 253 Average 249 272 244 277 245 272 Stdev 131 136 128 138 130 136 p (t-test) 0.31 0.13 0.21 Min 1.83 22.9 1.83 22.9 64.1 1.83 Max 667 605 667 647 667 647 n (Patient) 91 59 84 66 77 73 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.60 0.51 0.56 0.61 0.49 0.58 0.66 0.51 0.58 SE 0.059 0.060 0.048 0.063 0.060 0.047 0.061 0.062 0.047 p Value 0.11 0.92 0.24 0.081 0.90 0.086 0.0075 0.82 0.088 nCohort Recovered 25 29 91 21 28 84 19 26 77 nCohort Non- 126 121 59 130 122 66 132 124 73 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 76% 74% 78% 76% 74% 79% 77% 74% 79% Specificity 32% 24% 27% 33% 21% 29% 37% 23% 30% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 56% 53% 51% 58% 54% 52% 56% Specificity 64% 55% 54% 67% 54% 56% 74% 58% 56% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 27% 26% 32% 26% 25% 33% 27% 26% 32% Specificity 84% 76% 79% 81% 75% 81% 89% 77% 81% OR Quartile 2 1.51 0.924 1.34 1.60 0.767 1.49 1.90 0.862 1.65 p Value 0.39 0.87 0.46 0.36 0.60 0.31 0.22 0.77 0.19 Lower limit of 95% 0.591 0.360 0.621 0.592 0.285 0.697 0.689 0.318 0.779 CI Upper limit of 95% 3.84 2.37 2.89 4.31 2.06 3.17 5.25 2.34 3.48 CI OR Quartile 3 2.02 1.29 1.48 2.26 1.19 1.72 3.26 1.45 1.62 p Value 0.12 0.54 0.24 0.099 0.68 0.10 0.032 0.39 0.14 Lower limit of 95% 0.830 0.573 0.766 0.857 0.523 0.899 1.11 0.619 0.850 CI Upper limit of 95% 4.91 2.92 2.86 5.97 2.72 3.31 9.57 3.42 3.09 CI OR Quartile 4 1.94 1.08 1.80 1.51 1.02 2.12 3.19 1.16 1.90 p Value 0.25 0.87 0.12 0.49 0.96 0.048 0.13 0.77 0.093 Lower limit of 95% 0.621 0.421 0.855 0.473 0.396 1.01 0.701 0.428 0.898 CI Upper limit of 95% 6.06 2.78 3.79 4.79 2.64 4.49 14.5 3.14 4.02 CI

TABLE-US-00025 TABLE 6.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 186 249 180 249 170 250 Average 234 268 230 268 214 271 Stdev 124 136 124 135 117 135 p (t-test) 0.17 0.13 0.032 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 551 667 551 667 551 667 n (Patient) 40 111 36 115 32 119 sCr only Median 200 245 203 243 196 245 Average 249 264 251 262 243 265 Stdev 126 137 127 137 124 137 p (t-test) 0.54 0.65 0.36 Min 85.4 1.83 85.4 1.83 85.4 1.83 Max 562 667 562 667 562 667 n (Patient) 44 107 43 108 40 111 UO only Median 217 256 213 255 209 255 Average 250 275 249 274 249 271 Stdev 130 139 132 136 133 134 p (t-test) 0.28 0.27 0.32 Min 1.83 22.9 1.83 22.9 64.1 1.83 Max 667 605 667 605 667 605 n (Patient) 100 50 93 57 85 65 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.60 0.55 0.56 0.61 0.54 0.57 0.66 0.57 0.57 SE 0.050 0.051 0.050 0.051 0.051 0.049 0.051 0.052 0.047 p Value 0.047 0.33 0.21 0.029 0.44 0.18 0.0017 0.18 0.12 nCohort Recovered 40 44 100 36 43 93 32 40 85 nCohort Non- 111 107 50 115 108 57 119 111 65 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 78% 77% 78% 78% 76% 77% 79% 77% 78% Specificity 35% 30% 27% 36% 28% 27% 41% 30% 28% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 56% 54% 58% 56% 54% 58% 56% 55% 57% Specificity 65% 59% 54% 67% 58% 55% 72% 62% 55% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 25% 34% 25% 25% 33% 27% 26% 32% Specificity 75% 75% 79% 75% 74% 80% 81% 78% 80% OR Quartile 2 1.95 1.38 1.31 2.03 1.22 1.24 2.57 1.40 1.43 p Value 0.098 0.43 0.51 0.086 0.62 0.58 0.026 0.41 0.35 Lower limit of 95% 0.885 0.626 0.588 0.904 0.549 0.576 1.12 0.626 0.672 CI Upper limit of 95% 4.31 3.02 2.92 4.58 2.71 2.69 5.91 3.14 3.05 CI OR Quartile 3 2.35 1.71 1.62 2.51 1.61 1.67 3.29 2.03 1.63 p Value 0.026 0.14 0.17 0.022 0.19 0.13 0.0061 0.061 0.14 Lower limit of 95% 1.11 0.840 0.817 1.15 0.789 0.858 1.41 0.969 0.852 CI Upper limit of 95% 4.97 3.48 3.22 5.50 3.29 3.25 7.72 4.27 3.13 CI OR Quartile 4 1.01 1.01 1.94 1.01 0.970 1.95 1.59 1.22 1.91 p Value 0.98 0.98 0.087 0.98 0.94 0.080 0.35 0.65 0.088 Lower limit of 95% 0.440 0.450 0.908 0.426 0.431 0.923 0.601 0.518 0.908 CI Upper limit of 95% 2.33 2.28 4.13 2.40 2.18 4.11 4.23 2.86 4.02 CI

TABLE-US-00026 TABLE 6.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 196 252 192 253 180 253 Average 244 267 236 269 228 271 Stdev 134 133 133 133 131 133 p (t-test) 0.31 0.16 0.079 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 667 647 667 647 667 647 n (Patient) 50 101 46 105 40 111 sCr only Median 204 245 204 245 203 247 Average 255 262 254 262 250 264 Stdev 134 133 134 133 132 135 p (t-test) 0.78 0.74 0.56 Min 85.4 1.83 85.4 1.83 85.4 1.83 Max 667 647 667 647 667 647 n (Patient) 54 97 52 99 49 102 UO only Median 225 237 222 249 214 256 Average 253 268 252 269 247 274 Stdev 132 137 132 136 135 131 p (t-test) 0.53 0.45 0.22 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 98 52 94 56 86 64 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.58 0.54 0.54 0.61 0.54 0.54 0.63 0.55 0.58 SE 0.048 0.049 0.050 0.048 0.049 0.049 0.049 0.049 0.047 p Value 0.084 0.43 0.47 0.025 0.40 0.39 0.0061 0.30 0.091 nCohort Recovered 50 54 98 46 52 94 40 49 86 nCohort Non- 101 97 52 105 99 56 111 102 64 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 79% 77% 77% 79% 77% 77% 79% 76% 80% Specificity 34% 30% 27% 35% 29% 27% 38% 29% 29% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 55% 54% 52% 56% 54% 54% 57% 54% 56% Specificity 60% 56% 51% 63% 56% 52% 68% 57% 55% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 25% 33% 26% 25% 32% 27% 26% 33% Specificity 74% 74% 79% 76% 75% 79% 80% 78% 80% OR Quartile 2 1.96 1.44 1.20 2.01 1.34 1.20 2.30 1.30 1.61 p Value 0.081 0.35 0.64 0.074 0.45 0.65 0.039 0.50 0.22 Lower limit of 95% 0.920 0.676 0.549 0.934 0.627 0.554 1.04 0.602 0.747 CI Upper limit of 95% 4.18 3.05 2.64 4.33 2.86 2.59 5.05 2.81 3.46 CI OR Quartile 3 1.87 1.44 1.12 2.19 1.45 1.26 2.73 1.56 1.55 p Value 0.076 0.28 0.73 0.031 0.28 0.50 0.0098 0.20 0.19 Lower limit of 95% 0.938 0.740 0.574 1.07 0.740 0.647 1.27 0.785 0.808 CI Upper limit of 95% 3.72 2.82 2.20 4.46 2.85 2.44 5.83 3.10 2.97 CI OR Quartile 4 0.936 0.939 1.78 1.10 1.01 1.75 1.48 1.24 1.98 p Value 0.87 0.87 0.13 0.81 0.97 0.14 0.38 0.59 0.072 Lower limit of 95% 0.431 0.438 0.838 0.492 0.467 0.830 0.614 0.557 0.942 CI Upper limit of 95% 2.04 2.02 3.79 2.47 2.20 3.70 3.57 2.77 4.17 CI

TABLE-US-00027 TABLE 6.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 196 252 194 254 183 254 Average 245 268 233 274 228 273 Stdev 135 132 128 135 130 133 p (t-test) 0.30 0.071 0.052 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 667 647 667 647 667 647 n (Patient) 58 93 53 98 47 104 sCr only Median 203 249 203 251 203 251 Average 249 266 247 267 247 267 Stdev 132 135 131 135 131 135 p (t-test) 0.46 0.35 0.37 Min 84.8 1.83 84.8 1.83 84.8 1.83 Max 667 647 667 647 667 647 n (Patient) 60 91 59 92 57 94 UO only Median 225 237 217 251 211 256 Average 256 262 250 271 246 275 Stdev 135 131 132 135 135 130 p (t-test) 0.78 0.34 0.19 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 96 54 92 58 86 64 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.58 0.56 0.53 0.62 0.57 0.56 0.64 0.57 0.59 SE 0.047 0.047 0.049 0.047 0.047 0.049 0.047 0.048 0.047 p Value 0.076 0.21 0.61 0.010 0.14 0.24 0.0035 0.15 0.068 nCohort Recovered 58 60 96 53 59 92 47 57 86 nCohort Non- 93 91 54 98 92 58 104 94 64 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 81% 79% 76% 81% 79% 78% 81% 79% 80% Specificity 34% 32% 26% 36% 32% 27% 38% 32% 29% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 56% 55% 52% 57% 55% 55% 58% 55% 58% Specificity 59% 57% 51% 62% 58% 53% 66% 58% 56% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 25% 31% 27% 26% 33% 28% 27% 33% Specificity 74% 75% 78% 77% 76% 79% 81% 77% 80% OR Quartile 2 2.19 1.76 1.11 2.32 1.82 1.29 2.61 1.71 1.61 p Value 0.039 0.14 0.79 0.028 0.11 0.51 0.014 0.16 0.22 Lower limit of 95% 1.04 0.836 0.513 1.10 0.868 0.598 1.21 0.810 0.747 CI Upper limit of 95% 4.63 3.69 2.40 4.93 3.84 2.79 5.60 3.60 3.46 CI OR Quartile 3 1.80 1.59 1.12 2.20 1.69 1.40 2.64 1.70 1.73 p Value 0.084 0.16 0.73 0.024 0.12 0.32 0.0080 0.12 0.100 Lower limit of 95% 0.925 0.827 0.576 1.11 0.874 0.725 1.29 0.876 0.900 CI Upper limit of 95% 3.49 3.08 2.19 4.36 3.27 2.71 5.42 3.31 3.33 CI OR Quartile 4 0.942 1.01 1.64 1.23 1.13 1.87 1.63 1.23 1.98 p Value 0.88 0.97 0.20 0.60 0.74 0.099 0.25 0.60 0.072 Lower limit of 95% 0.443 0.479 0.774 0.563 0.531 0.888 0.702 0.568 0.942 CI Upper limit of 95% 2.00 2.15 3.48 2.70 2.42 3.94 3.80 2.65 4.17 CI

TABLE-US-00028 TABLE 6.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 219 247 217 249 217 249 Average 257 262 253 266 253 266 Stdev 136 132 132 136 132 136 p (t-test) 0.83 0.56 0.56 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 81 70 80 71 80 71 sCr only Median 206 253 203 254 203 254 Average 254 263 251 266 251 266 Stdev 138 130 139 129 139 129 p (t-test) 0.67 0.49 0.49 Min 84.8 1.83 84.8 1.83 84.8 1.83 Max 667 619 667 619 667 619 n (Patient) 67 84 65 86 65 86 UO only Median 220 249 219 253 219 253 Average 255 264 252 269 252 268 Stdev 134 132 132 136 133 134 p (t-test) 0.68 0.43 0.46 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 95 55 93 57 91 59 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.52 0.55 0.54 0.54 0.57 0.55 0.54 0.57 0.55 SE 0.047 0.047 0.049 0.047 0.047 0.049 0.047 0.047 0.048 p Value 0.60 0.25 0.46 0.44 0.13 0.29 0.44 0.13 0.28 nCohort Recovered 81 67 95 80 65 93 80 65 91 nCohort Non- 70 84 55 71 86 57 71 86 59 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 77% 79% 76% 77% 79% 77% 77% 79% 78% Specificity 27% 30% 26% 28% 31% 27% 28% 31% 27% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 54% 56% 55% 55% 57% 56% 55% 57% 56% Specificity 53% 57% 53% 54% 58% 54% 54% 58% 54% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 26% 26% 33% 27% 27% 33% 27% 27% 32% Specificity 75% 76% 79% 76% 77% 80% 76% 77% 79% OR Quartile 2 1.26 1.56 1.15 1.30 1.68 1.24 1.30 1.68 1.34 p Value 0.54 0.24 0.72 0.48 0.17 0.58 0.48 0.17 0.46 Lower limit of 95% 0.599 0.746 0.533 0.621 0.801 0.576 0.621 0.801 0.621 CI Upper limit of 95% 2.64 3.27 2.50 2.74 3.52 2.69 2.74 3.52 2.89 CI OR Quartile 3 1.34 1.66 1.33 1.42 1.86 1.49 1.42 1.86 1.48 p Value 0.37 0.12 0.40 0.29 0.061 0.24 0.29 0.061 0.24 Lower limit of 95% 0.707 0.871 0.685 0.746 0.971 0.767 0.746 0.971 0.766 CI Upper limit of 95% 2.55 3.18 2.60 2.69 3.58 2.89 2.69 3.58 2.86 CI OR Quartile 4 1.06 1.13 1.82 1.17 1.22 1.95 1.17 1.22 1.80 p Value 0.89 0.75 0.12 0.67 0.61 0.080 0.67 0.61 0.12 Lower limit of 95% 0.506 0.538 0.863 0.562 0.575 0.923 0.562 0.575 0.855 CI Upper limit of 95% 2.20 2.38 3.86 2.45 2.57 4.11 2.45 2.57 3.79 CI

Example 7. Use of Angiopoietin-Related Protein 6 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0144] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Angiopoietin-related protein 6 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0145] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0146] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00029 TABLE 7.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.48 6.76 2.48 6.76 2.59 6.61 Stdev 6.53 17.4 6.53 17.4 6.65 17.2 p (t-test) 0.11 0.11 0.14 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 46 85 46 85 44 87 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.11 7.56 2.11 7.56 2.19 7.37 Stdev 6.08 18.2 6.08 18.2 6.18 18.0 p (t-test) 0.036 0.036 0.048 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 54 76 54 76 52 78 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.67 4.35 5.59 4.68 5.65 4.65 Stdev 16.4 8.97 16.6 9.67 16.9 9.50 p (t-test) 0.65 0.74 0.71 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 93 37 88 42 84 46 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.61 0.66 0.44 0.61 0.66 0.47 0.59 0.64 0.47 SE 0.050 0.047 0.057 0.050 0.047 0.055 0.051 0.048 0.053 p Value 0.022 5.1E4 0.30 0.022 5.1E4 0.58 0.066 0.0027 0.63 nCohort Recovered 46 54 93 46 54 88 44 52 84 nCohort Non- 85 76 37 85 76 42 87 78 46 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 73% 78% 57% 73% 78% 62% 71% 76% 63% Specificity 46% 48% 29% 46% 48% 31% 43% 46% 31% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 28% 32% 22% 28% 32% 21% 28% 31% 22% Specificity 80% 83% 73% 80% 83% 73% 80% 83% 73% OR Quartile 2 1.84 1.40 0.401 1.84 1.40 0.480 1.97 1.50 0.550 p Value 0.76 0.87 0.65 0.76 0.87 0.71 0.74 0.84 0.77 Lower limit of 95% 0.0359 0.0274 0.00781 0.0359 0.0274 0.00937 0.0384 0.0292 0.0107 CI Upper limit of 95% 94.2 71.8 20.6 94.2 71.8 24.6 101 76.5 28.2 CI OR Quartile 3 2.26 3.22 0.537 2.26 3.22 0.719 1.88 2.66 0.765 p Value 0.033 0.0025 0.12 0.033 0.0025 0.40 0.10 0.011 0.49 Lower limit of 95% 1.07 1.51 0.244 1.07 1.51 0.333 0.885 1.26 0.359 CI Upper limit of 95% 4.80 6.88 1.18 4.80 6.88 1.55 4.01 5.64 1.63 CI OR Quartile 4 1.62 2.31 0.750 1.62 2.31 0.727 1.48 2.12 0.737 p Value 0.28 0.058 0.53 0.28 0.058 0.47 0.38 0.088 0.48 Lower limit of 95% 0.679 0.973 0.303 0.679 0.973 0.304 0.620 0.895 0.315 CI Upper limit of 95% 3.85 5.47 1.86 3.85 5.47 1.74 3.54 5.04 1.72 CI

TABLE-US-00030 TABLE 7.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.28 7.55 2.28 7.55 2.36 7.35 Stdev 6.06 18.4 6.06 18.4 6.16 18.2 p (t-test) 0.040 0.040 0.054 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 57 74 57 74 55 76 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.06 8.21 2.06 8.21 2.13 7.98 Stdev 5.80 19.1 5.80 19.1 5.89 18.9 p (t-test) 0.016 0.016 0.022 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 63 68 63 68 61 70 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.07 5.88 5.17 5.61 5.32 5.24 Stdev 15.9 10.9 16.1 10.7 16.6 10.2 p (t-test) 0.78 0.88 0.98 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 94 36 92 38 86 44 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.61 0.65 0.51 0.61 0.65 0.52 0.59 0.63 0.50 SE 0.049 0.048 0.057 0.049 0.048 0.056 0.050 0.048 0.054 p Value 0.026 0.0020 0.81 0.026 0.0020 0.70 0.072 0.0085 1.00 nCohort Recovered 57 63 94 57 63 92 55 61 86 nCohort Non- 74 68 36 74 68 38 76 70 44 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 73% 76% 67% 73% 76% 68% 71% 74% 66% Specificity 42% 44% 33% 42% 44% 34% 40% 43% 33% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 30% 32% 25% 30% 32% 24% 29% 31% 23% Specificity 81% 83% 74% 81% 83% 74% 80% 82% 73% OR Quartile 2 1.30 1.08 0.386 1.30 1.08 0.416 1.38 1.15 0.514 p Value 0.90 0.97 0.64 0.90 0.97 0.66 0.87 0.95 0.74 Lower limit of 95% 0.0253 0.0211 0.00752 0.0253 0.0211 0.00811 0.0269 0.0224 0.0100 CI Upper limit of 95% 66.3 55.2 19.8 66.3 55.2 21.4 70.5 58.6 26.4 CI OR Quartile 3 1.96 2.60 0.984 1.96 2.60 1.10 1.64 2.15 0.933 p Value 0.072 0.012 0.97 0.072 0.012 0.82 0.19 0.043 0.86 Lower limit of 95% 0.942 1.23 0.435 0.942 1.23 0.490 0.786 1.03 0.432 CI Upper limit of 95% 4.09 5.50 2.22 4.09 5.50 2.47 3.40 4.49 2.01 CI OR Quartile 4 1.77 2.26 0.972 1.77 2.26 0.879 1.63 2.08 0.806 p Value 0.18 0.053 0.95 0.18 0.053 0.77 0.25 0.081 0.62 Lower limit of 95% 0.775 0.990 0.401 0.775 0.990 0.364 0.713 0.913 0.344 CI Upper limit of 95% 4.04 5.16 2.36 4.04 5.16 2.12 3.72 4.75 1.89 CI

TABLE-US-00031 TABLE 7.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.05 8.31 2.05 8.31 2.12 8.07 Stdev 5.76 19.2 5.76 19.2 5.84 19.0 p (t-test) 0.014 0.014 0.019 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 64 67 64 67 62 69 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.97 8.59 1.97 8.59 2.00 8.46 Stdev 5.68 19.5 5.68 19.5 5.72 19.4 p (t-test) 0.0090 0.0090 0.011 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 66 65 66 65 65 66 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 4.70 6.85 4.70 6.85 5.02 5.87 Stdev 15.8 11.1 15.8 11.1 16.3 10.5 p (t-test) 0.46 0.46 0.76 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 94 36 94 36 88 42 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.62 0.65 0.58 0.62 0.65 0.58 0.60 0.64 0.53 SE 0.049 0.048 0.057 0.049 0.048 0.057 0.049 0.048 0.055 p Value 0.014 0.0024 0.15 0.014 0.0024 0.15 0.044 0.0050 0.58 nCohort Recovered 64 66 94 64 66 94 62 65 88 nCohort Non- 67 65 36 67 65 36 69 66 42 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 73% 75% 75% 73% 75% 75% 71% 74% 69% Specificity 41% 42% 36% 41% 42% 36% 39% 42% 34% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 33% 34% 31% 33% 34% 31% 32% 33% 26% Specificity 83% 83% 77% 83% 83% 77% 82% 83% 75% OR Quartile 2 1.05 0.985 0.386 1.05 0.985 0.386 1.11 1.02 0.480 p Value 0.98 0.99 0.64 0.98 0.99 0.64 0.96 0.99 0.71 Lower limit of 95% 0.0205 0.0193 0.00752 0.0205 0.0193 0.00752 0.0217 0.0198 0.00937 CI Upper limit of 95% 53.5 50.4 19.8 53.5 50.4 19.8 56.9 51.9 24.6 CI OR Quartile 3 1.86 2.26 1.70 1.86 2.26 1.70 1.55 2.05 1.15 p Value 0.097 0.033 0.23 0.097 0.033 0.23 0.24 0.058 0.72 Lower limit of 95% 0.893 1.07 0.717 0.893 1.07 0.717 0.746 0.977 0.524 CI Upper limit of 95% 3.89 4.76 4.03 3.89 4.76 4.03 3.21 4.29 2.54 CI OR Quartile 4 2.36 2.56 1.44 2.36 2.56 1.44 2.17 2.45 1.06 p Value 0.042 0.026 0.40 0.042 0.026 0.40 0.066 0.033 0.88 Lower limit of 95% 1.03 1.12 0.612 1.03 1.12 0.612 0.951 1.07 0.459 CI Upper limit of 95% 5.38 5.85 3.39 5.38 5.85 3.39 4.95 5.61 2.47 CI

TABLE-US-00032 TABLE 7.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.01 8.76 2.04 8.62 2.10 8.36 Stdev 5.61 19.8 5.65 19.6 5.73 19.4 p (t-test) 0.0078 0.0095 0.014 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 68 63 67 64 65 66 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.96 8.92 1.96 8.92 1.99 8.78 Stdev 5.58 19.9 5.58 19.9 5.62 19.7 p (t-test) 0.0060 0.0060 0.0074 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 69 62 69 62 68 63 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 4.91 6.17 4.97 6.01 5.14 5.60 Stdev 16.2 10.7 16.2 10.6 16.5 10.4 p (t-test) 0.65 0.71 0.86 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 90 40 89 41 86 44 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.64 0.56 0.61 0.64 0.55 0.59 0.63 0.52 SE 0.049 0.049 0.055 0.049 0.049 0.055 0.050 0.049 0.054 p Value 0.026 0.0049 0.32 0.026 0.0049 0.32 0.071 0.0097 0.74 nCohort Recovered 68 69 90 67 69 89 65 68 86 nCohort Non- 63 62 40 64 62 41 66 63 44 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 71% 74% 72% 72% 74% 73% 70% 73% 68% Specificity 38% 41% 36% 39% 41% 36% 37% 40% 34% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 33% 34% 28% 33% 34% 27% 32% 33% 25% Specificity 82% 83% 76% 82% 83% 75% 82% 82% 74% OR Quartile 2 0.927 0.899 0.448 0.956 0.899 0.464 1.02 0.927 0.514 p Value 0.97 0.96 0.69 0.98 0.96 0.70 0.99 0.97 0.74 Lower limit of 95% 0.0181 0.0176 0.00873 0.0187 0.0176 0.00904 0.0198 0.0181 0.0100 CI Upper limit of 95% 47.4 46.0 23.0 48.9 46.0 23.8 51.9 47.4 26.4 CI OR Quartile 3 1.55 1.96 1.45 1.62 1.96 1.53 1.35 1.78 1.09 p Value 0.24 0.076 0.37 0.20 0.076 0.31 0.42 0.13 0.83 Lower limit of 95% 0.743 0.932 0.642 0.778 0.932 0.678 0.650 0.851 0.502 CI Upper limit of 95% 3.22 4.13 3.29 3.38 4.13 3.46 2.79 3.73 2.37 CI OR Quartile 4 2.33 2.43 1.17 2.24 2.43 1.12 2.06 2.33 0.970 p Value 0.041 0.032 0.71 0.052 0.032 0.80 0.081 0.041 0.94 Lower limit of 95% 1.03 1.08 0.504 0.992 1.08 0.481 0.914 1.03 0.420 CI Upper limit of 95% 5.27 5.50 2.73 5.05 5.50 2.59 4.65 5.27 2.24 CI

TABLE-US-00033 TABLE 7.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.32 9.22 3.36 9.01 3.39 8.81 Stdev 9.57 21.2 9.62 21.0 9.67 20.8 p (t-test) 0.029 0.036 0.044 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 88 43 87 44 86 45 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.96 10.1 1.96 10.1 1.96 10.1 Stdev 5.33 21.3 5.33 21.3 5.33 21.3 p (t-test) 0.0015 0.0015 0.0015 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 78 53 78 53 78 53 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.47 9.40 3.51 9.17 3.55 8.95 Stdev 9.52 21.9 9.57 21.7 9.61 21.5 p (t-test) 0.033 0.041 0.050 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 90 40 89 41 88 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.64 0.57 0.59 0.64 0.57 0.57 0.64 0.56 SE 0.054 0.050 0.055 0.054 0.050 0.055 0.053 0.050 0.055 p Value 0.11 0.0039 0.18 0.11 0.0039 0.18 0.17 0.0039 0.27 nCohort Recovered 88 78 90 87 78 89 86 78 88 nCohort Non- 43 53 40 44 53 41 45 53 42 recovered Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 72% 75% 72% 73% 75% 73% 71% 75% 71% Specificity 36% 40% 36% 37% 40% 36% 36% 40% 35% Cutoff Quartile 4 3.17 3.17 3.19 3.17 3.17 3.19 3.17 3.17 3.19 Sensitivity 33% 34% 30% 32% 34% 29% 31% 34% 29% Specificity 78% 81% 77% 78% 81% 76% 78% 81% 76% OR Quartile 2 0.492 0.682 0.448 0.509 0.682 0.464 0.526 0.682 0.480 p Value 0.72 0.85 0.69 0.74 0.85 0.70 0.75 0.85 0.71 Lower limit of 95% 0.00959 0.0133 0.00873 0.00992 0.0133 0.00904 0.0103 0.0133 0.00937 CI Upper limit of 95% 25.2 34.9 23.0 26.1 34.9 23.8 26.9 34.9 24.6 CI OR Quartile 3 1.48 2.03 1.45 1.55 2.03 1.53 1.39 2.03 1.36 p Value 0.34 0.073 0.37 0.28 0.073 0.31 0.41 0.073 0.45 Lower limit of 95% 0.666 0.937 0.642 0.701 0.937 0.678 0.636 0.937 0.611 CI Upper limit of 95% 3.27 4.40 3.29 3.43 4.40 3.46 3.03 4.40 3.03 CI OR Quartile 4 1.75 2.16 1.41 1.67 2.16 1.34 1.59 2.16 1.28 p Value 0.18 0.059 0.42 0.22 0.059 0.49 0.26 0.059 0.56 Lower limit of 95% 0.776 0.970 0.611 0.741 0.970 0.583 0.708 0.970 0.557 CI Upper limit of 95% 3.96 4.81 3.24 3.77 4.81 3.08 3.58 4.81 2.93 CI

TABLE-US-00034 TABLE 7.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 245 209 245 208 245 Average 256 261 256 261 251 263 Stdev 128 136 130 136 126 137 p (t-test) 0.83 0.83 0.63 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 647 667 647 667 647 667 n (Patient) 49 102 48 103 46 105 sCr only Median 225 227 225 227 225 228 Average 272 253 272 253 267 255 Stdev 133 135 133 135 129 137 p (t-test) 0.41 0.41 0.62 Min 85.4 1.83 85.4 1.83 85.4 1.83 Max 647 667 647 667 647 667 n (Patient) 52 98 52 98 51 99 UO only Median 220 254 216 255 219 250 Average 255 266 251 272 254 264 Stdev 132 136 131 137 134 133 p (t-test) 0.64 0.35 0.66 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 597 667 605 667 605 n (Patient) 104 46 97 53 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.52 0.47 0.53 0.52 0.47 0.56 0.53 0.48 0.53 SE 0.050 0.049 0.052 0.050 0.049 0.050 0.051 0.050 0.049 p Value 0.72 0.48 0.52 0.69 0.48 0.26 0.53 0.66 0.52 nCohort Recovered 49 52 104 48 52 97 46 51 91 nCohort Non- 102 98 46 103 98 53 105 99 59 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 75% 72% 76% 75% 72% 77% 75% 73% 76% Specificity 24% 21% 26% 25% 21% 27% 26% 22% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 50% 57% 53% 50% 58% 53% 51% 54% Specificity 55% 50% 53% 56% 50% 55% 57% 51% 53% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 24% 30% 25% 24% 32% 26% 25% 29% Specificity 76% 73% 77% 75% 73% 78% 76% 75% 77% OR Quartile 2 0.948 0.706 1.12 0.987 0.706 1.25 1.07 0.733 1.15 p Value 0.89 0.39 0.79 0.97 0.39 0.58 0.86 0.45 0.72 Lower limit of 95% 0.431 0.317 0.498 0.448 0.317 0.571 0.485 0.329 0.539 CI Upper limit of 95% 2.09 1.57 2.50 2.18 1.57 2.74 2.37 1.63 2.46 CI OR Quartile 3 1.38 1.00 1.46 1.47 1.00 1.70 1.49 1.06 1.32 p Value 0.36 1.0 0.29 0.27 1.0 0.13 0.27 0.86 0.40 Lower limit of 95% 0.697 0.510 0.726 0.739 0.510 0.862 0.739 0.540 0.686 CI Upper limit of 95% 2.74 1.96 2.93 2.94 1.96 3.34 2.99 2.09 2.55 CI OR Quartile 4 1.05 0.880 1.46 1.01 0.880 1.71 1.10 0.988 1.35 p Value 0.89 0.74 0.34 0.97 0.74 0.16 0.81 0.97 0.43 Lower limit of 95% 0.479 0.409 0.671 0.460 0.409 0.805 0.492 0.455 0.640 CI Upper limit of 95% 2.32 1.89 3.17 2.23 1.89 3.63 2.47 2.15 2.84 CI

TABLE-US-00035 TABLE 7.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 214 245 214 245 214 245 Average 257 261 257 261 254 263 Stdev 135 133 135 133 133 135 p (t-test) 0.86 0.86 0.66 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 667 619 667 619 667 619 n (Patient) 64 87 64 87 62 89 sCr only Median 225 237 225 237 220 245 Average 263 256 263 256 260 259 Stdev 136 132 136 132 133 134 p (t-test) 0.73 0.73 0.99 Min 85.4 1.83 85.4 1.83 85.4 1.83 Max 667 619 667 619 667 619 n (Patient) 67 84 67 84 66 85 UO only Median 219 255 219 255 219 253 Average 253 270 253 270 255 265 Stdev 131 140 131 138 135 132 p (t-test) 0.47 0.45 0.66 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 105 45 103 47 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.53 0.50 0.54 0.53 0.50 0.55 0.54 0.51 0.54 SE 0.047 0.047 0.052 0.047 0.047 0.051 0.048 0.047 0.049 p Value 0.58 0.97 0.40 0.58 0.97 0.34 0.45 0.77 0.46 nCohort Recovered 64 67 105 64 67 103 62 66 95 nCohort Non- 87 84 45 87 84 47 89 85 55 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 77% 76% 76% 77% 76% 77% 78% 76% 76% Specificity 28% 27% 26% 28% 27% 26% 29% 27% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 58% 53% 51% 57% 53% 52% 55% Specificity 53% 51% 53% 53% 51% 53% 53% 52% 53% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 25% 33% 25% 25% 34% 26% 26% 31% Specificity 75% 75% 78% 75% 75% 79% 76% 76% 78% OR Quartile 2 1.31 1.18 1.07 1.31 1.18 1.16 1.41 1.22 1.15 p Value 0.47 0.67 0.87 0.47 0.67 0.71 0.36 0.60 0.72 Lower limit of 95% 0.626 0.562 0.477 0.626 0.562 0.520 0.673 0.583 0.533 CI Upper limit of 95% 2.75 2.46 2.40 2.75 2.46 2.60 2.96 2.55 2.50 CI OR Quartile 3 1.27 1.08 1.56 1.27 1.08 1.55 1.27 1.14 1.33 p Value 0.47 0.81 0.21 0.47 0.81 0.22 0.47 0.69 0.40 Lower limit of 95% 0.666 0.569 0.773 0.666 0.569 0.771 0.665 0.599 0.685 CI Upper limit of 95% 2.43 2.05 3.16 2.43 2.05 3.10 2.44 2.17 2.60 CI OR Quartile 4 1.02 0.980 1.78 1.02 0.980 1.90 1.09 1.09 1.58 p Value 0.97 0.96 0.14 0.97 0.96 0.10 0.82 0.82 0.23 Lower limit of 95% 0.482 0.468 0.823 0.482 0.468 0.884 0.516 0.519 0.745 CI Upper limit of 95% 2.14 2.05 3.86 2.14 2.05 4.09 2.31 2.29 3.34 CI

TABLE-US-00036 TABLE 7.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 247 211 249 211 249 Average 254 264 254 264 250 267 Stdev 136 132 137 131 133 134 p (t-test) 0.64 0.64 0.44 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 667 619 667 619 667 619 n (Patient) 73 78 72 79 70 81 sCr only Median 214 245 214 245 214 245 Average 255 263 255 263 255 263 Stdev 134 134 134 134 134 134 p (t-test) 0.72 0.72 0.72 Min 84.8 1.83 84.8 1.83 84.8 1.83 Max 667 619 667 619 667 619 n (Patient) 74 77 74 77 74 77 UO only Median 225 245 225 228 225 237 Average 256 263 257 260 256 263 Stdev 134 133 135 131 134 133 p (t-test) 0.77 0.90 0.76 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 105 45 103 47 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.55 0.54 0.53 0.55 0.54 0.52 0.56 0.54 0.52 SE 0.047 0.047 0.052 0.047 0.047 0.051 0.047 0.047 0.049 p Value 0.33 0.41 0.58 0.31 0.41 0.70 0.22 0.41 0.64 nCohort Recovered 73 74 105 72 74 103 70 74 96 nCohort Non- 78 77 45 79 77 47 81 77 54 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 79% 79% 76% 80% 79% 77% 80% 79% 76% Specificity 30% 30% 26% 31% 30% 26% 31% 30% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 54% 53% 53% 54% 53% 51% 54% 53% 52% Specificity 53% 53% 51% 54% 53% 50% 54% 53% 51% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 27% 27% 33% 27% 27% 32% 27% 27% 31% Specificity 77% 77% 78% 76% 77% 78% 77% 77% 78% OR Quartile 2 1.67 1.61 1.07 1.73 1.61 1.16 1.86 1.61 1.11 p Value 0.18 0.21 0.87 0.15 0.21 0.71 0.10 0.21 0.79 Lower limit of 95% 0.795 0.768 0.477 0.824 0.768 0.520 0.885 0.768 0.513 CI Upper limit of 95% 3.51 3.39 2.40 3.64 3.39 2.60 3.92 3.39 2.40 CI OR Quartile 3 1.34 1.27 1.21 1.41 1.27 1.06 1.41 1.27 1.12 p Value 0.37 0.47 0.59 0.29 0.47 0.86 0.29 0.47 0.73 Lower limit of 95% 0.706 0.670 0.601 0.744 0.670 0.534 0.743 0.670 0.576 CI Upper limit of 95% 2.54 2.40 2.44 2.68 2.40 2.12 2.68 2.40 2.19 CI OR Quartile 4 1.21 1.26 1.78 1.17 1.26 1.63 1.26 1.26 1.64 p Value 0.61 0.54 0.14 0.67 0.54 0.21 0.54 0.54 0.20 Lower limit of 95% 0.580 0.601 0.823 0.560 0.601 0.756 0.599 0.601 0.774 CI Upper limit of 95% 2.54 2.63 3.86 2.45 2.63 3.52 2.64 2.63 3.48 CI

TABLE-US-00037 TABLE 7.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 220 249 216 251 216 251 Average 254 265 254 265 250 268 Stdev 133 134 134 133 131 136 p (t-test) 0.62 0.62 0.42 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 667 619 667 619 667 619 n (Patient) 76 75 75 76 73 78 sCr only Median 225 247 225 247 225 247 Average 257 262 257 262 257 262 Stdev 131 137 131 137 131 137 p (t-test) 0.80 0.80 0.80 Min 84.8 1.83 84.8 1.83 84.8 1.83 Max 667 619 667 619 667 619 n (Patient) 77 74 77 74 77 74 UO only Median 225 237 225 237 225 245 Average 257 261 257 261 256 263 Stdev 135 130 135 130 135 132 p (t-test) 0.87 0.87 0.74 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 100 50 100 50 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.54 0.52 0.52 0.54 0.52 0.52 0.55 0.52 0.53 SE 0.047 0.047 0.050 0.047 0.047 0.050 0.047 0.047 0.049 p Value 0.39 0.63 0.65 0.36 0.63 0.65 0.26 0.63 0.57 nCohort Recovered 76 77 100 75 77 100 73 77 95 nCohort Non- 75 74 50 76 74 50 78 74 55 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 79% 77% 76% 79% 77% 76% 79% 77% 76% Specificity 29% 27% 26% 29% 27% 26% 30% 27% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 52% 54% 51% 52% 54% 51% 53% Specificity 53% 51% 51% 53% 51% 51% 53% 51% 52% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 28% 28% 32% 28% 28% 32% 28% 28% 31% Specificity 78% 78% 78% 77% 78% 78% 78% 78% 78% OR Quartile 2 1.50 1.26 1.11 1.56 1.26 1.11 1.67 1.26 1.15 p Value 0.28 0.54 0.79 0.24 0.54 0.79 0.18 0.54 0.72 Lower limit of 95% 0.715 0.601 0.506 0.741 0.601 0.506 0.795 0.601 0.533 CI Upper limit of 95% 3.16 2.63 2.45 3.27 2.63 2.45 3.51 2.63 2.50 CI OR Quartile 3 1.27 1.08 1.13 1.34 1.08 1.13 1.34 1.08 1.19 p Value 0.46 0.81 0.73 0.37 0.81 0.73 0.37 0.81 0.61 Lower limit of 95% 0.670 0.572 0.572 0.706 0.572 0.572 0.706 0.572 0.611 CI Upper limit of 95% 2.41 2.05 2.22 2.54 2.05 2.22 2.54 2.05 2.31 CI OR Quartile 4 1.35 1.40 1.67 1.30 1.40 1.67 1.40 1.40 1.58 p Value 0.43 0.37 0.19 0.48 0.37 0.19 0.37 0.37 0.23 Lower limit of 95% 0.645 0.668 0.781 0.623 0.668 0.781 0.666 0.668 0.745 CI Upper limit of 95% 2.82 2.93 3.57 2.73 2.93 3.57 2.94 2.93 3.34 CI

TABLE-US-00038 TABLE 7.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 225 247 222 249 220 251 Average 255 265 255 265 252 269 Stdev 130 139 131 138 127 142 p (t-test) 0.67 0.67 0.43 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 89 62 88 63 87 64 sCr only Median 225 247 225 247 225 247 Average 255 264 255 264 255 264 Stdev 129 139 129 139 129 139 p (t-test) 0.68 0.68 0.68 Min 84.8 1.83 84.8 1.83 84.8 1.83 Max 667 619 667 619 667 619 n (Patient) 79 72 79 72 79 72 UO only Median 222 247 222 247 219 251 Average 257 261 257 261 254 267 Stdev 135 131 135 131 133 135 p (t-test) 0.85 0.85 0.57 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 98 52 98 52 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.52 0.53 0.53 0.52 0.53 0.53 0.54 0.53 0.54 SE 0.048 0.047 0.050 0.048 0.047 0.050 0.048 0.047 0.049 p Value 0.66 0.58 0.58 0.62 0.58 0.58 0.45 0.58 0.39 nCohort Recovered 89 79 98 88 79 98 87 79 96 nCohort Non- 62 72 52 63 72 52 64 72 54 recovered Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 76% 76% 77% 76% 76% 77% 77% 76% 78% Specificity 26% 27% 27% 26% 27% 27% 26% 27% 27% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 53% 54% 54% 53% 54% 55% 53% 56% Specificity 52% 52% 52% 52% 52% 52% 53% 52% 53% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 29% 29% 33% 29% 29% 33% 30% 29% 33% Specificity 78% 78% 79% 77% 78% 79% 78% 78% 79% OR Quartile 2 1.09 1.17 1.20 1.13 1.17 1.20 1.17 1.17 1.30 p Value 0.82 0.67 0.64 0.75 0.67 0.64 0.67 0.67 0.51 Lower limit of 95% 0.516 0.560 0.549 0.535 0.560 0.549 0.555 0.560 0.594 CI Upper limit of 95% 2.31 2.45 2.64 2.40 2.45 2.64 2.48 2.45 2.85 CI OR Quartile 3 1.22 1.21 1.27 1.28 1.21 1.27 1.35 1.21 1.42 p Value 0.55 0.57 0.49 0.45 0.57 0.49 0.36 0.57 0.31 Lower limit of 95% 0.636 0.636 0.645 0.671 0.636 0.645 0.709 0.636 0.725 CI Upper limit of 95% 2.33 2.29 2.48 2.46 2.29 2.48 2.59 2.29 2.77 CI OR Quartile 4 1.41 1.50 1.78 1.36 1.50 1.78 1.51 1.50 1.90 p Value 0.36 0.28 0.13 0.42 0.28 0.13 0.27 0.28 0.094 Lower limit of 95% 0.673 0.717 0.838 0.649 0.717 0.838 0.722 0.717 0.897 CI Upper limit of 95% 2.96 3.14 3.79 2.85 3.14 3.79 3.16 3.14 4.02 CI

Example 8. Use of Angiopoietin-Related Protein 6 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0147] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Angiopoietin-related protein 6 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0148] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0149] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00039 TABLE 8.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.82 8.20 3.65 9.04 3.70 9.53 Stdev 9.53 21.5 9.35 22.4 9.23 23.5 p (t-test) 0.11 0.053 0.043 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 88 43 92 39 96 35 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.82 8.40 3.61 9.53 3.74 9.53 Stdev 9.53 21.7 9.31 22.9 9.27 23.5 p (t-test) 0.096 0.037 0.046 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 88 42 93 37 95 35 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.08 6.65 4.99 7.48 4.99 7.48 Stdev 15.2 11.5 15.0 12.0 15.0 12.0 p (t-test) 0.68 0.53 0.53 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 112 18 114 16 114 16 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.56 0.56 0.55 0.57 0.57 0.55 0.55 0.55 0.55 SE 0.054 0.055 0.075 0.056 0.057 0.079 0.058 0.058 0.079 p Value 0.27 0.30 0.52 0.18 0.20 0.51 0.37 0.40 0.51 nCohort Non- 88 88 112 92 93 114 96 95 114 persistent nCohort Persistent 43 42 18 39 37 16 35 35 16 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 72% 71% 72% 72% 70% 69% 69% 69% 69% Specificity 36% 35% 34% 36% 34% 33% 34% 34% 33% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 28% 29% 28% 31% 32% 31% 29% 29% 31% Specificity 76% 76% 75% 77% 77% 75% 76% 76% 75% OR Quartile 2 0.492 0.480 0.164 0.427 0.401 0.144 0.368 0.372 0.144 p Value 0.72 0.71 0.37 0.67 0.65 0.34 0.62 0.62 0.34 Lower limit of 95% 0.00959 0.00937 0.00316 0.00832 0.00781 0.00276 0.00716 0.00724 0.00276 CI Upper limit of 95% 25.2 24.6 8.55 21.9 20.6 7.51 18.9 19.1 7.51 CI OR Quartile 3 1.48 1.36 1.34 1.42 1.24 1.10 1.14 1.11 1.10 p Value 0.34 0.45 0.61 0.40 0.61 0.87 0.75 0.81 0.87 Lower limit of 95% 0.666 0.611 0.443 0.629 0.544 0.357 0.499 0.483 0.357 CI Upper limit of 95% 3.27 3.03 4.02 3.22 2.83 3.39 2.62 2.54 3.39 CI OR Quartile 4 1.24 1.28 1.15 1.50 1.65 1.40 1.27 1.25 1.40 p Value 0.62 0.56 0.80 0.34 0.25 0.57 0.59 0.61 0.57 Lower limit of 95% 0.540 0.557 0.378 0.651 0.709 0.447 0.532 0.524 0.447 CI Upper limit of 95% 2.82 2.93 3.52 3.47 3.82 4.36 3.03 2.99 4.36 CI

TABLE-US-00040 TABLE 8.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.41 9.45 2.44 10.3 2.63 10.6 Stdev 5.82 21.3 5.87 22.4 5.89 23.4 p (t-test) 0.0064 0.0029 0.0030 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 78 53 84 47 88 43 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.38 9.82 2.26 10.7 2.49 10.8 Stdev 5.78 21.7 5.66 22.4 5.73 23.1 p (t-test) 0.0044 0.0015 0.0020 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 79 51 83 47 86 44 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 4.79 7.55 4.70 8.23 4.70 8.23 Stdev 15.1 12.5 15.0 12.9 15.0 12.9 p (t-test) 0.41 0.30 0.30 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 106 24 108 22 108 22 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.60 0.57 0.60 0.62 0.57 0.57 0.60 0.57 SE 0.051 0.052 0.067 0.052 0.052 0.069 0.054 0.054 0.069 p Value 0.074 0.054 0.30 0.050 0.017 0.29 0.18 0.076 0.29 nCohort Non- 78 79 106 84 83 108 88 86 108 persistent nCohort Persistent 53 51 24 47 47 22 43 44 22 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 72% 73% 75% 72% 74% 73% 70% 73% 73% Specificity 37% 37% 35% 37% 37% 34% 35% 36% 34% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 32% 33% 29% 34% 36% 32% 30% 32% 32% Specificity 79% 80% 75% 80% 81% 76% 77% 78% 76% OR Quartile 2 0.682 0.648 0.230 0.562 0.569 0.207 0.492 0.514 0.207 p Value 0.85 0.83 0.47 0.77 0.78 0.43 0.72 0.74 0.43 Lower limit of 95% 0.0133 0.0127 0.00445 0.0110 0.0111 0.00401 0.00959 0.0100 0.00401 CI Upper limit of 95% 34.9 33.2 11.9 28.8 29.1 10.7 25.2 26.4 10.7 CI OR Quartile 3 1.50 1.53 1.61 1.53 1.74 1.39 1.26 1.50 1.39 p Value 0.29 0.27 0.35 0.28 0.17 0.53 0.57 0.32 0.53 Lower limit of 95% 0.706 0.712 0.588 0.703 0.787 0.502 0.573 0.678 0.502 CI Upper limit of 95% 3.19 3.30 4.40 3.33 3.84 3.85 2.75 3.33 3.85 CI OR Quartile 4 1.83 1.97 1.27 2.03 2.37 1.47 1.47 1.65 1.47 p Value 0.14 0.097 0.64 0.084 0.036 0.45 0.35 0.23 0.45 Lower limit of 95% 0.825 0.885 0.473 0.910 1.06 0.542 0.649 0.729 0.542 CI Upper limit of 95% 4.06 4.38 3.39 4.55 5.32 4.00 3.34 3.71 4.00 CI

TABLE-US-00041 TABLE 8.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.29 8.99 2.15 9.83 2.22 10.2 Stdev 5.72 20.5 5.56 21.3 5.50 21.9 p (t-test) 0.0087 0.0028 0.0022 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 73 58 78 53 81 50 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.20 9.65 2.09 10.4 2.19 10.6 Stdev 5.63 21.1 5.50 21.8 5.47 22.2 p (t-test) 0.0039 0.0014 0.0014 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 76 54 80 50 82 48 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 4.71 7.33 4.58 8.17 4.58 8.17 Stdev 15.4 11.8 15.2 12.2 15.2 12.2 p (t-test) 0.40 0.27 0.27 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 101 29 104 26 104 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.62 0.57 0.61 0.64 0.59 0.59 0.63 0.59 SE 0.050 0.050 0.062 0.051 0.051 0.065 0.052 0.052 0.065 p Value 0.077 0.019 0.29 0.029 0.0050 0.18 0.071 0.015 0.18 nCohort Non- 73 76 101 78 80 104 81 82 104 persistent nCohort Persistent 58 54 29 53 50 26 50 48 26 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 71% 74% 72% 72% 76% 73% 70% 75% 73% Specificity 37% 38% 35% 37% 39% 35% 36% 38% 35% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 31% 33% 31% 34% 36% 35% 32% 33% 35% Specificity 79% 80% 76% 81% 81% 77% 79% 79% 77% OR Quartile 2 0.796 0.712 0.291 0.682 0.627 0.254 0.620 0.588 0.254 p Value 0.91 0.87 0.54 0.85 0.82 0.50 0.81 0.79 0.50 Lower limit of 95% 0.0156 0.0139 0.00564 0.0133 0.0123 0.00492 0.0121 0.0115 0.00492 CI Upper limit of 95% 40.7 36.5 15.0 34.9 32.1 13.1 31.7 30.1 13.1 CI OR Quartile 3 1.42 1.76 1.39 1.50 2.00 1.44 1.30 1.82 1.44 p Value 0.36 0.15 0.48 0.29 0.085 0.46 0.50 0.14 0.46 Lower limit of 95% 0.676 0.821 0.559 0.706 0.910 0.552 0.611 0.827 0.552 CI Upper limit of 95% 2.96 3.79 3.46 3.19 4.41 3.74 2.77 4.02 3.74 CI OR Quartile 4 1.74 2.03 1.44 2.16 2.44 1.76 1.77 1.91 1.76 p Value 0.17 0.082 0.43 0.059 0.030 0.23 0.16 0.11 0.23 Lower limit of 95% 0.786 0.914 0.581 0.970 1.09 0.698 0.796 0.856 0.698 CI Upper limit of 95% 3.85 4.52 3.59 4.81 5.45 4.46 3.94 4.27 4.46 CI

TABLE-US-00042 TABLE 8.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.32 8.83 2.17 9.65 2.27 9.79 Stdev 5.76 20.4 5.60 21.1 5.56 21.5 p (t-test) 0.011 0.0036 0.0036 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 72 59 77 54 79 52 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.26 9.31 2.15 10.0 2.24 10.2 Stdev 5.69 20.8 5.56 21.4 5.53 21.9 p (t-test) 0.0062 0.0024 0.0024 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 74 56 78 52 80 50 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 4.91 6.44 4.76 7.08 4.76 7.08 Stdev 15.7 11.3 15.5 11.7 15.5 11.7 p (t-test) 0.61 0.45 0.45 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 97 33 100 30 100 30 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.61 0.53 0.61 0.63 0.55 0.59 0.61 0.55 SE 0.050 0.050 0.059 0.051 0.051 0.061 0.051 0.051 0.061 p Value 0.076 0.034 0.57 0.029 0.010 0.42 0.069 0.029 0.42 nCohort Non- 72 74 97 77 78 100 79 80 100 persistent nCohort Persistent 59 56 33 54 52 30 52 50 30 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 71% 73% 70% 72% 75% 70% 71% 74% 70% Specificity 38% 38% 34% 38% 38% 34% 37% 38% 34% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 31% 32% 27% 33% 35% 30% 31% 32% 30% Specificity 79% 80% 75% 81% 81% 76% 78% 79% 76% OR Quartile 2 0.821 0.758 0.344 0.703 0.669 0.303 0.660 0.627 0.303 p Value 0.92 0.89 0.60 0.86 0.84 0.55 0.84 0.82 0.55 Lower limit of 95% 0.0160 0.0148 0.00668 0.0137 0.0131 0.00590 0.0129 0.0123 0.00590 CI Upper limit of 95% 42.0 38.8 17.7 36.0 34.2 15.6 33.8 32.1 15.6 CI OR Quartile 3 1.48 1.66 1.19 1.57 1.88 1.20 1.43 1.71 1.20 p Value 0.30 0.19 0.70 0.24 0.11 0.68 0.35 0.18 0.68 Lower limit of 95% 0.708 0.782 0.505 0.740 0.863 0.497 0.673 0.785 0.497 CI Upper limit of 95% 3.10 3.54 2.78 3.34 4.07 2.91 3.04 3.72 2.91 CI OR Quartile 4 1.67 1.86 1.14 2.07 2.22 1.36 1.62 1.74 1.36 p Value 0.21 0.13 0.77 0.075 0.051 0.51 0.23 0.17 0.51 Lower limit of 95% 0.754 0.839 0.466 0.930 0.997 0.549 0.731 0.784 0.549 CI Upper limit of 95% 3.69 4.14 2.79 4.59 4.96 3.36 3.60 3.88 3.36 CI

TABLE-US-00043 TABLE 8.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.32 8.83 2.17 9.65 2.27 9.79 Stdev 5.76 20.4 5.60 21.1 5.56 21.5 p (t-test) 0.011 0.0036 0.0036 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 72 59 77 54 79 52 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.29 9.14 2.17 9.83 2.27 9.98 Stdev 5.72 20.7 5.60 21.3 5.56 21.7 p (t-test) 0.0077 0.0031 0.0031 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 73 57 77 53 79 51 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.63 9.81 3.56 10.4 3.56 10.4 Stdev 9.47 23.2 9.39 23.8 9.39 23.8 p (t-test) 0.033 0.020 0.020 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 95 35 97 33 97 33 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.60 0.56 0.61 0.62 0.56 0.59 0.60 0.56 SE 0.050 0.050 0.058 0.051 0.051 0.059 0.051 0.051 0.059 p Value 0.076 0.057 0.29 0.029 0.019 0.29 0.069 0.049 0.29 nCohort Non- 72 73 95 77 77 97 79 79 97 persistent nCohort Persistent 59 57 35 54 53 33 52 51 33 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 71% 72% 71% 72% 74% 70% 71% 73% 70% Specificity 38% 37% 35% 38% 38% 34% 37% 37% 34% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 31% 32% 29% 33% 34% 30% 31% 31% 30% Specificity 79% 79% 76% 81% 81% 76% 78% 78% 76% OR Quartile 2 0.821 0.782 0.372 0.703 0.690 0.344 0.660 0.648 0.344 p Value 0.92 0.90 0.62 0.86 0.85 0.60 0.84 0.83 0.60 Lower limit of 95% 0.0160 0.0153 0.00724 0.0137 0.0135 0.00668 0.0129 0.0127 0.00668 CI Upper limit of 95% 42.0 40.0 19.1 36.0 35.3 17.7 33.8 33.2 17.7 CI OR Quartile 3 1.48 1.50 1.33 1.57 1.68 1.19 1.43 1.53 1.19 p Value 0.30 0.28 0.51 0.24 0.18 0.70 0.35 0.27 0.70 Lower limit of 95% 0.708 0.712 0.571 0.740 0.783 0.505 0.673 0.712 0.505 CI Upper limit of 95% 3.10 3.18 3.10 3.34 3.62 2.78 3.04 3.30 2.78 CI OR Quartile 4 1.67 1.78 1.25 2.07 2.13 1.40 1.62 1.67 1.40 p Value 0.21 0.15 0.61 0.075 0.065 0.45 0.23 0.21 0.45 Lower limit of 95% 0.754 0.805 0.524 0.930 0.954 0.582 0.731 0.750 0.582 CI Upper limit of 95% 3.69 3.96 2.99 4.59 4.73 3.36 3.60 3.71 3.36 CI

TABLE-US-00044 TABLE 8.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 225 249 225 249 225 249 Average 256 266 254 272 251 281 Stdev 130 141 128 146 127 150 p (t-test) 0.65 0.44 0.22 Min 33.6 1.83 33.6 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 96 55 104 47 111 40 sCr only Median 225 247 225 249 223 251 Average 257 262 253 273 250 282 Stdev 130 142 127 148 127 149 p (t-test) 0.84 0.39 0.19 Min 33.6 1.83 33.6 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 94 56 103 47 108 42 UO only Median 225 245 225 245 225 249 Average 255 281 255 281 254 288 Stdev 132 141 132 141 132 142 p (t-test) 0.43 0.43 0.32 Min 1.83 121 1.83 121 1.83 121 Max 667 597 667 597 667 597 n (Patient) 131 19 131 19 132 18 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.52 0.51 0.54 0.53 0.54 0.54 0.54 0.56 0.56 SE 0.049 0.049 0.072 0.051 0.051 0.072 0.054 0.053 0.074 p Value 0.64 0.83 0.57 0.51 0.43 0.57 0.42 0.30 0.42 nCohort Non- 96 94 131 104 103 131 111 108 132 persistent nCohort Persistent 55 56 19 47 47 19 40 42 18 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 75% 73% 79% 77% 77% 79% 78% 79% 83% Specificity 25% 24% 26% 26% 26% 26% 26% 27% 27% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 52% 53% 53% 53% 53% 52% 55% 56% Specificity 51% 51% 50% 51% 51% 50% 50% 52% 51% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 27% 27% 37% 30% 32% 37% 32% 33% 39% Specificity 76% 76% 76% 77% 78% 76% 77% 78% 77% OR Quartile 2 0.976 0.885 1.31 1.15 1.16 1.31 1.22 1.35 1.80 p Value 0.95 0.75 0.65 0.74 0.71 0.65 0.65 0.49 0.37 Lower limit of 95% CI 0.455 0.416 0.408 0.513 0.520 0.408 0.518 0.575 0.492 Upper limit of 95% CI 2.09 1.89 4.24 2.57 2.60 4.24 2.86 3.15 6.61 OR Quartile 3 1.16 1.12 1.13 1.18 1.20 1.13 1.13 1.30 1.29 p Value 0.66 0.74 0.81 0.64 0.60 0.81 0.75 0.47 0.62 Lower limit of 95% CI 0.599 0.578 0.430 0.592 0.604 0.430 0.546 0.638 0.479 Upper limit of 95% CI 2.26 2.17 2.96 2.35 2.40 2.96 2.32 2.67 3.47 OR Quartile 4 1.19 1.13 1.88 1.41 1.63 1.88 1.66 1.75 2.07 p Value 0.65 0.75 0.22 0.38 0.21 0.22 0.21 0.16 0.17 Lower limit of 95% CI 0.559 0.530 0.682 0.652 0.756 0.682 0.746 0.798 0.741 Upper limit of 95% CI 2.54 2.40 5.20 3.07 3.52 5.20 3.68 3.84 5.80

TABLE-US-00045 TABLE 8.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 220 253 223 253 225 257 Average 251 271 249 276 248 283 Stdev 129 140 126 145 125 148 p (t-test) 0.36 0.25 0.13 Min 33.6 1.83 33.6 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 88 63 94 57 101 50 sCr only Median 225 247 225 245 225 245 Average 254 267 253 269 251 274 Stdev 127 143 125 148 124 151 p (t-test) 0.56 0.50 0.32 Min 33.6 1.83 33.6 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 88 62 93 57 99 51 UO only Median 225 253 225 253 223 257 Average 255 275 255 275 254 280 Stdev 129 152 129 152 129 153 p (t-test) 0.47 0.47 0.37 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 123 27 123 27 124 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.55 0.53 0.53 0.55 0.52 0.53 0.56 0.53 0.55 SE 0.048 0.048 0.062 0.049 0.049 0.062 0.050 0.050 0.063 p Value 0.31 0.59 0.59 0.26 0.64 0.59 0.23 0.58 0.46 nCohort Non- 88 88 123 94 93 123 101 99 124 persistent nCohort Persistent 63 62 27 57 57 27 50 51 26 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 76% 74% 74% 77% 74% 74% 78% 75% 77% Specificity 26% 25% 25% 27% 25% 25% 27% 25% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 54% 52% 56% 54% 51% 56% 54% 51% 58% Specificity 52% 51% 51% 52% 51% 51% 51% 51% 52% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 30% 29% 37% 33% 32% 37% 34% 31% 38% Specificity 78% 77% 77% 80% 78% 77% 79% 78% 77% OR Quartile 2 1.13 0.958 0.963 1.23 0.920 0.963 1.29 0.988 1.16 p Value 0.75 0.91 0.94 0.60 0.83 0.94 0.53 0.97 0.77 Lower limit of 95% CI 0.535 0.455 0.372 0.568 0.433 0.372 0.581 0.455 0.428 Upper limit of 95% CI 2.40 2.02 2.49 2.65 1.96 2.49 2.88 2.15 3.14 OR Quartile 3 1.28 1.12 1.31 1.30 1.06 1.31 1.25 1.06 1.45 p Value 0.45 0.74 0.52 0.44 0.87 0.52 0.53 0.86 0.39 Lower limit of 95% CI 0.671 0.583 0.568 0.671 0.547 0.568 0.632 0.540 0.619 Upper limit of 95% CI 2.46 2.14 3.03 2.51 2.05 3.03 2.46 2.09 3.42 OR Quartile 4 1.57 1.39 2.00 1.97 1.68 2.00 1.96 1.60 2.14 p Value 0.23 0.38 0.13 0.074 0.17 0.13 0.081 0.22 0.095 Lower limit of 95% CI 0.748 0.663 0.822 0.936 0.799 0.822 0.920 0.750 0.875 Upper limit of 95% CI 3.29 2.92 4.85 4.16 3.55 4.85 4.18 3.41 5.25

TABLE-US-00046 TABLE 8.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 225 247 225 245 227 221 Average 254 266 253 267 252 272 Stdev 129 139 128 141 126 145 p (t-test) 0.57 0.53 0.38 Min 64.1 1.83 64.1 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 83 68 86 65 94 57 sCr only Median 225 233 225 233 225 221 Average 256 263 253 268 252 272 Stdev 128 141 128 142 127 144 p (t-test) 0.75 0.51 0.37 Min 84.8 1.83 33.6 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 82 68 86 64 93 57 UO only Median 228 220 228 220 227 221 Average 259 256 259 256 258 259 Stdev 131 142 131 142 131 143 p (t-test) 0.93 0.93 0.96 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 115 35 115 35 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.53 0.52 0.49 0.53 0.53 0.49 0.53 0.53 0.50 SE 0.047 0.048 0.056 0.048 0.048 0.056 0.049 0.049 0.057 p Value 0.47 0.68 0.89 0.47 0.49 0.89 0.51 0.51 0.96 nCohort Non- 83 82 115 86 86 115 94 93 116 persistent nCohort Persistent 68 68 35 65 64 35 57 57 34 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 76% 75% 74% 77% 77% 74% 77% 77% 76% Specificity 27% 26% 25% 27% 27% 25% 27% 27% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 51% 50% 46% 51% 50% 46% 49% 49% 47% Specificity 51% 50% 49% 50% 50% 49% 49% 49% 49% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 29% 29% 31% 31% 31% 31% 32% 32% 32% Specificity 78% 78% 77% 79% 79% 77% 79% 78% 77% OR Quartile 2 1.17 1.03 0.974 1.22 1.19 0.974 1.23 1.24 1.13 p Value 0.68 0.93 0.95 0.61 0.65 0.95 0.60 0.58 0.78 Lower limit of 95% CI 0.558 0.493 0.409 0.575 0.563 0.409 0.568 0.576 0.463 Upper limit of 95% CI 2.46 2.16 2.32 2.57 2.52 2.32 2.65 2.69 2.77 OR Quartile 3 1.09 1.00 0.799 1.03 1.00 0.799 0.925 0.945 0.859 p Value 0.80 1.0 0.56 0.93 1.0 0.56 0.82 0.87 0.70 Lower limit of 95% CI 0.572 0.526 0.374 0.541 0.524 0.374 0.479 0.489 0.399 Upper limit of 95% CI 2.06 1.90 1.71 1.96 1.91 1.71 1.79 1.83 1.85 OR Quartile 4 1.50 1.48 1.49 1.68 1.72 1.49 1.71 1.68 1.58 p Value 0.28 0.30 0.35 0.17 0.15 0.35 0.16 0.17 0.29 Lower limit of 95% CI 0.719 0.708 0.649 0.801 0.818 0.649 0.810 0.799 0.682 Upper limit of 95% CI 3.15 3.10 3.44 3.52 3.60 3.44 3.60 3.55 3.64

TABLE-US-00047 TABLE 8.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 225 247 225 233 225 233 Average 255 264 255 265 253 269 Stdev 130 138 127 141 127 143 p (t-test) 0.66 0.65 0.47 Min 64.1 1.83 64.1 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 81 70 85 66 91 60 sCr only Median 225 221 227 221 227 221 Average 258 261 257 262 255 266 Stdev 128 141 126 144 127 145 p (t-test) 0.89 0.83 0.63 Min 84.8 1.83 84.8 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 81 69 84 66 90 60 UO only Median 225 221 227 221 225 221 Average 257 261 258 260 257 263 Stdev 132 138 132 140 131 141 p (t-test) 0.88 0.92 0.81 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 109 41 110 40 111 39 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.53 0.51 0.51 0.52 0.51 0.51 0.53 0.51 0.52 SE 0.047 0.047 0.053 0.048 0.048 0.054 0.048 0.048 0.054 p Value 0.56 0.86 0.81 0.63 0.86 0.91 0.58 0.81 0.77 nCohort Non- 81 81 109 85 84 110 91 90 111 persistent nCohort Persistent 70 69 41 66 66 40 60 60 39 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 76% 74% 76% 76% 74% 75% 77% 75% 77% Specificity 26% 25% 26% 26% 25% 25% 26% 26% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 51% 49% 49% 50% 48% 48% 50% 48% 49% Specificity 51% 49% 50% 49% 49% 49% 49% 49% 50% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 29% 29% 32% 30% 30% 32% 30% 30% 33% Specificity 78% 78% 77% 79% 79% 77% 78% 78% 77% OR Quartile 2 1.09 0.929 1.07 1.09 0.961 1.02 1.18 1.03 1.18 p Value 0.82 0.84 0.87 0.82 0.92 0.95 0.67 0.94 0.71 Lower limit of 95% CI 0.521 0.444 0.466 0.519 0.458 0.445 0.551 0.485 0.500 Upper limit of 95% CI 2.28 1.94 2.46 2.29 2.01 2.36 2.51 2.19 2.78 OR Quartile 3 1.09 0.948 0.935 0.977 0.897 0.872 0.978 0.895 0.933 p Value 0.80 0.87 0.85 0.94 0.74 0.71 0.95 0.74 0.85 Lower limit of 95% CI 0.572 0.499 0.456 0.513 0.471 0.423 0.510 0.465 0.450 Upper limit of 95% CI 2.06 1.80 1.92 1.86 1.71 1.80 1.88 1.72 1.94 OR Quartile 4 1.40 1.43 1.56 1.62 1.59 1.64 1.52 1.50 1.72 p Value 0.37 0.34 0.27 0.20 0.22 0.23 0.27 0.28 0.18 Lower limit of 95% CI 0.670 0.683 0.704 0.773 0.761 0.737 0.724 0.714 0.772 Upper limit of 95% CI 2.93 2.99 3.45 3.39 3.34 3.64 3.20 3.15 3.83

TABLE-US-00048 TABLE 8.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 225 249 225 247 225 245 Average 255 264 255 264 253 268 Stdev 130 138 128 140 127 142 p (t-test) 0.71 0.66 0.50 Min 84.8 1.83 84.8 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 78 73 81 70 88 63 sCr only Median 225 245 225 233 225 233 Average 256 263 255 264 253 268 Stdev 129 140 127 142 127 143 p (t-test) 0.75 0.70 0.51 Min 84.8 1.83 84.8 1.83 1.83 22.9 Max 667 619 667 619 667 619 n (Patient) 79 71 82 68 88 62 UO only Median 227 221 227 221 225 221 Average 258 259 258 259 257 262 Stdev 133 137 133 137 132 137 p (t-test) 0.95 0.95 0.84 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 108 42 108 42 109 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.53 0.52 0.51 0.53 0.52 0.51 0.53 0.52 0.52 SE 0.047 0.047 0.053 0.047 0.048 0.053 0.048 0.048 0.053 p Value 0.55 0.66 0.87 0.55 0.65 0.87 0.56 0.60 0.73 nCohort Non- 78 79 108 81 82 108 88 88 109 persistent nCohort Persistent 73 71 42 70 68 42 63 62 41 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 75% 75% 76% 76% 75% 76% 76% 76% 78% Specificity 26% 25% 26% 26% 26% 26% 26% 26% 27% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 52% 51% 48% 51% 50% 48% 51% 50% 49% Specificity 51% 51% 49% 51% 50% 49% 50% 50% 50% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 29% 30% 31% 30% 31% 31% 30% 31% 32% Specificity 78% 78% 77% 79% 79% 77% 78% 78% 77% OR Quartile 2 1.05 0.998 1.12 1.09 1.03 1.12 1.13 1.11 1.29 p Value 0.89 1.00 0.79 0.82 0.93 0.79 0.75 0.79 0.56 Lower limit of 95% CI 0.505 0.478 0.488 0.521 0.493 0.488 0.535 0.523 0.549 Upper limit of 95% CI 2.20 2.09 2.57 2.28 2.16 2.57 2.40 2.35 3.02 OR Quartile 3 1.14 1.05 0.876 1.09 1.00 0.876 1.03 1.00 0.935 p Value 0.68 0.87 0.72 0.80 1.0 0.72 0.92 1.0 0.85 Lower limit of 95% CI 0.603 0.556 0.429 0.572 0.526 0.429 0.541 0.522 0.456 Upper limit of 95% CI 2.16 2.00 1.79 2.06 1.90 1.79 1.97 1.92 1.92 OR Quartile 4 1.45 1.53 1.49 1.61 1.71 1.49 1.57 1.60 1.56 p Value 0.33 0.26 0.33 0.21 0.16 0.33 0.23 0.21 0.27 Lower limit of 95% CI 0.692 0.731 0.674 0.770 0.814 0.674 0.748 0.765 0.704 Upper limit of 95% CI 3.03 3.21 3.29 3.38 3.59 3.29 3.29 3.37 3.45

Example 9. Use of Angiopoietin-Related Protein 6 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0150] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Angiopoietin-related protein 6 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0151] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0152] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00049 TABLE 9.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.14 7.44 3.12 7.64 3.14 8.00 Stdev 6.07 18.1 7.55 19.5 7.51 20.2 p (t-test) 0.040 0.077 0.059 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 54 77 69 62 74 57 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.06 7.75 2.59 8.46 2.38 9.40 Stdev 5.98 18.4 6.50 20.1 6.28 21.0 p (t-test) 0.028 0.022 0.0067 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 56 74 70 60 76 54 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.43 4.83 5.17 5.87 5.09 6.37 Stdev 15.8 9.81 15.5 10.6 15.3 11.0 p (t-test) 0.85 0.84 0.72 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 102 28 107 23 109 21 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.66 0.45 0.59 0.61 0.54 0.58 0.61 0.53 SE 0.048 0.048 0.063 0.050 0.050 0.067 0.051 0.051 0.070 p Value 0.0033 0.0011 0.47 0.067 0.025 0.60 0.12 0.028 0.71 nCohort Non- 54 56 102 69 70 107 74 76 109 persistent nCohort Persistent 77 74 28 62 60 23 57 54 21 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 75% 77% 57% 74% 75% 70% 72% 72% 67% Specificity 46% 46% 30% 41% 40% 34% 38% 37% 33% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 31% 32% 21% 29% 32% 26% 30% 35% 29% Specificity 83% 84% 74% 78% 80% 75% 78% 82% 75% OR Quartile 2 1.42 1.32 0.278 0.899 0.858 0.219 0.772 0.712 0.196 p Value 0.86 0.89 0.52 0.96 0.94 0.45 0.90 0.87 0.42 Lower limit of 95% 0.0278 0.0258 0.00540 0.0176 0.0168 0.00423 0.0151 0.0139 0.00379 CI Upper limit of 95% 72.8 67.5 14.3 46.0 43.9 11.3 39.5 36.5 10.2 CI OR Quartile 3 2.63 2.91 0.582 1.96 2.00 1.16 1.56 1.52 0.986 p Value 0.011 0.0056 0.22 0.076 0.072 0.77 0.24 0.28 0.98 Lower limit of 95% 1.25 1.37 0.247 0.932 0.940 0.437 0.741 0.712 0.366 CI Upper limit of 95% 5.54 6.18 1.37 4.13 4.26 3.07 3.28 3.23 2.66 CI OR Quartile 4 2.26 2.51 0.758 1.47 1.85 1.05 1.54 2.40 1.21 p Value 0.063 0.037 0.59 0.34 0.13 0.93 0.29 0.033 0.71 Lower limit of 95% 0.955 1.06 0.278 0.667 0.833 0.374 0.697 1.07 0.429 CI Upper limit of 95% 5.37 5.94 2.07 3.25 4.12 2.92 3.40 5.38 3.44 CI

TABLE-US-00050 TABLE 9.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.01 7.19 2.09 8.19 2.22 8.43 Stdev 6.07 17.6 5.80 19.1 5.94 19.6 p (t-test) 0.049 0.016 0.015 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 49 82 63 68 67 64 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.86 7.66 2.00 8.59 1.91 9.01 Stdev 5.86 18.1 5.72 19.5 5.61 19.8 p (t-test) 0.026 0.0099 0.0054 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 53 77 65 65 68 62 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.23 5.46 4.97 6.34 4.89 6.73 Stdev 16.0 10.8 15.6 11.4 15.4 11.7 p (t-test) 0.94 0.65 0.55 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 94 36 99 31 101 29 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.68 0.47 0.62 0.65 0.54 0.61 0.65 0.53 SE 0.048 0.047 0.057 0.049 0.048 0.060 0.049 0.048 0.062 p Value 0.0027 1.4E4 0.63 0.014 0.0014 0.50 0.031 0.0016 0.60 nCohort Non- 49 53 94 63 65 99 67 68 101 persistent nCohort Persistent 82 77 36 68 65 31 64 62 29 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 74% 78% 61% 74% 77% 71% 72% 76% 69% Specificity 47% 49% 31% 41% 43% 34% 39% 41% 34% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 30% 32% 22% 32% 34% 26% 33% 35% 28% Specificity 84% 85% 73% 83% 83% 75% 82% 84% 75% OR Quartile 2 1.67 1.45 0.386 1.08 1.00 0.317 0.956 0.912 0.291 p Value 0.80 0.85 0.64 0.97 1.0 0.57 0.98 0.96 0.54 Lower limit of 95% 0.0325 0.0283 0.00752 0.0211 0.0195 0.00615 0.0187 0.0178 0.00564 CI Upper limit of 95% 85.3 74.1 19.8 55.2 51.2 16.3 48.9 46.7 15.0 CI OR Quartile 3 2.57 3.40 0.701 1.95 2.52 1.28 1.62 2.19 1.13 p Value 0.013 0.0016 0.38 0.075 0.017 0.58 0.20 0.042 0.79 Lower limit of 95% 1.22 1.59 0.315 0.935 1.18 0.531 0.778 1.03 0.464 CI Upper limit of 95% 5.43 7.28 1.56 4.08 5.38 3.08 3.38 4.67 2.74 CI OR Quartile 4 2.25 2.70 0.789 2.26 2.51 1.03 2.24 2.85 1.16 p Value 0.075 0.029 0.61 0.053 0.029 0.95 0.052 0.013 0.76 Lower limit of 95% 0.922 1.11 0.318 0.990 1.10 0.409 0.992 1.24 0.456 CI Upper limit of 95% 5.48 6.59 1.96 5.16 5.74 2.59 5.05 6.53 2.94 CI

TABLE-US-00051 TABLE 9.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.01 7.19 2.09 8.19 2.02 8.44 Stdev 6.07 17.6 5.80 19.1 5.72 19.4 p (t-test) 0.049 0.016 0.011 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 49 82 63 68 65 66 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.90 7.56 2.03 8.46 1.97 8.73 Stdev 5.91 18.0 5.76 19.4 5.68 19.6 p (t-test) 0.031 0.012 0.0081 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 52 78 64 66 66 64 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.14 5.64 4.86 6.43 4.78 6.76 Stdev 16.3 10.6 15.9 11.1 15.7 11.3 p (t-test) 0.86 0.59 0.50 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 89 41 94 36 96 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.67 0.50 0.62 0.64 0.57 0.62 0.64 0.56 SE 0.048 0.047 0.055 0.049 0.048 0.057 0.049 0.048 0.058 p Value 0.0027 3.7E4 0.94 0.014 0.0031 0.23 0.015 0.0034 0.28 nCohort Non- 49 52 89 63 64 94 65 66 96 persistent nCohort Persistent 82 78 41 68 66 36 66 64 34 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 74% 77% 66% 74% 76% 75% 73% 75% 74% Specificity 47% 48% 33% 41% 42% 36% 40% 41% 35% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 30% 32% 24% 32% 33% 28% 33% 34% 29% Specificity 84% 85% 74% 83% 83% 76% 83% 83% 76% OR Quartile 2 1.67 1.50 0.464 1.08 1.03 0.386 1.02 0.970 0.358 p Value 0.80 0.84 0.70 0.97 0.99 0.64 0.99 0.99 0.61 Lower limit of 95% 0.0325 0.0292 0.00904 0.0211 0.0202 0.00752 0.0198 0.0190 0.00696 CI Upper limit of 95% 85.3 76.5 23.8 55.2 52.7 19.8 51.9 49.6 18.4 CI OR Quartile 3 2.57 3.09 0.932 1.95 2.28 1.70 1.78 2.08 1.52 p Value 0.013 0.0035 0.86 0.075 0.031 0.23 0.12 0.056 0.34 Lower limit of 95% 1.22 1.45 0.426 0.935 1.08 0.717 0.853 0.982 0.639 CI Upper limit of 95% 5.43 6.58 2.04 4.08 4.83 4.03 3.71 4.39 3.63 CI OR Quartile 4 2.25 2.59 0.926 2.26 2.41 1.19 2.45 2.62 1.32 p Value 0.075 0.036 0.86 0.053 0.037 0.70 0.033 0.023 0.53 Lower limit of 95% 0.922 1.06 0.393 0.990 1.05 0.499 1.07 1.14 0.552 CI Upper limit of 95% 5.48 6.32 2.18 5.16 5.51 2.83 5.61 5.99 3.17 CI

TABLE-US-00052 TABLE 9.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.01 7.19 2.12 8.07 2.05 8.31 Stdev 6.07 17.6 5.84 19.0 5.76 19.2 p (t-test) 0.049 0.019 0.014 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 49 82 62 69 64 67 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.90 7.56 2.06 8.34 2.00 8.59 Stdev 5.91 18.0 5.80 19.2 5.72 19.5 p (t-test) 0.031 0.014 0.0099 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 52 78 63 67 65 65 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 5.31 5.26 5.08 5.79 4.98 6.05 Stdev 16.5 10.3 16.2 10.7 16.0 10.9 p (t-test) 0.98 0.80 0.71 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 128 34.4 128 34.4 128 34.4 n (Patient) 86 44 90 40 92 38 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.67 0.49 0.62 0.64 0.54 0.62 0.64 0.53 SE 0.048 0.047 0.054 0.049 0.048 0.055 0.049 0.048 0.056 p Value 0.0027 3.7E4 0.90 0.013 0.0030 0.46 0.014 0.0032 0.54 nCohort Non- 49 52 86 62 63 90 64 65 92 persistent nCohort Persistent 82 78 44 69 67 40 67 65 38 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 74% 77% 66% 74% 76% 72% 73% 75% 71% Specificity 47% 48% 33% 42% 43% 36% 41% 42% 35% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 30% 32% 23% 32% 33% 25% 33% 34% 26% Specificity 84% 85% 73% 82% 83% 74% 83% 83% 75% OR Quartile 2 1.67 1.50 0.514 1.11 1.06 0.448 1.05 1.00 0.416 p Value 0.80 0.84 0.74 0.96 0.98 0.69 0.98 1.0 0.66 Lower limit of 95% 0.0325 0.0292 0.0100 0.0217 0.0208 0.00873 0.0205 0.0195 0.00811 CI Upper limit of 95% 85.3 76.5 26.4 56.9 54.4 23.0 53.5 51.2 21.4 CI OR Quartile 3 2.57 3.09 0.933 2.05 2.39 1.45 1.86 2.18 1.31 p Value 0.013 0.0035 0.86 0.057 0.023 0.37 0.097 0.042 0.52 Lower limit of 95% 1.22 1.45 0.432 0.979 1.13 0.642 0.893 1.03 0.575 CI Upper limit of 95% 5.43 6.58 2.01 4.28 5.07 3.29 3.89 4.60 2.98 CI OR Quartile 4 2.25 2.59 0.806 2.17 2.31 0.971 2.36 2.51 1.07 p Value 0.075 0.036 0.62 0.066 0.047 0.95 0.042 0.029 0.88 Lower limit of 95% 0.922 1.06 0.344 0.951 1.01 0.412 1.03 1.10 0.452 CI Upper limit of 95% 5.48 6.32 1.89 4.95 5.28 2.29 5.38 5.74 2.54 CI

TABLE-US-00053 TABLE 9.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 2.01 7.19 2.15 7.96 2.09 8.19 Stdev 6.07 17.6 5.88 18.9 5.80 19.1 p (t-test) 0.049 0.023 0.016 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 49 82 61 70 63 68 sCr only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 1.90 7.56 2.06 8.34 2.00 8.59 Stdev 5.91 18.0 5.80 19.2 5.72 19.5 p (t-test) 0.031 0.014 0.0099 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 35.9 128 35.9 128 35.9 128 n (Patient) 52 78 63 67 65 65 UO only Median 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Average 3.89 7.87 3.75 8.42 3.68 8.80 Stdev 9.89 20.7 9.74 21.3 9.64 21.7 p (t-test) 0.14 0.088 0.065 Min 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Max 62.1 128 62.1 128 62.1 128 n (Patient) 84 46 87 43 89 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.67 0.52 0.61 0.64 0.55 0.61 0.64 0.55 SE 0.048 0.047 0.053 0.049 0.048 0.054 0.049 0.048 0.055 p Value 0.0027 3.7E4 0.73 0.024 0.0030 0.32 0.026 0.0032 0.39 nCohort Non- 49 52 84 61 63 87 63 65 89 persistent nCohort Persistent 82 78 46 70 67 43 68 65 41 Cutoff Quartile 2 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 0.00238 Sensitivity 100% 100% 100% 100% 100% 100% 100% 100% 100% Specificity 0% 0% 0% 0% 0% 0% 0% 0% 0% Cutoff Quartile 3 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 0.00302 Sensitivity 74% 77% 67% 73% 76% 72% 72% 75% 71% Specificity 47% 48% 33% 41% 43% 36% 40% 42% 35% Cutoff Quartile 4 3.17 3.19 3.19 3.17 3.19 3.19 3.17 3.19 3.19 Sensitivity 30% 32% 24% 31% 33% 26% 32% 34% 27% Specificity 84% 85% 74% 82% 83% 75% 83% 83% 75% OR Quartile 2 1.67 1.50 0.550 1.15 1.06 0.497 1.08 1.00 0.464 p Value 0.80 0.84 0.77 0.95 0.98 0.73 0.97 1.0 0.70 Lower limit of 95% 0.0325 0.0292 0.0107 0.0224 0.0208 0.00970 0.0211 0.0195 0.00904 CI Upper limit of 95% 85.3 76.5 28.2 58.6 54.4 25.5 55.2 51.2 23.8 CI OR Quartile 3 2.57 3.09 1.03 1.86 2.39 1.43 1.70 2.18 1.29 p Value 0.013 0.0035 0.93 0.096 0.023 0.38 0.16 0.042 0.53 Lower limit of 95% 1.22 1.45 0.481 0.895 1.13 0.644 0.816 1.03 0.579 CI Upper limit of 95% 5.43 6.58 2.22 3.88 5.07 3.18 3.53 4.60 2.88 CI OR Quartile 4 2.25 2.59 0.886 2.08 2.31 1.02 2.26 2.51 1.12 p Value 0.075 0.036 0.78 0.081 0.047 0.97 0.053 0.029 0.80 Lower limit of 95% 0.922 1.06 0.385 0.913 1.01 0.439 0.990 1.10 0.481 CI Upper limit of 95% 5.48 6.32 2.04 4.75 5.28 2.35 5.16 5.74 2.59 CI

TABLE-US-00054 TABLE 9.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 214 245 225 227 216 247 Average 261 259 266 253 258 261 Stdev 132 135 139 128 135 133 p (t-test) 0.92 0.55 0.86 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 647 667 667 619 667 619 n (Patient) 50 101 75 76 85 66 sCr only Median 225 227 225 225 214 251 Average 272 253 263 256 251 271 Stdev 133 135 133 136 129 141 p (t-test) 0.41 0.74 0.37 Min 85.4 1.83 85.4 1.83 67.1 1.83 Max 647 667 667 619 667 619 n (Patient) 52 98 73 77 86 64 UO only Median 223 249 225 237 225 253 Average 257 263 259 255 257 266 Stdev 134 134 133 135 132 144 p (t-test) 0.82 0.87 0.76 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 597 667 597 667 597 n (Patient) 112 38 120 30 125 25 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.51 0.47 0.52 0.49 0.49 0.50 0.53 0.56 0.53 SE 0.050 0.049 0.055 0.047 0.047 0.059 0.048 0.048 0.064 p Value 0.91 0.48 0.68 0.87 0.91 0.97 0.54 0.24 0.69 nCohort Non- 50 52 112 75 73 120 85 86 125 persistent nCohort Persistent 101 98 38 76 77 30 66 64 25 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 74% 72% 76% 76% 75% 73% 79% 80% 76% Specificity 24% 21% 26% 27% 26% 25% 28% 29% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 52% 50% 55% 50% 49% 53% 53% 55% 56% Specificity 54% 50% 52% 49% 49% 51% 52% 53% 51% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 24% 29% 22% 25% 30% 26% 30% 36% Specificity 74% 73% 76% 72% 74% 76% 75% 78% 77% OR Quartile 2 0.911 0.706 1.13 1.17 1.07 0.917 1.46 1.61 1.09 p Value 0.82 0.39 0.79 0.67 0.85 0.85 0.33 0.22 0.87 Lower limit of 95% CI 0.414 0.317 0.477 0.561 0.514 0.369 0.686 0.747 0.400 Upper limit of 95% CI 2.00 1.57 2.66 2.45 2.24 2.27 3.11 3.46 2.97 OR Quartile 3 1.30 1.00 1.33 0.974 0.948 1.18 1.21 1.39 1.34 p Value 0.45 1.0 0.45 0.93 0.87 0.68 0.56 0.32 0.51 Lower limit of 95% CI 0.657 0.510 0.634 0.514 0.500 0.530 0.636 0.725 0.563 Upper limit of 95% CI 2.56 1.96 2.78 1.84 1.80 2.63 2.31 2.66 3.17 OR Quartile 4 0.936 0.880 1.28 0.741 0.931 1.34 1.06 1.49 1.86 p Value 0.87 0.74 0.55 0.43 0.85 0.51 0.88 0.29 0.18 Lower limit of 95% CI 0.431 0.409 0.563 0.354 0.446 0.555 0.505 0.711 0.745 Upper limit of 95% CI 2.04 1.89 2.92 1.55 1.94 3.26 2.22 3.12 4.65

TABLE-US-00055 TABLE 9.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 245 214 249 206 258 Average 260 259 257 262 249 271 Stdev 133 134 137 131 132 135 p (t-test) 0.98 0.81 0.31 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 647 667 667 619 667 619 n (Patient) 49 102 70 81 79 72 sCr only Median 225 228 220 237 213 253 Average 271 253 260 259 252 267 Stdev 134 134 135 134 130 138 p (t-test) 0.46 0.96 0.51 Min 85.4 1.83 85.4 1.83 84.8 1.83 Max 647 667 667 619 667 619 n (Patient) 51 99 70 80 79 71 UO only Median 219 256 221 253 221 263 Average 252 272 255 268 252 278 Stdev 131 139 131 141 129 148 p (t-test) 0.38 0.58 0.32 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 103 47 111 39 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.51 0.47 0.55 0.53 0.52 0.54 0.57 0.55 0.56 SE 0.050 0.050 0.051 0.047 0.047 0.054 0.047 0.047 0.057 p Value 0.80 0.58 0.30 0.46 0.75 0.51 0.11 0.31 0.29 nCohort Non- 49 51 103 70 70 111 79 79 116 persistent nCohort Persistent 102 99 47 81 80 39 72 71 34 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 75% 73% 77% 78% 76% 74% 81% 77% 76% Specificity 24% 22% 26% 29% 27% 25% 30% 28% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 57% 53% 51% 56% 57% 55% 59% Specificity 55% 51% 53% 53% 51% 52% 56% 54% 53% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 24% 34% 26% 26% 36% 29% 30% 41% Specificity 73% 73% 79% 76% 76% 78% 78% 78% 79% OR Quartile 2 0.948 0.733 1.16 1.40 1.20 0.978 1.81 1.33 1.13 p Value 0.89 0.45 0.71 0.37 0.63 0.96 0.12 0.46 0.78 Lower limit of 95% CI 0.431 0.329 0.520 0.670 0.573 0.424 0.849 0.631 0.463 Upper limit of 95% CI 2.09 1.63 2.60 2.93 2.50 2.26 3.85 2.79 2.77 OR Quartile 3 1.38 1.06 1.55 1.27 1.11 1.42 1.66 1.46 1.58 p Value 0.36 0.86 0.22 0.47 0.74 0.35 0.12 0.25 0.24 Lower limit of 95% CI 0.697 0.540 0.771 0.668 0.586 0.679 0.873 0.765 0.731 Upper limit of 95% CI 2.74 2.09 3.10 2.41 2.11 2.95 3.17 2.77 3.44 OR Quartile 4 0.899 0.846 1.90 1.09 1.11 2.03 1.50 1.53 2.68 p Value 0.79 0.67 0.10 0.82 0.78 0.081 0.28 0.26 0.018 Lower limit of 95% CI 0.413 0.392 0.884 0.521 0.530 0.917 0.717 0.731 1.18 Upper limit of 95% CI 1.96 1.82 4.09 2.28 2.32 4.50 3.14 3.21 6.08

TABLE-US-00056 TABLE 9.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 245 216 247 213 251 Average 260 259 258 261 252 266 Stdev 133 134 137 131 135 132 p (t-test) 0.98 0.88 0.51 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 647 667 667 619 667 619 n (Patient) 49 102 69 82 75 76 sCr only Median 225 228 225 228 216 245 Average 271 253 261 258 255 263 Stdev 134 134 135 133 133 135 p (t-test) 0.46 0.89 0.71 Min 85.4 1.83 85.4 1.83 84.8 1.83 Max 647 667 667 619 667 619 n (Patient) 51 99 69 81 75 75 UO only Median 225 237 225 221 225 233 Average 255 265 258 258 256 265 Stdev 133 134 133 135 131 140 p (t-test) 0.66 0.98 0.71 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 98 52 105 45 110 40 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.51 0.47 0.53 0.53 0.51 0.50 0.56 0.54 0.52 SE 0.050 0.050 0.050 0.047 0.047 0.052 0.047 0.047 0.054 p Value 0.80 0.58 0.52 0.52 0.81 0.96 0.24 0.44 0.67 nCohort Non- 49 51 98 69 69 105 75 75 110 persistent nCohort Persistent 102 99 52 82 81 45 76 75 40 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 75% 73% 77% 78% 77% 73% 80% 79% 75% Specificity 24% 22% 27% 29% 28% 25% 31% 29% 25% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 52% 52% 51% 49% 54% 52% 50% Specificity 55% 51% 51% 52% 51% 50% 53% 52% 50% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 24% 31% 26% 26% 31% 28% 28% 35% Specificity 73% 73% 78% 75% 75% 77% 77% 77% 78% OR Quartile 2 0.948 0.733 1.20 1.45 1.24 0.905 1.80 1.53 1.02 p Value 0.89 0.45 0.64 0.32 0.57 0.81 0.12 0.26 0.95 Lower limit of 95% CI 0.431 0.329 0.549 0.694 0.593 0.408 0.851 0.728 0.445 Upper limit of 95% CI 2.09 1.63 2.64 3.03 2.59 2.01 3.80 3.22 2.36 OR Quartile 3 1.38 1.06 1.12 1.20 1.06 0.938 1.34 1.17 1.00 p Value 0.36 0.86 0.73 0.57 0.87 0.86 0.37 0.62 1.0 Lower limit of 95% CI 0.697 0.540 0.574 0.634 0.555 0.467 0.706 0.618 0.485 Upper limit of 95% CI 2.74 2.09 2.20 2.28 2.01 1.89 2.54 2.23 2.06 OR Quartile 4 0.899 0.846 1.54 1.05 1.07 1.52 1.30 1.33 1.93 p Value 0.79 0.67 0.27 0.89 0.86 0.29 0.48 0.45 0.10 Lower limit of 95% CI 0.413 0.392 0.721 0.503 0.511 0.700 0.623 0.634 0.874 Upper limit of 95% CI 1.96 1.82 3.27 2.20 2.24 3.32 2.73 2.78 4.26

TABLE-US-00057 TABLE 9.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 245 220 245 214 249 Average 260 259 260 259 254 264 Stdev 133 134 137 131 135 133 p (t-test) 0.98 0.98 0.63 Min 64.1 1.83 64.1 1.83 64.1 1.83 Max 647 667 667 619 667 619 n (Patient) 49 102 68 83 74 77 sCr only Median 225 228 225 227 220 237 Average 271 253 263 256 257 261 Stdev 134 134 135 133 133 135 p (t-test) 0.46 0.76 0.85 Min 85.4 1.83 85.4 1.83 84.8 1.83 Max 647 667 667 619 667 619 n (Patient) 51 99 68 82 74 76 UO only Median 225 228 225 225 225 245 Average 257 261 259 257 256 263 Stdev 135 132 135 131 133 136 p (t-test) 0.85 0.94 0.76 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 95 55 100 50 105 45 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.51 0.47 0.52 0.52 0.50 0.50 0.54 0.52 0.52 SE 0.050 0.050 0.049 0.047 0.048 0.050 0.047 0.047 0.052 p Value 0.80 0.58 0.71 0.68 1.00 0.93 0.35 0.60 0.66 nCohort Non- 49 51 95 68 68 100 74 74 105 persistent nCohort Persistent 102 99 55 83 82 50 77 76 45 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 75% 73% 76% 77% 76% 74% 79% 78% 76% Specificity 24% 22% 26% 28% 26% 25% 30% 28% 26% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 51% 52% 50 % 50 % 53 % 51 % 51% Specificity 55% 51% 51% 51% 50% 50% 53% 51% 50% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 25% 24% 29% 25% 26% 30% 27% 28% 33% Specificity 73% 73% 77% 75% 75% 77% 77% 77% 78% OR Quartile 2 0.948 0.733 1.15 1.31 1.12 0.949 1.61 1.38 1.07 p Value 0.89 0.45 0.72 0.48 0.77 0.89 0.21 0.40 0.87 Lower limit of 95% CI 0.431 0.329 0.533 0.625 0.534 0.436 0.768 0.657 0.477 Upper limit of 95% CI 2.09 1.63 2.50 2.73 2.33 2.06 3.39 2.88 2.40 OR Quartile 3 1.38 1.06 1.06 1.14 1.00 1.00 1.27 1.11 1.07 p Value 0.36 0.86 0.87 0.69 1.0 1.0 0.47 0.74 0.86 Lower limit of 95% CI 0.697 0.540 0.545 0.600 0.526 0.507 0.670 0.586 0.530 Upper limit of 95% CI 2.74 2.09 2.06 2.17 1.90 1.97 2.40 2.11 2.14 OR Quartile 4 0.899 0.846 1.36 1.02 1.03 1.43 1.26 1.28 1.78 p Value 0.79 0.67 0.42 0.97 0.93 0.35 0.54 0.51 0.14 Lower limit of 95% CI 0.413 0.392 0.642 0.485 0.493 0.669 0.601 0.611 0.823 Upper limit of 95% CI 1.96 1.82 2.89 2.13 2.16 3.08 2.63 2.68 3.86

TABLE-US-00058 TABLE 9.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 245 216 247 211 253 Average 263 258 256 262 250 267 Stdev 133 134 132 135 131 136 p (t-test) 0.82 0.79 0.44 Min 85.4 1.83 85.4 1.83 84.8 1.83 Max 647 667 667 619 667 619 n (Patient) 47 104 65 86 70 81 sCr only Median 220 229 220 237 214 247 Average 270 254 261 258 255 263 Stdev 135 133 136 133 134 135 p (t-test) 0.49 0.92 0.69 Min 85.4 1.83 85.4 1.83 84.8 1.83 Max 647 667 667 619 667 619 n (Patient) 50 100 66 84 72 78 UO only Median 225 237 225 245 220 249 Average 252 268 251 270 249 276 Stdev 131 137 129 141 127 143 p (t-test) 0.48 0.41 0.24 Min 1.83 22.9 1.83 22.9 1.83 22.9 Max 667 605 667 605 667 605 n (Patient) 92 58 95 55 99 51 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.50 0.48 0.54 0.53 0.51 0.54 0.56 0.54 0.56 SE 0.051 0.050 0.049 0.047 0.048 0.049 0.047 0.047 0.050 p Value 0.92 0.66 0.44 0.56 0.76 0.42 0.24 0.40 0.25 nCohort 47 50 92 65 66 95 70 72 99 Non-persistent nCohort Persistent 104 100 58 86 84 55 81 78 51 Cutoff Quartile 2 166 166 166 166 166 166 166 166 166 Sensitivity 74% 73% 78% 77% 76% 76% 79% 78% 78% Specificity 23% 22% 27% 28% 27% 26% 30% 29% 27% Cutoff Quartile 3 225 225 225 225 225 225 225 225 225 Sensitivity 53% 51% 52% 52% 51% 53% 54% 53% 55% Specificity 55% 52% 51% 52% 52% 52% 54% 53% 53% Cutoff Quartile 4 324 324 323 324 324 323 324 324 323 Sensitivity 24% 24% 31% 27% 26% 33% 28% 28% 35% Specificity 72% 72% 78% 77% 76% 79% 79% 78% 80% OR Quartile 2 0.871 0.763 1.29 1.26 1.20 1.15 1.61 1.48 1.36 p Value 0.74 0.51 0.51 0.53 0.63 0.72 0.21 0.30 0.45 Lower limit of 0.390 0.342 0.598 0.604 0.573 0.533 0.770 0.705 0.612 95% CI Upper limit of 1.95 1.70 2.79 2.65 2.51 2.50 3.38 3.10 3.04 95% CI OR Quartile 3 1.39 1.13 1.12 1.20 1.11 1.19 1.41 1.24 1.35 p Value 0.35 0.73 0.74 0.57 0.74 0.61 0.29 0.51 0.39 Lower limit of 0.696 0.572 0.580 0.632 0.585 0.611 0.743 0.652 0.684 95% CI Upper limit of 2.78 2.22 2.16 2.29 2.12 2.31 2.68 2.35 2.65 95% CI OR Quartile 4 0.828 0.812 1.62 1.22 1.11 1.82 1.45 1.38 2.15 p Value 0.64 0.60 0.20 0.61 0.79 0.12 0.33 0.40 0.046 Lower limit of 0.379 0.376 0.769 0.575 0.527 0.863 0.688 0.654 1.01 95% CI Upper limit of 1.81 1.75 3.41 2.57 2.33 3.86 3.07 2.89 4.59 95% CI

Example 10. Use of Complement C5 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0153] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Complement C5 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0154] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0155] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00059 TABLE 10.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.181 0.477 0.162 0.470 0.169 0.458 Average 0.343 0.754 0.333 0.739 0.360 0.728 Stdev 0.762 0.921 0.841 0.906 0.888 0.902 p (t-test) 0.0019 0.0049 0.015 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 57 259 46 270 41 275 sCr only Median 0.184 0.488 0.184 0.485 0.187 0.478 Average 0.327 0.792 0.331 0.787 0.339 0.777 Stdev 0.669 0.946 0.678 0.944 0.696 0.939 p (t-test) 8.9E5 1.4E4 3.3E4 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 76 239 74 241 70 245 UO only Median 0.348 0.467 0.340 0.472 0.339 0.477 Average 0.562 0.873 0.570 0.817 0.544 0.815 Stdev 0.702 1.14 0.737 1.07 0.688 1.07 p (t-test) 0.0031 0.016 0.0082 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 193 121 172 142 155 159 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.73 0.56 0.75 0.73 0.57 0.73 0.72 0.57 SE 0.033 0.030 0.034 0.033 0.030 0.033 0.036 0.031 0.032 p Value 6.9E12 2.9E15 0.067 2.5E14 1.3E14 0.039 2.0E10 6.6E13 0.026 nCohort 57 76 193 46 74 172 41 70 155 Recovered nCohort Non- 259 239 121 270 241 142 275 245 159 recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 80% 82% 75% 80% 81% 76% 79% 80% 77% Specificity 47% 46% 25% 54% 46% 26% 51% 44% 27% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 57% 59% 58% 56% 59% 58% 55% 58% 58% Specificity 82% 79% 55% 87% 78% 56% 85% 77% 58% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 29% 31% 31% 28% 31% 30% 28% 30% 28% Specificity 93% 93% 79% 93% 93% 78% 93% 93% 78% OR Quartile 2 3.58 3.78 1.03 4.76 3.70 1.13 3.93 3.26 1.23 p Value 3.3E5 2.9E6 0.91 2.7E6 4.7E6 0.65 7.5E5 4.4E5 0.44 Lower limit of 1.96 2.17 0.611 2.48 2.11 0.673 2.00 1.85 0.735 95% CI Upper limit of 6.54 6.60 1.74 9.14 6.48 1.88 7.73 5.75 2.04 95% CI OR Quartile 3 6.27 5.49 1.67 8.59 5.20 1.77 7.21 4.65 1.90 p Value 7.1E7 4.2E8 0.028 2.3E6 1.2E7 0.013 1.6E5 8.8E7 0.0050 Lower limit of 3.03 2.99 1.06 3.52 2.82 1.13 2.94 2.52 1.21 95% CI Upper limit of 12.9 10.1 2.65 20.9 9.57 2.77 17.7 8.59 2.98 95% CI OR Quartile 4 5.40 6.37 1.70 5.62 6.11 1.53 4.84 5.63 1.40 p Value 0.0017 1.3E4 0.045 0.0048 1.8E4 0.10 0.010 3.6E4 0.19 Lower limit of 1.89 2.47 1.01 1.69 2.37 0.918 1.45 2.18 0.841 95% CI Upper limit of 15.5 16.4 2.84 18.6 15.8 2.56 16.1 14.5 2.35 95% CI

TABLE-US-00060 TABLE 10.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.201 0.533 0.183 0.520 0.191 0.488 Average 0.332 0.819 0.330 0.797 0.353 0.775 Stdev 0.633 0.962 0.671 0.946 0.704 0.938 p (t-test) 1.3E5 6.3E5 5.1E4 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 90 226 79 237 71 245 sCr only Median 0.215 0.550 0.215 0.546 0.216 0.534 Average 0.334 0.855 0.336 0.848 0.342 0.834 Stdev 0.590 0.987 0.596 0.984 0.610 0.977 p (t-test) 9.7E7 1.7E6 5.8E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 106 210 104 212 99 217 UO only Median 0.343 0.566 0.341 0.522 0.341 0.513 Average 0.562 0.927 0.575 0.851 0.557 0.842 Stdev 0.727 1.17 0.755 1.10 0.712 1.10 p (t-test) 7.8E4 0.0089 0.0056 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 211 103 193 121 177 137 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.74 0.59 0.74 0.74 0.57 0.71 0.73 0.57 SE 0.028 0.028 0.035 0.029 0.028 0.033 0.031 0.029 0.033 p Value 0 0 0.010 0 0 0.026 8.8E12 2.2E15 0.038 nCohort 90 106 211 79 104 193 71 99 177 Recovered nCohort 226 210 103 237 212 121 245 217 137 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 82% 83% 77% 82% 83% 76% 80% 82% 76% Specificity 43% 42% 26% 47% 41% 26% 44% 40% 26% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 62% 63% 61% 61% 63% 59% 59% 61% 58% Specificity 80% 76% 55% 82% 76% 55% 80% 75% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 32% 34% 35% 31% 33% 31% 30% 33% 30% Specificity 92% 92% 80% 92% 92% 79% 92% 92% 79% OR Quartile 2 3.56 3.55 1.16 4.09 3.45 1.11 3.18 3.09 1.11 p Value 4.0E6 2.8E6 0.60 6.1E7 4.7E6 0.70 6.0E5 3.0E5 0.70 Lower limit of 2.07 2.09 0.669 2.35 2.03 0.655 1.81 1.82 0.661 95% CI Upper limit of 6.10 6.03 2.01 7.11 5.85 1.88 5.60 5.26 1.85 95% CI OR Quartile 3 6.51 5.60 1.96 7.19 5.32 1.77 5.80 4.69 1.73 p Value 2.8E10 1.8E10 0.0060 1.0E9 5.9E10 0.015 6.4E8 1.1E8 0.017 Lower limit of 3.64 3.30 1.21 3.81 3.13 1.12 3.07 2.76 1.10 95% CI Upper limit of 11.7 9.50 3.17 13.5 9.03 2.80 11.0 7.96 2.71 95% CI OR Quartile 4 5.54 6.26 2.10 5.42 6.04 1.70 4.60 5.53 1.56 p Value 4.3E5 3.6E6 0.0057 1.6E4 5.5E6 0.045 6.8E4 1.6E5 0.088 Lower limit of 2.44 2.88 1.24 2.25 2.78 1.01 1.91 2.54 0.936 95% CI Upper limit of 12.6 13.6 3.55 13.0 13.1 2.84 11.1 12.0 2.61 95% CI

TABLE-US-00061 TABLE 10.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.218 0.563 0.213 0.548 0.229 0.529 Average 0.345 0.869 0.347 0.851 0.361 0.821 Stdev 0.584 0.999 0.602 0.987 0.628 0.975 p (t-test) 5.0E7 2.1E6 2.5E5 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 114 202 107 209 97 219 sCr only Median 0.237 0.582 0.238 0.571 0.239 0.552 Average 0.353 0.900 0.356 0.889 0.363 0.871 Stdev 0.559 1.02 0.565 1.02 0.575 1.01 p (t-test) 8.1E8 2.1E7 9.2E7 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 127 189 124 192 119 197 UO only Median 0.341 0.576 0.343 0.531 0.341 0.529 Average 0.587 0.880 0.601 0.829 0.569 0.852 Stdev 0.832 1.03 0.849 0.998 0.799 1.04 p (t-test) 0.0075 0.033 0.0068 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 213 101 203 111 189 125 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.73 0.61 0.73 0.72 0.59 0.71 0.71 0.59 SE 0.028 0.028 0.035 0.028 0.028 0.034 0.029 0.029 0.033 p Value 0 2.2E16 0.0024 0 2.2E15 0.012 5.3E13 2.0E13 0.0097 nCohort 114 127 213 107 124 203 97 119 189 Recovered nCohort 202 189 101 209 192 111 219 197 125 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 84% 80% 84% 83% 78% 82% 82% 78% Specificity 40% 38% 28% 42% 38% 27% 41% 37% 27% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 64% 65% 62% 63% 64% 59% 61% 62% 59% Specificity 75% 72% 56% 76% 72% 55% 75% 71% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 34% 35% 36% 33% 35% 32% 32% 34% 32% Specificity 91% 91% 80% 91% 90% 79% 90% 90% 79% OR Quartile 2 3.46 3.10 1.55 3.74 3.05 1.35 3.24 2.72 1.28 p Value 4.0E6 2.6E5 0.13 1.2E6 3.1E5 0.29 1.5E5 1.7E4 0.36 Lower limit of 2.04 1.83 0.874 2.20 1.81 0.779 1.90 1.61 0.754 95% CI Upper limit of 5.88 5.24 2.75 6.36 5.16 2.33 5.51 4.57 2.17 95% CI OR Quartile 3 5.55 4.90 2.10 5.34 4.53 1.81 4.80 3.99 1.85 p Value 6.8E11 2.2E10 0.0027 3.6E10 1.5E9 0.014 9.5E9 2.8E8 0.0083 Lower limit of 3.31 3.00 1.29 3.16 2.78 1.13 2.81 2.45 1.17 95% CI Upper limit of 9.28 8.00 3.41 9.02 7.40 2.89 8.19 6.50 2.93 95% CI OR Quartile 4 5.40 5.26 2.19 4.78 5.00 1.79 4.00 4.60 1.81 p Value 3.4E6 9.9E7 0.0036 1.7E5 2.1E6 0.029 1.4E4 7.1E6 0.024 Lower limit of 2.65 2.71 1.29 2.35 2.57 1.06 1.96 2.36 1.08 95% CI Upper limit of 11.0 10.2 3.71 9.74 9.73 3.01 8.17 8.94 3.03 95% CI

TABLE-US-00062 TABLE 10.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.237 0.582 0.237 0.563 0.237 0.538 Average 0.363 0.910 0.364 0.884 0.371 0.852 Stdev 0.556 1.04 0.573 1.02 0.596 1.00 p (t-test) 6.7E8 4.1E7 4.8E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 133 183 124 192 113 203 sCr only Median 0.239 0.584 0.243 0.584 0.243 0.579 Average 0.362 0.930 0.365 0.921 0.367 0.910 Stdev 0.544 1.05 0.548 1.04 0.553 1.04 p (t-test) 1.6E8 3.3E8 8.1E8 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 139 177 137 179 134 182 UO only Median 0.339 0.576 0.339 0.552 0.340 0.531 Average 0.574 0.915 0.581 0.872 0.564 0.869 Stdev 0.811 1.06 0.826 1.03 0.792 1.05 p (t-test) 0.0019 0.0069 0.0037 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 215 99 206 108 193 121 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.72 0.73 0.61 0.72 0.72 0.60 0.71 0.72 0.59 SE 0.028 0.028 0.035 0.028 0.028 0.034 0.029 0.028 0.033 p Value 1.6E15 4.4E16 0.0012 8.4E15 3.8E15 0.0023 1.7E12 2.5E14 0.0054 nCohort 133 139 215 124 137 206 113 134 193 Recovered nCohort 183 177 99 192 179 108 203 182 121 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 84% 80% 84% 84% 80% 83% 84% 78% Specificity 38% 37% 27% 40% 36% 28% 40% 37% 27% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 66% 67% 64% 64% 66% 62% 62% 65% 60% Specificity 71% 71% 56% 72% 71% 56% 72% 70% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 34% 36% 35% 33% 36% 33% 32% 35% 32% Specificity 88% 89% 80% 88% 89% 79% 88% 89% 79% OR Quartile 2 3.20 3.08 1.49 3.53 2.97 1.50 3.29 2.92 1.28 p Value 1.7E5 3.2E5 0.17 3.2E6 5.3E5 0.16 9.4E6 6.5E5 0.36 Lower limit of 1.88 1.81 0.841 2.08 1.75 0.855 1.94 1.73 0.753 95% CI Upper limit of 5.43 5.24 2.65 6.00 5.04 2.62 5.57 4.94 2.19 95% CI OR Quartile 3 4.76 4.95 2.25 4.53 4.69 2.11 4.14 4.33 1.97 p Value 2.7E10 8.0E11 0.0012 1.5E9 3.0E10 0.0022 2.2E8 2.0E9 0.0039 Lower limit of 2.93 3.06 1.38 2.78 2.90 1.31 2.52 2.68 1.24 95% CI Upper limit of 7.73 8.02 3.68 7.40 7.59 3.39 6.81 7.00 3.13 95% CI OR Quartile 4 3.84 4.68 2.13 3.63 4.53 1.90 3.33 4.30 1.82 p Value 1.3E5 9.5E7 0.0052 4.2E5 1.6E6 0.016 1.9E4 3.6E6 0.023 Lower limit of 2.10 2.53 1.25 1.96 2.44 1.12 1.77 2.32 1.09 95% CI Upper limit of 7.03 8.68 3.61 6.74 8.39 3.20 6.27 7.98 3.05 95% CI

TABLE-US-00063 TABLE 10.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.306 0.582 0.309 0.579 0.309 0.579 Average 0.509 0.928 0.510 0.917 0.510 0.917 Stdev 0.748 1.05 0.754 1.04 0.754 1.04 p (t-test) 4.4E5 7.1E5 7.1E5 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 187 129 184 132 184 132 sCr only Median 0.259 0.593 0.252 0.587 0.259 0.584 Average 0.449 0.914 0.451 0.903 0.453 0.899 Stdev 0.739 0.999 0.746 0.993 0.748 0.991 p (t-test) 3.7E6 7.0E6 9.5E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 159 157 156 160 155 161 UO only Median 0.331 0.584 0.332 0.576 0.331 0.571 Average 0.553 0.941 0.555 0.925 0.546 0.933 Stdev 0.777 1.09 0.782 1.08 0.767 1.09 p (t-test) 3.4E4 5.9E4 2.9E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 210 104 207 107 204 110 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.71 0.62 0.66 0.70 0.61 0.66 0.70 0.62 SE 0.031 0.029 0.034 0.031 0.029 0.034 0.031 0.029 0.034 p Value 1.4E7 1.6E12 5.3E4 1.7E7 3.3E12 7.9E4 1.7E7 8.2E12 6.7E4 nCohort 187 159 210 184 156 207 184 155 204 Recovered nCohort 129 157 104 132 160 107 132 161 110 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 85% 85% 79% 86% 85% 79% 86% 84% 78% Specificity 32% 35% 27% 33% 35% 27% 33% 35% 27% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 66% 67% 62% 65% 66% 62% 65% 66% 62% Specificity 61% 67% 56% 61% 67% 56% 61% 66% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 33% 36% 37% 33% 35% 36% 33% 35% 36% Specificity 81% 86% 80% 81% 85% 81% 81% 85% 81% OR Quartile 2 2.74 2.93 1.39 2.88 3.09 1.35 2.88 2.91 1.32 p Value 6.1E4 1.1E4 0.25 3.2E4 4.9E5 0.28 3.2E4 1.1E4 0.32 Lower limit of 1.54 1.70 0.793 1.62 1.79 0.778 1.62 1.70 0.765 95% CI Upper limit of 4.86 5.05 2.43 5.12 5.32 2.36 5.12 4.99 2.29 95% CI OR Quartile 3 3.02 4.04 2.14 2.91 3.93 2.05 2.91 3.82 2.09 p Value 3.7E6 5.1E9 0.0020 6.7E6 9.6E9 0.0031 6.7E6 1.8E8 0.0023 Lower limit of 1.89 2.53 1.32 1.83 2.46 1.27 1.83 2.40 1.30 95% CI Upper limit of 4.82 6.45 3.46 4.63 6.26 3.31 4.63 6.08 3.36 95% CI OR Quartile 4 2.10 3.28 2.37 2.13 3.11 2.39 2.13 3.06 2.42 p Value 0.0049 2.3E5 0.0013 0.0041 5.0E5 0.0011 0.0041 6.5E5 9.2E4 Lower limit of 1.25 1.89 1.40 1.27 1.80 1.42 1.27 1.77 1.43 95% CI Upper limit of 3.51 5.68 4.01 3.57 5.39 4.04 3.57 5.30 4.08 95% CI

Example 11. Use of Complement C5 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0156] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Complement C5 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0157] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0158] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00064 TABLE 11.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non-Recovered recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.224 0.546 0.224 0.535 0.224 0.529 Average 0.341 0.856 0.346 0.844 0.345 0.835 Stdev 0.586 0.992 0.596 0.986 0.605 0.980 p (t-test) 1.2E6 3.2E6 6.0E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 108 208 104 212 100 216 sCr only Median 0.233 0.576 0.233 0.566 0.237 0.559 Average 0.340 0.906 0.342 0.899 0.345 0.891 Stdev 0.551 1.02 0.555 1.02 0.559 1.02 p (t-test) 3.0E8 5.6E8 1.1E7 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 126 189 124 191 122 193 UO only Median 0.341 0.538 0.348 0.503 0.341 0.520 Average 0.565 0.959 0.567 0.903 0.555 0.894 Stdev 0.707 1.23 0.711 1.18 0.700 1.15 p (t-test) 4.1E4 0.0018 0.0013 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 221 93 207 107 197 117 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.74 0.59 0.72 0.74 0.58 0.72 0.73 0.58 SE 0.028 0.027 0.036 0.029 0.028 0.034 0.029 0.028 0.034 p Value 1.1E15 0 0.0099 1.4E14 0 0.028 3.4E14 2.2E16 0.016 nCohort 108 126 221 104 124 207 100 122 197 Recovered nCohort 208 189 93 212 191 107 216 193 117 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 82% 84% 77% 82% 84% 76% 81% 83% 76% Specificity 39% 39% 26% 38% 39% 26% 39% 39% 26% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 64% 66% 62% 63% 65% 59% 62% 65% 59% Specificity 78% 74% 55% 77% 73% 55% 77% 73% 55% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 34% 36% 33% 33% 36% 33% 33% 35% 32% Specificity 93% 91% 78% 92% 91% 79% 93% 91% 79% OR Quartile 2 2.94 3.37 1.22 2.77 3.26 1.07 2.81 3.15 1.11 p Value 5.7E5 6.8E6 0.49 1.5E4 1.1E5 0.80 1.3E4 1.9E5 0.70 Lower limit of 1.74 1.99 0.689 1.64 1.92 0.624 1.66 1.86 0.653 95% CI Upper limit of 4.97 5.73 2.16 4.69 5.53 1.84 4.77 5.34 1.89 95% CI OR Quartile 3 6.34 5.50 2.04 5.73 5.22 1.72 5.58 4.96 1.78 p Value 1.4E11 2.0E11 0.0048 1.6E10 7.4E11 0.024 4.8E10 2.7E10 0.015 Lower limit of 3.71 3.34 1.24 3.35 3.18 1.07 3.25 3.02 1.12 95% CI Upper limit of 10.8 9.06 3.35 9.78 8.59 2.76 9.59 8.15 2.83 95% CI OR Quartile 4 6.48 5.88 1.80 6.04 5.68 1.80 6.64 5.49 1.83 p Value 2.3E6 4.2E7 0.032 5.5E6 7.0E7 0.028 5.8E6 1.2E6 0.022 Lower limit of 2.98 2.96 1.05 2.78 2.86 1.07 2.93 2.76 1.09 95% CI Upper limit of 14.1 11.7 3.08 13.1 11.3 3.04 15.1 10.9 3.07 95% CI

TABLE-US-00065 TABLE 11.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.239 0.579 0.239 0.571 0.239 0.559 Average 0.389 0.900 0.392 0.892 0.394 0.877 Stdev 0.585 1.04 0.589 1.03 0.598 1.03 p (t-test) 4.5E7 8.1E7 2.3E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 136 180 134 182 129 187 sCr only Median 0.244 0.584 0.252 0.584 0.265 0.583 Average 0.390 0.939 0.392 0.934 0.395 0.925 Stdev 0.564 1.07 0.565 1.06 0.569 1.06 p (t-test) 4.2E8 6.2E8 1.3E7 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 149 167 148 168 146 170 UO only Median 0.340 0.610 0.340 0.576 0.339 0.571 Average 0.556 1.000 0.560 0.961 0.553 0.926 Stdev 0.727 1.21 0.734 1.18 0.729 1.14 p (t-test) 8.2E5 3.0E4 5.2E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 225 89 219 95 206 108 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.71 0.63 0.70 0.71 0.61 0.70 0.70 0.61 SE 0.029 0.029 0.036 0.029 0.029 0.035 0.029 0.029 0.034 p Value 3.8E13 1.3E13 5.2E4 1.5E12 4.2E13 0.0014 1.1E11 2.9E12 0.0017 nCohort 136 149 225 134 148 219 129 146 206 Recovered nCohort 180 167 89 182 168 95 187 170 108 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 83% 84% 81% 83% 83% 80% 82% 83% 79% Specificity 36% 35% 28% 36% 34% 27% 36% 34% 27% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 66% 67% 65% 65% 67% 63% 64% 66% 61% Specificity 71% 69% 56% 71% 69% 56% 71% 68% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 34% 36% 38% 34% 36% 37% 34% 35% 35% Specificity 88% 87% 80% 87% 87% 80% 88% 87% 80% OR Quartile 2 2.82 2.78 1.61 2.72 2.63 1.51 2.59 2.53 1.38 p Value 1.1E4 1.7E4 0.12 1.8E4 3.4E4 0.17 3.5E4 5.3E4 0.25 Lower limit of 1.66 1.63 0.881 1.61 1.55 0.842 1.54 1.50 0.793 95% CI Upper limit of 4.76 4.73 2.95 4.59 4.46 2.71 4.35 4.28 2.40 95% CI OR Quartile 3 4.85 4.56 2.38 4.60 4.43 2.16 4.29 4.20 1.99 p Value 1.5E10 3.6E10 8.4E4 5.4E10 6.9E10 0.0023 3.3E9 2.5E9 0.0046 Lower limit of 2.99 2.84 1.43 2.84 2.76 1.31 2.65 2.62 1.24 95% CI Upper limit of 7.87 7.33 3.96 7.45 7.12 3.54 6.95 6.73 3.19 95% CI OR Quartile 4 3.68 3.84 2.47 3.56 3.77 2.32 3.59 3.65 2.18 p Value 1.7E5 4.7E6 9.8E4 2.8E5 6.2E6 0.0019 3.5E5 1.1E5 0.0034 Lower limit of 2.03 2.16 1.44 1.96 2.12 1.36 1.96 2.05 1.30 95% CI Upper limit of 6.66 6.82 4.24 6.44 6.71 3.95 6.57 6.48 3.68 95% CI

TABLE-US-00066 TABLE 11.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.239 0.599 0.239 0.593 0.243 0.584 Average 0.399 0.944 0.402 0.934 0.408 0.917 Stdev 0.583 1.07 0.586 1.06 0.593 1.06 p (t-test) 4.8E8 1.0E7 4.0E7 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 153 163 151 165 147 169 sCr only Median 0.252 0.596 0.259 0.593 0.260 0.591 Average 0.406 0.961 0.408 0.955 0.409 0.950 Stdev 0.573 1.09 0.574 1.08 0.576 1.08 p (t-test) 2.8E8 4.2E8 6.3E8 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 160 156 159 157 158 158 UO only Median 0.339 0.659 0.339 0.639 0.340 0.593 Average 0.583 0.924 0.584 0.917 0.581 0.886 Stdev 0.832 1.04 0.834 1.04 0.832 1.03 p (t-test) 0.0024 0.0030 0.0051 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 223 91 222 92 211 103 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.71 0.63 0.72 0.71 0.63 0.71 0.71 0.62 SE 0.028 0.029 0.036 0.028 0.029 0.036 0.029 0.029 0.034 p Value 1.6E15 1.0E13 1.6E4 1.7E14 3.4E13 2.0E4 6.7E13 9.9E13 6.8E4 nCohort 153 160 223 151 159 222 147 158 211 Recovered nCohort 163 156 91 165 157 92 169 158 103 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 86% 85% 82% 85% 85% 83% 84% 84% 81% Specificity 37% 35% 28% 36% 35% 28% 35% 34% 28% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 69% 69% 66% 68% 68% 65% 67% 68% 62% Specificity 71% 68% 57% 70% 68% 56% 69% 68% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 36% 37% 38% 36% 36% 38% 35% 36% 36% Specificity 87% 86% 80% 87% 86% 80% 86% 86% 80% OR Quartile 2 3.51 3.11 1.85 3.12 2.93 1.88 2.88 2.76 1.61 p Value 7.6E6 5.0E5 0.050 3.7E5 1.1E4 0.043 1.0E4 2.2E4 0.10 Lower limit of 2.03 1.80 0.999 1.82 1.70 1.02 1.69 1.61 0.908 95% CI Upper limit of 6.09 5.39 3.41 5.35 5.05 3.47 4.90 4.74 2.86 95% CI OR Quartile 3 5.42 4.67 2.51 5.12 4.53 2.42 4.57 4.40 2.08 p Value 5.8E12 1.9E10 3.7E4 2.4E11 3.8E10 6.1E4 3.5E10 7.3E10 0.0029 Lower limit of 3.35 2.90 1.51 3.17 2.82 1.46 2.84 2.75 1.29 95% CI Upper limit of 8.78 7.50 4.18 8.26 7.27 4.00 7.35 7.05 3.37 95% CI OR Quartile 4 3.77 3.61 2.54 3.65 3.55 2.48 3.41 3.49 2.26 p Value 4.7E6 5.9E6 6.4E4 8.1E6 7.8E6 8.5E4 2.3E5 1.0E5 0.0024 Lower limit of 2.14 2.07 1.49 2.07 2.04 1.46 1.93 2.00 1.33 95% CI Upper limit of 6.66 6.29 4.35 6.43 6.19 4.24 6.01 6.08 3.82 95% CI

TABLE-US-00067 TABLE 11.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.259 0.610 0.260 0.605 0.266 0.596 Average 0.464 0.922 0.466 0.911 0.473 0.893 Stdev 0.758 0.997 0.764 0.991 0.772 0.985 p (t-test) 5.5E6 9.9E6 3.2E5 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 167 149 164 152 160 156 sCr only Median 0.270 0.610 0.274 0.605 0.277 0.600 Average 0.467 0.931 0.469 0.926 0.471 0.921 Stdev 0.750 1.01 0.751 1.01 0.753 1.01 p (t-test) 4.2E6 5.9E6 8.2E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 171 145 170 146 169 147 UO only Median 0.336 0.614 0.332 0.619 0.339 0.593 Average 0.575 0.939 0.574 0.937 0.580 0.896 Stdev 0.816 1.07 0.817 1.06 0.829 1.03 p (t-test) 0.0012 0.0011 0.0039 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 222 92 221 93 213 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.70 0.63 0.70 0.70 0.63 0.69 0.69 0.62 SE 0.029 0.030 0.036 0.029 0.030 0.035 0.030 0.030 0.035 p Value 9.8E13 7.9E12 2.4E4 2.7E12 2.3E11 1.5E4 7.3E11 6.1E11 6.1E4 nCohort 167 171 222 164 170 221 160 169 213 Recovered nCohort 149 145 92 152 146 93 156 147 101 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 85% 85% 82% 84% 84% 82% 83% 84% 80% Specificity 34% 33% 28% 34% 33% 28% 33% 33% 28% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 70% 69% 65% 69% 68% 66% 67% 68% 63% Specificity 68% 66% 56% 68% 66% 57% 67% 66% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 36% 37% 37% 36% 37% 38% 35% 37% 36% Specificity 85% 85% 80% 85% 85% 80% 85% 85% 80% OR Quartile 2 2.99 2.80 1.71 2.69 2.63 1.74 2.48 2.47 1.55 p Value 1.1E4 2.8E4 0.081 3.6E4 5.5E4 0.070 8.8E4 0.0011 0.13 Lower limit of 1.72 1.61 0.936 1.56 1.52 0.955 1.45 1.44 0.874 95% CI Upper limit of 5.21 4.86 3.12 4.63 4.55 3.18 4.23 4.26 2.75 95% CI OR Quartile 3 4.84 4.33 2.42 4.68 4.20 2.48 4.16 4.07 2.23 p Value 9.3E11 1.3E9 6.1E4 1.9E10 2.5E9 4.0E4 2.7E9 4.8E9 0.0012 Lower limit of 3.00 2.70 1.46 2.91 2.62 1.50 2.60 2.54 1.37 95% CI Upper limit of 7.79 6.95 4.00 7.52 6.73 4.11 6.65 6.52 3.63 95% CI OR Quartile 4 3.23 3.47 2.31 3.31 3.40 2.43 3.09 3.34 2.19 p Value 2.1E5 6.9E6 0.0022 1.7E5 9.2E6 0.0011 4.9E5 1.2E5 0.0036 Lower limit of 1.88 2.02 1.35 1.92 1.98 1.42 1.79 1.95 1.29 95% CI Upper limit of 5.54 5.96 3.94 5.70 5.85 4.14 5.32 5.75 3.71 95% CI

TABLE-US-00068 TABLE 11.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.312 0.596 0.312 0.596 0.313 0.593 Average 0.536 0.934 0.537 0.927 0.539 0.920 Stdev 0.771 1.06 0.774 1.06 0.776 1.06 p (t-test) 1.6E4 2.0E4 2.7E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 202 114 200 116 199 117 sCr only Median 0.292 0.632 0.292 0.632 0.292 0.632 Average 0.494 0.939 0.494 0.939 0.494 0.939 Stdev 0.763 1.02 0.763 1.02 0.763 1.02 p (t-test) 1.3E5 1.3E5 1.3E5 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 184 132 184 132 184 132 UO only Median 0.331 0.601 0.329 0.610 0.332 0.593 Average 0.557 0.955 0.556 0.954 0.560 0.938 Stdev 0.785 1.09 0.787 1.09 0.790 1.08 p (t-test) 2.9E4 2.9E4 5.2E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 216 98 215 99 213 101 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.69 0.63 0.66 0.69 0.63 0.65 0.69 0.63 SE 0.033 0.031 0.035 0.033 0.031 0.035 0.033 0.031 0.035 p Value 1.4E6 1.8E10 1.7E4 1.4E6 1.8E10 1.1E4 2.4E6 1.8E10 2.7E4 nCohort 202 184 216 200 184 215 199 184 213 Recovered nCohort 114 132 98 116 132 99 117 132 101 Non-recovered Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 85% 81% 84% 85% 81% 84% 85% 80% Specificity 30% 32% 28% 30% 32% 28% 30% 32% 28% Cutoff Quartile 3 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 0.384 Sensitivity 67% 69% 63% 66% 69% 64% 66% 69% 62% Specificity 59% 64% 56% 60% 64% 56% 59% 64% 56% Cutoff Quartile 4 0.724 0.724 0.728 0.724 0.724 0.728 0.724 0.724 0.728 Sensitivity 34% 38% 38% 34% 38% 38% 34% 38% 38% Specificity 80% 84% 81% 80% 84% 81% 80% 84% 81% OR Quartile 2 2.31 2.64 1.60 2.19 2.64 1.63 2.23 2.64 1.55 p Value 0.0052 7.9E4 0.11 0.0079 7.9E4 0.10 0.0066 7.9E4 0.13 Lower limit of 1.28 1.50 0.893 1.23 1.50 0.911 1.25 1.50 0.874 95% CI Upper limit of 4.15 4.66 2.86 3.90 4.66 2.92 3.97 4.66 2.75 95% CI OR Quartile 3 2.93 3.88 2.19 2.90 3.88 2.25 2.80 3.88 2.10 p Value 1.2E5 2.3E8 0.0017 1.2E5 2.3E8 0.0012 2.1E5 2.3E8 0.0027 Lower limit of 1.81 2.41 1.34 1.80 2.41 1.38 1.74 2.41 1.29 95% CI Upper limit of 4.73 6.24 3.58 4.68 6.24 3.68 4.51 6.24 3.41 95% CI OR Quartile 4 2.11 3.26 2.51 2.17 3.26 2.64 2.13 3.26 2.53 p Value 0.0049 1.2E5 6.5E4 0.0034 1.2E5 3.2E4 0.0042 1.2E5 5.6E4 Lower limit of 1.25 1.92 1.48 1.29 1.92 1.56 1.27 1.92 1.49 95% CI Upper limit of 3.54 5.54 4.27 3.65 5.54 4.49 3.58 5.54 4.29 95% CI

Example 8. Use of Complement C5 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0159] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Complement C5 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0160] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0161] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00069 TABLE 12.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.306 0.619 0.304 0.632 0.324 0.632 Average 0.469 1.07 0.478 1.15 0.499 1.20 Stdev 0.609 1.20 0.618 1.24 0.614 1.33 p (t-test) 8.1E9 5.8E10 5.2E10 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 205 111 221 95 235 81 sCr only Median 0.312 0.600 0.306 0.632 0.322 0.632 Average 0.509 1.01 0.513 1.08 0.529 1.11 Stdev 0.733 1.11 0.732 1.14 0.726 1.20 p (t-test) 2.5E6 2.2E7 3.7E7 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 208 107 223 92 234 81 UO only Median 0.362 0.802 0.362 0.975 0.362 0.988 Average 0.588 1.32 0.588 1.38 0.586 1.42 Stdev 0.787 1.35 0.783 1.39 0.782 1.39 p (t-test) 1.4E6 4.3E7 1.5E7 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 274 40 277 37 278 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.68 0.67 0.72 0.71 0.67 0.69 0.69 0.69 SE 0.032 0.033 0.049 0.033 0.034 0.051 0.036 0.036 0.051 p Value 5.6E10 3.8E8 4.4E4 4.2E11 1.5E9 7.0E4 6.3E8 3.0E7 2.0E4 nCohort 205 208 274 221 223 277 235 234 278 Non-persistent nCohort Persistent 111 107 40 95 92 37 81 81 36 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 86% 84% 85% 87% 86% 84% 86% 85% 86% Specificity 31% 30% 27% 30% 30% 26% 29% 29% 27% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 71% 70% 65% 76% 75% 65% 73% 73% 67% Specificity 61% 60% 52% 61% 60% 52% 58% 58% 52% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 39% 37% 52% 41% 40% 54% 41% 40% 56% Specificity 82% 81% 79% 82% 81% 79% 80% 80% 79% OR Quartile 2 2.63 2.25 2.06 3.01 2.55 1.85 2.59 2.31 2.25 p Value 0.0018 0.0079 0.12 0.0013 0.0049 0.19 0.0073 0.015 0.11 Lower limit of 1.44 1.24 0.830 1.54 1.33 0.741 1.29 1.17 0.843 95% CI Upper limit of 4.83 4.09 5.10 5.88 4.91 4.61 5.19 4.53 6.00 95% CI OR Quartile 3 3.94 3.53 2.03 4.91 4.52 2.00 3.68 3.66 2.18 p Value 6.8E8 7.0E7 0.045 8.4E9 5.2E8 0.058 3.9E6 4.5E6 0.037 Lower limit of 2.39 2.14 1.02 2.86 2.63 0.978 2.12 2.10 1.05 95% CI Upper limit of 6.48 5.81 4.05 8.45 7.77 4.09 6.41 6.36 4.53 95% CI OR Quartile 4 2.97 2.59 4.12 3.15 2.90 4.35 2.82 2.60 4.64 p Value 4.8E5 3.8E4 5.1E5 2.5E5 9.7E5 4.7E5 2.0E4 6.4E4 2.8E5 Lower limit of 1.76 1.53 2.08 1.85 1.70 2.14 1.63 1.50 2.26 95% CI Upper limit of 5.02 4.37 8.17 5.37 4.95 8.82 4.89 4.50 9.51 95% CI

TABLE-US-00070 TABLE 12.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.295 0.614 0.301 0.632 0.305 0.651 Average 0.450 1.01 0.464 1.07 0.478 1.13 Stdev 0.608 1.14 0.616 1.18 0.612 1.24 p (t-test) 3.6E8 4.7E9 1.3E9 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 186 130 204 112 218 98 sCr only Median 0.303 0.593 0.303 0.610 0.312 0.621 Average 0.501 0.958 0.508 1.00 0.521 1.03 Stdev 0.741 1.07 0.743 1.09 0.736 1.13 p (t-test) 1.0E5 2.8E6 2.8E6 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 192 123 206 109 217 98 UO only Median 0.348 0.692 0.352 0.692 0.350 0.730 Average 0.572 1.15 0.573 1.19 0.571 1.21 Stdev 0.788 1.21 0.782 1.25 0.781 1.25 p (t-test) 7.1E6 3.3E6 1.6E6 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 255 59 259 55 260 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.67 0.67 0.71 0.69 0.67 0.71 0.68 0.68 SE 0.031 0.032 0.041 0.032 0.032 0.043 0.033 0.034 0.043 p Value 7.9E11 7.5E8 3.4E5 2.8E11 5.9E9 9.6E5 3.8E10 1.2E7 3.0E5 nCohort 186 192 255 204 206 259 218 217 260 Non-persistent nCohort Persistent 130 123 59 112 109 55 98 98 54 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 85% 83% 85% 86% 84% 84% 87% 85% 85% Specificity 32% 30% 27% 31% 30% 27% 30% 29% 27% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 70% 68% 68% 73% 72% 67% 73% 71% 69% Specificity 64% 61% 54% 63% 61% 54% 61% 59% 54% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 38% 36% 49% 40% 38% 49% 42% 38% 50% Specificity 84% 82% 80% 83% 82% 80% 83% 81% 80% OR Quartile 2 2.56 2.10 2.10 2.68 2.33 1.89 2.84 2.31 2.16 p Value 0.0012 0.0095 0.056 0.0014 0.0055 0.10 0.0017 0.0082 0.059 Lower limit of 1.45 1.20 0.982 1.46 1.28 0.881 1.48 1.24 0.972 95% CI Upper limit of 4.51 3.69 4.50 4.92 4.23 4.07 5.45 4.31 4.80 95% CI OR Quartile 3 4.14 3.43 2.48 4.60 3.96 2.38 4.25 3.66 2.54 p Value 6.4E9 4.3E7 0.0029 3.2E9 7.5E8 0.0056 6.3E8 7.8E7 0.0034 Lower limit of 2.56 2.13 1.36 2.78 2.40 1.29 2.52 2.19 1.36 95% CI Upper limit of 6.70 5.54 4.52 7.63 6.54 4.40 7.18 6.14 4.74 95% CI OR Quartile 4 3.38 2.50 3.96 3.36 2.67 3.84 3.41 2.53 4.00 p Value 6.8E6 5.5E4 6.1E6 6.8E6 2.4E4 1.5E5 6.4E6 6.0E4 9.6E6 Lower limit of 1.99 1.49 2.18 1.98 1.58 2.09 2.00 1.49 2.16 95% CI Upper limit of 5.75 4.20 7.20 5.69 4.50 7.06 5.80 4.29 7.39 95% CI

TABLE-US-00071 TABLE 12.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.290 0.619 0.292 0.651 0.302 0.658 Average 0.438 0.980 0.448 1.03 0.470 1.06 Stdev 0.613 1.10 0.625 1.13 0.627 1.18 p (t-test) 6.8E8 1.2E8 1.4E8 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 175 141 190 126 204 112 sCr only Median 0.302 0.599 0.301 0.638 0.304 0.638 Average 0.488 0.942 0.493 0.983 0.513 0.999 Stdev 0.750 1.04 0.753 1.05 0.748 1.09 p (t-test) 9.3E6 2.3E6 4.9E6 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 182 133 195 120 207 108 UO only Median 0.343 0.681 0.345 0.678 0.345 0.678 Average 0.574 1.06 0.573 1.11 0.573 1.11 Stdev 0.801 1.15 0.793 1.18 0.793 1.18 p (t-test) 6.4E5 2.3E5 2.3E5 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 245 69 250 64 250 64 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.68 0.66 0.72 0.70 0.66 0.71 0.69 0.66 SE 0.030 0.031 0.039 0.030 0.031 0.040 0.031 0.033 0.040 p Value 5.0E12 2.7E9 4.3E5 1.7E13 4.2E11 5.9E5 2.2E11 5.4E9 5.9E5 nCohort 175 182 245 190 195 250 204 207 250 Non-persistent nCohort Persistent 141 133 69 126 120 64 112 108 64 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 83% 84% 86% 85% 84% 87% 85% 84% Specificity 33% 31% 28% 32% 31% 28% 31% 30% 28% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 70% 68% 67% 73% 72% 67% 73% 71% 67% Specificity 66% 63% 55% 65% 63% 54% 63% 61% 54% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 38% 37% 45% 40% 39% 45% 40% 39% 45% Specificity 86% 84% 80% 85% 84% 80% 83% 82% 80% OR Quartile 2 2.61 2.30 2.03 2.84 2.58 2.06 2.96 2.52 2.06 p Value 6.8E4 0.0032 0.049 4.7E4 0.0015 0.052 6.0E4 0.0029 0.052 Lower limit of 1.50 1.32 1.00 1.58 1.44 0.993 1.59 1.37 0.993 95% CI Upper limit of 4.55 4.01 4.09 5.09 4.63 4.27 5.49 4.62 4.27 95% CI OR Quartile 3 4.37 3.72 2.41 5.08 4.32 2.44 4.60 3.86 2.44 p Value 1.2E9 5.5E8 0.0020 1.1E10 5.6E9 0.0025 3.2E9 1.3E7 0.0025 Lower limit of 2.72 2.32 1.38 3.10 2.64 1.37 2.78 2.34 1.37 95% CI Upper limit of 7.03 5.97 4.23 8.33 7.07 4.35 7.63 6.38 4.35 95% CI OR Quartile 4 3.72 2.96 3.35 3.65 3.28 3.31 3.36 2.92 3.31 p Value 2.1E6 5.5E5 3.2E5 1.9E6 1.0E5 5.4E5 6.8E6 6.3E5 5.4E5 Lower limit of 2.16 1.75 1.89 2.14 1.94 1.85 1.98 1.73 1.85 95% CI Upper limit of 6.41 5.00 5.92 6.22 5.56 5.93 5.69 4.94 5.93 95% CI

TABLE-US-00072 TABLE 12.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.290 0.610 0.295 0.644 0.302 0.651 Average 0.439 0.971 0.450 1.02 0.469 1.04 Stdev 0.616 1.10 0.627 1.13 0.628 1.17 p (t-test) 1.2E7 1.9E8 2.7E8 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 173 143 189 127 200 116 sCr only Median 0.303 0.593 0.301 0.632 0.304 0.632 Average 0.492 0.930 0.496 0.966 0.512 0.983 Stdev 0.754 1.03 0.758 1.04 0.752 1.08 p (t-test) 1.8E5 5.8E6 8.0E6 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 180 135 192 123 203 112 UO only Median 0.339 0.664 0.340 0.664 0.340 0.664 Average 0.566 1.04 0.566 1.09 0.566 1.09 Stdev 0.794 1.13 0.785 1.17 0.785 1.17 p (t-test) 6.2E5 2.0E5 2.0E5 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 238 76 244 70 244 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.67 0.66 0.72 0.70 0.66 0.71 0.68 0.66 SE 0.030 0.031 0.038 0.030 0.031 0.039 0.031 0.032 0.039 p Value 1.1E11 1.5E8 2.6E5 6.3E13 3.0E10 4.2E5 4.8E11 1.1E8 4.2E5 nCohort 173 180 238 189 192 244 200 203 244 Non-persistent nCohort Persistent 143 135 76 127 123 70 116 112 70 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 82% 84% 85% 84% 84% 85% 84% 84% Specificity 32% 31% 28% 32% 31% 28% 31% 30% 28% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 69% 67% 67% 72% 71% 67% 72% 71% 67% Specificity 66% 63% 55% 65% 63% 55% 63% 61% 55% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 38% 36% 42% 39% 38% 43% 40% 38% 43% Specificity 86% 83% 80% 85% 83% 80% 84% 82% 80% OR Quartile 2 2.50 2.04 2.09 2.64 2.28 2.07 2.62 2.24 2.07 p Value 0.0011 0.010 0.033 9.4E4 0.0044 0.042 0.0015 0.0070 0.042 Lower limit of 1.44 1.18 1.06 1.49 1.29 1.03 1.44 1.25 1.03 95% CI Upper limit of 4.32 3.50 4.12 4.70 4.03 4.18 4.75 4.03 4.18 95% CI OR Quartile 3 4.35 3.49 2.54 4.90 4.12 2.49 4.47 3.76 2.49 p Value 1.3E9 1.9E7 7.6E4 2.2E10 1.2E8 0.0014 3.8E9 1.6E7 0.0014 Lower limit of 2.71 2.18 1.48 3.00 2.53 1.42 2.72 2.29 1.42 95% CI Upper limit of 6.99 5.58 4.37 8.00 6.70 4.35 7.36 6.16 4.35 95% CI OR Quartile 4 3.59 2.85 2.96 3.58 3.09 2.98 3.33 2.89 2.98 p Value 3.8E6 9.6E5 1.3E4 2.6E6 2.6E5 1.6E4 7.9E6 7.2E5 1.6E4 Lower limit of 2.09 1.68 1.69 2.10 1.83 1.69 1.96 1.71 1.69 95% CI Upper limit of 6.18 4.82 5.15 6.10 5.23 5.27 5.63 4.88 5.27 95% CI

TABLE-US-00073 TABLE 12.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.280 0.610 0.285 0.632 0.302 0.632 Average 0.433 0.964 0.448 1.00 0.471 1.02 Stdev 0.618 1.09 0.631 1.11 0.634 1.15 p (t-test) 1.2E7 4.1E8 9.7E8 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 169 147 184 132 196 120 sCr only Median 0.302 0.593 0.298 0.632 0.303 0.632 Average 0.488 0.922 0.493 0.956 0.509 0.973 Stdev 0.758 1.02 0.762 1.03 0.755 1.07 p (t-test) 2.0E5 6.6E6 9.5E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 176 139 188 127 199 116 UO only Median 0.329 0.667 0.336 0.660 0.336 0.660 Average 0.543 1.08 0.546 1.09 0.546 1.09 Stdev 0.763 1.15 0.759 1.17 0.759 1.17 p (t-test) 3.5E6 3.0E6 3.0E6 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 6.00 5.72 6.00 5.72 6.00 5.72 n (Patient) 233 81 236 78 236 78 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.68 0.68 0.72 0.70 0.67 0.70 0.68 0.67 SE 0.029 0.031 0.036 0.030 0.031 0.037 0.031 0.032 0.037 p Value 2.3E12 9.3E9 1.1E6 5.6E13 1.9E10 5.2E6 1.7E10 7.7E9 5.2E6 nCohort 169 176 233 184 188 236 196 199 236 Non-persistent nCohort Persistent 147 139 81 132 127 78 120 116 78 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 82% 85% 85% 83% 85% 85% 84% 85% Specificity 33% 31% 29% 32% 31% 28% 31% 30% 28% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 69% 67% 69% 71% 70% 68% 71% 70% 68% Specificity 66% 63% 57% 65% 63% 56% 63% 61% 56% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 38% 37% 43% 39% 39% 42% 38% 39% 42% Specificity 86% 84% 81% 85% 84% 81% 83% 83% 81% OR Quartile 2 2.47 2.02 2.32 2.64 2.25 2.18 2.56 2.20 2.18 p Value 0.0011 0.011 0.015 7.9E4 0.0046 0.024 0.0016 0.0073 0.024 Lower limit of 1.44 1.18 1.18 1.50 1.28 1.11 1.43 1.24 1.11 95% CI Upper limit of 4.26 3.46 4.56 4.66 3.95 4.29 4.60 3.93 4.29 95% CI OR Quartile 3 4.31 3.45 2.93 4.64 4.04 2.69 4.09 3.67 2.69 p Value 1.3E9 2.0E7 9.1E5 5.1E10 1.4E8 3.3E4 1.6E8 1.8E7 3.3E4 Lower limit of 2.69 2.16 1.71 2.86 2.49 1.57 2.51 2.25 1.57 95% CI Upper limit of 6.92 5.51 5.01 7.52 6.54 4.62 6.67 5.98 4.62 95% CI OR Quartile 4 3.91 3.06 3.27 3.51 3.31 3.03 3.07 3.08 3.03 p Value 1.3E6 3.6E5 2.3E5 4.0E6 9.3E6 8.5E5 2.8E5 2.7E5 8.5E5 Lower limit of 2.25 1.80 1.89 2.06 1.95 1.74 1.82 1.82 1.74 95% CI Upper limit of 6.78 5.21 5.66 5.98 5.62 5.26 5.19 5.20 5.26 95% CI

Example 9. Use of Complement C5 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0162] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Complement C5 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0163] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0164] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00074 TABLE 13.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.216 0.566 0.279 0.587 0.279 0.614 Average 0.335 0.888 0.425 0.935 0.430 1.00 Stdev 0.564 1.01 0.593 1.08 0.578 1.13 p (t-test) 8.2E8 3.7E7 1.3E8 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 119 197 158 158 178 138 sCr only Median 0.237 0.576 0.285 0.589 0.277 0.621 Average 0.383 0.888 0.437 0.937 0.440 1.01 Stdev 0.720 0.969 0.696 1.03 0.671 1.08 p (t-test) 8.0E7 6.9E7 1.8E8 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 130 185 162 153 183 132 UO only Median 0.342 0.614 0.348 0.688 0.354 0.761 Average 0.549 1.11 0.563 1.19 0.581 1.19 Stdev 0.683 1.33 0.720 1.37 0.787 1.26 p (t-test) 2.2E6 1.1E6 9.1E6 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 6.00 5.72 n (Patient) 240 74 255 59 262 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.73 0.63 0.69 0.70 0.65 0.70 0.71 0.66 SE 0.027 0.028 0.039 0.030 0.030 0.042 0.030 0.030 0.044 p Value 0 0 6.1E4 1.5E10 3.3E11 2.9E4 7.0E12 9.0E13 4.4E4 nCohort 119 130 240 158 162 255 178 183 262 Non-persistent nCohort Persistent 197 185 74 158 153 59 138 132 52 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 85% 84% 81% 84% 84% 81% 86% 86% 81% Specificity 41% 38% 27% 34% 33% 27% 33% 33% 26% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 66% 66% 65% 67% 67% 68% 71% 72% 67% Specificity 77% 73% 55% 67% 66% 54% 66% 66% 53% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 36% 36% 41% 36% 37% 47% 38% 39% 52% Specificity 92% 90% 80% 86% 86% 80% 85% 85% 80% OR Quartile 2 3.90 3.36 1.59 2.56 2.56 1.59 2.93 2.90 1.50 p Value 5.8E7 7.6E6 0.16 5.6E4 6.3E4 0.20 2.1E4 2.9E4 0.28 Lower limit of 2.29 1.98 0.833 1.50 1.49 0.779 1.66 1.63 0.715 95% CI Upper limit of 6.64 5.72 3.04 4.37 4.39 3.23 5.16 5.16 3.15 95% CI OR Quartile 3 6.76 5.38 2.22 4.16 4.01 2.48 4.82 4.89 2.36 p Value 6.5E13 2.3E11 0.0039 2.7E9 6.5E9 0.0029 1.5E10 1.7E10 0.0073 Lower limit of 4.02 3.29 1.29 2.60 2.51 1.36 2.98 3.00 1.26 95% CI Upper limit of 11.4 8.82 3.81 6.64 6.41 4.52 7.80 7.96 4.43 95% CI OR Quartile 4 6.74 4.99 2.66 3.49 3.49 3.61 3.65 3.76 4.36 p Value 4.3E7 1.1E6 6.3E4 1.0E5 8.6E6 2.4E5 2.6E6 1.4E6 3.6E6 Lower limit of 3.22 2.61 1.52 2.00 2.01 1.99 2.13 2.19 2.34 95% CI Upper limit of 14.1 9.53 4.65 6.08 6.05 6.56 6.25 6.43 8.13 95% CI

TABLE-US-00075 TABLE 13.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.215 0.556 0.244 0.593 0.243 0.632 Average 0.334 0.870 0.395 0.928 0.396 0.986 Stdev 0.578 0.996 0.578 1.06 0.565 1.09 p (t-test) 3.2E7 1.1E7 3.0E9 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 112 204 147 169 164 152 sCr only Median 0.237 0.566 0.274 0.584 0.260 0.600 Average 0.385 0.876 0.436 0.913 0.436 0.959 Stdev 0.730 0.963 0.712 1.01 0.694 1.04 p (t-test) 1.8E6 2.3E6 2.0E7 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 126 189 154 161 168 147 UO only Median 0.332 0.610 0.339 0.667 0.340 0.690 Average 0.538 1.02 0.553 1.08 0.573 1.06 Stdev 0.692 1.23 0.730 1.24 0.800 1.15 p (t-test) 1.3E5 9.1E6 6.7E5 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 6.00 5.72 n (Patient) 221 93 237 77 244 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.73 0.64 0.71 0.70 0.65 0.73 0.71 0.65 SE 0.027 0.028 0.035 0.029 0.029 0.038 0.028 0.029 0.039 p Value 0 2.2E16 1.0E4 1.5E13 2.1E11 4.8E5 2.2E16 2.6E13 8.3E5 nCohort 112 126 221 147 154 237 164 168 244 Non-persistent nCohort Persistent 204 189 93 169 161 77 152 147 70 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 84% 84% 82% 83% 83% 82% 86% 85% 81% Specificity 41% 38% 28% 35% 34% 27% 35% 34% 27% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 65% 66% 66% 67% 66% 69% 72% 70% 69% Specificity 78% 73% 57% 70% 67% 56% 70% 67% 55% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 34% 35% 39% 36% 35% 44% 39% 37% 47% Specificity 92% 90% 81% 88% 86% 81% 88% 86% 81% OR Quartile 2 3.61 3.14 1.74 2.68 2.53 1.70 3.15 2.92 1.63 p Value 2.0E6 2.1E5 0.070 2.7E4 6.2E4 0.11 5.0E5 1.5E4 0.15 Lower limit of 2.13 1.85 0.955 1.58 1.49 0.892 1.81 1.68 0.836 95% CI Upper limit of 6.13 5.31 3.18 4.54 4.30 3.24 5.48 5.08 3.16 95% CI OR Quartile 3 6.52 5.16 2.48 4.85 4.00 2.82 5.95 4.81 2.70 p Value 4.1E12 7.9E11 4.0E4 9.1E11 6.7E9 2.0E4 6.5E13 1.2E10 5.5E4 Lower limit of 3.84 3.15 1.50 3.01 2.50 1.64 3.66 2.98 1.54 95% CI Upper limit of 11.1 8.47 4.11 7.82 6.39 4.88 9.67 7.76 4.75 95% CI OR Quartile 4 5.98 4.66 2.61 4.05 3.29 3.37 4.57 3.59 3.84 p Value 2.2E6 3.1E6 4.2E4 2.8E6 2.6E5 1.7E5 1.8E7 4.6E6 3.5E6 Lower limit of 2.85 2.44 1.53 2.26 1.89 1.94 2.58 2.08 2.17 95% CI Upper limit of 12.5 8.91 4.46 7.26 5.73 5.87 8.08 6.19 6.78 95% CI

TABLE-US-00076 TABLE 13.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.216 0.552 0.243 0.587 0.243 0.610 Average 0.336 0.866 0.397 0.917 0.398 0.958 Stdev 0.581 0.995 0.584 1.05 0.576 1.08 p (t-test) 4.4E7 2.4E7 2.1E8 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 111 205 144 172 157 159 sCr only Median 0.238 0.559 0.277 0.579 0.266 0.593 Average 0.389 0.868 0.440 0.900 0.441 0.932 Stdev 0.736 0.961 0.718 1.01 0.706 1.03 p (t-test) 3.4E6 5.3E6 1.1E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 124 191 151 164 162 153 UO only Median 0.329 0.610 0.336 0.659 0.340 0.660 Average 0.528 0.996 0.547 1.02 0.568 0.996 Stdev 0.681 1.20 0.726 1.20 0.801 1.11 p (t-test) 1.5E5 3.1E5 2.1E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 6.00 5.72 n (Patient) 211 103 224 90 231 83 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.72 0.64 0.71 0.69 0.64 0.73 0.70 0.64 SE 0.028 0.028 0.034 0.029 0.030 0.036 0.028 0.029 0.037 p Value 0 3.1E15 7.1E5 5.3E13 1.3E10 7.0E5 1.6E15 4.6E12 1.3E4 nCohort 111 124 211 144 151 224 157 162 231 Non-persistent nCohort Persistent 205 191 103 172 164 90 159 153 83 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 83% 83% 82% 83% 82% 81% 86% 84% 81% Specificity 41% 37% 28% 35% 33% 28% 36% 34% 27% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 65% 65% 65% 66% 65% 67% 70% 68% 66% Specificity 77% 73% 57% 69% 66% 57% 70% 67% 56% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 34% 35% 38% 35% 35% 41% 37% 36% 43% Specificity 92% 90% 81% 88% 85% 81% 87% 85% 81% OR Quartile 2 3.43 2.82 1.76 2.62 2.30 1.64 3.28 2.76 1.57 p Value 4.8E6 1.0E4 0.057 3.3E4 0.0018 0.11 2.3E5 2.5E4 0.15 Lower limit of 2.02 1.67 0.983 1.55 1.36 0.899 1.89 1.60 0.847 95% CI Upper limit of 5.82 4.76 3.14 4.44 3.90 3.01 5.68 4.76 2.91 95% CI OR Quartile 3 6.35 4.90 2.50 4.47 3.68 2.62 5.41 4.24 2.48 p Value 7.8E12 2.9E10 2.3E4 6.6E10 4.2E8 2.3E4 5.9E12 1.8E9 6.6E4 Lower limit of 3.74 2.99 1.54 2.78 2.31 1.57 3.35 2.65 1.47 95% CI Upper limit of 10.8 8.03 4.08 7.18 5.86 4.37 8.75 6.80 4.19 95% CI OR Quartile 4 5.88 4.51 2.61 3.85 3.12 3.03 4.04 3.23 3.35 p Value 2.7E6 5.1E6 3.6E4 6.2E6 5.7E5 5.4E5 1.5E6 2.5E5 1.4E5 Lower limit of 2.80 2.36 1.54 2.14 1.79 1.77 2.29 1.87 1.94 95% CI Upper limit of 12.3 8.61 4.41 6.90 5.44 5.18 7.14 5.57 5.78 95% CI

TABLE-US-00077 TABLE 13.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.215 0.550 0.244 0.584 0.243 0.600 Average 0.336 0.863 0.399 0.912 0.401 0.949 Stdev 0.584 0.993 0.585 1.05 0.579 1.07 p (t-test) 5.5E7 3.5E7 4.2E8 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 110 206 143 173 155 161 sCr only Median 0.238 0.559 0.279 0.576 0.270 0.591 Average 0.389 0.868 0.442 0.896 0.443 0.927 Stdev 0.736 0.961 0.720 1.01 0.708 1.02 p (t-test) 3.4E6 7.4E6 1.5E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 124 191 150 165 161 154 UO only Median 0.329 0.576 0.329 0.619 0.339 0.619 Average 0.532 0.971 0.550 0.984 0.573 0.956 Stdev 0.687 1.18 0.733 1.17 0.810 1.08 p (t-test) 4.1E5 8.8E5 7.0E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 6.00 5.72 n (Patient) 207 107 219 95 225 89 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.72 0.63 0.70 0.69 0.64 0.72 0.70 0.63 SE 0.028 0.028 0.034 0.029 0.030 0.035 0.028 0.029 0.036 p Value 0 3.1E15 1.4E4 1.7E12 3.5E10 9.0E5 8.9E15 1.4E11 2.2E4 nCohort 110 124 207 143 150 219 155 161 225 Non-persistent nCohort Persistent 206 191 107 173 165 95 161 154 89 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 83% 83% 81% 83% 82% 81% 85% 84% 81% Specificity 41% 37% 29% 34% 33% 28% 35% 34% 28% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 65% 65% 64% 66% 65% 66% 69% 68% 65% Specificity 77% 73% 57% 69% 66% 57% 70% 66% 56% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 34% 35% 36% 35% 35% 39% 37% 36% 40% Specificity 92% 90% 81% 87% 85% 81% 87% 85% 81% OR Quartile 2 3.50 2.82 1.73 2.48 2.18 1.65 3.14 2.60 1.61 p Value 3.4E6 1.0E4 0.059 6.6E4 0.0034 0.097 3.8E5 5.0E4 0.12 Lower limit of 2.06 1.67 0.979 1.47 1.29 0.914 1.82 1.52 0.881 95% CI Upper limit of 5.94 4.76 3.07 4.19 3.68 2.99 5.41 4.46 2.95 95% CI OR Quartile 3 6.19 4.90 2.46 4.35 3.58 2.62 5.10 4.12 2.38 p Value 1.5E11 2.9E10 2.6E4 1.3E9 7.6E8 1.7E4 2.4E11 3.5E9 8.4E4 Lower limit of 3.65 2.99 1.52 2.71 2.25 1.58 3.16 2.58 1.43 95% CI Upper limit of 10.5 8.03 3.98 6.99 5.70 4.33 8.23 6.59 3.96 95% CI OR Quartile 4 5.78 4.51 2.39 3.78 3.07 2.69 3.90 3.17 2.87 p Value 3.4E6 5.1E6 0.0011 8.1E6 7.3E5 2.7E4 2.7E6 3.3E5 1.2E4 Lower limit of 2.76 2.36 1.42 2.11 1.76 1.58 2.21 1.84 1.68 95% CI Upper limit of 12.1 8.61 4.04 6.78 5.35 4.58 6.89 5.47 4.92 95% CI

TABLE-US-00078 TABLE 13.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.212 0.550 0.243 0.579 0.243 0.593 Average 0.331 0.856 0.400 0.897 0.403 0.927 Stdev 0.592 0.985 0.594 1.04 0.589 1.06 p (t-test) 7.5E7 9.1E7 1.8E7 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 106 210 138 178 149 167 sCr only Median 0.236 0.563 0.265 0.576 0.259 0.591 Average 0.384 0.864 0.440 0.887 0.440 0.917 Stdev 0.743 0.954 0.729 0.995 0.716 1.01 p (t-test) 3.6E6 1.0E5 2.2E6 Min 0.00300 0.00224 0.00300 0.00224 0.00300 0.00224 Max 5.75 6.00 5.75 6.00 5.75 6.00 n (Patient) 121 194 146 169 157 158 UO only Median 0.324 0.576 0.328 0.610 0.329 0.601 Average 0.508 0.991 0.531 0.989 0.555 0.960 Stdev 0.643 1.19 0.699 1.18 0.786 1.09 p (t-test) 4.7E6 2.3E5 2.3E4 Min 0.00224 0.00410 0.00224 0.00410 0.00224 0.00410 Max 5.75 6.00 5.75 6.00 6.00 5.72 n (Patient) 201 113 211 103 216 98 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.75 0.73 0.64 0.70 0.69 0.64 0.71 0.70 0.64 SE 0.027 0.028 0.033 0.029 0.029 0.034 0.029 0.029 0.035 p Value 0 2.2E16 2.0E5 2.8E12 6.4E11 3.5E5 5.2E14 2.4E12 7.5E5 nCohort 106 121 201 138 146 211 149 157 216 Non-persistent nCohort Persistent 210 194 113 178 169 103 167 158 98 Cutoff Quartile 2 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 0.173 Sensitivity 83% 83% 82% 83% 82% 82% 84% 84% 82% Specificity 42% 38% 29% 35% 34% 28% 36% 34% 28% Cutoff Quartile 3 0.384 0.382 0.384 0.384 0.382 0.384 0.384 0.382 0.384 Sensitivity 64% 65% 65% 65% 64% 65% 67% 67% 64% Specificity 78% 74% 58% 69% 66% 57% 69% 67% 56% Cutoff Quartile 4 0.724 0.716 0.728 0.724 0.716 0.728 0.724 0.716 0.728 Sensitivity 34% 35% 36% 35% 34% 38% 36% 35% 39% Specificity 92% 90% 81% 88% 86% 81% 87% 85% 81% OR Quartile 2 3.55 2.99 1.93 2.53 2.34 1.76 2.99 2.79 1.75 p Value 2.8E6 4.2E5 0.024 5.0E4 0.0014 0.057 6.1E5 1.9E4 0.064 Lower limit of 2.09 1.77 1.09 1.50 1.39 0.983 1.75 1.63 0.969 95% CI Upper limit of 6.03 5.06 3.42 4.26 3.95 3.14 5.12 4.78 3.16 95% CI OR Quartile 3 6.50 5.15 2.54 4.03 3.60 2.50 4.56 4.12 2.34 p Value 1.2E11 1.3E10 1.3E4 7.8E9 7.4E8 2.3E4 3.6E10 3.5E9 7.4E4 Lower limit of 3.78 3.13 1.58 2.51 2.26 1.54 2.84 2.57 1.43 95% CI Upper limit of 11.2 8.50 4.09 6.47 5.73 4.08 7.33 6.58 3.83 95% CI OR Quartile 4 6.26 4.79 2.44 3.80 3.11 2.61 3.84 3.20 2.70 p Value 3.6E6 3.9E6 7.9E4 1.0E5 7.3E5 3.6E4 4.7E6 3.4E5 2.3E4 Lower limit of 2.88 2.46 1.45 2.10 1.78 1.54 2.16 1.85 1.59 95% CI Upper limit of 13.6 9.32 4.11 6.89 5.45 4.41 6.82 5.54 4.59 95% CI

Example 14. Use of Fibroblast Growth Factor 21 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0165] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 21 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0166] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0167] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00079 TABLE 14.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0175 0.287 0.0169 0.289 0.0169 0.286 Average 0.437 0.718 0.131 0.763 0.144 0.750 Stdev 1.20 1.16 0.314 1.24 0.330 1.23 p (t-test) 0.31 0.029 0.046 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 1.33 5.96 1.33 5.96 n (Patient) 22 108 19 111 17 113 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0181 0.298 0.0186 0.292 0.0191 0.290 Average 0.316 0.772 0.327 0.764 0.340 0.756 Stdev 1.02 1.20 1.04 1.20 1.05 1.19 p (t-test) 0.066 0.082 0.10 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.40 5.96 5.40 5.96 n (Patient) 29 100 28 101 27 102 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.144 0.180 0.121 0.297 0.0814 0.298 Average 0.616 0.781 0.514 0.901 0.505 0.860 Stdev 1.09 1.30 0.972 1.38 1.01 1.31 p (t-test) 0.44 0.064 0.085 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 82 47 75 54 67 62 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.68 0.72 0.52 0.74 0.70 0.58 0.73 0.69 0.61 SE 0.057 0.049 0.053 0.054 0.051 0.051 0.058 0.053 0.050 p Value 0.0021 1.2E5 0.76 1.2E5 9.5E5 0.10 9.0E5 3.8E4 0.035 nCohort Recovered 22 29 82 19 28 75 17 27 67 nCohort Non-recovered 108 100 47 111 101 54 113 102 62 Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 79% 81% 77% 78% 80% 80% 78% 79% 81% Specificity 45% 45% 26% 47% 43% 28% 47% 41% 30% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 56% 57% 53% 56% 56% 59% 55% 56% 60% Specificity 77% 72% 51% 84% 71% 56% 82% 70% 58% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 28% 31% 28% 29% 31% 35% 28% 30% 35% Specificity 86% 93% 76% 95% 93% 81% 94% 93% 84% OR Quartile 2 3.08 3.46 1.13 3.26 3.04 1.52 3.13 2.65 1.77 p Value 0.021 0.0060 0.78 0.021 0.015 0.32 0.033 0.035 0.17 Lower limit of 95% CI 1.18 1.43 0.487 1.19 1.24 0.661 1.09 1.07 0.782 Upper limit of 95% CI 8.02 8.40 2.60 8.94 7.43 3.49 8.95 6.56 4.02 OR Quartile 3 4.25 3.48 1.19 6.75 3.24 1.85 5.67 3.01 2.06 p Value 0.0079 0.0070 0.63 0.0037 0.011 0.089 0.0089 0.018 0.043 Lower limit of 95% CI 1.46 1.41 0.582 1.86 1.30 0.911 1.54 1.21 1.02 Upper limit of 95% CI 12.4 8.61 2.45 24.5 8.04 3.76 20.8 7.50 4.16 OR Quartile 4 2.44 6.07 1.19 7.29 5.76 2.37 6.32 5.46 2.80 p Value 0.18 0.018 0.68 0.058 0.022 0.036 0.080 0.027 0.015 Lower limit of 95% CI 0.672 1.36 0.525 0.934 1.29 1.06 0.805 1.22 1.22 Upper limit of 95% CI 8.84 27.1 2.68 56.9 25.8 5.29 49.7 24.5 6.42

TABLE-US-00080 TABLE 14.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0175 0.336 0.0175 0.319 0.0181 0.305 Average 0.300 0.802 0.317 0.786 0.348 0.763 Stdev 0.960 1.21 0.988 1.20 1.03 1.19 p (t-test) 0.031 0.048 0.092 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.40 5.96 5.40 5.96 n (Patient) 34 96 32 98 29 101 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0186 0.359 0.0191 0.347 0.0204 0.347 Average 0.286 0.842 0.293 0.832 0.301 0.823 Stdev 0.890 1.24 0.900 1.24 0.911 1.23 p (t-test) 0.012 0.015 0.020 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.40 5.96 5.40 5.96 n (Patient) 40 90 39 91 38 92 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.136 0.265 0.123 0.285 0.107 0.298 Average 0.573 0.896 0.579 0.850 0.578 0.811 Stdev 1.06 1.38 1.08 1.31 1.12 1.23 p (t-test) 0.15 0.21 0.27 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 88 41 83 46 75 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.73 0.54 0.72 0.72 0.56 0.70 0.71 0.58 SE 0.046 0.044 0.055 0.047 0.046 0.053 0.050 0.047 0.051 p Value 6.1E7 1.3E7 0.45 3.0E6 1.4E6 0.30 5.4E5 6.8E6 0.14 nCohort Recovered 34 40 88 32 39 83 29 38 75 nCohort Non-recovered 96 90 41 98 91 46 101 92 54 Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 81% 82% 76% 81% 81% 78% 79% 80% 80% Specificity 44% 42% 25% 44% 41% 27% 41% 39% 28% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 61% 62% 56% 60% 62% 59% 58% 61% 59% Specificity 82% 78% 52% 81% 77% 54% 79% 76% 56% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 31% 33% 32% 31% 33% 33% 30% 33% 33% Specificity 91% 92% 77% 91% 92% 78% 90% 92% 80% OR Quartile 2 3.42 3.42 1.03 3.23 3.03 1.30 2.69 2.68 1.52 p Value 0.0045 0.0036 0.94 0.0074 0.0087 0.55 0.028 0.020 0.32 Lower limit of 95% CI 1.46 1.49 0.437 1.37 1.32 0.553 1.11 1.17 0.661 Upper limit of 95% CI 8.00 7.82 2.44 7.64 6.93 3.05 6.49 6.15 3.49 OR Quartile 3 7.44 5.67 1.40 6.56 5.33 1.68 5.38 5.01 1.85 p Value 5.3E5 7.0E5 0.38 1.6E4 1.3E4 0.16 7.8E4 2.3E4 0.089 Lower limit of 95% CI 2.81 2.41 0.664 2.47 2.27 0.812 2.02 2.13 0.911 Upper limit of 95% CI 19.7 13.4 2.95 17.4 12.6 3.49 14.4 11.8 3.76 OR Quartile 4 4.70 6.17 1.58 4.26 5.90 1.75 3.66 5.65 2.00 p Value 0.016 0.0045 0.28 0.025 0.0056 0.18 0.045 0.0070 0.090 Lower limit of 95% CI 1.33 1.76 0.692 1.20 1.68 0.779 1.03 1.61 0.899 Upper limit of 95% CI 16.6 21.6 3.60 15.1 20.7 3.92 13.0 19.8 4.45

TABLE-US-00081 TABLE 14.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0333 0.346 0.0349 0.326 0.0349 0.305 Average 0.438 0.802 0.457 0.784 0.498 0.750 Stdev 1.18 1.15 1.20 1.14 1.25 1.13 p (t-test) 0.088 0.13 0.26 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 47 83 45 85 41 89 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0341 0.359 0.0349 0.347 0.0349 0.346 Average 0.419 0.838 0.428 0.827 0.443 0.808 Stdev 1.13 1.17 1.13 1.17 1.16 1.16 p (t-test) 0.045 0.057 0.085 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 52 78 51 79 49 81 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.140 0.278 0.131 0.278 0.123 0.278 Average 0.627 0.784 0.634 0.756 0.597 0.793 Stdev 1.17 1.19 1.19 1.15 1.12 1.25 p (t-test) 0.48 0.58 0.35 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 89 40 85 44 77 52 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.68 0.69 0.53 0.67 0.68 0.54 0.65 0.67 0.56 SE 0.047 0.046 0.055 0.048 0.047 0.054 0.050 0.047 0.052 p Value 9.6E5 2.6E5 0.60 3.2E4 1.3E4 0.51 0.0026 4.5E4 0.26 nCohort Recovered 47 52 89 45 51 85 41 49 77 nCohort Non-recovered 83 78 40 85 79 44 89 81 52 Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 81% 82% 75% 80% 81% 77% 79% 80% 79% Specificity 36% 37% 25% 36% 35% 26% 34% 35% 27% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 63% 63% 55% 61% 62% 57% 58% 60% 58% Specificity 72% 69% 52% 71% 69% 53% 68% 67% 55% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 33% 35% 30% 32% 34% 30% 30% 33% 31% Specificity 87% 88% 76% 87% 88% 76% 85% 88% 78% OR Quartile 2 2.37 2.63 0.985 2.21 2.33 1.19 1.91 2.16 1.40 p Value 0.036 0.019 0.97 0.055 0.039 0.69 0.12 0.061 0.43 Lower limit of 95% CI 1.06 1.17 0.416 0.982 1.04 0.504 0.841 0.967 0.607 Upper limit of 95% CI 5.32 5.91 2.33 4.96 5.20 2.79 4.34 4.82 3.22 OR Quartile 3 4.39 3.80 1.31 3.88 3.57 1.48 3.03 3.16 1.64 p Value 2.0E4 4.6E4 0.48 6.4E4 8.2E4 0.29 0.0055 0.0025 0.17 Lower limit of 95% CI 2.01 1.80 0.618 1.78 1.69 0.711 1.39 1.50 0.805 Upper limit of 95% CI 9.56 8.02 2.76 8.45 7.53 3.08 6.61 6.65 3.33 OR Quartile 4 3.29 4.06 1.39 3.03 3.89 1.36 2.54 3.58 1.57 p Value 0.016 0.0047 0.44 0.026 0.0060 0.46 0.061 0.0100 0.27 Lower limit of 95% CI 1.25 1.54 0.602 1.14 1.48 0.601 0.956 1.36 0.706 Upper limit of 95% CI 8.71 10.7 3.20 8.01 10.3 3.09 6.75 9.46 3.48

TABLE-US-00082 TABLE 14.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0349 0.370 0.0349 0.346 0.0407 0.309 Average 0.412 0.848 0.435 0.813 0.482 0.767 Stdev 1.12 1.18 1.16 1.16 1.21 1.14 p (t-test) 0.036 0.074 0.19 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 53 77 49 81 44 86 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0349 0.370 0.0351 0.359 0.0349 0.347 Average 0.411 0.861 0.418 0.850 0.425 0.840 Stdev 1.10 1.19 1.11 1.19 1.12 1.18 p (t-test) 0.030 0.038 0.046 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 55 75 54 76 53 77 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.131 0.298 0.123 0.298 0.115 0.292 Average 0.630 0.770 0.639 0.743 0.600 0.784 Stdev 1.18 1.17 1.20 1.13 1.13 1.24 p (t-test) 0.53 0.63 0.38 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 87 42 83 46 76 53 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.69 0.70 0.55 0.68 0.68 0.55 0.65 0.68 0.56 SE 0.046 0.046 0.055 0.046 0.046 0.053 0.049 0.046 0.052 p Value 3.3E5 1.6E5 0.36 7.2E5 8.4E5 0.31 0.0020 1.0E4 0.24 nCohort Recovered 53 55 87 49 54 83 44 53 76 nCohort Non-recovered 77 75 42 81 76 46 86 77 53 Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 82% 83% 79% 81% 82% 80% 79% 82% 79% Specificity 36% 36% 26% 37% 35% 28% 34% 36% 28% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 64% 64% 57% 63% 63% 59% 59% 62% 58% Specificity 70% 69% 53% 71% 69% 54% 68% 68% 55% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 35% 36% 29% 33% 36% 28% 31% 35% 30% Specificity 89% 89% 76% 88% 89% 76% 86% 89% 78% OR Quartile 2 2.51 2.73 1.32 2.55 2.40 1.58 1.95 2.51 1.46 p Value 0.025 0.016 0.54 0.023 0.033 0.31 0.11 0.025 0.37 Lower limit of 95% CI 1.12 1.21 0.548 1.14 1.07 0.658 0.868 1.12 0.634 Upper limit of 95% CI 5.63 6.14 3.17 5.73 5.38 3.77 4.40 5.63 3.35 OR Quartile 3 4.05 3.97 1.50 4.25 3.73 1.68 3.12 3.51 1.74 p Value 2.5E4 2.6E4 0.29 2.2E4 4.8E4 0.16 0.0036 8.7E4 0.13 Lower limit of 95% CI 1.92 1.89 0.712 1.97 1.78 0.812 1.45 1.68 0.856 Upper limit of 95% CI 8.55 8.34 3.14 9.15 7.82 3.49 6.72 7.33 3.54 OR Quartile 4 4.23 4.59 1.26 3.58 4.41 1.24 2.90 4.23 1.50 p Value 0.0036 0.0021 0.59 0.0100 0.0027 0.60 0.032 0.0036 0.32 Lower limit of 95% CI 1.60 1.74 0.548 1.36 1.67 0.549 1.09 1.60 0.676 Upper limit of 95% CI 11.2 12.1 2.88 9.46 11.6 2.80 7.68 11.2 3.33

TABLE-US-00083 TABLE 14.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0778 0.305 0.0684 0.305 0.0684 0.305 Average 0.630 0.733 0.640 0.714 0.640 0.714 Stdev 1.24 1.06 1.25 1.05 1.25 1.05 p (t-test) 0.63 0.72 0.72 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 79 51 77 53 77 53 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0553 0.347 0.0553 0.347 0.0553 0.347 Average 0.518 0.828 0.518 0.828 0.518 0.828 Stdev 1.17 1.16 1.17 1.16 1.17 1.16 p (t-test) 0.13 0.13 0.13 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 66 64 66 64 66 64 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.127 0.305 0.115 0.305 0.107 0.298 Average 0.638 0.752 0.647 0.729 0.653 0.717 Stdev 1.20 1.12 1.21 1.10 1.22 1.09 p (t-test) 0.60 0.71 0.77 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 86 43 84 45 83 46 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.60 0.65 0.56 0.60 0.65 0.56 0.60 0.65 0.56 SE 0.051 0.048 0.054 0.051 0.048 0.054 0.051 0.048 0.053 p Value 0.051 0.0023 0.29 0.047 0.0023 0.28 0.047 0.0023 0.28 nCohort Recovered 79 66 86 77 66 84 77 66 83 nCohort Non-recovered 51 64 43 53 64 45 53 64 46 Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 82% 83% 79% 83% 83% 80% 83% 83% 80% Specificity 30% 33% 27% 31% 33% 27% 31% 33% 28% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 63% 64% 58% 64% 64% 60% 64% 64% 61% Specificity 58% 64% 53% 60% 64% 55% 60% 64% 55% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 29% 34% 30% 28% 34% 29% 28% 34% 28% Specificity 77% 83% 77% 77% 83% 76% 77% 83% 76% OR Quartile 2 2.04 2.41 1.38 2.21 2.41 1.51 2.21 2.41 1.58 p Value 0.11 0.037 0.47 0.071 0.037 0.36 0.071 0.037 0.31 Lower limit of 95% CI 0.857 1.05 0.574 0.933 1.05 0.629 0.933 1.05 0.658 Upper limit of 95% CI 4.84 5.51 3.31 5.25 5.51 3.61 5.25 5.51 3.77 OR Quartile 3 2.35 3.12 1.60 2.66 3.12 1.82 2.66 3.12 1.93 p Value 0.021 0.0018 0.21 0.0081 0.0018 0.11 0.0081 0.0018 0.078 Lower limit of 95% CI 1.14 1.52 0.763 1.29 1.52 0.871 1.29 1.52 0.929 Upper limit of 95% CI 4.84 6.38 3.35 5.47 6.38 3.79 5.47 6.38 4.03 OR Quartile 4 1.41 2.62 1.43 1.29 2.62 1.30 1.29 2.62 1.24 p Value 0.40 0.023 0.39 0.53 0.023 0.53 0.53 0.023 0.60 Lower limit of 95% CI 0.635 1.14 0.629 0.583 1.14 0.574 0.583 1.14 0.549 Upper limit of 95% CI 3.14 5.99 3.25 2.87 5.99 2.94 2.87 5.99 2.80

TABLE-US-00084 TABLE 14.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.144 0.575 0.133 0.566 0.133 0.566 Average 0.402 1.17 0.397 1.15 0.400 1.13 Stdev 0.513 1.42 0.511 1.41 0.528 1.40 p (t-test) 0.0087 0.017 0.026 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 1.64 8.76 1.64 8.76 1.64 8.76 n (Patient) 25 126 21 130 19 132 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.178 0.567 0.190 0.566 0.190 0.566 Average 0.711 1.09 0.730 1.09 0.758 1.07 Stdev 1.63 1.23 1.66 1.23 1.71 1.22 p (t-test) 0.16 0.20 0.27 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 6.76 8.76 6.76 n (Patient) 29 121 28 122 26 124 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.289 0.781 0.282 0.771 0.286 0.753 Average 0.891 1.28 0.873 1.27 0.914 1.18 Stdev 1.22 1.49 1.22 1.47 1.26 1.42 p (t-test) 0.081 0.077 0.22 Min 0.00478 0.0598 0.00478 0.0335 0.0113 0.00478 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 91 59 84 66 77 73 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.67 0.62 0.73 0.67 0.62 0.72 0.66 0.59 SE 0.049 0.051 0.047 0.052 0.052 0.046 0.054 0.054 0.046 p Value 2.2E6 7.4E4 0.011 1.3E5 0.0013 0.0082 3.9E5 0.0033 0.057 nCohort Recovered 25 29 91 21 28 84 19 26 77 nCohort Non-recovered 126 121 59 130 122 66 132 124 73 Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 80% 79% 81% 80% 80% 82% 80% 79% 79% Specificity 52% 45% 30% 57% 46% 31% 58% 46% 30% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 55% 55% 63% 54% 54% 61% 54% 54% 58% Specificity 72% 69% 58% 71% 68% 58% 74% 69% 57% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 29% 29% 31% 28% 29% 30% 28% 28% 27% Specificity 96% 90% 78% 95% 89% 79% 95% 88% 77% OR Quartile 2 4.38 3.12 1.84 5.33 3.36 2.02 5.35 3.23 1.65 p Value 0.0013 0.0090 0.13 6.8E4 0.0059 0.077 0.0011 0.0093 0.19 Lower limit of 95% CI 1.78 1.33 0.832 2.03 1.42 0.927 1.96 1.33 0.779 Upper limit of 95% CI 10.7 7.33 4.08 14.0 7.97 4.39 14.6 7.82 3.48 OR Quartile 3 3.11 2.67 2.35 2.92 2.49 2.15 3.26 2.64 1.81 p Value 0.018 0.026 0.013 0.037 0.040 0.022 0.032 0.035 0.073 Lower limit of 95% CI 1.21 1.12 1.20 1.06 1.04 1.12 1.11 1.07 0.946 Upper limit of 95% CI 7.98 6.33 4.59 7.99 5.94 4.16 9.57 6.54 3.45 OR Quartile 4 9.98 3.53 1.56 7.96 3.35 1.59 7.01 3.01 1.24 p Value 0.027 0.050 0.24 0.047 0.060 0.22 0.063 0.087 0.57 Lower limit of 95% CI 1.30 1.00 0.741 1.03 0.951 0.761 0.903 0.851 0.592 Upper limit of 95% CI 76.5 12.4 3.28 61.5 11.8 3.34 54.4 10.7 2.58

TABLE-US-00085 TABLE 14.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.196 0.716 0.209 0.582 0.196 0.680 Average 0.665 1.18 0.707 1.15 0.573 1.17 Stdev 1.02 1.42 1.06 1.41 0.907 1.41 p (t-test) 0.038 0.087 0.026 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 4.20 8.76 4.20 8.76 n (Patient) 40 111 36 115 32 119 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.226 0.582 0.231 0.575 0.226 0.582 Average 0.885 1.11 0.902 1.10 0.858 1.11 Stdev 1.56 1.24 1.58 1.24 1.57 1.25 p (t-test) 0.36 0.42 0.31 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 6.76 8.76 6.76 n (Patient) 44 107 43 108 40 111 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.294 0.805 0.289 0.753 0.295 0.716 Average 0.920 1.30 0.911 1.27 0.961 1.16 Stdev 1.23 1.53 1.24 1.49 1.27 1.44 p (t-test) 0.11 0.12 0.38 Min 0.00478 0.0598 0.00478 0.0335 0.0113 0.00478 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 100 50 93 57 85 65 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.61 0.62 0.65 0.61 0.61 0.68 0.62 0.57 SE 0.047 0.049 0.050 0.049 0.049 0.048 0.049 0.050 0.047 p Value 4.2E4 0.018 0.018 0.0028 0.026 0.017 2.8E4 0.020 0.16 nCohort Recovered 40 44 100 36 43 93 32 40 85 nCohort Non-recovered 111 107 50 115 108 57 119 111 65 Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 80% 79% 82% 80% 79% 82% 80% 78% 78% Specificity 40% 34% 29% 42% 35% 30% 44% 35% 28% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 56% 55% 62% 55% 55% 60% 55% 55% 55% Specificity 65% 61% 56% 64% 60% 56% 69% 62% 54% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 30% 29% 32% 29% 29% 32% 29% 29% 28% Specificity 88% 84% 78% 86% 84% 78% 91% 85% 76% OR Quartile 2 2.70 1.89 1.86 2.86 1.98 2.02 3.08 1.95 1.43 p Value 0.013 0.11 0.15 0.011 0.085 0.089 0.0079 0.098 0.35 Lower limit of 95% CI 1.23 0.870 0.803 1.28 0.909 0.897 1.34 0.885 0.672 Upper limit of 95% CI 5.92 4.10 4.31 6.39 4.31 4.57 7.06 4.31 3.05 OR Quartile 3 2.35 1.95 2.08 2.14 1.84 1.87 2.74 2.03 1.46 p Value 0.026 0.067 0.039 0.053 0.096 0.066 0.017 0.061 0.25 Lower limit of 95% CI 1.11 0.954 1.04 0.990 0.897 0.960 1.19 0.969 0.765 Upper limit of 95% CI 4.97 4.00 4.16 4.64 3.78 3.66 6.28 4.27 2.80 OR Quartile 4 2.96 2.16 1.67 2.50 2.07 1.68 4.03 2.30 1.24 p Value 0.037 0.098 0.19 0.081 0.12 0.17 0.029 0.090 0.56 Lower limit of 95% CI 1.07 0.868 0.781 0.893 0.833 0.799 1.15 0.879 0.594 Upper limit of 95% CI 8.23 5.35 3.57 6.97 5.15 3.55 14.1 6.00 2.61

TABLE-US-00086 TABLE 14.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.218 0.733 0.209 0.716 0.185 0.716 Average 0.676 1.22 0.702 1.19 0.587 1.20 Stdev 0.955 1.47 0.990 1.45 0.867 1.45 p (t-test) 0.018 0.040 0.012 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 4.20 8.76 4.20 8.76 n (Patient) 50 101 46 105 40 111 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.242 0.582 0.242 0.567 0.231 0.575 Average 0.871 1.14 0.895 1.12 0.855 1.13 Stdev 1.44 1.28 1.46 1.28 1.44 1.29 p (t-test) 0.25 0.34 0.24 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 6.76 8.76 6.76 n (Patient) 54 97 52 99 49 102 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.316 0.728 0.292 0.747 0.287 0.728 Average 0.946 1.23 0.927 1.24 0.944 1.18 Stdev 1.24 1.53 1.24 1.49 1.27 1.44 p (t-test) 0.21 0.16 0.29 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0505 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 98 52 94 56 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.60 0.60 0.65 0.59 0.61 0.68 0.61 0.59 SE 0.046 0.047 0.050 0.046 0.048 0.048 0.046 0.048 0.047 p Value 8.9E4 0.032 0.055 0.0014 0.050 0.020 8.7E5 0.025 0.048 nCohort Recovered 50 54 98 46 52 94 40 49 86 nCohort Non-recovered 101 97 52 105 99 56 111 102 64 Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 80% 78% 83% 81% 79% 84% 81% 79% 81% Specificity 36% 31% 30% 39% 33% 31% 42% 35% 30% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 57% 56% 60% 56% 55% 61% 57% 55% 58% Specificity 64% 59% 55% 63% 58% 56% 68% 59% 56% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 30% 29% 29% 29% 28% 30% 30% 28% 28% Specificity 84% 81% 77% 83% 81% 78% 88% 82% 77% OR Quartile 2 2.28 1.66 2.01 2.73 1.80 2.33 3.17 2.05 1.88 p Value 0.033 0.18 0.10 0.010 0.12 0.048 0.0041 0.064 0.11 Lower limit of 95% CI 1.07 0.785 0.868 1.27 0.849 1.01 1.44 0.959 0.862 Upper limit of 95% CI 4.86 3.52 4.65 5.88 3.83 5.38 6.96 4.38 4.09 OR Quartile 3 2.40 1.83 1.81 2.19 1.64 2.00 2.73 1.77 1.73 p Value 0.014 0.080 0.088 0.031 0.15 0.044 0.0098 0.11 0.100 Lower limit of 95% CI 1.19 0.930 0.916 1.07 0.831 1.02 1.27 0.885 0.900 Upper limit of 95% CI 4.83 3.59 3.58 4.46 3.22 3.92 5.83 3.52 3.33 OR Quartile 4 2.22 1.79 1.32 1.90 1.66 1.52 2.96 1.77 1.29 p Value 0.072 0.16 0.47 0.15 0.23 0.28 0.037 0.19 0.50 Lower limit of 95% CI 0.931 0.790 0.618 0.794 0.732 0.717 1.07 0.761 0.616 Upper limit of 95% CI 5.29 4.03 2.83 4.54 3.75 3.20 8.23 4.10 2.71

TABLE-US-00087 TABLE 14.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.258 0.716 0.231 0.649 0.216 0.725 Average 0.808 1.19 0.824 1.16 0.612 1.23 Stdev 1.21 1.41 1.25 1.38 0.822 1.48 p (t-test) 0.093 0.14 0.0079 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 6.76 8.76 6.76 8.76 4.20 8.76 n (Patient) 58 93 53 98 47 104 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.282 0.582 0.286 0.575 0.286 0.575 Average 0.950 1.10 0.962 1.09 0.925 1.11 Stdev 1.57 1.18 1.58 1.17 1.56 1.20 p (t-test) 0.50 0.56 0.41 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 5.01 8.76 5.01 8.76 5.01 n (Patient) 60 91 59 92 57 94 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.316 0.575 0.292 0.649 0.287 0.649 Average 0.967 1.19 0.951 1.20 0.954 1.17 Stdev 1.24 1.52 1.25 1.48 1.27 1.44 p (t-test) 0.34 0.28 0.34 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0505 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 96 54 92 58 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.58 0.58 0.62 0.58 0.59 0.66 0.59 0.59 SE 0.046 0.047 0.049 0.047 0.047 0.048 0.046 0.047 0.047 p Value 0.014 0.077 0.12 0.012 0.087 0.053 7.1E4 0.054 0.064 nCohort Recovered 58 60 96 53 59 92 47 57 86 nCohort Non-recovered 93 91 54 98 92 58 104 94 64 Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 78% 77% 81% 80% 77% 83% 80% 78% 81% Specificity 31% 28% 29% 34% 29% 30% 36% 30% 30% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 56% 55% 56% 55% 54% 57% 56% 54% 56% Specificity 59% 57% 53% 58% 56% 54% 62% 56% 55% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 29% 29% 28% 29% 28% 29% 31% 29% 28% Specificity 81% 80% 76% 81% 80% 77% 87% 81% 77% OR Quartile 2 1.64 1.32 1.81 2.01 1.37 2.10 2.24 1.48 1.88 p Value 0.19 0.47 0.15 0.069 0.41 0.074 0.039 0.31 0.11 Lower limit of 95% CI 0.780 0.626 0.801 0.946 0.650 0.931 1.04 0.700 0.862 Upper limit of 95% CI 3.46 2.77 4.10 4.25 2.88 4.74 4.81 3.12 4.09 OR Quartile 3 1.80 1.59 1.42 1.73 1.51 1.57 2.03 1.52 1.55 p Value 0.084 0.16 0.31 0.11 0.22 0.18 0.048 0.22 0.19 Lower limit of 95% CI 0.925 0.827 0.725 0.880 0.783 0.810 1.00 0.783 0.808 Upper limit of 95% CI 3.49 3.08 2.77 3.40 2.92 3.05 4.11 2.94 2.97 OR Quartile 4 1.75 1.60 1.22 1.72 1.54 1.40 3.04 1.69 1.29 p Value 0.17 0.24 0.61 0.19 0.28 0.37 0.022 0.20 0.50 Lower limit of 95% CI 0.790 0.734 0.572 0.761 0.708 0.665 1.17 0.761 0.616 Upper limit of 95% CI 3.87 3.49 2.60 3.89 3.36 2.96 7.87 3.73 2.71

TABLE-US-00088 TABLE 14.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.294 0.728 0.291 0.740 0.291 0.740 Average 0.845 1.27 0.834 1.27 0.834 1.27 Stdev 1.15 1.51 1.16 1.50 1.16 1.50 p (t-test) 0.053 0.044 0.044 Min 0.00478 0.0113 0.00478 0.0113 0.00478 0.0113 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 81 70 80 71 80 71 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.286 0.649 0.286 0.649 0.286 0.649 Average 0.989 1.08 0.983 1.08 0.983 1.08 Stdev 1.57 1.14 1.58 1.14 1.58 1.14 p (t-test) 0.67 0.65 0.65 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 4.31 8.76 4.31 8.76 4.31 n (Patient) 67 84 65 86 65 86 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.295 0.716 0.294 0.740 0.289 0.781 Average 0.904 1.29 0.878 1.32 0.856 1.34 Stdev 1.16 1.60 1.16 1.58 1.16 1.56 p (t-test) 0.090 0.050 0.031 Min 0.00478 0.0113 0.00478 0.0113 0.00478 0.0113 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 95 55 93 57 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.57 0.59 0.60 0.58 0.61 0.60 0.58 0.62 SE 0.046 0.047 0.049 0.046 0.047 0.048 0.046 0.047 0.047 p Value 0.046 0.12 0.069 0.030 0.085 0.026 0.030 0.085 0.011 nCohort Recovered 81 67 95 80 65 93 80 65 91 nCohort Non-recovered 70 84 55 71 86 57 71 86 59 Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 77% 77% 80% 77% 78% 81% 77% 78% 81% Specificity 27% 28% 28% 28% 29% 29% 28% 29% 30% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 57% 56% 56% 58% 56% 58% 58% 56% 59% Specificity 56% 57% 54% 56% 57% 55% 56% 57% 56% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 33% 27% 31% 34% 28% 33% 34% 28% 34% Specificity 81% 78% 78% 82% 78% 80% 82% 78% 80% OR Quartile 2 1.26 1.35 1.59 1.30 1.46 1.71 1.30 1.46 1.84 p Value 0.54 0.42 0.26 0.48 0.32 0.19 0.48 0.32 0.13 Lower limit of 95% CI 0.599 0.648 0.716 0.621 0.696 0.772 0.621 0.696 0.832 Upper limit of 95% CI 2.64 2.83 3.52 2.74 3.05 3.79 2.74 3.05 4.08 OR Quartile 3 1.67 1.66 1.50 1.76 1.67 1.67 1.76 1.67 1.86 p Value 0.12 0.12 0.24 0.087 0.12 0.13 0.087 0.12 0.067 Lower limit of 95% CI 0.874 0.871 0.767 0.921 0.872 0.858 0.921 0.872 0.957 Upper limit of 95% CI 3.18 3.18 2.92 3.35 3.20 3.25 3.35 3.20 3.61 OR Quartile 4 2.15 1.31 1.58 2.41 1.41 1.95 2.41 1.41 2.08 p Value 0.045 0.48 0.23 0.023 0.37 0.080 0.023 0.37 0.054 Lower limit of 95% CI 1.02 0.618 0.745 1.13 0.662 0.923 1.13 0.662 0.986 Upper limit of 95% CI 4.56 2.76 3.34 5.14 3.00 4.11 5.14 3.00 4.39

Example 15. Use of Fibroblast Growth Factor 21 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0168] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 21 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0169] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0170] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00089 TABLE 15.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0333 0.326 0.0333 0.326 0.0349 0.313 Average 0.367 0.831 0.367 0.831 0.383 0.812 Stdev 0.900 1.26 0.900 1.26 0.918 1.26 p (t-test) 0.031 0.031 0.049 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.40 5.96 5.40 5.96 n (Patient) 45 85 45 85 43 87 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0306 0.396 0.0306 0.396 0.0333 0.358 Average 0.335 0.902 0.335 0.902 0.348 0.879 Stdev 0.837 1.32 0.837 1.32 0.851 1.31 p (t-test) 0.0064 0.0064 0.011 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.40 5.96 5.40 5.96 n (Patient) 53 76 53 76 51 78 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.144 0.180 0.131 0.233 0.131 0.233 Average 0.605 0.852 0.589 0.855 0.603 0.807 Stdev 1.06 1.41 1.07 1.36 1.09 1.31 p (t-test) 0.28 0.23 0.35 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 92 37 87 42 83 46 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.71 0.51 0.67 0.71 0.54 0.65 0.68 0.54 SE 0.048 0.045 0.057 0.048 0.045 0.055 0.049 0.046 0.053 p Value 3.9E4 4.0E6 0.84 3.9E4 4.0E6 0.49 0.0018 7.0E5 0.50 nCohort Recovered 45 53 92 45 53 87 43 51 83 nCohort Non-recovered 85 76 37 85 76 42 87 78 46 Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 81% 86% 73% 81% 86% 76% 79% 83% 76% Specificity 38% 40% 24% 38% 40% 25% 35% 37% 25% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 61% 63% 54% 61% 63% 57% 60% 62% 57% Specificity 71% 68% 51% 71% 68% 53% 70% 67% 53% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 32% 36% 30% 32% 36% 31% 31% 35% 30% Specificity 87% 89% 76% 87% 89% 77% 86% 88% 77% OR Quartile 2 2.62 3.88 0.849 2.62 3.88 1.08 2.05 2.97 1.08 p Value 0.020 0.0016 0.71 0.020 0.0016 0.86 0.083 0.0095 0.86 Lower limit of 95% CI 1.16 1.67 0.356 1.16 1.67 0.459 0.910 1.30 0.466 Upper limit of 95% CI 5.90 9.01 2.02 5.90 9.01 2.56 4.63 6.76 2.49 OR Quartile 3 3.88 3.63 1.23 3.88 3.63 1.50 3.43 3.20 1.47 p Value 6.4E4 6.6E4 0.60 6.4E4 6.6E4 0.29 0.0019 0.0021 0.30 Lower limit of 95% CI 1.78 1.73 0.572 1.78 1.73 0.712 1.57 1.53 0.710 Upper limit of 95% CI 8.45 7.62 2.64 8.45 7.62 3.14 7.47 6.70 3.03 OR Quartile 4 3.03 4.32 1.35 3.03 4.32 1.50 2.78 3.97 1.47 p Value 0.026 0.0032 0.49 0.026 0.0032 0.33 0.040 0.0054 0.35 Lower limit of 95% CI 1.14 1.63 0.574 1.14 1.63 0.659 1.05 1.50 0.655 Upper limit of 95% CI 8.01 11.4 3.16 8.01 11.4 3.42 7.36 10.5 3.31

TABLE-US-00090 TABLE 15.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0351 0.358 0.0351 0.358 0.0409 0.336 Average 0.461 0.829 0.461 0.829 0.478 0.808 Stdev 1.12 1.19 1.12 1.19 1.14 1.18 p (t-test) 0.075 0.075 0.11 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 56 74 56 74 54 76 sCr only Median 0.0351 0.432 0.0351 0.432 0.0409 0.396 Average 0.436 0.884 0.436 0.884 0.451 0.859 Stdev 1.07 1.22 1.07 1.22 1.08 1.21 p (t-test) 0.029 0.029 0.047 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 62 68 62 68 60 70 UO only Median 0.147 0.172 0.140 0.222 0.131 0.233 Average 0.623 0.811 0.622 0.804 0.634 0.757 Stdev 1.14 1.25 1.15 1.22 1.19 1.15 p (t-test) 0.42 0.42 0.58 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 93 36 91 38 85 44 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.69 0.52 0.67 0.69 0.53 0.65 0.66 0.54 SE 0.047 0.046 0.057 0.047 0.046 0.056 0.048 0.047 0.054 p Value 3.3E4 4.7E5 0.73 3.3E4 4.7E5 0.56 0.0015 5.1E4 0.44 nCohort 56 62 93 56 62 91 54 60 85 Recovered nCohort 74 68 36 74 68 38 76 70 44 Non-recovered Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 82% 84% 75% 82% 84% 76% 80% 81% 77% Specificity 36% 35% 25% 36% 35% 25% 33% 33% 26% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 65% 66% 53% 65% 66% 55% 63% 64% 57% Specificity 70% 68% 51% 70% 68% 52% 69% 67% 53% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 32% 35% 31% 32% 35% 32% 32% 34% 32% Specificity 84% 85% 76% 84% 85% 77% 83% 85% 78% OR Quartile 2 2.61 2.85 0.986 2.61 2.85 1.09 2.03 2.19 1.19 p Value 0.021 0.013 0.97 0.021 0.013 0.85 0.082 0.057 0.69 Lower limit of 1.16 1.24 0.405 1.16 1.24 0.450 0.914 0.978 0.504 95% CI Upper limit of 5.86 6.53 2.40 5.86 6.53 2.64 4.52 4.91 2.79 95% CI OR Quartile 3 4.24 4.11 1.14 4.24 4.11 1.32 3.73 3.60 1.48 p Value 1.4E4 1.5E4 0.74 1.4E4 1.5E4 0.47 4.8E4 5.4E4 0.29 Lower limit of 2.01 1.98 0.529 2.01 1.98 0.617 1.78 1.74 0.711 95% CI Upper limit of 8.90 8.54 2.47 8.90 8.54 2.82 7.82 7.44 3.08 95% CI OR Quartile 4 2.51 3.21 1.42 2.51 3.21 1.54 2.31 2.96 1.62 p Value 0.037 0.0081 0.42 0.037 0.0081 0.31 0.058 0.014 0.24 Lower limit of 1.06 1.35 0.604 1.06 1.35 0.664 0.973 1.25 0.718 95% CI Upper limit of 5.94 7.62 3.34 5.94 7.62 3.56 5.47 7.01 3.66 95% CI

TABLE-US-00091 TABLE 15.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0465 0.346 0.0465 0.346 0.0465 0.326 Average 0.476 0.854 0.476 0.854 0.489 0.831 Stdev 1.07 1.24 1.07 1.24 1.08 1.23 p (t-test) 0.065 0.065 0.096 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 63 67 63 67 61 69 sCr only Median 0.0465 0.370 0.0465 0.370 0.0518 0.358 Average 0.462 0.879 0.462 0.879 0.469 0.866 Stdev 1.05 1.25 1.05 1.25 1.06 1.24 p (t-test) 0.041 0.041 0.052 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 65 65 65 65 64 66 UO only Median 0.140 0.298 0.140 0.298 0.131 0.278 Average 0.608 0.851 0.608 0.851 0.625 0.781 Stdev 1.14 1.24 1.14 1.24 1.18 1.17 p (t-test) 0.29 0.29 0.48 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 93 36 93 36 87 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.66 0.55 0.65 0.66 0.55 0.64 0.65 0.55 SE 0.048 0.048 0.057 0.048 0.048 0.057 0.048 0.048 0.055 p Value 0.0020 6.5E4 0.35 0.0020 6.5E4 0.35 0.0035 0.0021 0.33 nCohort 63 65 93 63 65 93 61 64 87 Recovered nCohort 67 65 36 67 65 36 69 66 42 Non-recovered Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 82% 83% 78% 82% 83% 78% 81% 82% 79% Specificity 33% 34% 26% 33% 34% 26% 33% 33% 26% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 64% 65% 56% 64% 65% 56% 64% 64% 57% Specificity 65% 65% 52% 65% 65% 52% 66% 64% 53% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 31% 34% 33% 31% 34% 33% 30% 33% 31% Specificity 81% 83% 77% 81% 83% 77% 80% 83% 77% OR Quartile 2 2.29 2.51 1.22 2.29 2.51 1.22 2.10 2.20 1.32 p Value 0.046 0.029 0.67 0.046 0.029 0.67 0.071 0.058 0.54 Lower limit of 1.01 1.10 0.489 1.01 1.10 0.489 0.938 0.973 0.548 95% CI Upper limit of 5.18 5.74 3.03 5.18 5.74 3.03 4.71 4.96 3.17 95% CI OR Quartile 3 3.34 3.33 1.33 3.34 3.33 1.33 3.35 3.12 1.50 p Value 0.0010 0.0010 0.47 0.0010 0.0010 0.47 0.0010 0.0018 0.29 Lower limit of 1.63 1.62 0.615 1.63 1.62 0.615 1.63 1.52 0.712 95% CI Upper limit of 6.86 6.84 2.89 6.86 6.84 2.89 6.89 6.38 3.14 95% CI OR Quartile 4 1.94 2.51 1.71 1.94 2.51 1.71 1.79 2.41 1.50 p Value 0.11 0.029 0.21 0.11 0.029 0.21 0.16 0.037 0.33 Lower limit of 0.860 1.10 0.735 0.860 1.10 0.735 0.792 1.05 0.659 95% CI Upper limit of 4.38 5.74 4.00 4.38 5.74 4.00 4.03 5.51 3.42 95% CI

TABLE-US-00092 TABLE 15.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0570 0.370 0.0518 0.358 0.0518 0.336 Average 0.461 0.893 0.464 0.884 0.475 0.860 Stdev 1.04 1.26 1.05 1.26 1.06 1.24 p (t-test) 0.035 0.040 0.061 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 67 63 66 64 64 66 sCr only Median 0.0518 0.396 0.0518 0.396 0.0570 0.370 Average 0.450 0.912 0.450 0.912 0.457 0.898 Stdev 1.03 1.27 1.03 1.27 1.04 1.26 p (t-test) 0.024 0.024 0.031 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 68 62 68 62 67 63 UO only Median 0.131 0.298 0.127 0.305 0.123 0.298 Average 0.622 0.795 0.626 0.783 0.630 0.764 Stdev 1.17 1.19 1.17 1.18 1.19 1.15 p (t-test) 0.44 0.48 0.54 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 89 40 88 41 85 44 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.67 0.56 0.66 0.67 0.56 0.65 0.66 0.56 SE 0.048 0.047 0.056 0.048 0.047 0.055 0.048 0.048 0.054 p Value 0.0012 2.7E4 0.28 9.4E4 2.7E4 0.27 0.0017 9.8E4 0.26 nCohort 67 68 89 66 68 88 64 67 85 Recovered nCohort 63 62 40 64 62 41 66 63 44 Non-recovered Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 83% 84% 80% 83% 84% 80% 82% 83% 80% Specificity 33% 34% 27% 33% 34% 27% 33% 33% 27% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 65% 66% 57% 66% 66% 59% 65% 65% 59% Specificity 64% 65% 53% 65% 65% 53% 66% 64% 54% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 33% 35% 30% 33% 35% 29% 32% 35% 30% Specificity 82% 84% 76% 82% 84% 76% 81% 84% 76% OR Quartile 2 2.31 2.66 1.48 2.41 2.66 1.55 2.20 2.31 1.44 p Value 0.047 0.023 0.40 0.037 0.023 0.34 0.058 0.047 0.41 Lower limit of 1.01 1.14 0.597 1.05 1.14 0.627 0.973 1.01 0.601 95% CI Upper limit of 5.28 6.17 3.65 5.51 6.17 3.82 4.96 5.28 3.46 95% CI OR Quartile 3 3.34 3.58 1.51 3.57 3.58 1.62 3.57 3.34 1.70 p Value 0.0010 5.5E4 0.28 5.6E4 5.5E4 0.21 5.6E4 0.0010 0.16 Lower limit of 1.63 1.74 0.713 1.73 1.74 0.765 1.73 1.63 0.815 95% CI Upper limit of 6.86 7.38 3.21 7.35 7.38 3.42 7.35 6.86 3.56 95% CI OR Quartile 4 2.29 2.85 1.39 2.20 2.85 1.32 2.02 2.73 1.36 p Value 0.046 0.013 0.44 0.058 0.013 0.51 0.090 0.017 0.46 Lower limit of 1.01 1.24 0.602 0.973 1.24 0.574 0.896 1.19 0.601 95% CI Upper limit of 5.18 6.53 3.20 4.96 6.53 3.03 4.56 6.25 3.09 95% CI

TABLE-US-00093 TABLE 15.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0814 0.326 0.0805 0.319 0.0796 0.313 Average 0.595 0.824 0.598 0.813 0.603 0.798 Stdev 1.19 1.13 1.19 1.12 1.20 1.11 p (t-test) 0.29 0.32 0.37 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 87 43 86 44 85 45 sCr only Median 0.0684 0.346 0.0684 0.346 0.0684 0.346 Average 0.511 0.903 0.511 0.903 0.511 0.903 Stdev 1.10 1.24 1.10 1.24 1.10 1.24 p (t-test) 0.060 0.060 0.060 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 77 53 77 53 77 53 UO only Median 0.123 0.315 0.115 0.313 0.107 0.309 Average 0.623 0.794 0.626 0.782 0.631 0.768 Stdev 1.18 1.15 1.19 1.14 1.20 1.13 p (t-test) 0.44 0.48 0.54 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 89 40 88 41 87 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.62 0.64 0.58 0.62 0.64 0.58 0.62 0.64 0.58 SE 0.054 0.050 0.055 0.053 0.050 0.055 0.053 0.050 0.055 p Value 0.030 0.0042 0.16 0.028 0.0042 0.15 0.028 0.0042 0.15 nCohort 87 77 89 86 77 88 85 77 87 Recovered nCohort 43 53 40 44 53 41 45 53 42 Non-recovered Cutoff Quartile 2 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 0.0111 0.0111 0.0131 Sensitivity 84% 83% 82% 84% 83% 83% 84% 83% 83% Specificity 30% 31% 28% 30% 31% 28% 31% 31% 29% Cutoff Quartile 3 0.155 0.155 0.163 0.155 0.155 0.163 0.155 0.155 0.163 Sensitivity 63% 64% 60% 64% 64% 61% 64% 64% 62% Specificity 56% 60% 54% 57% 60% 55% 58% 60% 55% Cutoff Quartile 4 0.774 0.774 0.780 0.774 0.774 0.780 0.774 0.774 0.780 Sensitivity 35% 38% 32% 34% 38% 32% 33% 38% 31% Specificity 79% 83% 78% 79% 83% 77% 79% 83% 77% OR Quartile 2 2.19 2.21 1.84 2.29 2.21 1.93 2.39 2.21 2.02 p Value 0.098 0.071 0.20 0.081 0.071 0.17 0.066 0.071 0.14 Lower limit of 0.864 0.933 0.721 0.904 0.933 0.756 0.945 0.933 0.792 95% CI Upper limit of 5.56 5.25 4.70 5.80 5.25 4.92 6.06 5.25 5.14 95% CI OR Quartile 3 2.18 2.66 1.76 2.32 2.66 1.88 2.47 2.66 2.00 p Value 0.042 0.0081 0.15 0.028 0.0081 0.10 0.018 0.0081 0.071 Lower limit of 1.03 1.29 0.823 1.10 1.29 0.881 1.17 1.29 0.942 95% CI Upper limit of 4.60 5.47 3.75 4.90 5.47 3.99 5.21 5.47 4.24 95% CI OR Quartile 4 2.05 2.98 1.66 1.95 2.98 1.58 1.86 2.98 1.50 p Value 0.083 0.0086 0.23 0.11 0.0086 0.28 0.13 0.0086 0.33 Lower limit of 0.910 1.32 0.726 0.868 1.32 0.692 0.829 1.32 0.659 95% CI Upper limit of 4.63 6.74 3.80 4.40 6.74 3.60 4.18 6.74 3.42 95% CI

TABLE-US-00094 TABLE 15.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.216 0.725 0.223 0.716 0.209 0.582 Average 0.627 1.24 0.639 1.23 0.655 1.21 Stdev 0.862 1.48 0.867 1.48 0.882 1.47 p (t-test) 0.0082 0.012 0.019 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 4.20 8.76 4.20 8.76 n (Patient) 49 102 48 103 46 105 sCr only Median 0.238 0.575 0.238 0.575 0.231 0.567 Average 0.821 1.12 0.821 1.12 0.831 1.12 Stdev 1.41 1.26 1.41 1.26 1.42 1.26 p (t-test) 0.18 0.18 0.21 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 6.76 8.76 6.76 n (Patient) 52 98 52 98 51 99 UO only Median 0.316 0.771 0.294 0.762 0.294 0.762 Average 0.939 1.29 0.943 1.23 0.927 1.23 Stdev 1.22 1.58 1.25 1.50 1.25 1.48 p (t-test) 0.15 0.21 0.18 Min 0.00478 0.0598 0.00478 0.0335 0.00478 0.0335 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 104 46 97 53 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.62 0.60 0.65 0.62 0.59 0.65 0.62 0.60 SE 0.045 0.047 0.051 0.046 0.047 0.049 0.046 0.047 0.048 p Value 2.5E4 0.0096 0.051 8.5E4 0.0096 0.063 0.0012 0.011 0.046 nCohort 49 52 104 48 52 97 46 51 91 Recovered nCohort 102 98 46 103 98 53 105 99 59 Non-recovered Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 80% 80% 80% 80% 80% 79% 80% 80% 80% Specificity 37% 35% 28% 35% 35% 28% 37% 35% 29% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 58% 56% 61% 57% 56% 60% 56% 56% 59% Specificity 65% 62% 55% 65% 62% 56% 63% 61% 56% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 31% 31% 28% 31% 31% 28% 30% 30% 29% Specificity 88% 85% 76% 88% 85% 76% 87% 84% 77% OR Quartile 2 2.38 2.06 1.59 2.14 2.06 1.47 2.34 2.15 1.57 p Value 0.025 0.059 0.28 0.050 0.059 0.34 0.029 0.046 0.26 Lower limit of 1.11 0.972 0.683 1.00 0.972 0.663 1.09 1.01 0.718 95% CI Upper limit of 5.09 4.39 3.70 4.59 4.39 3.27 5.05 4.59 3.42 95% CI OR Quartile 3 2.58 2.05 1.89 2.45 2.05 1.91 2.19 1.94 1.86 p Value 0.0086 0.041 0.078 0.013 0.041 0.062 0.031 0.059 0.067 Lower limit of 1.27 1.03 0.930 1.20 1.03 0.969 1.07 0.974 0.957 95% CI Upper limit of 5.24 4.07 3.83 4.97 4.07 3.78 4.46 3.85 3.61 95% CI OR Quartile 4 3.28 2.43 1.24 3.15 2.43 1.27 2.92 2.34 1.35 p Value 0.014 0.045 0.58 0.018 0.045 0.54 0.027 0.055 0.43 Lower limit of 1.27 1.02 0.569 1.22 1.02 0.595 1.13 0.981 0.640 95% CI Upper limit of 8.48 5.78 2.73 8.17 5.78 2.71 7.58 5.57 2.84 95% CI

TABLE-US-00095 TABLE 15.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.242 0.716 0.242 0.716 0.234 0.582 Average 0.810 1.21 0.810 1.21 0.828 1.19 Stdev 1.19 1.43 1.19 1.43 1.20 1.42 p (t-test) 0.070 0.070 0.10 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 64 87 64 87 62 89 sCr only Median 0.289 0.566 0.289 0.566 0.284 0.565 Average 0.980 1.09 0.980 1.09 0.990 1.08 Stdev 1.52 1.19 1.52 1.19 1.53 1.19 p (t-test) 0.62 0.62 0.68 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 5.01 8.76 5.01 8.76 5.01 n (Patient) 67 84 67 84 66 85 UO only Median 0.294 0.864 0.294 0.828 0.294 0.828 Average 0.909 1.37 0.922 1.32 0.897 1.30 Stdev 1.22 1.57 1.23 1.55 1.22 1.51 p (t-test) 0.057 0.096 0.075 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 105 45 103 47 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.63 0.57 0.64 0.63 0.57 0.62 0.62 0.57 0.62 SE 0.045 0.047 0.051 0.045 0.047 0.051 0.045 0.047 0.048 p Value 0.0056 0.11 0.0065 0.0056 0.11 0.016 0.0077 0.12 0.012 nCohort 64 67 105 64 67 103 62 66 95 Recovered nCohort 87 84 45 87 84 47 89 85 55 Non-recovered Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 82% 80% 84% 82% 80% 83% 82% 80% 82% Specificity 34% 31% 30% 34% 31% 29% 35% 32% 29% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 57% 55% 67% 57% 55% 64% 56% 54% 62% Specificity 59% 55% 57% 59% 55% 56% 58% 55% 57% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 30% 27% 33% 30% 27% 32% 29% 27% 33% Specificity 81% 78% 78% 81% 78% 78% 81% 77% 79% OR Quartile 2 2.32 1.80 2.27 2.32 1.80 2.00 2.51 1.87 1.88 p Value 0.027 0.12 0.076 0.027 0.12 0.12 0.016 0.099 0.13 Lower limit of 1.10 0.857 0.917 1.10 0.857 0.838 1.18 0.889 0.833 95% CI Upper limit of 4.91 3.78 5.64 4.91 3.78 4.79 5.32 3.92 4.25 95% CI OR Quartile 3 1.98 1.49 2.67 1.98 1.49 2.27 1.78 1.42 2.13 p Value 0.042 0.22 0.0085 0.042 0.22 0.024 0.086 0.29 0.029 Lower limit of 1.03 0.783 1.28 1.03 0.783 1.12 0.922 0.742 1.08 95% CI Upper limit of 3.80 2.85 5.54 3.80 2.85 4.63 3.42 2.70 4.20 95% CI OR Quartile 4 1.85 1.31 1.78 1.85 1.31 1.63 1.72 1.26 1.82 p Value 0.12 0.48 0.14 0.12 0.48 0.21 0.17 0.54 0.12 Lower limit of 0.849 0.618 0.823 0.849 0.618 0.756 0.790 0.597 0.863 95% CI Upper limit of 4.02 2.76 3.86 4.02 2.76 3.52 3.74 2.67 3.86 95% CI

TABLE-US-00096 TABLE 15.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.289 0.575 0.287 0.582 0.287 0.582 Average 0.887 1.19 0.864 1.20 0.861 1.20 Stdev 1.17 1.48 1.17 1.47 1.18 1.46 p (t-test) 0.17 0.12 0.13 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 73 78 72 79 70 81 sCr only Median 0.294 0.565 0.294 0.565 0.294 0.565 Average 1.02 1.06 1.02 1.06 1.02 1.06 Stdev 1.48 1.20 1.48 1.20 1.48 1.20 p (t-test) 0.85 0.85 0.85 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 5.01 8.76 5.01 8.76 5.01 n (Patient) 74 77 74 77 74 77 UO only Median 0.338 0.716 0.338 0.716 0.316 0.728 Average 0.940 1.29 0.945 1.27 0.933 1.25 Stdev 1.20 1.62 1.21 1.59 1.23 1.52 p (t-test) 0.14 0.17 0.17 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 105 45 103 47 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.58 0.54 0.60 0.59 0.54 0.59 0.60 0.54 0.59 SE 0.046 0.047 0.052 0.046 0.047 0.051 0.046 0.047 0.049 p Value 0.084 0.34 0.055 0.050 0.34 0.073 0.038 0.34 0.053 nCohort 73 74 105 72 74 103 70 74 96 Recovered nCohort 78 77 45 79 77 47 81 77 54 Non-recovered Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 79% 78% 84% 80% 78% 83% 80% 78% 81% Specificity 30% 28% 30% 31% 28% 29% 31% 28% 29% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 55% 53% 60% 56% 53% 60% 56% 53% 59% Specificity 55% 53% 54% 56% 53% 54% 56% 53% 55% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 27% 25% 31% 28% 25% 30% 28% 25% 31% Specificity 77% 74% 77% 78% 74% 77% 79% 74% 78% OR Quartile 2 1.67 1.40 2.27 1.73 1.40 2.00 1.86 1.40 1.81 p Value 0.18 0.37 0.076 0.15 0.37 0.12 0.10 0.37 0.15 Lower limit of 0.795 0.668 0.917 0.824 0.668 0.838 0.885 0.668 0.801 95% CI Upper limit of 3.51 2.93 5.64 3.64 2.93 4.79 3.92 2.93 4.10 95% CI OR Quartile 3 1.49 1.27 1.78 1.57 1.27 1.76 1.57 1.27 1.79 p Value 0.22 0.47 0.11 0.17 0.47 0.11 0.17 0.47 0.090 Lower limit of 0.784 0.670 0.876 0.826 0.670 0.872 0.826 0.670 0.912 95% CI Upper limit of 2.83 2.40 3.62 2.99 2.40 3.54 2.99 2.40 3.52 95% CI OR Quartile 4 1.21 0.948 1.52 1.35 0.948 1.40 1.45 0.948 1.64 p Value 0.61 0.89 0.29 0.43 0.89 0.40 0.33 0.89 0.20 Lower limit of 0.580 0.455 0.700 0.643 0.455 0.644 0.688 0.455 0.774 95% CI Upper limit of 2.54 1.98 3.32 2.84 1.98 3.03 3.07 1.98 3.48 95% CI

TABLE-US-00097 TABLE 15.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.287 0.582 0.286 0.649 0.286 0.649 Average 0.874 1.21 0.852 1.23 0.848 1.22 Stdev 1.16 1.49 1.15 1.49 1.16 1.48 p (t-test) 0.12 0.085 0.088 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 76 75 75 76 73 78 sCr only Median 0.294 0.575 0.294 0.575 0.294 0.575 Average 0.981 1.10 0.981 1.10 0.981 1.10 Stdev 1.46 1.22 1.46 1.22 1.46 1.22 p (t-test) 0.58 0.58 0.58 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 5.01 8.76 5.01 8.76 5.01 n (Patient) 77 74 77 74 77 74 UO only Median 0.316 0.575 0.316 0.575 0.295 0.582 Average 0.957 1.22 0.957 1.22 0.947 1.22 Stdev 1.22 1.56 1.22 1.56 1.24 1.51 p (t-test) 0.25 0.25 0.24 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 100 50 100 50 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.56 0.58 0.60 0.56 0.58 0.60 0.56 0.59 SE 0.046 0.047 0.050 0.046 0.047 0.050 0.046 0.047 0.049 p Value 0.053 0.17 0.11 0.030 0.17 0.11 0.023 0.17 0.075 nCohort 76 77 100 75 77 100 73 77 95 Recovered nCohort 75 74 50 76 74 50 78 74 55 Non-recovered Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 80% 78% 82% 80% 78% 82% 81% 78% 82% Specificity 30% 29% 29% 31% 29% 29% 32% 29% 29% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 56% 55% 56% 57% 55% 56% 56% 55% 56% Specificity 55% 55% 53% 56% 55% 53% 56% 55% 54% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 28% 27% 30% 29% 27% 30% 29% 27% 31% Specificity 78% 77% 77% 79% 77% 77% 79% 77% 78% OR Quartile 2 1.74 1.45 1.86 1.80 1.45 1.86 1.93 1.45 1.88 p Value 0.15 0.33 0.15 0.12 0.33 0.15 0.085 0.33 0.13 Lower limit of 0.822 0.690 0.803 0.851 0.690 0.803 0.914 0.690 0.833 95% CI Upper limit of 3.67 3.05 4.31 3.80 3.05 4.31 4.09 3.05 4.25 95% CI OR Quartile 3 1.57 1.49 1.44 1.66 1.49 1.44 1.66 1.49 1.50 p Value 0.17 0.22 0.30 0.12 0.22 0.30 0.12 0.22 0.24 Lower limit of 0.827 0.785 0.725 0.872 0.785 0.725 0.871 0.785 0.767 95% CI Upper limit of 2.99 2.83 2.84 3.16 2.83 2.84 3.16 2.83 2.92 95% CI OR Quartile 4 1.35 1.21 1.43 1.50 1.21 1.43 1.62 1.21 1.58 p Value 0.43 0.61 0.35 0.28 0.61 0.35 0.21 0.61 0.23 Lower limit of 0.645 0.582 0.669 0.715 0.582 0.669 0.765 0.582 0.745 95% CI Upper limit of 2.82 2.53 3.08 3.16 2.53 3.08 3.42 2.53 3.34 95% CI

TABLE-US-00098 TABLE 15.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.295 0.649 0.294 0.716 0.294 0.728 Average 0.886 1.26 0.868 1.28 0.858 1.29 Stdev 1.15 1.56 1.15 1.55 1.15 1.54 p (t-test) 0.089 0.060 0.050 Min 0.00478 0.0113 0.00478 0.0113 0.00478 0.0113 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 89 62 88 63 87 64 sCr only Median 0.294 0.575 0.294 0.575 0.294 0.575 Average 1.01 1.08 1.01 1.08 1.01 1.08 Stdev 1.48 1.18 1.48 1.18 1.48 1.18 p (t-test) 0.76 0.76 0.76 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 4.31 8.76 4.31 8.76 4.31 n (Patient) 79 72 79 72 79 72 UO only Median 0.316 0.728 0.316 0.728 0.294 0.760 Average 0.896 1.33 0.896 1.33 0.870 1.36 Stdev 1.15 1.63 1.15 1.63 1.15 1.61 p (t-test) 0.061 0.061 0.033 Min 0.00478 0.0113 0.00478 0.0113 0.00478 0.0113 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 98 52 98 52 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.58 0.56 0.59 0.59 0.56 0.59 0.60 0.56 0.61 SE 0.048 0.047 0.050 0.047 0.047 0.050 0.047 0.047 0.049 p Value 0.080 0.24 0.057 0.048 0.24 0.057 0.031 0.24 0.021 nCohort 89 79 98 88 79 98 87 79 96 Recovered nCohort 62 72 52 63 72 52 64 72 54 Non-recovered Cutoff Quartile 2 0.162 0.162 0.161 0.162 0.162 0.161 0.162 0.162 0.161 Sensitivity 79% 78% 81% 79% 78% 81% 80% 78% 81% Specificity 28% 28% 29% 28% 28% 29% 29% 28% 29% Cutoff Quartile 3 0.511 0.511 0.519 0.511 0.511 0.519 0.511 0.511 0.519 Sensitivity 56% 56% 58% 57% 56% 58% 58% 56% 59% Specificity 54% 54% 54% 55% 54% 54% 55% 54% 55% Cutoff Quartile 4 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 1.46 Sensitivity 31% 26% 33% 32% 26% 33% 33% 26% 35% Specificity 79% 76% 79% 80% 76% 79% 80% 76% 80% OR Quartile 2 1.47 1.35 1.68 1.53 1.35 1.68 1.58 1.35 1.81 p Value 0.32 0.43 0.21 0.28 0.43 0.21 0.24 0.43 0.15 Lower limit of 0.684 0.643 0.742 0.709 0.643 0.742 0.736 0.643 0.801 95% CI Upper limit of 3.17 2.84 3.80 3.28 2.84 3.80 3.40 2.84 4.10 95% CI OR Quartile 3 1.52 1.49 1.61 1.60 1.49 1.61 1.69 1.49 1.79 p Value 0.21 0.22 0.17 0.16 0.22 0.17 0.12 0.22 0.090 Lower limit of 0.790 0.786 0.815 0.834 0.786 0.815 0.879 0.786 0.912 95% CI Upper limit of 2.91 2.84 3.17 3.07 2.84 3.17 3.24 2.84 3.52 95% CI OR Quartile 4 1.63 1.13 1.78 1.81 1.13 1.78 2.01 1.13 2.20 p Value 0.20 0.74 0.13 0.12 0.74 0.13 0.066 0.74 0.040 Lower limit of 0.776 0.543 0.838 0.862 0.543 0.838 0.956 0.543 1.04 95% CI Upper limit of 3.41 2.36 3.79 3.80 2.36 3.79 4.23 2.36 4.66 95% CI

Example 16. Use of Fibroblast Growth Factor 21 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0171] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 21 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0172] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0173] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00099 TABLE 16.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0796 0.313 0.0814 0.305 0.123 0.265 Average 0.565 0.884 0.556 0.937 0.578 0.922 Stdev 1.08 1.31 1.06 1.36 1.05 1.42 p (t-test) 0.14 0.088 0.14 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 87 43 91 39 95 35 sCr only Median 0.0796 0.326 0.0805 0.305 0.0943 0.289 Average 0.559 0.897 0.547 0.974 0.572 0.931 Stdev 1.08 1.32 1.06 1.39 1.06 1.42 p (t-test) 0.13 0.061 0.12 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 87 42 92 37 94 35 UO only Median 0.163 0.183 0.163 0.183 0.163 0.183 Average 0.643 0.876 0.635 0.965 0.635 0.965 Stdev 1.11 1.51 1.11 1.58 1.11 1.58 p (t-test) 0.44 0.29 0.29 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 111 18 113 16 113 16 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.62 0.62 0.52 0.62 0.63 0.54 0.59 0.60 0.54 SE 0.054 0.054 0.074 0.055 0.056 0.079 0.058 0.058 0.079 p Value 0.024 0.023 0.76 0.027 0.022 0.62 0.12 0.076 0.62 nCohort 87 87 111 91 92 113 95 94 113 Recovered nCohort 43 42 18 39 37 16 35 35 16 Non-recovered Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 84% 86% 78% 85% 86% 81% 83% 86% 81% Specificity 30% 30% 25% 30% 29% 26% 28% 29% 26% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 63% 62% 50% 62% 62% 50% 57% 60% 50% Specificity 56% 55% 50% 55% 54% 50% 53% 53% 50% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 33% 33% 28% 36% 38% 31% 34% 34% 31% Specificity 78% 78% 75% 79% 79% 75% 78% 78% 75% OR Quartile 2 2.19 2.56 1.18 2.32 2.66 1.50 1.92 2.42 1.50 p Value 0.098 0.060 0.78 0.092 0.066 0.55 0.19 0.098 0.55 Lower limit of 0.864 0.961 0.359 0.871 0.936 0.398 0.716 0.849 0.398 95% CI Upper limit of 5.56 6.80 3.88 6.18 7.55 5.63 5.14 6.89 5.63 95% CI OR Quartile 3 2.18 2.00 0.982 1.95 1.96 0.982 1.48 1.70 0.982 p Value 0.042 0.071 0.97 0.087 0.092 0.97 0.32 0.18 0.97 Lower limit of 1.03 0.942 0.363 0.907 0.896 0.345 0.678 0.775 0.345 95% CI Upper limit of 4.60 4.24 2.66 4.20 4.27 2.80 3.24 3.75 2.80 95% CI OR Quartile 4 1.73 1.79 1.14 2.12 2.34 1.38 1.84 1.81 1.38 p Value 0.19 0.16 0.82 0.074 0.046 0.58 0.16 0.17 0.58 Lower limit of 0.764 0.789 0.373 0.928 1.02 0.441 0.786 0.775 0.441 95% CI Upper limit of 3.91 4.06 3.48 4.85 5.39 4.32 4.30 4.24 4.32 95% CI

TABLE-US-00100 TABLE 16.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0684 0.422 0.0778 0.441 0.0814 0.305 Average 0.531 0.873 0.520 0.937 0.547 0.920 Stdev 1.11 1.23 1.07 1.29 1.06 1.34 p (t-test) 0.10 0.051 0.087 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 77 53 83 47 87 43 sCr only Median 0.0731 0.422 0.0731 0.441 0.0796 0.326 Average 0.528 0.885 0.517 0.935 0.547 0.905 Stdev 1.10 1.25 1.08 1.29 1.07 1.33 p (t-test) 0.091 0.051 0.10 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 78 51 82 47 85 44 UO only Median 0.147 0.285 0.147 0.285 0.147 0.285 Average 0.622 0.910 0.613 0.979 0.613 0.979 Stdev 1.12 1.39 1.11 1.44 1.11 1.44 p (t-test) 0.28 0.18 0.18 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 105 24 107 22 107 22 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.65 0.56 0.65 0.66 0.57 0.62 0.63 0.57 SE 0.050 0.050 0.067 0.051 0.051 0.069 0.053 0.053 0.069 p Value 0.0024 0.0037 0.38 0.0028 0.0022 0.29 0.022 0.017 0.29 nCohort 77 78 105 83 82 107 87 85 107 Recovered nCohort 53 51 24 47 47 22 43 44 22 Non-recovered Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 85% 86% 79% 85% 87% 82% 84% 86% 82% Specificity 32% 32% 26% 31% 32% 26% 30% 31% 26% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 64% 63% 54% 64% 64% 55% 60% 61% 55% Specificity 60% 58% 50% 58% 57% 50% 55% 55% 50% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 34% 35% 33% 36% 38% 36% 35% 36% 36% Specificity 81% 81% 76% 81% 82% 77% 79% 80% 77% OR Quartile 2 2.70 2.96 1.32 2.61 3.17 1.59 2.19 2.79 1.59 p Value 0.029 0.022 0.62 0.043 0.020 0.43 0.098 0.039 0.43 Lower limit of 1.11 1.17 0.448 1.03 1.20 0.497 0.864 1.05 0.497 95% CI Upper limit of 6.59 7.50 3.87 6.59 8.41 5.12 5.56 7.41 5.12 95% CI OR Quartile 3 2.66 2.30 1.20 2.42 2.37 1.22 1.88 1.96 1.22 p Value 0.0081 0.024 0.68 0.019 0.022 0.67 0.095 0.075 0.67 Lower limit of 1.29 1.11 0.495 1.16 1.13 0.487 0.895 0.935 0.487 95% CI Upper limit of 5.47 4.74 2.93 5.06 4.96 3.07 3.96 4.13 3.07 95% CI OR Quartile 4 2.13 2.29 1.60 2.37 2.77 1.87 2.05 2.29 1.87 p Value 0.065 0.043 0.34 0.036 0.014 0.21 0.083 0.046 0.21 Lower limit of 0.954 1.02 0.613 1.06 1.23 0.705 0.910 1.01 0.705 95% CI Upper limit of 4.73 5.12 4.18 5.32 6.24 4.98 4.63 5.15 4.98 95% CI

TABLE-US-00101 TABLE 16.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0600 0.432 0.0630 0.455 0.0731 0.448 Average 0.517 0.861 0.503 0.914 0.518 0.914 Stdev 1.13 1.19 1.10 1.23 1.09 1.26 p (t-test) 0.096 0.049 0.060 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 72 58 77 53 80 50 sCr only Median 0.0630 0.432 0.0630 0.448 0.0684 0.394 Average 0.511 0.889 0.500 0.937 0.517 0.927 Stdev 1.11 1.23 1.09 1.26 1.08 1.28 p (t-test) 0.071 0.039 0.055 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 75 54 79 50 81 48 UO only Median 0.136 0.305 0.131 0.380 0.131 0.380 Average 0.618 0.875 0.603 0.963 0.603 0.963 Stdev 1.14 1.29 1.12 1.33 1.12 1.33 p (t-test) 0.30 0.16 0.16 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 100 29 103 26 103 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.67 0.57 0.67 0.68 0.61 0.65 0.66 0.61 SE 0.048 0.049 0.062 0.049 0.050 0.064 0.050 0.051 0.064 p Value 8.5E4 7.2E4 0.26 6.0E4 4.1E4 0.094 0.0030 0.0018 0.094 nCohort 72 75 100 77 79 103 80 81 103 Non-persistent nCohort 58 54 29 53 50 26 50 48 26 Persistent Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 84% 87% 79% 85% 88% 85% 84% 88% 85% Specificity 33% 33% 26% 32% 33% 27% 31% 32% 27% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 66% 65% 59% 66% 66% 62% 64% 65% 62% Specificity 62% 60% 52% 61% 59% 52% 59% 58% 52% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 33% 35% 31% 36% 38% 35% 36% 38% 35% Specificity 81% 81% 76% 82% 82% 77% 81% 81% 77% OR Quartile 2 2.72 3.36 1.35 2.70 3.60 2.05 2.39 3.31 2.05 p Value 0.023 0.011 0.56 0.029 0.0100 0.22 0.056 0.016 0.22 Lower limit of 1.15 1.33 0.494 1.11 1.36 0.650 0.978 1.25 0.650 95% CI Upper limit of 6.45 8.49 3.67 6.59 9.52 6.49 5.82 8.77 6.49 95% CI OR Quartile 3 3.17 2.76 1.53 3.05 2.85 1.76 2.53 2.52 1.76 p Value 0.0017 0.0060 0.32 0.0028 0.0054 0.21 0.013 0.014 0.21 Lower limit of 1.54 1.34 0.665 1.47 1.36 0.732 1.22 1.21 0.732 95% CI Upper limit of 6.52 5.70 3.54 6.32 5.96 4.25 5.25 5.27 4.25 95% CI OR Quartile 4 2.02 2.37 1.42 2.51 2.85 1.74 2.44 2.64 1.74 p Value 0.086 0.036 0.45 0.025 0.012 0.24 0.030 0.019 0.24 Lower limit of 0.906 1.06 0.573 1.12 1.26 0.689 1.09 1.17 0.689 95% CI Upper limit of 4.50 5.29 3.54 5.63 6.41 4.41 5.45 5.93 4.41 95% CI

TABLE-US-00102 TABLE 16.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0570 0.422 0.0600 0.448 0.0657 0.394 Average 0.520 0.852 0.505 0.903 0.523 0.892 Stdev 1.14 1.19 1.11 1.22 1.10 1.24 p (t-test) 0.11 0.056 0.078 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 71 59 76 54 78 52 sCr only Median 0.0630 0.384 0.0630 0.394 0.0684 0.336 Average 0.520 0.863 0.509 0.907 0.526 0.896 Stdev 1.13 1.21 1.10 1.25 1.09 1.27 p (t-test) 0.10 0.058 0.081 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 73 56 77 52 79 50 UO only Median 0.127 0.305 0.123 0.315 0.123 0.315 Average 0.632 0.802 0.616 0.872 0.616 0.872 Stdev 1.16 1.22 1.14 1.26 1.14 1.26 p (t-test) 0.47 0.30 0.30 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 96 33 99 30 99 30 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.65 0.57 0.67 0.66 0.61 0.65 0.64 0.61 SE 0.048 0.049 0.059 0.049 0.050 0.061 0.050 0.051 0.061 p Value 6.9E4 0.0020 0.21 4.9E4 0.0012 0.079 0.0021 0.0047 0.079 nCohort 71 73 96 76 77 99 78 79 99 Non-persistent nCohort 59 56 33 54 52 30 52 50 30 Persistent Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 85% 86% 82% 85% 87% 87% 85% 86% 87% Specificity 34% 33% 27% 33% 32% 28% 32% 32% 28% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 66% 64% 61% 67% 65% 63% 65% 64% 63% Specificity 63% 60% 53% 62% 60% 54% 60% 58% 54% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 32% 34% 27% 35% 37% 30% 35% 36% 30% Specificity 80% 81% 75% 82% 82% 76% 81% 81% 76% OR Quartile 2 2.84 2.94 1.67 2.82 3.09 2.56 2.59 2.84 2.56 p Value 0.018 0.018 0.31 0.023 0.017 0.11 0.036 0.027 0.11 Lower limit of 1.20 1.20 0.619 1.16 1.22 0.820 1.06 1.12 0.820 95% CI Upper limit of 6.73 7.18 4.51 6.87 7.82 8.01 6.32 7.20 8.01 95% CI OR Quartile 3 3.38 2.73 1.74 3.24 2.80 1.99 2.86 2.48 1.99 p Value 9.9E4 0.0062 0.18 0.0016 0.0057 0.11 0.0047 0.015 0.11 Lower limit of 1.64 1.33 0.779 1.56 1.35 0.858 1.38 1.19 0.858 95% CI Upper limit of 6.96 5.61 3.90 6.73 5.82 4.61 5.94 5.14 4.61 95% CI OR Quartile 4 1.93 2.16 1.12 2.40 2.59 1.34 2.22 2.40 1.34 p Value 0.11 0.060 0.80 0.033 0.021 0.53 0.051 0.033 0.53 Lower limit of 0.869 0.969 0.460 1.07 1.15 0.541 0.997 1.07 0.541 95% CI Upper limit of 4.30 4.83 2.75 5.38 5.82 3.31 4.96 5.37 3.31 95% CI

TABLE-US-00103 TABLE 16.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0570 0.422 0.0600 0.448 0.0657 0.394 Average 0.520 0.852 0.505 0.903 0.523 0.892 Stdev 1.14 1.19 1.11 1.22 1.10 1.24 p (t-test) 0.11 0.056 0.078 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 71 59 76 54 78 52 sCr only Median 0.0657 0.346 0.0657 0.346 0.0731 0.326 Average 0.528 0.848 0.515 0.890 0.532 0.878 Stdev 1.13 1.21 1.11 1.24 1.10 1.26 p (t-test) 0.12 0.074 0.10 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 72 57 76 53 78 51 UO only Median 0.115 0.313 0.115 0.326 0.115 0.326 Average 0.617 0.835 0.607 0.875 0.607 0.875 Stdev 1.16 1.20 1.15 1.22 1.15 1.22 p (t-test) 0.35 0.26 0.26 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 94 35 96 33 96 33 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.64 0.60 0.67 0.64 0.61 0.65 0.63 0.61 SE 0.048 0.050 0.058 0.049 0.050 0.059 0.050 0.051 0.059 p Value 6.9E4 0.0058 0.091 4.9E4 0.0039 0.064 0.0021 0.013 0.064 nCohort 71 72 94 76 76 96 78 78 96 Non-persistent nCohort 59 57 35 54 53 33 52 51 33 Persistent Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 85% 84% 83% 85% 85% 85% 85% 84% 85% Specificity 34% 32% 28% 33% 32% 28% 32% 31% 28% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 66% 63% 63% 67% 64% 64% 65% 63% 64% Specificity 63% 60% 54% 62% 59% 54% 60% 58% 54% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 32% 33% 31% 35% 36% 33% 35% 35% 33% Specificity 80% 81% 77% 82% 82% 77% 81% 81% 77% OR Quartile 2 2.84 2.50 1.85 2.82 2.60 2.19 2.59 2.39 2.19 p Value 0.018 0.038 0.22 0.023 0.037 0.14 0.036 0.056 0.14 Lower limit of 1.20 1.05 0.688 1.16 1.06 0.766 1.06 0.976 0.766 95% CI Upper limit of 6.73 5.96 4.97 6.87 6.35 6.26 6.32 5.85 6.26 95% CI OR Quartile 3 3.38 2.54 2.01 3.24 2.60 2.07 2.86 2.30 2.07 p Value 9.9E4 0.011 0.087 0.0016 0.0098 0.081 0.0047 0.024 0.081 Lower limit of 1.64 1.24 0.905 1.56 1.26 0.915 1.38 1.11 0.915 95% CI Upper limit of 6.96 5.20 4.45 6.73 5.36 4.67 5.94 4.74 4.67 95% CI OR Quartile 4 1.93 2.07 1.50 2.40 2.47 1.68 2.22 2.29 1.68 p Value 0.11 0.075 0.35 0.033 0.028 0.24 0.051 0.043 0.24 Lower limit of 0.869 0.928 0.636 1.07 1.10 0.707 0.997 1.02 0.707 95% CI Upper limit of 4.30 4.62 3.54 5.38 5.55 4.00 4.96 5.12 4.00 95% CI

TABLE-US-00104 TABLE 16.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.417 0.582 0.491 0.559 0.494 0.571 Average 0.956 1.19 1.02 1.08 1.03 1.06 Stdev 1.37 1.29 1.38 1.26 1.40 1.18 p (t-test) 0.31 0.82 0.90 Min 0.0113 0.00478 0.0113 0.00478 0.00478 0.0627 Max 8.76 5.01 8.76 5.01 8.76 4.30 n (Patient) 96 55 104 47 111 40 sCr only Median 0.417 0.575 0.487 0.559 0.469 0.571 Average 0.931 1.17 0.997 1.07 1.01 1.05 Stdev 1.34 1.29 1.35 1.27 1.38 1.16 p (t-test) 0.29 0.76 0.84 Min 0.0153 0.00478 0.0153 0.00478 0.00478 0.0113 Max 8.76 5.01 8.76 5.01 8.76 4.30 n (Patient) 94 56 103 47 108 42 UO only Median 0.511 0.716 0.511 0.716 0.503 0.748 Average 1.04 1.07 1.04 1.07 1.04 1.10 Stdev 1.38 1.11 1.38 1.11 1.38 1.13 p (t-test) 0.95 0.95 0.85 Min 0.00478 0.0757 0.00478 0.0757 0.00478 0.0757 Max 8.76 3.76 8.76 3.76 8.76 3.76 n (Patient) 131 19 131 19 132 18 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.57 0.56 0.56 0.53 0.52 0.56 0.54 0.54 0.56 SE 0.049 0.049 0.073 0.051 0.051 0.073 0.054 0.053 0.074 p Value 0.17 0.23 0.43 0.52 0.64 0.43 0.45 0.46 0.40 nCohort 96 94 131 104 103 131 111 108 132 Non-persistent nCohort 55 56 19 47 47 19 40 42 18 Persistent Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 76% 75% 84% 77% 74% 84% 78% 76% 83% Specificity 26% 26% 27% 26% 25% 27% 26% 26% 27% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 56% 55% 53% 53% 53% 53% 52% 55% 56% Specificity 53% 53% 50% 51% 51% 50% 50% 52% 51% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 35% 36% 32% 28% 30% 32% 28% 31% 33% Specificity 80% 81% 76% 76% 77% 76% 76% 77% 76% OR Quartile 2 1.14 1.03 1.94 1.15 0.985 1.94 1.22 1.12 1.80 p Value 0.74 0.94 0.31 0.74 0.97 0.31 0.65 0.79 0.37 Lower limit of 0.526 0.480 0.534 0.513 0.446 0.534 0.518 0.488 0.492 95% CI Upper limit of 2.46 2.20 7.08 2.57 2.17 7.08 2.86 2.57 6.61 95% CI OR Quartile 3 1.46 1.41 1.13 1.18 1.20 1.13 1.13 1.30 1.29 p Value 0.26 0.31 0.81 0.64 0.60 0.81 0.75 0.47 0.62 Lower limit of 0.751 0.725 0.430 0.592 0.604 0.430 0.546 0.638 0.479 95% CI Upper limit of 2.85 2.74 2.96 2.35 2.40 2.96 2.32 2.67 3.47 95% CI OR Quartile 4 2.14 2.35 1.43 1.21 1.40 1.43 1.18 1.49 1.56 p Value 0.047 0.026 0.50 0.64 0.40 0.50 0.69 0.33 0.41 Lower limit of 1.01 1.11 0.502 0.553 0.644 0.502 0.521 0.674 0.543 95% CI Upper limit of 4.52 4.97 4.07 2.64 3.03 4.07 2.67 3.29 4.50 95% CI

TABLE-US-00105 TABLE 16.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.369 0.567 0.433 0.559 0.487 0.649 Average 0.959 1.16 1.01 1.09 1.01 1.10 Stdev 1.38 1.29 1.39 1.26 1.41 1.20 p (t-test) 0.37 0.74 0.70 Min 0.0113 0.00478 0.0113 0.00478 0.00478 0.0598 Max 8.76 5.01 8.76 5.01 8.76 4.31 n (Patient) 88 63 94 57 101 50 sCr only Median 0.378 0.563 0.494 0.511 0.487 0.559 Average 0.963 1.10 1.03 1.01 1.03 1.00 Stdev 1.38 1.24 1.40 1.20 1.42 1.11 p (t-test) 0.53 0.94 0.91 Min 0.0153 0.00478 0.0153 0.00478 0.00478 0.0113 Max 8.76 5.01 8.76 5.01 8.76 4.30 n (Patient) 88 62 93 57 99 51 UO only Median 0.494 0.740 0.494 0.740 0.491 0.760 Average 1.02 1.14 1.02 1.14 1.02 1.17 Stdev 1.38 1.20 1.38 1.20 1.38 1.21 p (t-test) 0.68 0.68 0.61 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 8.76 4.31 8.76 4.31 8.76 4.31 n (Patient) 123 27 123 27 124 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.56 0.55 0.57 0.54 0.52 0.57 0.56 0.53 0.57 SE 0.048 0.048 0.063 0.049 0.049 0.063 0.050 0.050 0.064 p Value 0.17 0.34 0.28 0.39 0.74 0.28 0.25 0.55 0.26 nCohort 88 88 123 94 93 123 101 99 124 Non-persistent nCohort 63 62 27 57 57 27 50 51 26 Persistent Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 78% 76% 81% 77% 75% 81% 78% 76% 81% Specificity 27% 26% 27% 27% 26% 27% 27% 26% 27% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 54% 53% 56% 53% 51% 56% 54% 53% 58% Specificity 52% 52% 51% 51% 51% 51% 51% 52% 52% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 32% 32% 33% 28% 28% 33% 30% 29% 35% Specificity 80% 80% 76% 77% 76% 76% 77% 77% 77% OR Quartile 2 1.31 1.11 1.61 1.23 1.07 1.61 1.29 1.16 1.52 p Value 0.48 0.79 0.37 0.60 0.86 0.37 0.53 0.72 0.43 Lower limit of 0.616 0.523 0.565 0.568 0.499 0.565 0.581 0.527 0.531 95% CI Upper limit of 2.80 2.35 4.61 2.65 2.29 4.61 2.88 2.54 4.37 95% CI OR Quartile 3 1.28 1.25 1.31 1.16 1.06 1.31 1.25 1.20 1.45 p Value 0.45 0.51 0.52 0.66 0.87 0.52 0.53 0.61 0.39 Lower limit of 0.671 0.650 0.568 0.600 0.547 0.568 0.632 0.608 0.619 95% CI Upper limit of 2.46 2.39 3.03 2.24 2.05 3.03 2.46 2.35 3.42 95% CI OR Quartile 4 1.81 1.85 1.62 1.28 1.26 1.62 1.45 1.38 1.73 p Value 0.12 0.10 0.29 0.52 0.55 0.29 0.34 0.41 0.23 Lower limit of 0.862 0.881 0.658 0.604 0.595 0.658 0.678 0.643 0.699 95% CI Upper limit of 3.80 3.89 3.99 2.70 2.67 3.99 3.12 2.95 4.30 95% CI

TABLE-US-00106 TABLE 16.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.295 0.575 0.331 0.567 0.369 0.582 Average 0.961 1.14 0.969 1.14 1.00 1.11 Stdev 1.41 1.26 1.40 1.27 1.43 1.19 p (t-test) 0.42 0.45 0.64 Min 0.0113 0.00478 0.0113 0.00478 0.00478 0.0598 Max 8.76 5.01 8.76 5.01 8.76 4.31 n (Patient) 83 68 86 65 94 57 sCr only Median 0.331 0.566 0.369 0.562 0.371 0.565 Average 0.973 1.08 0.991 1.06 1.03 1.01 Stdev 1.42 1.20 1.40 10.76 .22 1.44 1.11 p (t-test) 0.63 0.94 Min 0.0153 0.00478 0.0153 0.00478 0.00478 0.0113 Max 8.76 5.01 8.76 5.01 8.76 4.30 n (Patient) 82 68 86 64 93 57 UO only Median 0.487 0.716 0.487 0.716 0.475 0.728 Average 1.03 1.11 1.03 1.11 1.02 1.13 Stdev 1.40 1.18 1.40 1.18 1.39 1.19 p (t-test) 0.75 0.75 0.68 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 8.76 4.31 8.76 4.31 8.76 4.31 n (Patient) 115 35 115 35 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.57 0.56 0.56 0.57 0.54 0.56 0.57 0.54 0.56 SE 0.047 0.047 0.057 0.047 0.048 0.057 0.049 0.049 0.057 p Value 0.11 0.24 0.30 0.14 0.39 0.30 0.14 0.41 0.29 nCohort 83 82 115 86 86 115 94 93 116 Non-persistent nCohort 68 68 35 65 64 35 57 57 34 Persistent Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 79% 78% 80% 80% 78% 80% 81% 79% 79% Specificity 29% 28% 27% 29% 28% 27% 29% 28% 27% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 56% 54% 57% 55% 53% 57% 56% 54% 59% Specificity 54% 54% 52% 53% 52% 52% 53% 53% 53% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 31% 31% 31% 29% 28% 31% 30% 28% 32% Specificity 80% 79% 77% 78% 77% 77% 78% 76% 77% OR Quartile 2 1.57 1.38 1.48 1.64 1.38 1.48 1.69 1.46 1.41 p Value 0.24 0.40 0.41 0.21 0.40 0.41 0.20 0.35 0.47 Lower limit of 0.737 0.651 0.585 0.762 0.648 0.585 0.761 0.666 0.556 95% CI Upper limit of 3.34 2.91 3.72 3.52 2.95 3.72 3.73 3.18 3.56 95% CI OR Quartile 3 1.50 1.38 1.45 1.43 1.24 1.45 1.45 1.33 1.58 p Value 0.22 0.33 0.34 0.28 0.51 0.34 0.27 0.40 0.24 Lower limit of 0.787 0.725 0.678 0.747 0.651 0.678 0.751 0.685 0.731 95% CI Upper limit of 2.86 2.63 3.12 2.73 2.38 3.12 2.82 2.57 3.44 95% CI OR Quartile 4 1.73 1.71 1.49 1.46 1.29 1.49 1.48 1.26 1.58 p Value 0.15 0.16 0.35 0.32 0.50 0.35 0.31 0.55 0.29 Lower limit of 0.827 0.814 0.649 0.696 0.616 0.649 0.700 0.595 0.682 95% CI Upper limit of 3.64 3.59 3.44 3.05 2.71 3.44 3.12 2.67 3.64 95% CI

TABLE-US-00107 TABLE 16.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.294 0.649 0.295 0.575 0.368 0.575 Average 0.852 1.26 0.957 1.15 1.01 1.09 Stdev 1.12 1.54 1.40 1.27 1.45 1.18 p (t-test) 0.063 0.39 0.69 Min 0.0113 0.00478 0.0113 0.00478 0.00478 0.0598 Max 6.76 8.76 8.76 5.01 8.76 4.31 n (Patient) 81 70 85 66 91 60 sCr only Median 0.295 0.567 0.331 0.566 0.369 0.566 Average 0.960 1.09 0.969 1.08 1.02 1.02 Stdev 1.42 1.20 1.41 1.21 1.45 1.10 p (t-test) 0.55 0.60 0.98 Min 0.0153 0.00478 0.0153 0.00478 0.00478 0.0113 Max 8.76 5.01 8.76 5.01 8.76 4.30 n (Patient) 81 69 84 66 90 60 UO only Median 0.462 0.716 0.475 0.649 0.462 0.716 Average 0.938 1.33 1.01 1.15 1.00 1.17 Stdev 1.18 1.69 1.39 1.22 1.39 1.23 p (t-test) 0.11 0.58 0.52 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 8.76 4.31 8.76 4.31 n (Patient) 109 41 110 40 111 39 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.60 0.56 0.58 0.58 0.56 0.57 0.57 0.55 0.57 SE 0.046 0.047 0.053 0.047 0.047 0.054 0.048 0.048 0.054 p Value 0.038 0.17 0.12 0.094 0.21 0.21 0.15 0.32 0.20 nCohort 81 81 109 85 84 110 91 90 111 Non-persistent nCohort 70 69 41 66 66 40 60 60 39 Persistent Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 80% 78% 80% 80% 79% 80% 80% 78% 79% Specificity 30% 28% 28% 29% 29% 27% 29% 28% 27% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 57% 55% 59% 56% 55% 57% 57% 55% 59% Specificity 56% 54% 53% 54% 54% 53% 54% 53% 53% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 33% 32% 34% 30% 30% 32% 30% 30% 33% Specificity 81% 80% 78% 79% 79% 77% 78% 78% 77% OR Quartile 2 1.68 1.43 1.57 1.70 1.49 1.50 1.60 1.39 1.44 p Value 0.18 0.35 0.32 0.17 0.31 0.37 0.24 0.40 0.42 Lower limit of 0.791 0.675 0.650 0.790 0.697 0.621 0.734 0.645 0.594 95% CI Upper limit of 3.58 3.02 3.77 3.65 3.17 3.62 3.49 3.00 3.47 95% CI OR Quartile 3 1.67 1.46 1.61 1.50 1.38 1.51 1.53 1.40 1.63 p Value 0.12 0.25 0.20 0.22 0.32 0.27 0.21 0.32 0.19 Lower limit of 0.874 0.765 0.777 0.788 0.725 0.727 0.792 0.725 0.779 95% CI Upper limit of 3.18 2.78 3.32 2.87 2.64 3.13 2.94 2.69 3.42 95% CI OR Quartile 4 2.15 1.90 1.84 1.62 1.59 1.64 1.52 1.50 1.72 p Value 0.045 0.091 0.13 0.20 0.22 0.23 0.27 0.28 0.18 Lower limit of 1.02 0.902 0.835 0.773 0.761 0.737 0.724 0.714 0.772 95% CI Upper limit of 4.56 4.01 4.04 3.39 3.34 3.64 3.20 3.15 3.83 95% CI

TABLE-US-00108 TABLE 16.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.294 0.582 0.295 0.575 0.331 0.582 Average 0.836 1.26 0.849 1.26 0.898 1.24 Stdev 1.09 1.55 1.08 1.57 1.17 1.54 p (t-test) 0.052 0.058 0.12 Min 0.0153 0.00478 0.0153 0.00478 0.00478 0.0113 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 78 73 81 70 88 63 sCr only Median 0.295 0.567 0.331 0.566 0.369 0.566 Average 0.936 1.11 0.946 1.11 0.996 1.05 Stdev 1.40 1.23 1.38 1.24 1.44 1.15 p (t-test) 0.42 0.45 0.80 Min 0.0153 0.00478 0.0153 0.00478 0.00478 0.0113 Max 8.76 5.01 8.76 5.01 8.76 4.30 n (Patient) 79 71 82 68 88 62 UO only Median 0.415 0.728 0.415 0.728 0.427 0.740 Average 0.907 1.40 0.907 1.40 0.902 1.43 Stdev 1.14 1.73 1.14 1.73 1.14 1.75 p (t-test) 0.042 0.042 0.033 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 108 42 108 42 109 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.57 0.60 0.58 0.56 0.60 0.58 0.55 0.60 SE 0.046 0.047 0.053 0.047 0.047 0.053 0.047 0.048 0.053 p Value 0.066 0.16 0.065 0.085 0.19 0.065 0.090 0.29 0.060 nCohort 78 79 108 81 82 108 88 88 109 Non-persistent nCohort 73 71 42 70 68 42 63 62 41 Persistent Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 78% 77% 81% 79% 78% 81% 79% 77% 80% Specificity 28% 28% 28% 28% 28% 28% 28% 27% 28% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 56% 55% 60% 56% 54% 60% 57% 55% 61% Specificity 55% 54% 54% 54% 54% 54% 55% 53% 54% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 33% 32% 36% 31% 31% 36% 32% 31% 37% Specificity 82% 81% 79% 80% 79% 79% 80% 78% 79% OR Quartile 2 1.40 1.33 1.63 1.45 1.38 1.63 1.53 1.29 1.57 p Value 0.37 0.46 0.27 0.33 0.40 0.27 0.28 0.52 0.32 Lower limit of 0.666 0.631 0.680 0.688 0.651 0.680 0.709 0.603 0.650 95% CI Upper limit of 2.94 2.79 3.93 3.07 2.91 3.93 3.28 2.74 3.77 95% CI OR Quartile 3 1.57 1.46 1.71 1.50 1.38 1.71 1.60 1.39 1.84 p Value 0.17 0.25 0.15 0.22 0.33 0.15 0.16 0.32 0.10 Lower limit of 0.828 0.765 0.828 0.786 0.725 0.828 0.834 0.725 0.887 95% CI Upper limit of 2.99 2.77 3.52 2.85 2.63 3.52 3.07 2.67 3.83 95% CI OR Quartile 4 2.24 2.04 2.05 1.86 1.71 2.05 1.81 1.60 2.16 p Value 0.037 0.062 0.071 0.10 0.16 0.071 0.12 0.21 0.055 Lower limit of 1.05 0.965 0.940 0.885 0.814 0.940 0.862 0.765 0.984 95% CI Upper limit of 4.77 4.33 4.49 3.92 3.59 4.49 3.80 3.37 4.73 95% CI

Example 17. Use of Fibroblast Growth Factor 21 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0174] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 21 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0175] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0176] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00109 TABLE 17.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0306 0.370 0.0627 0.330 0.0796 0.305 Average 0.351 0.890 0.538 0.816 0.544 0.833 Stdev 0.842 1.31 1.09 1.24 1.05 1.30 p (t-test) 0.0093 0.18 0.16 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 53 77 68 62 73 57 sCr only Median 0.0333 0.396 0.0570 0.358 0.0684 0.358 Average 0.347 0.908 0.498 0.866 0.490 0.918 Stdev 0.827 1.33 1.05 1.28 1.01 1.33 p (t-test) 0.0067 0.076 0.041 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 55 74 69 60 75 54 UO only Median 0.131 0.233 0.155 0.265 0.155 0.265 Average 0.632 0.832 0.623 0.919 0.637 0.875 Stdev 1.13 1.31 1.11 1.42 1.12 1.42 p (t-test) 0.43 0.27 0.40 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 101 28 106 23 108 21 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.69 0.55 0.62 0.64 0.53 0.59 0.63 0.53 SE 0.045 0.046 0.063 0.049 0.049 0.067 0.051 0.050 0.070 p Value 9.6E6 2.4E5 0.45 0.013 0.0049 0.61 0.063 0.0088 0.71 nCohort 53 55 101 68 69 106 73 75 108 Non-persistent nCohort 77 74 28 62 60 23 57 54 21 Persistent Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 84% 85% 79% 82% 83% 74% 81% 83% 76% Specificity 40% 38% 26% 32% 32% 25% 30% 31% 25% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 64% 62% 61% 63% 63% 52% 60% 63% 52% Specificity 70% 65% 52% 62% 61% 50% 58% 59% 50% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 34% 35% 32% 31% 33% 35% 30% 35% 33% Specificity 87% 87% 76% 79% 81% 76% 78% 81% 76% OR Quartile 2 3.55 3.54 1.27 2.22 2.34 0.921 1.80 2.21 1.07 p Value 0.0026 0.0032 0.64 0.059 0.049 0.88 0.16 0.073 0.91 Lower limit of 1.56 1.53 0.464 0.971 1.00 0.329 0.790 0.929 0.357 95% CI Upper limit of 8.12 8.20 3.48 5.07 5.46 2.58 4.12 5.27 3.19 95% CI OR Quartile 3 4.05 3.11 1.71 2.74 2.69 1.09 2.00 2.41 1.10 p Value 2.5E4 0.0022 0.22 0.0054 0.0066 0.85 0.053 0.016 0.84 Lower limit of 1.92 1.50 0.727 1.35 1.32 0.442 0.991 1.18 0.432 95% CI Upper limit of 8.55 6.44 4.00 5.57 5.49 2.69 4.05 4.95 2.80 95% CI OR Quartile 4 3.35 3.71 1.52 1.70 2.15 1.73 1.51 2.37 1.58 p Value 0.010 0.0055 0.37 0.19 0.063 0.27 0.31 0.036 0.38 Lower limit of 1.33 1.47 0.608 0.767 0.960 0.656 0.685 1.06 0.575 95% CI Upper limit of 8.45 9.37 3.80 3.79 4.83 4.55 3.35 5.29 4.32 95% CI

TABLE-US-00110 TABLE 17.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0204 0.396 0.0409 0.396 0.0627 0.358 Average 0.309 0.882 0.464 0.859 0.475 0.872 Stdev 0.853 1.28 1.08 1.23 1.04 1.26 p (t-test) 0.0064 0.054 0.053 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 48 82 62 68 66 64 sCr only Median 0.0262 0.422 0.0409 0.422 0.0570 0.396 Average 0.308 0.913 0.450 0.885 0.457 0.898 Stdev 0.823 1.31 1.06 1.25 1.04 1.28 p (t-test) 0.0037 0.034 0.032 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 52 77 64 65 67 62 UO only Median 0.131 0.233 0.155 0.265 0.155 0.265 Average 0.622 0.814 0.613 0.875 0.628 0.840 Stdev 1.15 1.24 1.12 1.32 1.13 1.31 p (t-test) 0.41 0.28 0.39 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 93 36 98 31 100 29 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.72 0.54 0.66 0.67 0.53 0.64 0.66 0.52 SE 0.044 0.044 0.057 0.047 0.047 0.060 0.049 0.048 0.062 p Value 3.0E7 5.4E7 0.47 6.9E4 2.7E4 0.63 0.0052 0.0013 0.72 nCohort 48 52 93 62 64 98 66 67 100 Non-persistent nCohort 82 77 36 68 65 31 64 62 29 Persistent Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 84% 86% 78% 82% 85% 74% 81% 84% 76% Specificity 42% 40% 26% 34% 34% 24% 32% 33% 25% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 65% 64% 58% 65% 65% 52% 62% 63% 52% Specificity 75% 69% 53% 66% 64% 50% 62% 61% 50% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 34% 36% 31% 32% 35% 32% 31% 35% 31% Specificity 90% 90% 76% 82% 84% 77% 80% 84% 76% OR Quartile 2 3.79 4.06 1.22 2.39 2.88 0.932 2.02 2.54 1.05 p Value 0.0015 0.0011 0.67 0.036 0.015 0.88 0.090 0.031 0.92 Lower limit of 1.66 1.75 0.489 1.06 1.23 0.369 0.896 1.09 0.400 95% CI Upper limit of 8.65 9.46 3.03 5.40 6.73 2.36 4.56 5.93 2.75 95% CI OR Quartile 3 5.48 3.94 1.56 3.58 3.26 1.07 2.73 2.67 1.07 p Value 2.7E5 3.4E4 0.26 5.5E4 0.0013 0.88 0.0055 0.0068 0.87 Lower limit of 2.48 1.86 0.716 1.74 1.58 0.475 1.34 1.31 0.469 95% CI Upper limit of 12.1 8.34 3.39 7.38 6.69 2.39 5.56 5.45 2.45 95% CI OR Quartile 4 4.46 5.37 1.42 2.22 2.96 1.55 1.85 2.80 1.42 p Value 0.0045 0.0014 0.42 0.059 0.012 0.33 0.13 0.015 0.45 Lower limit of 1.59 1.91 0.604 0.971 1.27 0.640 0.829 1.22 0.573 95% CI Upper limit of 12.5 15.1 3.34 5.07 6.88 3.77 4.14 6.42 3.54 95% CI

TABLE-US-00111 TABLE 17.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence 24 48 72 Period Non- Non- Non- Duration persistent Persistent persistent Persistent persistent Persistent (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0204 0.396 0.0409 0.396 0.0518 0.358 Average 0.309 0.882 0.464 0.859 0.474 0.862 Stdev 0.853 1.28 1.08 1.23 1.06 1.24 p (t-test) 0.0064 0.054 0.058 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 48 82 62 68 64 66 sCr only Persistence 24 48 72 Period Non- Non- Non- Duration persistent Persistent persistent Persistent persistent Persistent (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0306 0.396 0.0465 0.396 0.0570 0.358 Average 0.314 0.901 0.457 0.872 0.467 0.875 Stdev 0.830 1.31 1.07 1.24 1.05 1.26 p (t-test) 0.0051 0.044 0.048 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 51 78 63 66 65 64 UO only Persistence 24 48 72 Period Non- Non- Non- Duration persistent Persistent persistent Persistent persistent Persistent (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.127 0.265 0.147 0.278 0.147 0.278 Average 0.636 0.761 0.625 0.807 0.641 0.773 Stdev 1.18 1.17 1.15 1.24 1.16 1.22 p (t-test) 0.57 0.43 0.57 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 88 41 93 36 95 34 Persistence Period 24 48 72 Duration sCr or sCr UO sCr or sCr UO sCr or sCr UO (hr) UO only only UO only only UO only only AUC 0.73 0.71 0.55 0.66 0.66 0.54 0.65 0.64 0.53 SE 0.044 0.045 0.055 0.047 0.048 0.057 0.048 0.049 0.058 p Value 3.0E7 4.2E6 0.38 6.9E4 9.8E4 0.51 0.0025 0.0034 0.59 nCohort 48 51 88 62 63 93 64 65 95 Non- persistent nCohort 82 78 41 68 66 36 66 64 34 Persistent Cutoff 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Quartile 2 Sensitivity 84% 85% 80% 82% 83% 78% 82% 83% 79% Specificity 42% 39% 27% 34% 33% 26% 33% 32% 26% Cutoff 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Quartile 3 Sensitivity 65% 63% 59% 65% 64% 53% 64% 62% 53% Specificity 75% 69% 53% 66% 63% 51% 64% 62% 51% Cutoff 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Quartile 4 Sensitivity 34% 36% 29% 32% 35% 31% 32% 34% 29% Specificity 90% 90% 76% 82% 84% 76% 81% 83% 76% OR 3.79 3.55 1.55 2.39 2.50 1.22 2.20 2.30 1.38 Quartile 2 p Value 0.0015 0.0029 0.34 0.036 0.031 0.67 0.058 0.050 0.51 Lower 1.66 1.54 0.627 1.06 1.09 0.489 0.973 1.00 0.534 limit of 95% CI Upper 8.65 8.16 3.82 5.40 5.75 3.03 4.96 5.28 3.56 limit of 95% CI OR 5.48 3.70 1.62 3.58 3.04 1.14 3.12 2.67 1.15 Quartile 3 p Value 2.7E5 6.2E4 0.21 5.5E4 0.0024 0.74 0.0018 0.0069 0.73 Lower 2.48 1.75 0.765 1.74 1.49 0.529 1.52 1.31 0.524 limit of 95% CI Upper 12.1 7.82 3.42 7.38 6.24 2.47 6.38 5.43 2.52 limit of 95% CI OR 4.46 5.15 1.32 2.22 2.83 1.42 2.02 2.57 1.30 Quartile 4 p Value 0.0045 0.0019 0.51 0.059 0.016 0.42 0.090 0.025 0.55 Lower 1.59 1.83 0.574 0.971 1.22 0.604 0.896 1.12 0.544 limit of 95% CI Upper 12.5 14.5 3.03 5.07 6.60 3.34 4.56 5.89 3.13 limit of 95% CI

TABLE-US-00112 TABLE 17.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0204 0.396 0.0353 0.370 0.0465 0.346 Average 0.309 0.882 0.466 0.851 0.476 0.854 Stdev 0.853 1.28 1.08 1.22 1.07 1.24 p (t-test) 0.0064 0.060 0.065 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 48 82 61 69 63 67 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0306 0.396 0.0409 0.370 0.0518 0.346 Average 0.314 0.901 0.459 0.864 0.469 0.866 Stdev 0.830 1.31 1.07 1.24 1.06 1.25 p (t-test) 0.0051 0.050 0.054 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 51 78 62 67 64 65 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.107 0.290 0.131 0.298 0.131 0.298 Average 0.645 0.735 0.638 0.760 0.654 0.727 Stdev 1.20 1.14 1.17 1.18 1.18 1.16 p (t-test) 0.68 0.59 0.75 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 85 44 89 40 91 38 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.73 0.71 0.56 0.66 0.66 0.55 0.65 0.64 0.54 SE 0.044 0.045 0.054 0.047 0.048 0.056 0.048 0.048 0.056 p Value 3.0E7 4.2E6 0.28 5.3E4 7.6E4 0.39 0.0020 0.0028 0.45 nCohort Non- 48 51 85 61 62 89 63 64 91 persistent nCohort Persistent 82 78 44 69 67 40 67 65 38 Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 84% 85% 82% 83% 84% 80% 82% 83% 82% Specificity 42% 39% 28% 34% 34% 27% 33% 33% 27% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 65% 63% 61% 65% 64% 57% 64% 63% 58% Specificity 75% 69% 55% 67% 65% 53% 65% 62% 53% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 34% 36% 27% 32% 34% 28% 31% 34% 26% Specificity 90% 90% 75% 82% 84% 75% 81% 83% 75% OR Quartile 2 3.79 3.55 1.77 2.49 2.61 1.48 2.29 2.40 1.68 p Value 0.0015 0.0029 0.21 0.028 0.024 0.40 0.046 0.039 0.28 Lower limit of 95% 1.66 1.54 0.720 1.10 1.13 0.597 1.01 1.04 0.655 CI Upper limit of 95% CI 8.65 8.16 4.35 5.64 6.00 3.65 5.18 5.51 4.30 OR Quartile 3 5.48 3.70 1.96 3.84 3.26 1.51 3.34 2.85 1.53 p Value 2.7E5 6.2E4 0.075 2.9E4 0.0013 0.28 0.0010 0.0041 0.27 Lower limit of 95% 2.48 1.75 0.935 1.85 1.58 0.713 1.63 1.39 0.715 CI Upper limit of 95% CI 12.1 7.82 4.13 7.97 6.70 3.21 6.86 5.81 3.30 OR Quartile 4 4.46 5.15 1.14 2.13 2.72 1.16 1.94 2.47 1.06 p Value 0.0045 0.0019 0.75 0.073 0.020 0.74 0.11 0.033 0.90 Lower limit of 95% 1.59 1.83 0.500 0.931 1.17 0.496 0.860 1.08 0.445 CI Upper limit of 95% CI 12.5 14.5 2.61 4.86 6.32 2.69 4.38 5.64 2.50

TABLE-US-00113 TABLE 17.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0204 0.396 0.0351 0.358 0.0409 0.336 Average 0.309 0.882 0.471 0.842 0.481 0.843 Stdev 0.853 1.28 1.09 1.21 1.08 1.23 p (t-test) 0.0064 0.071 0.077 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 48 82 60 70 62 68 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0306 0.396 0.0409 0.370 0.0518 0.346 Average 0.314 0.901 0.459 0.864 0.469 0.866 Stdev 0.830 1.31 1.07 1.24 1.06 1.25 p (t-test) 0.0051 0.050 0.054 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.40 5.96 5.96 5.46 5.96 5.46 n (Patient) 51 78 62 67 64 65 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0814 0.298 0.115 0.305 0.115 0.305 Average 0.628 0.763 0.627 0.774 0.644 0.745 Stdev 1.20 1.12 1.18 1.15 1.19 1.13 p (t-test) 0.53 0.50 0.65 Min 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 1.37E6 Max 5.96 5.46 5.96 5.46 5.96 5.46 n (Patient) 83 46 86 43 88 41 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.73 0.71 0.58 0.66 0.66 0.57 0.65 0.64 0.56 SE 0.044 0.045 0.053 0.047 0.048 0.054 0.048 0.048 0.055 p Value 3.0E7 4.2E6 0.13 5.1E4 7.6E4 0.20 0.0020 0.0028 0.24 nCohort Non- 48 51 83 60 62 86 62 64 88 persistent nCohort Persistent 82 78 46 70 67 43 68 65 41 Cutoff Quartile 2 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 0.0111 0.0105 0.0131 Sensitivity 84% 85% 83% 83% 84% 81% 82% 83% 83% Specificity 42% 39% 29% 35% 34% 28% 34% 33% 28% Cutoff Quartile 3 0.155 0.147 0.163 0.155 0.147 0.163 0.155 0.147 0.163 Sensitivity 65% 63% 63% 66% 64% 60% 65% 63% 61% Specificity 75% 69% 57% 68% 65% 55% 66% 62% 55% Cutoff Quartile 4 0.774 0.756 0.780 0.774 0.756 0.780 0.774 0.756 0.780 Sensitivity 34% 36% 30% 31% 34% 30% 31% 34% 29% Specificity 90% 90% 77% 82% 84% 77% 81% 83% 76% OR Quartile 2 3.79 3.55 1.93 2.60 2.61 1.69 2.39 2.40 1.93 p Value 0.0015 0.0029 0.15 0.022 0.024 0.25 0.036 0.039 0.17 Lower limit of 95% 1.66 1.54 0.787 1.15 1.13 0.688 1.06 1.04 0.756 CI Upper limit of 95% CI 8.65 8.16 4.74 5.89 6.00 4.17 5.40 5.51 4.92 OR Quartile 3 5.48 3.70 2.23 4.14 3.26 1.84 3.58 2.85 1.88 p Value 2.7E5 6.2E4 0.034 1.5E4 0.0013 0.11 5.5E4 0.0041 0.10 Lower limit of 95% 2.48 1.75 1.06 1.98 1.58 0.876 1.74 1.39 0.881 CI Upper limit of 95% CI 12.1 7.82 4.67 8.62 6.70 3.88 7.38 5.81 3.99 OR Quartile 4 4.46 5.15 1.47 2.04 2.72 1.43 1.86 2.47 1.32 p Value 0.0045 0.0019 0.35 0.090 0.020 0.39 0.13 0.033 0.51 Lower limit of 95% 1.59 1.83 0.655 0.894 1.17 0.629 0.825 1.08 0.574 CI Upper limit of 95% CI 12.5 14.5 3.31 4.66 6.32 3.25 4.20 5.64 3.03

TABLE-US-00114 TABLE 17.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.209 0.733 0.295 0.566 0.371 0.566 Average 0.617 1.25 0.879 1.20 0.895 1.23 Stdev 0.856 1.49 1.14 1.50 1.11 1.58 p (t-test) 0.0059 0.14 0.13 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 6.76 8.76 6.76 8.76 n (Patient) 50 101 75 76 85 66 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.238 0.575 0.295 0.559 0.429 0.535 Average 0.821 1.12 0.995 1.04 1.04 0.998 Stdev 1.41 1.26 1.47 1.16 1.43 1.17 p (t-test) 0.18 0.83 0.86 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 5.01 8.76 5.01 n (Patient) 52 98 73 77 86 64 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.417 0.748 0.475 0.642 0.487 0.716 Average 0.954 1.32 0.977 1.32 0.966 1.44 Stdev 1.22 1.65 1.21 1.80 1.19 1.94 p (t-test) 0.15 0.22 0.11 Min 0.00478 0.0678 0.00478 0.0757 0.00478 0.0757 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 112 38 120 30 125 25 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.67 0.62 0.60 0.57 0.55 0.58 0.55 0.51 0.58 SE 0.045 0.047 0.055 0.047 0.047 0.060 0.047 0.048 0.065 p Value 1.1E4 0.0096 0.074 0.12 0.31 0.19 0.26 0.79 0.21 nCohort Non- 50 52 112 75 73 120 85 86 125 persistent nCohort Persistent 101 98 38 76 77 30 66 64 25 Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 81% 80% 82% 79% 78% 83% 76% 75% 80% Specificity 38% 35% 28% 29% 29% 28% 26% 26% 26% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 58% 56% 61% 55% 53% 57% 55% 52% 56% Specificity 66% 62% 54% 55% 53% 52% 53% 51% 51% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 32% 31% 32% 29% 29% 30% 27% 25% 36% Specificity 88% 85% 77% 79% 78% 76% 76% 74% 77% OR Quartile 2 2.65 2.06 1.69 1.56 1.43 1.90 1.09 1.03 1.43 p Value 0.012 0.059 0.26 0.24 0.35 0.23 0.82 0.94 0.50 Lower limit of 95% CI 1.24 0.972 0.676 0.741 0.680 0.670 0.519 0.490 0.498 Upper limit of 95% CI 5.65 4.39 4.25 3.27 2.99 5.37 2.29 2.17 4.13 OR Quartile 3 2.73 2.05 1.77 1.49 1.31 1.40 1.35 1.12 1.34 p Value 0.0054 0.041 0.14 0.22 0.41 0.42 0.36 0.74 0.51 Lower limit of 95% CI 1.35 1.03 0.837 0.785 0.688 0.624 0.708 0.584 0.563 Upper limit of 95% CI 5.53 4.07 3.74 2.83 2.48 3.13 2.57 2.13 3.17 OR Quartile 4 3.40 2.43 1.53 1.50 1.42 1.34 1.22 0.970 1.86 p Value 0.012 0.045 0.31 0.28 0.35 0.51 0.60 0.94 0.18 Lower limit of 95% CI 1.31 1.02 0.677 0.715 0.678 0.555 0.583 0.460 0.745 Upper limit of 95% CI 8.80 5.78 3.44 3.16 3.00 3.26 2.55 2.04 4.65

TABLE-US-00115 TABLE 17.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Non- Non- Non- Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.201 0.737 0.284 0.567 0.289 0.575 Average 0.603 1.25 0.876 1.18 0.884 1.21 Stdev 0.859 1.48 1.18 1.46 1.14 1.52 p (t-test) 0.0050 0.16 0.13 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 6.76 8.76 6.76 8.76 n (Patient) 49 102 70 81 79 72 sCr only 24 48 72 Persistence Non- Non- Non- Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.231 0.582 0.291 0.562 0.295 0.559 Average 0.811 1.13 1.00 1.04 1.04 0.999 Stdev 1.42 1.26 1.50 1.14 1.47 1.14 p (t-test) 0.17 0.87 0.86 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 5.01 8.76 5.01 n (Patient) 51 99 70 80 79 71 UO only 24 48 72 Persistence Non- Non- Non- Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.295 0.781 0.451 0.740 0.456 0.760 Average 0.923 1.31 0.951 1.31 0.940 1.41 Stdev 1.22 1.57 1.20 1.67 1.18 1.77 p (t-test) 0.099 0.15 0.076 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 103 47 111 39 116 34 Persistence 24 48 72 Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.68 0.63 0.61 0.59 0.55 0.59 0.57 0.53 0.59 SE 0.044 0.047 0.051 0.046 0.047 0.054 0.047 0.047 0.057 p Value 4.9E5 0.0060 0.033 0.062 0.24 0.094 0.11 0.59 0.11 nCohort Non- 49 51 103 70 70 111 79 79 116 persistent nCohort 102 99 47 81 80 39 72 71 34 Persistent Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 81% 80% 81% 80% 79% 82% 78% 76% 79% Specificity 39% 35% 28% 31% 30% 28% 28% 27% 27% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 59% 57% 62% 56% 54% 59% 56% 52% 59% Specificity 67% 63% 55% 56% 54% 53% 54% 52% 53% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 31% 30% 34% 28% 28% 33% 28% 25% 38% Specificity 88% 84% 79% 79% 77% 77% 77% 75% 78% OR Quartile 2 2.77 2.15 1.65 1.86 1.59 1.77 1.35 1.15 1.41 p Value 0.0087 0.046 0.24 0.10 0.22 0.22 0.43 0.71 0.47 Lower limit of 1.29 1.01 0.711 0.885 0.757 0.708 0.643 0.549 0.556 95% CI Upper limit of 5.92 4.59 3.85 3.92 3.33 4.43 2.84 2.41 3.56 95% CI OR Quartile 3 2.95 2.19 2.00 1.57 1.38 1.63 1.49 1.17 1.58 p Value 0.0031 0.026 0.055 0.17 0.33 0.19 0.22 0.62 0.24 Lower limit of 1.44 1.10 0.987 0.826 0.725 0.779 0.786 0.618 0.731 95% CI Upper limit of 6.03 4.39 4.04 2.99 2.63 3.42 2.84 2.23 3.44 95% CI OR Quartile 4 3.28 2.34 1.90 1.45 1.28 1.72 1.30 1.00 2.25 p Value 0.014 0.055 0.10 0.33 0.51 0.18 0.48 1.00 0.052 Lower limit of 1.27 0.981 0.884 0.688 0.609 0.772 0.624 0.479 0.991 95% CI Upper limit of 8.48 5.57 4.09 3.07 2.69 3.83 2.72 2.09 5.12 95% CI

TABLE-US-00116 TABLE 17.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.201 0.737 0.289 0.566 0.294 0.566 Average 0.603 1.25 0.885 1.17 0.908 1.17 Stdev 0.859 1.48 1.18 1.46 1.17 1.49 p (t-test) 0.0050 0.19 0.23 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 6.76 8.76 6.76 8.76 n (Patient) 49 102 69 82 75 76 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.231 0.582 0.294 0.559 0.295 0.559 Average 0.811 1.13 1.01 1.03 1.02 1.01 Stdev 1.42 1.26 1.51 1.14 1.47 1.16 p (t-test) 0.17 0.95 0.96 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 5.01 8.76 5.01 n (Patient) 51 99 69 81 75 75 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.294 0.760 0.451 0.716 0.456 0.728 Average 0.913 1.30 0.951 1.27 0.939 1.34 Stdev 1.21 1.55 1.20 1.62 1.18 1.71 p (t-test) 0.098 0.19 0.11 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 98 52 105 45 110 40 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.68 0.63 0.61 0.58 0.55 0.58 0.57 0.53 0.58 SE 0.044 0.047 0.049 0.046 0.047 0.052 0.047 0.047 0.054 p Value 4.9E5 0.0060 0.025 0.071 0.27 0.12 0.16 0.48 0.14 nCohort Non- persistent 49 51 98 69 69 105 75 75 110 nCohort Persistent 102 99 52 82 81 45 76 75 40 Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 81% 80% 83% 80% 79% 82% 79% 77% 80% Specificity 39% 35% 30% 32% 30% 29% 29% 28% 27% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 59% 57% 62% 55% 53% 58% 54% 52% 57% Specificity 67% 63% 56% 55% 54% 53% 53% 52% 53% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 31% 30% 33% 28% 27% 31% 26% 25% 35% Specificity 88% 84% 79% 78% 77% 77% 76% 75% 78% OR Quartile 2 2.77 2.15 2.01 1.93 1.65 1.85 1.56 1.33 1.50 p Value 0.0087 0.046 0.10 0.083 0.19 0.17 0.24 0.45 0.37 Lower limit of 95% CI 1.29 1.01 0.868 0.917 0.785 0.772 0.741 0.634 0.621 Upper limit of 95% CI 5.92 4.59 4.65 4.07 3.46 4.43 3.27 2.78 3.62 OR Quartile 3 2.95 2.19 2.05 1.49 1.31 1.56 1.34 1.17 1.51 p Value 0.0031 0.026 0.041 0.22 0.41 0.21 0.37 0.62 0.27 Lower limit of 95% CI 1.44 1.10 1.03 0.783 0.687 0.773 0.706 0.618 0.727 Upper limit of 95% CI 6.03 4.39 4.07 2.84 2.49 3.16 2.54 2.23 3.13 OR Quartile 4 3.28 2.34 1.78 1.40 1.24 1.52 1.13 1.00 1.93 p Value 0.014 0.055 0.13 0.37 0.58 0.29 0.74 1.0 0.10 Lower limit of 95% CI 1.27 0.981 0.838 0.664 0.587 0.700 0.542 0.479 0.874 Upper limit of 95% CI 8.48 5.57 3.79 2.96 2.60 3.32 2.36 2.09 4.26

TABLE-US-00117 TABLE 17.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.201 0.737 0.284 0.567 0.291 0.567 Average 0.603 1.25 0.869 1.18 0.894 1.18 Stdev 0.859 1.48 1.19 1.45 1.17 1.49 p (t-test) 0.0050 0.15 0.19 Min 0.0113 0.00478 0.0113 0.00478 0.0113 0.00478 Max 4.20 8.76 6.76 8.76 6.76 8.76 n (Patient) 49 102 68 83 74 77 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.231 0.582 0.291 0.562 0.294 0.562 Average 0.811 1.13 0.998 1.04 1.01 1.03 Stdev 1.42 1.26 1.52 1.14 1.48 1.15 p (t-test) 0.17 0.85 0.95 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 5.01 8.76 5.01 n (Patient) 51 99 68 82 74 76 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.289 0.740 0.316 0.575 0.427 0.582 Average 0.911 1.28 0.963 1.21 0.950 1.27 Stdev 1.23 1.51 1.22 1.56 1.20 1.64 p (t-test) 0.11 0.29 0.18 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 95 55 100 50 105 45 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.68 0.63 0.62 0.59 0.56 0.58 0.57 0.54 0.57 SE 0.044 0.047 0.048 0.046 0.047 0.050 0.046 0.047 0.052 p Value 4.9E5 0.0060 0.016 0.044 0.19 0.13 0.11 0.37 0.16 nCohort Non- 49 51 95 68 68 100 74 74 105 persistent nCohort Persistent 102 99 55 83 82 50 77 76 45 Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 81% 80% 84% 81% 79% 82% 79% 78% 80% Specificity 39% 35% 31% 32% 31% 29% 30% 28% 28% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 59% 57% 60% 55% 54% 56% 55% 53% 56% Specificity 67% 63% 56% 56% 54% 53% 54% 53% 52% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 31% 30% 33% 29% 28% 30% 27% 26% 33% Specificity 88% 84% 79% 79% 78% 77% 77% 76% 78% OR Quartile 2 2.77 2.15 2.25 2.00 1.71 1.86 1.61 1.38 1.53 p Value 0.0087 0.046 0.058 0.068 0.16 0.15 0.21 0.40 0.33 Lower limit of 95% CI 1.29 1.01 0.972 0.950 0.814 0.803 0.768 0.657 0.655 Upper limit of 95% CI 5.92 4.59 5.19 4.22 3.59 4.31 3.39 2.88 3.56 OR Quartile 3 2.95 2.19 1.89 1.57 1.38 1.44 1.41 1.24 1.38 p Value 0.0031 0.026 0.064 0.17 0.33 0.30 0.29 0.51 0.37 Lower limit of 95% CI 1.44 1.10 0.964 0.826 0.725 0.725 0.744 0.652 0.682 Upper limit of 95% CI 6.03 4.39 3.72 3.00 2.63 2.84 2.68 2.35 2.77 OR Quartile 4 3.28 2.34 1.82 1.57 1.38 1.43 1.26 1.11 1.78 p Value 0.014 0.055 0.12 0.24 0.40 0.35 0.54 0.78 0.14 Lower limit of 95% CI 1.27 0.981 0.863 0.737 0.651 0.669 0.601 0.532 0.823 Upper limit of 95% CI 8.48 5.57 3.86 3.34 2.91 3.08 2.63 2.32 3.86

TABLE-US-00118 TABLE 17.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.216 0.725 0.278 0.575 0.287 0.582 Average 0.627 1.23 0.825 1.20 0.830 1.22 Stdev 0.869 1.47 1.15 1.46 1.12 1.49 p (t-test) 0.010 0.085 0.073 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 4.20 8.76 6.76 8.76 6.76 8.76 n (Patient) 47 104 65 86 70 81 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.238 0.575 0.291 0.562 0.294 0.562 Average 0.826 1.12 0.970 1.06 0.987 1.05 Stdev 1.43 1.26 1.50 1.17 1.46 1.19 p (t-test) 0.21 0.69 0.78 Min 0.0153 0.00478 0.0153 0.00478 0.0153 0.00478 Max 8.76 6.76 8.76 5.01 8.76 5.01 n (Patient) 50 100 66 84 72 78 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.282 0.805 0.289 0.740 0.295 0.740 Average 0.830 1.39 0.861 1.36 0.858 1.41 Stdev 1.15 1.56 1.15 1.59 1.13 1.65 p (t-test) 0.013 0.027 0.017 Min 0.00478 0.0598 0.00478 0.0598 0.00478 0.0598 Max 6.76 8.76 6.76 8.76 6.76 8.76 n (Patient) 92 58 95 55 99 51 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.65 0.62 0.65 0.60 0.56 0.63 0.59 0.54 0.63 SE 0.046 0.047 0.047 0.046 0.047 0.048 0.046 0.047 0.049 p Value 7.5E4 0.014 0.0014 0.028 0.19 0.0073 0.047 0.37 0.011 nCohort Non- 47 50 92 65 66 95 70 72 99 persistent nCohort Persistent 104 100 58 86 84 55 81 78 51 Cutoff Quartile 2 0.162 0.161 0.161 0.162 0.161 0.161 0.162 0.161 0.161 Sensitivity 80% 79% 84% 80% 79% 84% 79% 77% 82% Specificity 36% 34% 32% 32% 30% 31% 30% 28% 29% Cutoff Quartile 3 0.511 0.503 0.519 0.511 0.503 0.519 0.511 0.503 0.519 Sensitivity 58% 56% 62% 56% 54% 60% 56% 53% 59% Specificity 66% 62% 58% 57% 55% 56% 56% 53% 55% Cutoff Quartile 4 1.46 1.45 1.46 1.46 1.45 1.46 1.46 1.45 1.46 Sensitivity 31% 30% 36% 30% 29% 36% 30% 27% 39% Specificity 87% 84% 82% 82% 79% 81% 80% 76% 82% OR Quartile 2 2.24 1.94 2.51 1.94 1.59 2.25 1.61 1.28 1.93 p Value 0.039 0.087 0.031 0.081 0.22 0.058 0.21 0.51 0.12 Lower limit of 95% CI 1.04 0.908 1.09 0.922 0.761 0.972 0.770 0.613 0.835 Upper limit of 95% CI 4.81 4.13 5.78 4.07 3.34 5.19 3.38 2.68 4.48 OR Quartile 3 2.64 2.08 2.22 1.67 1.38 1.89 1.57 1.24 1.71 p Value 0.0080 0.039 0.020 0.12 0.32 0.064 0.17 0.51 0.12 Lower limit of 95% CI 1.29 1.04 1.14 0.872 0.725 0.964 0.826 0.652 0.865 Upper limit of 95% CI 5.42 4.16 4.36 3.20 2.64 3.72 2.99 2.35 3.40 OR Quartile 4 3.04 2.25 2.50 1.91 1.49 2.44 1.68 1.19 2.90 p Value 0.022 0.067 0.017 0.10 0.31 0.020 0.18 0.64 0.0060 Lower limit of 95% CI 1.17 0.944 1.18 0.880 0.697 1.15 0.791 0.569 1.36 Upper limit of 95% CI 7.87 5.36 5.31 4.16 3.17 5.18 3.58 2.50 6.20

Example 18. Use of Fibroblast Growth Factor 23 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0177] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0178] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0179] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00119 TABLE 18.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 1.90E6 0.0223 1.90E6 0.0220 1.90E6 0.0220 Average 0.0562 0.116 0.0188 0.121 0.0196 0.119 Stdev 0.189 0.239 0.0473 0.247 0.0500 0.245 p (t-test) 0.27 0.076 0.100 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.173 1.70 0.173 1.70 n (Patient) 22 108 19 111 17 113 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000547 0.0231 0.000806 0.0230 0.000547 0.0228 Average 0.0156 0.132 0.0161 0.131 0.0167 0.129 Stdev 0.0387 0.258 0.0392 0.257 0.0399 0.256 p (t-test) 0.017 0.020 0.024 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.173 1.70 0.173 1.70 0.173 1.70 n (Patient) 29 100 28 101 27 102 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0182 0.0215 0.0162 0.0216 0.0106 0.0222 Average 0.0863 0.142 0.0742 0.152 0.0668 0.150 Stdev 0.157 0.324 0.131 0.321 0.118 0.307 p (t-test) 0.19 0.061 0.042 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.500 1.70 0.459 1.70 n (Patient) 82 47 75 54 67 62 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.72 0.73 0.56 0.73 0.73 0.59 0.75 0.72 0.61 SE 0.053 0.048 0.053 0.055 0.049 0.051 0.055 0.049 0.050 p Value 4.5E5 1.0E6 0.25 2.5E5 3.7E6 0.078 7.6E6 5.7E6 0.021 nCohort Recovered 22 29 82 19 28 75 17 27 67 nCohort Non- 108 100 47 111 101 54 113 102 62 recovered Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 90% 90% 94% 89% 90% 93% 89% 90% 94% Specificity 27% 24% 17% 26% 25% 17% 29% 26% 19% Cutoff Quartile 3 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Sensitivity 56% 59% 55% 56% 58% 57% 56% 58% 60% Specificity 82% 79% 52% 84% 79% 55% 88% 78% 58% Cutoff Quartile 4 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Sensitivity 28% 31% 30% 28% 31% 31% 27% 30% 31% Specificity 86% 93% 77% 89% 93% 79% 88% 93% 79% OR Quartile 2 3.31 2.86 3.02 2.95 3.03 2.62 3.51 3.22 3.49 p Value 0.037 0.055 0.097 0.074 0.043 0.11 0.041 0.034 0.038 Lower limit of 95% 1.07 0.980 0.820 0.902 1.03 0.805 1.05 1.09 1.07 CI Upper limit of 95% CI 10.2 8.37 11.1 9.63 8.90 8.54 11.7 9.48 11.4 OR Quartile 3 5.84 5.52 1.37 6.75 5.15 1.63 9.45 4.80 2.06 p Value 0.0026 6.6E4 0.40 0.0037 0.0011 0.18 0.0038 0.0019 0.043 Lower limit of 95% 1.85 2.06 0.664 1.86 1.92 0.803 2.06 1.79 1.02 CI Upper limit of 95% CI 18.4 14.7 2.80 24.5 13.8 3.29 43.3 12.9 4.16 OR Quartile 4 2.44 6.07 1.41 3.29 5.76 1.69 2.84 5.46 1.67 p Value 0.18 0.018 0.41 0.12 0.022 0.19 0.18 0.027 0.21 Lower limit of 95% 0.672 1.36 0.627 0.718 1.29 0.764 0.613 1.22 0.752 CI Upper limit of 95% CI 8.84 27.1 3.16 15.1 25.8 3.76 13.1 24.5 3.72

TABLE-US-00120 TABLE 18.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 1.90E6 0.0231 1.90E6 0.0231 1.90E6 0.0230 Average 0.0181 0.137 0.0185 0.134 0.0195 0.131 Stdev 0.0393 0.262 0.0404 0.260 0.0423 0.257 p (t-test) 0.0096 0.013 0.022 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.173 1.70 0.173 1.70 0.173 1.70 n (Patient) 34 96 32 98 29 101 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000806 0.0303 0.00106 0.0303 0.000806 0.0277 Average 0.0172 0.145 0.0176 0.144 0.0180 0.142 Stdev 0.0364 0.268 0.0367 0.267 0.0371 0.266 p (t-test) 0.0032 0.0041 0.0050 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.173 1.70 0.173 1.70 0.173 1.70 n (Patient) 40 90 39 91 38 92 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0182 0.0219 0.0162 0.0225 0.0126 0.0230 Average 0.0723 0.180 0.0745 0.165 0.0680 0.160 Stdev 0.126 0.360 0.130 0.343 0.118 0.325 p (t-test) 0.013 0.034 0.025 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.500 1.70 0.500 1.70 0.459 1.70 n (Patient) 88 41 83 46 75 54 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.74 0.73 0.59 0.74 0.73 0.60 0.75 0.72 0.62 SE 0.045 0.044 0.055 0.046 0.045 0.053 0.046 0.046 0.050 p Value 1.5E7 1.3E7 0.086 1.7E7 4.9E7 0.056 1.2E7 8.6E7 0.015 nCohort Recovered 34 40 88 32 39 83 29 38 75 nCohort Non- 96 90 41 98 91 46 101 92 54 recovered Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 91% 90% 93% 91% 90% 93% 91% 90% 94% Specificity 24% 20% 16% 25% 21% 17% 28% 21% 19% Cutoff Quartile 3 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Sensitivity 59% 61% 56% 59% 60% 59% 58% 60% 61% Specificity 76% 75% 52% 78% 74% 54% 79% 74% 57% Cutoff Quartile 4 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Sensitivity 31% 33% 37% 31% 33% 33% 30% 33% 31% Specificity 91% 92% 80% 91% 92% 78% 90% 92% 79% OR Quartile 2 2.97 2.25 2.40 3.30 2.35 2.91 3.89 2.46 3.90 p Value 0.042 0.13 0.19 0.027 0.11 0.11 0.012 0.090 0.040 Lower limit of 95% 1.04 0.798 0.649 1.15 0.833 0.790 1.34 0.869 1.06 CI Upper limit of 95% CI 8.49 6.34 8.85 9.45 6.64 10.7 11.3 6.96 14.3 OR Quartile 3 4.75 4.71 1.40 5.18 4.43 1.68 5.38 4.16 2.11 p Value 6.1E4 2.6E4 0.38 5.3E4 4.6E4 0.16 7.8E4 8.0E4 0.040 Lower limit of 95% 1.95 2.05 0.664 2.04 1.93 0.812 2.02 1.81 1.03 CI Upper limit of 95% CI 11.6 10.8 2.95 13.1 10.2 3.49 14.4 9.58 4.31 OR Quartile 4 4.70 6.17 2.24 4.26 5.90 1.75 3.66 5.65 1.69 p Value 0.016 0.0045 0.053 0.025 0.0056 0.18 0.045 0.0070 0.19 Lower limit of 95% 1.33 1.76 0.988 1.20 1.68 0.779 1.03 1.61 0.764 CI Upper limit of 95% CI 16.6 21.6 5.09 15.1 20.7 3.92 13.0 19.8 3.76

TABLE-US-00121 TABLE 18.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000547 0.0303 0.000547 0.0303 1.90E6 0.0232 Average 0.0220 0.153 0.0225 0.150 0.0220 0.144 Stdev 0.0448 0.277 0.0457 0.275 0.0468 0.270 p (t-test) 0.0016 0.0025 0.0046 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.206 1.70 0.206 1.70 0.206 1.70 n (Patient) 47 83 45 85 41 89 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00174 0.0561 0.00242 0.0559 0.00106 0.0559 Average 0.0210 0.162 0.0214 0.160 0.0205 0.157 Stdev 0.0428 0.284 0.0431 0.282 0.0430 0.280 p (t-test) 5.1E4 6.8E4 9.0E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.206 1.70 0.206 1.70 0.206 1.70 n (Patient) 52 78 51 79 49 81 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0181 0.0267 0.0133 0.0267 0.0106 0.0231 Average 0.0704 0.187 0.0710 0.175 0.0698 0.161 Stdev 0.125 0.363 0.128 0.348 0.124 0.327 p (t-test) 0.0076 0.015 0.028 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.500 1.70 0.500 1.70 0.459 1.70 n (Patient) 89 40 85 44 77 52 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.74 0.74 0.62 0.73 0.73 0.63 0.74 0.74 0.64 SE 0.043 0.043 0.055 0.044 0.043 0.053 0.043 0.043 0.050 p Value 5.0E8 1.7E8 0.032 8.1E8 7.0E8 0.012 1.6E8 2.7E8 0.0061 nCohort Recovered 47 52 89 45 51 85 41 49 77 nCohort Non- 83 78 40 85 79 44 89 81 52 recovered Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 92% 91% 95% 92% 91% 95% 92% 91% 96% Specificity 21% 19% 17% 22% 20% 18% 24% 20% 19% Cutoff Quartile 3 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Sensitivity 63% 64% 57% 62% 63% 61% 62% 63% 63% Specificity 72% 71% 53% 73% 71% 55% 76% 71% 58% Cutoff Quartile 4 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Sensitivity 35% 37% 38% 34% 37% 36% 33% 36% 33% Specificity 91% 92% 80% 91% 92% 80% 90% 92% 79% OR Quartile 2 2.93 2.41 3.85 3.18 2.51 4.50 3.78 2.71 6.05 p Value 0.043 0.096 0.083 0.030 0.083 0.053 0.013 0.060 0.020 Lower limit of 95% 1.03 0.855 0.837 1.12 0.887 0.980 1.32 0.957 1.32 CI Upper limit of 95% CI 8.32 6.82 17.7 9.05 7.09 20.7 10.8 7.68 27.7 OR Quartile 3 4.39 4.40 1.51 4.55 4.14 1.96 5.01 4.25 2.44 p Value 2.0E4 1.3E4 0.28 1.8E4 2.3E4 0.075 1.4E4 2.2E4 0.016 Lower limit of 95% 2.01 2.06 0.713 2.06 1.94 0.935 2.18 1.97 1.18 CI Upper limit of 95% CI 9.56 9.40 3.21 10.1 8.82 4.13 11.5 9.15 5.04 OR Quartile 4 5.77 7.10 2.37 5.31 6.82 2.29 4.47 6.27 1.85 p Value 0.0021 5.9E4 0.040 0.0035 7.7E4 0.046 0.0089 0.0013 0.13 Lower limit of 95% 1.88 2.32 1.04 1.73 2.23 1.01 1.45 2.05 0.833 CI Upper limit of 95% CI 17.7 21.7 5.39 16.3 20.9 5.15 13.7 19.2 4.12

TABLE-US-00122 TABLE 18.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00106 0.0564 0.000547 0.0303 1.90E-6 0.0267 Average 0.0214 0.164 0.0217 0.157 0.0216 0.149 Stdev 0.0426 0.285 0.0442 0.280 0.0456 0.273 p (t-test) 4.4E-4 0.0011 0.0027 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.206 1.70 0.206 1.70 0.206 1.70 n (Patient) 53 77 49 81 44 86 sCr only Median 0.00106 0.0605 0.00174 0.0584 0.00106 0.0605 Average 0.0207 0.168 0.0211 0.166 0.0200 0.165 Stdev 0.0420 0.288 0.0423 0.286 0.0418 0.285 p (t-test) 2.5E-4 3.4E-4 3.5E-4 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.206 1.70 0.206 1.70 0.206 1.70 n (Patient) 55 75 54 76 53 77 UO only Median 0.0133 0.0303 0.0106 0.0267 0.00953 0.0232 Average 0.0707 0.181 0.0719 0.169 0.0704 0.159 Stdev 0.127 0.355 0.130 0.341 0.125 0.325 p (t-test) 0.011 0.022 0.033 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.500 1.70 0.500 1.70 0.459 1.70 n (Patient) 87 42 83 46 76 53 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.75 0.76 0.64 0.75 0.75 0.64 0.76 0.76 0.64 SE 0.042 0.042 0.054 0.042 0.042 0.052 0.042 0.042 0.050 p Value 5.9E-9 9.2E-10 0.012 3.2E-9 4.7E-9 0.0054 1.1E-9 7.5E-10 0.0051 nCohort Recovered 53 55 87 49 54 83 44 53 76 nCohort Non- 77 75 42 81 76 46 86 77 53 recovered Cutoff Quartile 2 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 Sensitivity 92% 92% 95% 93% 92% 96% 93% 92% 96% Specificity 21% 20% 17% 22% 20% 18% 25% 21% 20% Cutoff Quartile 3 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Sensitivity 64% 65% 62% 64% 64% 65% 63% 65% 64% Specificity 70% 71% 55% 73% 70% 58% 75% 72% 59% Cutoff Quartile 4 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Sensitivity 38% 39% 36% 36% 38% 35% 34% 38% 32% Specificity 92% 93% 79% 92% 93% 80% 91% 92% 79% OR Quartile 2 3.10 2.88 4.17 3.62 2.98 4.85 4.44 3.10 6.27 p Value 0.037 0.052 0.067 0.018 0.044 0.042 0.0065 0.037 0.018 Lower limit of 95% CI 1.07 0.992 0.907 1.24 1.03 1.06 1.52 1.07 1.37 Upper limit of 95% CI 8.99 8.33 19.2 10.5 8.66 22.3 13.0 8.99 28.7 OR Quartile 3 4.05 4.59 2.00 4.97 4.31 2.57 5.06 4.69 2.60 p Value 2.5E-4 7.0E-5 0.071 5.7E-5 1.3E-4 0.013 8.8E-5 6.6E-5 0.0098 Lower limit of 95% CI 1.92 2.17 0.942 2.28 2.04 1.22 2.25 2.20 1.26 Upper limit of 95% CI 8.55 9.74 4.24 10.8 9.12 5.43 11.4 10.0 5.36 OR Quartile 4 7.40 8.04 2.13 6.27 7.71 2.07 5.09 7.40 1.77 p Value 4.5E-4 2.6E-4 0.070 0.0013 3.4E-4 0.077 0.0044 4.5E-4 0.16 Lower limit of 95% CI 2.42 2.63 0.941 2.05 2.52 0.923 1.66 2.42 0.797 Upper limit of 95% CI 22.7 24.6 4.82 19.2 23.6 4.64 15.6 22.7 3.93

TABLE-US-00123 TABLE 18.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00847 0.0303 0.00752 0.0232 0.00752 0.0232 Average 0.0582 0.180 0.0591 0.174 0.0591 0.174 Stdev 0.108 0.333 0.110 0.328 0.110 0.328 p (t-test) 0.0031 0.0051 0.0051 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 79 51 77 53 77 53 sCr only Median 0.00344 0.0582 0.00344 0.0582 0.00344 0.0582 Average 0.0371 0.177 0.0371 0.177 0.0371 0.177 Stdev 0.0740 0.307 0.0740 0.307 0.0740 0.307 p (t-test) 4.6E-4 4.6E-4 4.6E-4 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.364 1.70 0.364 1.70 0.364 1.70 n (Patient) 66 64 66 64 66 64 UO only Median 0.0130 0.0303 0.0116 0.0303 0.0106 0.0267 Average 0.0612 0.198 0.0621 0.190 0.0627 0.186 Stdev 0.111 0.356 0.112 0.350 0.113 0.347 p (t-test) 0.0014 0.0026 0.0035 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 86 43 84 45 83 46 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.71 0.66 0.67 0.71 0.66 0.67 0.71 0.66 SE 0.050 0.045 0.053 0.049 0.045 0.052 0.049 0.045 0.052 p Value 7.3E-4 2.4E-6 0.0027 6.1E-4 2.4E-6 0.0025 6.1E-4 2.4E-6 0.0026 nCohort 79 66 86 77 66 84 77 66 83 Recovered nCohort 51 64 43 53 64 45 53 64 46 Non- recovered Cutoff 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 Quartile 2 Sensitivity 96% 94% 95% 96% 94% 96% 96% 94% 96% Specificity 19% 20% 17% 19% 20% 18% 19% 20% 18% Cutoff 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Quartile 3 Sensitivity 65% 66% 63% 66% 66% 64% 66% 66% 65% Specificity 59% 65% 56% 61% 65% 57% 61% 65% 58% Cutoff 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Quartile 4 Sensitivity 37% 39% 40% 36% 39% 38% 36% 39% 37% Specificity 82% 88% 81% 82% 88% 81% 82% 88% 81% OR 5.74 3.68 4.33 6.17 3.68 4.67 6.17 3.68 4.85 Quartile 2 p Value 0.024 0.030 0.060 0.019 0.030 0.047 0.019 0.030 0.042 Lower limit 1.25 1.13 0.943 1.35 1.13 1.02 1.35 1.13 1.06 of 95% CI Upper limit 26.3 12.0 19.9 28.2 12.0 21.5 28.2 12.0 22.3 of 95% CI OR 2.69 3.57 2.13 3.05 3.57 2.42 3.05 3.57 2.57 Quartile 3 p Value 0.0078 5.6E-4 0.048 0.0028 5.6E-4 0.021 0.0028 5.6E-4 0.013 Lower limit 1.30 1.73 1.01 1.47 1.73 1.14 1.47 1.73 1.22 of 95% CI Upper limit 5.58 7.35 4.52 6.32 7.35 5.11 6.32 7.35 5.43 of 95% CI OR 2.76 4.65 2.86 2.51 4.65 2.58 2.51 4.65 2.45 Quartile 4 p Value 0.014 7.5E-4 0.012 0.025 7.5E-4 0.022 0.025 7.5E-4 0.030 Lower limit 1.23 1.90 1.26 1.12 1.90 1.15 1.12 1.90 1.09 of 95% CI Upper limit 6.20 11.4 6.48 5.63 11.4 5.81 5.63 11.4 5.52 of 95% CI

TABLE-US-00124 TABLE 18.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0664 0.198 0.0625 0.190 0.0625 0.190 Average 0.233 0.365 0.219 0.363 0.172 0.367 Stdev 0.440 0.383 0.453 0.382 0.403 0.388 p (t-test) 0.13 0.12 0.043 Min 0.00372 0.00169 0.00372 0.00169 0.00372 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 25 126 21 130 19 132 sCr only Median 0.0664 0.204 0.0651 0.198 0.0631 0.198 Average 0.201 0.372 0.206 0.370 0.170 0.375 Stdev 0.395 0.387 0.402 0.386 0.356 0.393 p (t-test) 0.035 0.047 0.015 Min 0.00372 0.00169 0.00372 0.00169 0.00372 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 29 121 28 122 26 124 UO only Median 0.112 0.335 0.119 0.319 0.127 0.288 Average 0.282 0.442 0.276 0.433 0.286 0.407 Stdev 0.374 0.409 0.374 0.406 0.383 0.400 p (t-test) 0.015 0.015 0.059 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 91 59 84 66 77 73 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.68 0.64 0.68 0.67 0.64 0.71 0.70 0.61 SE 0.055 0.051 0.047 0.056 0.052 0.046 0.056 0.051 0.046 p Value 0.0047 5.5E-4 0.0041 0.0012 8.3E-4 0.0031 1.3E-4 1.1E-4 0.020 nCohort 25 29 91 21 28 84 19 26 77 Recovered nCohort 126 121 59 130 122 66 132 124 73 Non- recovered Cutoff 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Quartile 2 Sensitivity 76% 77% 80% 77% 77% 80% 77% 77% 78% Specificity 32% 34% 29% 38% 36% 30% 42% 38% 29% Cutoff 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Quartile 3 Sensitivity 56% 57% 63% 55% 57% 61% 55% 56% 58% Specificity 76% 79% 58% 76% 79% 58% 79% 81% 57% Cutoff 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Quartile 4 Sensitivity 28% 29% 37% 28% 29% 36% 28% 29% 34% Specificity 88% 90% 82% 90% 89% 83% 95% 92% 83% OR 1.51 1.75 1.57 2.05 1.87 1.73 2.47 2.14 1.42 Quartile 2 p Value 0.39 0.21 0.26 0.15 0.17 0.16 0.075 0.095 0.35 Lower limit 0.591 0.729 0.718 0.777 0.773 0.803 0.912 0.875 0.678 of 95% CI Upper limit 3.84 4.19 3.42 5.41 4.50 3.72 6.71 5.25 3.00 of 95% CI OR 3.96 5.09 2.35 3.85 4.77 2.15 4.50 5.44 1.81 Quartile 3 p Value 0.0061 9.9E-4 0.013 0.013 0.0016 0.022 0.011 0.0014 0.073 Lower limit 1.48 1.93 1.20 1.33 1.81 1.12 1.42 1.93 0.946 of 95% CI Upper limit 10.6 13.4 4.59 11.1 12.6 4.16 14.3 15.4 3.45 of 95% CI OR 2.82 3.53 2.79 3.64 3.35 2.86 7.01 4.91 2.56 Quartile 4 p Value 0.11 0.050 0.0078 0.093 0.060 0.0069 0.063 0.037 0.016 Lower limit 0.794 1.00 1.31 0.806 0.951 1.33 0.903 1.10 1.19 of 95% CI Upper limit 10.0 12.4 5.93 16.4 11.8 6.12 54.4 21.9 5.52 of 95% CI

TABLE-US-00125 TABLE18.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0769 0.204 0.0769 0.193 0.0713 0.204 Average 0.240 0.380 0.243 0.374 0.189 0.384 Stdev 0.371 0.398 0.385 0.394 0.340 0.399 p (t-test) 0.053 0.081 0.012 Min 0.00372 0.00169 0.00372 0.00169 0.00372 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 40 111 36 115 32 119 sCr only Median 0.0752 0.249 0.0762 0.226 0.0727 0.249 Average 0.229 0.390 0.232 0.387 0.201 0.394 Stdev 0.357 0.401 0.360 0.400 0.326 0.405 p (t-test) 0.022 0.029 0.0075 Min 0.00372 0.00169 0.00372 0.00169 0.00372 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 44 107 43 108 40 111 UO only Median 0.119 0.353 0.112 0.335 0.112 0.300 Average 0.276 0.483 0.271 0.465 0.274 0.438 Stdev 0.352 0.441 0.356 0.428 0.362 0.419 p (t-test) 0.0023 0.0032 0.012 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 100 50 93 57 85 65 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.63 0.65 0.66 0.64 0.64 0.66 0.68 0.67 0.63 SE 0.049 0.047 0.049 0.050 0.048 0.047 0.049 0.047 0.046 p Value 0.0066 0.0019 0.0015 0.0055 0.0028 8.8E-4 1.5E-4 3.1E-4 0.0045 nCohort Recovered 40 44 100 36 43 93 32 40 85 nCohort Non- 111 107 50 115 108 57 119 111 65 recovered Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 77% 78% 82% 77% 78% 82% 78% 78% 80% Specificity 30% 32% 29% 33% 33% 30% 38% 35% 29% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 57% 59% 64% 56% 58% 63% 56% 59% 60% Specificity 68% 70% 57% 67% 70% 58% 72% 72% 58% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 28% 29% 38% 28% 29% 37% 29% 30% 35% Specificity 82% 84% 81% 83% 84% 82% 91% 88% 82% OR Quartile 2 1.40 1.61 1.86 1.71 1.69 2.02 2.15 1.95 1.67 p Value 0.41 0.23 0.15 0.20 0.19 0.089 0.074 0.098 0.19 Lower limit of 95% CI 0.626 0.740 0.803 0.754 0.772 0.897 0.929 0.885 0.775 Upper limit of 95% CI 3.14 3.52 4.31 3.88 3.70 4.57 4.96 4.31 3.59 OR Quartile 3 2.73 3.41 2.36 2.51 3.23 2.37 3.29 3.73 2.04 p Value 0.0098 0.0014 0.016 0.022 0.0023 0.012 0.0061 0.0011 0.033 Lower limit of 95% CI 1.27 1.61 1.17 1.15 1.52 1.21 1.41 1.69 1.06 Upper limit of 95% CI 5.83 7.25 4.75 5.50 6.87 4.67 7.72 8.21 3.94 OR Quartile 4 1.83 2.16 2.61 1.93 2.07 2.61 4.03 2.96 2.56 p Value 0.20 0.098 0.013 0.18 0.12 0.013 0.029 0.037 0.015 Lower limit of 95% CI 0.732 0.868 1.22 0.733 0.833 1.23 1.15 1.07 1.20 Upper limit of 95% CI 4.56 5.35 5.58 5.07 5.15 5.53 14.1 8.23 5.44

TABLE-US-00126 TABLE 18.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0769 0.276 0.0769 0.276 0.0704 0.288 Average 0.232 0.398 0.218 0.398 0.169 0.405 Stdev 0.351 0.404 0.347 0.403 0.309 0.404 p (t-test) 0.014 0.0095 1.0E-3 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 50 101 46 105 40 111 sCr only Median 0.0752 0.288 0.0752 0.288 0.0693 0.288 Average 0.223 0.409 0.213 0.411 0.184 0.419 Stdev 0.341 0.408 0.334 0.408 0.301 0.412 p (t-test) 0.0050 0.0031 5.0E-4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 54 97 52 99 49 102 UO only Median 0.108 0.383 0.104 0.372 0.119 0.319 Average 0.267 0.493 0.265 0.480 0.271 0.445 Stdev 0.349 0.435 0.354 0.425 0.359 0.420 p (t-test) 7.1E-4 0.0011 0.0072 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 98 52 94 56 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.66 0.68 0.66 0.67 0.68 0.71 0.70 0.63 SE 0.046 0.044 0.047 0.046 0.044 0.046 0.044 0.043 0.046 p Value 7.9E-4 2.1E-4 1.7E-4 3.2E-4 8.7E-5 1.3E-4 9.1E-7 2.3E-6 0.0048 nCohort 50 54 98 46 52 94 40 49 86 Recovered nCohort 101 97 52 105 99 56 111 102 64 Non- recovered Cutoff 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Quartile 2 Sensitivity 79% 80% 85% 79% 81% 84% 80% 81% 78% Specificity 34% 35% 31% 35% 37% 31% 40% 39% 28% Cutoff 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Quartile 3 Sensitivity 58% 61% 65% 58% 61% 66% 59% 62% 61% Specificity 66% 69% 58% 67% 69% 60% 75% 73% 58% Cutoff 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Quartile 4 Sensitivity 30% 31% 38% 30% 31% 38% 32% 32% 36% Specificity 84% 85% 82% 87% 87% 82% 92% 90% 83% OR 1.96 2.23 2.43 2.01 2.42 2.33 2.70 2.77 1.38 Quartile 2 p Value 0.081 0.036 0.045 0.074 0.021 0.048 0.013 0.0087 0.40 Lower limit 0.920 1.05 1.02 0.934 1.14 1.01 1.23 1.29 0.648 of 95% CI Upper limit 4.18 4.72 5.78 4.33 5.15 5.38 5.92 5.92 2.95 of 95% CI OR 2.73 3.38 2.63 2.87 3.46 2.87 4.40 4.47 2.17 Quartile 3 p Value 0.0054 7.0E-4 0.0067 0.0046 6.5E-4 0.0027 3.4E-4 8.9E-5 0.022 Lower limit 1.35 1.67 1.31 1.38 1.70 1.44 1.96 2.11 1.12 of 95% CI Upper limit 5.53 6.83 5.28 5.93 7.07 5.72 9.89 9.47 4.19 of 95% CI OR 2.22 2.57 2.78 2.92 2.93 2.72 5.68 4.21 2.66 Quartile 4 p Value 0.072 0.032 0.0082 0.027 0.020 0.0094 0.0062 0.0055 0.011 Lower limit 0.931 1.08 1.30 1.13 1.19 1.28 1.64 1.53 1.25 of 95% CI Upper limit 5.29 6.12 5.92 7.58 7.23 5.78 19.7 11.6 5.65 of 95% CI

TABLE-US-00127 TABLE 18.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Cohort Non-recovered Cohort Recovered Cohort Non-recovered Cohort Recovered Cohort Non-recovered Cohort sCr or UO Median 0.0847 0.288 0.0804 0.291 0.0784 0.297 Average 0.230 0.413 0.216 0.411 0.193 0.411 Stdev 0.328 0.417 0.326 0.412 0.328 0.404 p (t-test) 0.0051 0.0033 0.0015 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 58 93 53 98 47 104 sCr only Median 0.0791 0.293 0.0784 0.297 0.0777 0.297 Average 0.222 0.422 0.211 0.427 0.204 0.427 Stdev 0.325 0.417 0.316 0.417 0.317 0.414 p (t-test) 0.0020 8.4E-4 6.5E-4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 60 91 59 92 57 94 UO only Median 0.119 0.350 0.108 0.354 0.128 0.302 Average 0.268 0.481 0.266 0.471 0.275 0.439 Stdev 0.348 0.438 0.353 0.427 0.358 0.424 p (t-test) 0.0013 0.0017 0.011 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 96 54 92 58 86 64 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr o rUO sCr only UO only AUC 0.64 0.65 0.65 0.65 0.67 0.66 0.68 0.68 0.61 SE 0.045 0.044 0.048 0.045 0.044 0.047 0.044 0.043 0.047 p Value 0.0025 4.8E-4 0.0013 8.7E-4 1.5E-4 8.6E-4 3.2E-5 4.0E-5 0.014 nCohort Recovered 58 60 96 53 59 92 47 57 86 nCohort Non-recovered 93 91 54 98 92 58 104 94 64 Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 77% 79% 81% 78% 79% 81% 79% 80% 77% Specificity 29% 32% 29% 30% 32% 29% 34% 33% 27% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 59% 62% 63% 59% 62% 64% 61% 63% 59% Specificity 64% 67% 57% 66% 68% 59% 72% 70% 57% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 32% 33% 39% 33% 34% 38% 33% 34% 36% Specificity 86% 87% 82% 89% 88% 83% 91% 89% 83% OR Quartile 2 1.42 1.76 1.81 1.49 1.82 1.77 1.92 1.97 1.19 p Value 0.36 0.14 0.15 0.30 0.11 0.16 0.094 0.074 0.65 Lower limit of 95% CI 0.674 0.836 0.801 0.703 0.868 0.801 0.895 0.936 0.563 Upper limit of 95% CI 3.00 3.69 4.10 3.18 3.84 3.93 4.13 4.16 2.52 OR Quartile 3 2.55 3.20 2.28 2.82 3.43 2.50 4.02 3.97 1.94 p Value 0.0067 8.4E-4 0.018 0.0035 4.6E-4 0.0079 2.8E-4 1.3E-4 0.049 Lower limit of 95% CI 1.30 1.62 1.15 1.40 1.72 1.27 1.90 1.96 1.00 Upper limit of 95% CI 5.02 6.34 4.52 5.66 6.83 4.93 8.51 8.03 3.73 OR Quartile 4 2.98 3.20 2.96 3.80 3.78 2.90 5.22 4.39 2.66 p Value 0.013 0.0083 0.0050 0.0058 0.0038 0.0057 0.0033 0.0022 0.011 Lower limit of 95% CI 1.25 1.35 1.39 1.47 1.54 1.36 1.73 1.70 1.25 Upper limit of 95% CI 7.06 7.58 6.31 9.81 9.28 6.18 15.7 11.3 5.65

TABLE-US-00128 TABLE 18.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.105 0.297 0.104 0.300 0.104 0.300 Average 0.238 0.464 0.237 0.462 0.237 0.462 Stdev 0.284 0.466 0.285 0.463 0.285 0.463 p (t-test) 3.6E-4 3.7E-4 3.7E-4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.44 1.80 1.44 1.80 1.44 1.80 n (Patient) 81 70 80 71 80 71 sCr only Median 0.0799 0.301 0.0784 0.303 0.0784 0.303 Average 0.215 0.445 0.195 0.454 0.195 0.454 Stdev 0.292 0.436 0.272 0.435 0.272 0.435 p (t-test) 3.1E-4 4.2E-5 4.2E-5 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.44 1.80 1.44 1.80 1.44 1.80 n (Patient) 67 84 65 86 65 86 UO only Median 0.105 0.396 0.104 0.373 0.104 0.373 Average 0.252 0.505 0.250 0.499 0.249 0.494 Stdev 0.311 0.469 0.314 0.462 0.314 0.458 p (t-test) 1.2E-4 1.3E-4 1.5E-4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.44 1.80 1.44 1.80 1.44 1.80 n (Patient) 95 55 93 57 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.63 0.66 0.67 0.63 0.68 0.67 0.63 0.68 0.67 SE 0.046 0.044 0.047 0.045 0.043 0.046 0.045 0.043 0.046 p Value 0.0056 2.5E-4 3.3E-4 0.0042 2.1E-5 1.6E-4 0.0042 2.1E-5 2.2E-4 nCohort Recovered 81 67 95 80 65 93 80 65 91 nCohort Non-recovered 70 84 55 71 86 57 71 86 59 Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 77% 80% 82% 77% 80% 82% 77% 80% 81% Specificity 27% 31% 29% 28% 32% 30% 28% 32% 30% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 60% 63% 64% 61% 64% 65% 61% 64% 64% Specificity 58% 66% 58% 59% 68% 59% 59% 68% 59% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 37% 36% 40% 37% 37% 39% 37% 37% 39% Specificity 85% 88% 83% 85% 91% 83% 85% 91% 84% OR Quartile 2 1.26 1.80 1.88 1.30 1.94 2.02 1.30 1.94 1.84 p Value 0.54 0.12 0.13 0.48 0.081 0.089 0.48 0.081 0.13 Lower limit of 95% CI 0.599 0.857 0.833 0.621 0.922 0.897 0.621 0.922 0.832 Upper limit of 95% CI 2.64 3.78 4.25 2.74 4.07 4.57 2.74 4.07 4.08 OR Quartile 3 2.07 3.27 2.41 2.19 3.72 2.68 2.19 3.72 2.64 p Value 0.028 5.4E-4 0.012 0.019 1.6E-4 0.0047 0.019 1.6E-4 0.0050 Lower limit of 95% CI 1.08 1.67 1.21 1.14 1.88 1.35 1.14 1.88 1.34 Upper limit of 95% CI 3.97 6.40 4.77 4.20 7.35 5.30 4.20 7.35 5.20 OR Quartile 4 3.40 4.10 3.29 3.27 5.83 3.02 3.27 5.83 3.24 p Value 0.0022 0.0014 0.0022 0.0029 2.6E-4 0.0042 0.0029 2.6E-4 0.0025 Lower limit of 95% CI 1.56 1.73 1.54 1.50 2.26 1.42 1.50 2.26 1.51 Upper limit of 95% CI 7.42 9.71 7.05 7.15 15.0 6.45 7.15 15.0 6.93

Example 19. Use of Fibroblast Growth Factor 23 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0180] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0181] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0182] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00129 TABLE 19.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Cohort Non-recovered Cohort Recovered Cohort Non-recovered Cohort Recovered Cohort Non-recovered Cohort sCr or UO Median 0.000547 0.0303 0.000547 0.0303 0.000547 0.0232 Average 0.0468 0.137 0.0468 0.137 0.0486 0.134 Stdev 0.144 0.262 0.144 0.262 0.147 0.259 p (t-test) 0.034 0.034 0.047 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 45 85 45 85 43 87 sCr only Median 0.00106 0.0534 0.00106 0.0534 0.00106 0.0494 Average 0.0411 0.151 0.0411 0.151 0.0424 0.147 Stdev 0.133 0.273 0.133 0.273 0.136 0.271 p (t-test) 0.0078 0.0078 0.012 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 53 76 53 76 51 78 UO only Median 0.0201 0.0194 0.0186 0.0203 0.0183 0.0213 Average 0.0836 0.164 0.0835 0.155 0.0857 0.144 Stdev 0.150 0.361 0.153 0.340 0.156 0.326 p (t-test) 0.076 0.10 0.17 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 92 37 87 42 83 46 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.72 0.55 0.70 0.72 0.57 0.69 0.72 0.57 SE 0.046 0.044 0.057 0.046 0.044 0.055 0.047 0.045 0.053 p Value 1.5E-5 4.0E-7 0.39 1.5E-5 4.0E-7 0.21 3.3E-5 1.1E-6 0.18 nCohort Recovered 45 53 92 45 53 87 43 51 83 nCohort Non-recovered 85 76 37 85 76 42 87 78 46 Cutoff Quartile 2 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 Sensitivity 91% 91% 95% 91% 91% 95% 91% 91% 96% Specificity 20% 19% 16% 20% 19% 17% 21% 20% 18% Cutoff Quartile 3 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Sensitivity 61% 64% 51% 61% 64% 52% 60% 64% 54% Specificity 71% 70% 50% 71% 70% 51% 70% 71% 52% Cutoff Quartile 4 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Sensitivity 32% 36% 30% 32% 36% 31% 31% 35% 28% Specificity 87% 89% 76% 87% 89% 77% 86% 88% 76% OR Quartile 2 2.41 2.29 3.41 2.41 2.29 4.17 2.61 2.47 4.85 p Value 0.095 0.12 0.12 0.095 0.12 0.067 0.068 0.088 0.042 Lower limit of 95% CI 0.858 0.812 0.739 0.858 0.812 0.907 0.930 0.875 1.06 Upper limit of 95% CI 6.75 6.47 15.7 6.75 6.47 19.2 7.35 7.00 22.3 OR Quartile 3 3.88 4.20 1.06 3.88 4.20 1.13 3.43 4.29 1.28 p Value 6.4E-4 1.8E-4 0.89 6.4E-4 1.8E-4 0.75 0.0019 1.7E-4 0.50 Lower limit of 95% CI 1.78 1.98 0.492 1.78 1.98 0.539 1.57 2.01 0.621 Upper limit of 95% CI 8.45 8.90 2.26 8.45 8.90 2.35 7.47 9.16 2.64 OR Quartile 4 3.03 4.32 1.35 3.03 4.32 1.50 2.78 3.97 1.24 p Value 0.026 0.0032 0.49 0.026 0.0032 0.33 0.040 0.0054 0.60 Lower limit of 95% CI 1.14 1.63 0.574 1.14 1.63 0.659 1.05 1.50 0.549 Upper limit of 95% CI 8.01 11.4 3.16 8.01 11.4 3.42 7.36

TABLE-US-00130 TABLE 19.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.000806 0.0303 0.000806 0.0303 0.000806 0.0267 Average 0.0409 0.155 0.0409 0.155 0.0420 0.151 Stdev 0.0902 0.288 0.0902 0.288 0.0916 0.285 p (t-test) 0.0049 0.0049 0.0076 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 56 74 56 74 54 76 sCr only Median 0.00259 0.0561 0.00259 0.0561 0.00259 0.0534 Average 0.0381 0.168 0.0381 0.168 0.0390 0.163 Stdev 0.0861 0.297 0.0861 0.297 0.0874 0.294 p (t-test) 0.0012 0.0012 0.0020 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 62 68 62 68 60 70 UO only Median 0.0183 0.0216 0.0183 0.0216 0.0162 0.0225 Average 0.0707 0.200 0.0715 0.191 0.0732 0.171 Stdev 0.123 0.381 0.125 0.372 0.128 0.349 p (t-test) 0.0043 0.0072 0.022 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.500 1.70 0.500 1.70 0.500 1.70 n (Patient) 93 36 91 38 85 44 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.71 0.61 0.70 0.71 0.61 0.69 0.70 0.62 SE 0.045 0.045 0.057 0.045 0.045 0.056 0.046 0.045 0.053 p Value 9.1E-6 2.1E-6 0.049 9.1E-6 2.1E-6 0.046 2.3E-5 6.0E-6 0.026 nCohort 56 62 93 56 62 91 54 60 85 Recovered nCohort 74 68 36 74 68 38 76 70 44 Non- recovered Cutoff 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 Quartile 2 Sensitivity 92% 91% 97% 92% 91% 97% 92% 91% 98% Specificity 20% 18% 17% 20% 18% 18% 20% 18% 19% Cutoff 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Quartile 3 Sensitivity 64% 66% 56% 64% 66% 55% 62% 64% 59% Specificity 68% 68% 52% 68% 68% 52% 67% 67% 54% Cutoff 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Quartile 4 Sensitivity 34% 37% 39% 34% 37% 37% 33% 36% 34% Specificity 86% 87% 80% 86% 87% 79% 85% 87% 79% OR 2.77 2.23 7.27 2.77 2.23 7.89 2.98 2.39 9.97 Quartile 2 p Value 0.060 0.14 0.059 0.060 0.14 0.049 0.044 0.11 0.028 Lower 0.956 0.771 0.927 0.956 0.771 1.01 1.03 0.828 1.28 limit of 95% CI Upper 8.03 6.44 57.0 8.03 6.44 61.8 8.66 6.93 77.9 limit of 95% CI OR 3.67 4.11 1.33 3.67 4.11 1.32 3.24 3.60 1.70 Quartile 3 p Value 5.1E-4 1.5E-4 0.47 5.1E-4 1.5E-4 0.47 0.0016 5.4E-4 0.16 Lower 1.76 1.98 0.615 1.76 1.98 0.617 1.56 1.74 0.815 limit of 95% CI Upper 7.66 8.54 2.89 7.66 8.54 2.82 6.73 7.44 3.56 limit of 95% CI OR 3.06 3.92 2.48 3.06 3.92 2.21 2.82 3.61 1.93 Quartile 4 p Value 0.014 0.0026 0.034 0.014 0.0026 0.061 0.023 0.0047 0.11 Lower 1.26 1.61 1.07 1.26 1.61 0.963 1.16 1.48 0.855 limit of 95% CI Upper 7.46 9.57 5.73 7.46 9.57 5.07 6.87 8.80 4.34 limit of 95% CI

TABLE-US-00131 TABLE 19.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00310 0.0303 0.00310 0.0303 0.00310 0.0303 Average 0.0451 0.163 0.0451 0.163 0.0462 0.159 Stdev 0.0948 0.299 0.0948 0.299 0.0961 0.296 p (t-test) 0.0033 0.0033 0.0053 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 63 67 63 67 61 69 sCr only Median 0.00310 0.0559 0.00310 0.0559 0.00344 0.0431 Average 0.0441 0.168 0.0441 0.168 0.0448 0.165 Stdev 0.0935 0.303 0.0935 0.303 0.0940 0.301 p (t-test) 0.0021 0.0021 0.0027 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 65 65 65 65 64 66 UO only Median 0.0181 0.0582 0.0181 0.0582 0.0133 0.0431 Average 0.0679 0.207 0.0679 0.207 0.0697 0.183 Stdev 0.123 0.378 0.123 0.378 0.127 0.355 p (t-test) 0.0021 0.0021 0.0088 Min 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 1.63E-6 Max 0.500 1.70 0.500 1.70 0.500 1.70 n (Patient) 93 36 93 36 87 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UOonly UO sCr only UO only AUC 0.68 0.69 0.64 0.68 0.69 0.64 0.68 0.68 0.64 SE 0.047 0.046 0.056 0.047 0.046 0.056 0.047 0.047 0.053 p Value 9.6E-5 5.2E-5 0.012 9.6E-5 5.2E-5 0.012 1.7E-4 1.3E-4 0.0074 nCohort 63 65 93 63 65 93 61 64 87 Recovered nCohort 67 65 36 67 65 36 69 66 42 Non- recovered Cutoff 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 1.90E-6 Quartile 2 Sensitivity 91% 91% 97% 91% 91% 97% 91% 91% 98% Specificity 17% 17% 17% 17% 17% 17% 18% 17% 18% Cutoff 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Quartile 3 Sensitivity 64% 65% 58% 64% 65% 58% 64% 64% 62% Specificity 65% 65% 53% 65% 65% 53% 66% 64% 55% Cutoff 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Quartile 4 Sensitivity 36% 37% 42% 36% 37% 42% 35% 36% 38% Specificity 86% 86% 81% 86% 86% 81% 85% 86% 80% OR 2.15 2.00 7.27 2.15 2.00 7.27 2.31 2.08 9.24 Quartile 2 p Value 0.16 0.20 0.059 0.16 0.20 0.059 0.12 0.18 0.034 Lower limit 0.744 0.693 0.927 0.744 0.693 0.927 0.799 0.718 1.18 of 95% CI Upper limit 6.22 5.79 57.0 6.22 5.79 57.0 6.68 6.00 72.2 of 95% CI OR 3.34 3.33 1.56 3.34 3.33 1.56 3.35 3.12 2.00 Quartile 3 p Value 0.0010 0.0010 0.26 0.0010 0.0010 0.26 0.0010 0.0018 0.071 Lower limit 1.63 1.62 0.716 1.63 1.62 0.716 1.63 1.52 0.942 of 95% CI Upper limit 6.86 6.84 3.39 6.86 6.84 3.39 6.89 6.38 4.24 of 95% CI OR 3.35 3.64 2.98 3.35 3.64 2.98 3.08 3.49 2.53 Quartile 4 p Value 0.0061 0.0034 0.011 0.0061 0.0034 0.011 0.011 0.0046 0.026 Lower limit 1.41 1.53 1.29 1.41 1.53 1.29 1.30 1.47 1.12 of 95% CI Upper limit of 95% CI 7.95 8.66 6.89 7.95 8.66 6.89 7.31 8.29 5.74

TABLE-US-00132 TABLE 19.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00378 0.0559 0.00344 0.0431 0.00344 0.0267 Average 0.0440 0.172 0.0443 0.169 0.0454 0.165 Stdev 0.0921 0.307 0.0927 0.305 0.0940 0.301 p (t-test) 0.0014 0.0018 0.0030 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 67 63 66 64 64 66 sCr only Median 0.00344 0.0582 0.00344 0.0582 0.00378 0.0559 Average 0.0434 0.174 0.0434 0.174 0.0441 0.172 Stdev 0.0915 0.308 0.0915 0.308 0.0921 0.307 p (t-test) 0.0011 0.0011 0.0015 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 68 62 68 62 67 63 UO only Median 0.0133 0.0431 0.0130 0.0303 0.0126 0.0267 Average 0.0694 0.190 0.0700 0.185 0.0708 0.176 Stdev 0.126 0.362 0.126 0.358 0.128 0.348 p (t-test) 0.0061 0.0081 0.014 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.500 1.70 0.500 1.70 0.500 1.70 n (Patient) 89 40 88 41 85 44 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.69 0.65 0.69 0.69 0.65 0.68 0.68 0.65 SE 0.047 0.046 0.054 0.047 0.046 0.054 0.047 0.047 0.053 p Value 6.8E5 3.3E5 0.0055 6.4E5 3.3E5 0.0057 1.2E4 8.6E5 0.0057 nCohort Recovered 67 68 89 66 68 88 64 67 85 nCohort Non- 63 62 40 64 62 41 66 63 44 recovered Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 92% 92% 98% 92% 92% 98% 92% 92% 98% Specificity 18% 18% 18% 18% 18% 18% 19% 18% 19% Cutoff Quartile 3 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Sensitivity 63% 65% 62% 64% 65% 63% 64% 63% 64% Specificity 63% 63% 55% 64% 63% 56% 64% 63% 56% Cutoff Quartile 4 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Sensitivity 38% 39% 38% 38% 39% 37% 36% 38% 36% Specificity 87% 87% 80% 86% 87% 80% 86% 87% 80% OR Quartile 2 2.53 2.44 8.55 2.62 2.44 8.89 2.82 2.53 9.97 p Value 0.10 0.11 0.041 0.088 0.11 0.037 0.067 0.10 0.028 Lower limit of 0.837 0.808 1.09 0.867 0.808 1.14 0.931 0.837 1.28 95% CI Upper limit of 7.65 7.39 66.9 7.93 7.39 69.5 8.52 7.65 77.9 95% CI OR Quartile 3 2.92 3.13 2.04 3.12 3.13 2.18 3.12 2.92 2.27 p Value 0.0032 0.0018 0.067 0.0018 0.0018 0.045 0.0018 0.0032 0.032 Lower limit of 1.43 1.53 0.951 1.52 1.53 1.02 1.52 1.43 1.07 95% CI Upper limit of 5.96 6.40 4.38 6.38 6.40 4.67 6.38 5.96 4.80 95% CI OR Quartile 4 3.97 4.14 2.37 3.80 4.14 2.24 3.49 3.97 2.29 p Value 0.0018 0.0013 0.040 0.0025 0.0013 0.053 0.0046 0.0018 0.046 Lower limit of 1.67 1.74 1.04 1.60 1.74 0.988 1.47 1.67 1.01 95% CI Upper limit of 9.44 9.86 5.39 9.04 9.86 5.09 8.29 9.44 5.15 95% CI

TABLE-US-00133 TABLE 19.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0106 0.0559 0.0105 0.0431 0.0104 0.0303 Average 0.0594 0.200 0.0598 0.196 0.0603 0.192 Stdev 0.110 0.355 0.111 0.352 0.112 0.349 p (t-test) 9.5E4 0.0013 0.0018 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 87 43 86 44 85 45 sCr only Median 0.00752 0.0605 0.00752 0.0605 0.00752 0.0605 Average 0.0487 0.189 0.0487 0.189 0.0487 0.189 Stdev 0.0951 0.328 0.0951 0.328 0.0951 0.328 p (t-test) 5.6E4 5.6E4 5.6E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 77 53 77 53 77 53 UO only Median 0.0126 0.0582 0.0116 0.0559 0.0106 0.0431 Average 0.0596 0.211 0.0600 0.207 0.0605 0.202 Stdev 0.109 0.366 0.110 0.362 0.110 0.359 p (t-test) 4.7E4 6.8E4 9.5E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.459 1.70 0.459 1.70 0.459 1.70 n (Patient) 89 40 88 41 87 42 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.68 0.70 0.68 0.67 0.70 0.68 0.67 0.70 0.68 SE 0.052 0.048 0.053 0.052 0.048 0.053 0.051 0.048 0.052 p Value 7.4E4 4.6E5 7.4E4 7.6E4 4.6E5 7.8E4 6.6E4 4.6E5 6.9E4 nCohort Recovered 87 77 89 86 77 88 85 77 87 nCohort Non- 43 53 40 44 53 41 45 53 42 recovered Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 98% 96% 98% 98% 96% 98% 98% 96% 98% Specificity 18% 19% 18% 19% 19% 18% 19% 19% 18% Cutoff Quartile 3 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 0.0190 0.0190 0.0194 Sensitivity 65% 66% 65% 66% 66% 66% 67% 66% 67% Specificity 57% 61% 56% 58% 61% 57% 59% 61% 57% Cutoff Quartile 4 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 0.0929 0.0929 0.0936 Sensitivity 42% 40% 42% 41% 40% 41% 40% 40% 40% Specificity 83% 84% 82% 83% 84% 82% 82% 84% 82% OR Quartile 2 9.46 6.17 8.55 9.83 6.17 8.89 10.2 6.17 9.24 p Value 0.032 0.019 0.041 0.029 0.019 0.037 0.027 0.019 0.034 Lower limit of 1.21 1.35 1.09 1.26 1.35 1.14 1.31 1.35 1.18 95% CI Upper limit of 74.0 28.2 66.9 76.8 28.2 69.5 79.7 28.2 72.2 95% CI OR Quartile 3 2.52 3.05 2.38 2.69 3.05 2.54 2.86 3.05 2.70 p Value 0.017 0.0028 0.028 0.010 0.0028 0.018 0.0065 0.0028 0.011 Lower limit of 1.18 1.47 1.10 1.26 1.47 1.17 1.34 1.47 1.25 95% CI Upper limit of 5.38 6.32 5.16 5.72 6.32 5.49 6.08 6.32 5.83 95% CI OR Quartile 4 3.46 3.55 3.37 3.28 3.55 3.19 3.11 3.55 3.02 p Value 0.0031 0.0026 0.0040 0.0045 0.0026 0.0058 0.0064 0.0026 0.0084 Lower limit of 1.52 1.56 1.47 1.44 1.56 1.40 1.38 1.56 1.33 95% CI Upper limit of 7.87 8.12 7.72 7.44 8.12 7.27 7.04 8.12 6.86 95% CI

TABLE-US-00134 TABLE 19.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0743 0.282 0.0727 0.276 0.0726 0.276 Average 0.257 0.384 0.261 0.381 0.239 0.388 Stdev 0.401 0.386 0.405 0.385 0.373 0.397 p (t-test) 0.063 0.081 0.032 Min 0.00372 0.00169 0.00372 0.00169 0.00372 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 49 102 48 103 46 105 sCr only Median 0.0752 0.282 0.0752 0.282 0.0743 0.288 Average 0.251 0.386 0.251 0.386 0.227 0.397 Stdev 0.391 0.388 0.391 0.388 0.357 0.400 p (t-test) 0.044 0.044 0.012 Min 0.00372 0.00169 0.00372 0.00169 0.00372 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 52 98 52 98 51 99 UO only Median 0.128 0.319 0.127 0.335 0.127 0.303 Average 0.299 0.449 0.287 0.451 0.284 0.440 Stdev 0.373 0.426 0.369 0.422 0.370 0.415 p (t-test) 0.031 0.015 0.017 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 104 46 97 53 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.64 0.64 0.62 0.63 0.64 0.63 0.65 0.66 0.63 SE 0.046 0.046 0.051 0.047 0.046 0.049 0.047 0.045 0.047 p Value 0.0030 0.0024 0.021 0.0040 0.0024 0.0061 0.0015 6.2E4 0.0058 nCohort Recovered 49 52 104 48 52 97 46 51 91 nCohort Non- 102 98 46 103 98 53 105 99 59 recovered Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 79% 78% 79% 79% 81% 79% 79% 81% Specificity 33% 33% 27% 33% 33% 29% 35% 33% 30% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 59% 60% 63% 58% 60% 62% 58% 61% 61% Specificity 67% 69% 56% 67% 69% 57% 67% 71% 57% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 28% 30% 37% 28% 30% 36% 29% 30% 36% Specificity 82% 83% 80% 81% 83% 80% 83% 84% 81% OR Quartile 2 1.76 1.78 1.33 1.84 1.78 1.74 2.01 1.86 1.84 p Value 0.14 0.13 0.50 0.12 0.13 0.18 0.074 0.11 0.13 Lower limit of 0.824 0.838 0.582 0.858 0.838 0.771 0.934 0.872 0.832 95% CI Upper limit of 3.77 3.79 3.02 3.95 3.79 3.95 4.33 3.95 4.08 95% CI OR Quartile 3 2.95 3.40 2.15 2.79 3.40 2.16 2.87 3.69 2.09 p Value 0.0031 7.8E4 0.035 0.0050 7.8E4 0.028 0.0046 4.1E4 0.031 Lower limit of 1.44 1.67 1.05 1.36 1.67 1.09 1.38 1.79 1.07 95% CI Upper limit of 6.03 6.95 4.39 5.71 6.95 4.29 5.93 7.62 4.07 95% CI OR Quartile 4 1.77 2.01 2.32 1.70 2.01 2.29 1.90 2.34 2.41 p Value 0.19 0.10 0.032 0.22 0.10 0.031 0.15 0.055 0.022 Lower limit of 0.761 0.868 1.08 0.731 0.868 1.08 0.794 0.981 1.14 95% CI Upper limit of 4.10 4.65 4.99 3.94 4.65 4.87 4.54 5.57 5.09 95% CI

TABLE-US-00135 TABLE 19.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0780 0.293 0.0780 0.293 0.0780 0.293 Average 0.239 0.419 0.239 0.419 0.222 0.427 Stdev 0.356 0.406 0.356 0.406 0.326 0.417 p (t-test) 0.0051 0.0051 0.0015 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 64 87 64 87 62 89 sCr only Median 0.0784 0.297 0.0784 0.297 0.0780 0.300 Average 0.238 0.426 0.238 0.426 0.220 0.438 Stdev 0.349 0.410 0.349 0.410 0.318 0.422 p (t-test) 0.0032 0.0032 6.1E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 67 84 67 84 66 85 UO only Median 0.112 0.370 0.105 0.434 0.104 0.373 Average 0.279 0.499 0.269 0.511 0.258 0.495 Stdev 0.355 0.441 0.348 0.441 0.349 0.427 p (t-test) 0.0015 4.1E4 3.3E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 105 45 103 47 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.65 0.67 0.65 0.65 0.68 0.66 0.67 0.69 SE 0.044 0.044 0.050 0.044 0.044 0.049 0.044 0.044 0.046 p Value 6.3E4 6.1E4 9.6E4 6.3E4 6.1E4 2.1E4 2.4E4 1.6E4 6.3E5 nCohort Recovered 64 67 105 64 67 103 62 66 95 nCohort Non- 87 84 45 87 84 47 89 85 55 recovered Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 79% 80% 82% 79% 80% 83% 80% 80% 84% Specificity 31% 31% 29% 31% 31% 29% 32% 32% 31% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 61% 62% 67% 61% 62% 68% 61% 62% 67% Specificity 64% 64% 57% 64% 64% 58% 65% 65% 60% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 32% 33% 40% 32% 33% 40% 33% 34% 40% Specificity 84% 85% 81% 84% 85% 82% 85% 86% 83% OR Quartile 2 1.74 1.80 1.85 1.74 1.80 2.00 1.88 1.87 2.25 p Value 0.14 0.12 0.17 0.14 0.12 0.12 0.096 0.099 0.058 Lower limit of 0.831 0.857 0.772 0.831 0.857 0.838 0.894 0.889 0.972 95% CI Upper limit of 3.65 3.78 4.43 3.65 3.78 4.79 3.95 3.92 5.19 95% CI OR Quartile 3 2.78 2.91 2.67 2.78 2.91 2.98 2.81 3.10 3.08 p Value 0.0027 0.0017 0.0085 0.0027 0.0017 0.0033 0.0026 9.4E4 0.0015 Lower limit of 1.42 1.50 1.28 1.42 1.50 1.44 1.43 1.58 1.54 95% CI Upper limit of 5.42 5.67 5.54 5.42 5.67 6.16 5.49 6.05 6.19 95% CI OR Quartile 4 2.56 2.85 2.83 2.56 2.85 3.00 2.85 3.28 3.29 p Value 0.023 0.011 0.0080 0.023 0.011 0.0050 0.014 0.0052 0.0022 Lower limit of 1.14 1.27 1.31 1.14 1.27 1.39 1.24 1.42 1.54 95% CI Upper limit of 5.77 6.41 6.12 5.77 6.41 6.46 6.55 7.55 7.05 95% CI

TABLE-US-00136 TABLE 19.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0939 0.297 0.0914 0.300 0.0914 0.300 Average 0.249 0.431 0.247 0.430 0.249 0.424 Stdev 0.342 0.421 0.344 0.418 0.348 0.415 p (t-test) 0.0044 0.0042 0.0060 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 73 78 72 79 70 81 sCr only Median 0.0914 0.300 0.0914 0.300 0.0914 0.300 Average 0.248 0.434 0.248 0.434 0.248 0.434 Stdev 0.340 0.422 0.340 0.422 0.340 0.422 p (t-test) 0.0035 0.0035 0.0035 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 74 77 74 77 74 77 UO only Median 0.127 0.434 0.112 0.434 0.104 0.384 Average 0.275 0.509 0.266 0.519 0.260 0.497 Stdev 0.350 0.445 0.343 0.445 0.349 0.428 p (t-test) 7.4E4 2.0E4 3.2E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 105 45 103 47 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.63 0.67 0.63 0.63 0.69 0.63 0.63 0.69 SE 0.045 0.045 0.050 0.045 0.045 0.049 0.045 0.045 0.047 p Value 0.0057 0.0039 6.3E4 0.0040 0.0039 1.5E4 0.0041 0.0039 7.3E5 nCohort Recovered 73 74 105 72 74 103 70 74 96 nCohort Non- 78 77 45 79 77 47 81 77 54 recovered Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 77% 78% 82% 77% 78% 83% 78% 78% 83% Specificity 27% 28% 29% 28% 28% 29% 29% 28% 30% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 60% 61% 67% 61% 61% 68% 60% 61% 69% Specificity 60% 61% 57% 61% 61% 58% 61% 61% 60% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 35% 35% 40% 34% 35% 40% 33% 35% 39% Specificity 85% 85% 81% 85% 85% 82% 84% 85% 82% OR Quartile 2 1.26 1.40 1.85 1.30 1.40 2.00 1.40 1.40 2.16 p Value 0.54 0.37 0.17 0.48 0.37 0.12 0.37 0.37 0.071 Lower limit of 0.602 0.668 0.772 0.624 0.668 0.838 0.670 0.668 0.936 95% CI Upper limit of 2.63 2.93 4.43 2.72 2.93 4.79 2.93 2.93 5.00 95% CI OR Quartile 3 2.30 2.43 2.67 2.43 2.43 2.98 2.44 2.43 3.32 p Value 0.012 0.0078 0.0085 0.0078 0.0078 0.0033 0.0077 0.0078 8.5E4 Lower limit of 1.20 1.26 1.28 1.26 1.26 1.44 1.27 1.26 1.64 95% CI Upper limit of 4.42 4.68 5.54 4.68 4.68 6.16 4.70 4.68 6.72 95% CI OR Quartile 4 2.98 3.09 2.83 2.88 3.09 3.00 2.68 3.09 2.96 p Value 0.0069 0.0053 0.0080 0.0089 0.0053 0.0050 0.015 0.0053 0.0050 Lower limit of 1.35 1.40 1.31 1.30 1.40 1.39 1.21 1.40 1.39 95% CI Upper limit of 6.59 6.84 6.12 6.36 6.84 6.46 5.92 6.84 6.31 95% CI

TABLE-US-00137 TABLE 19.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0988 0.293 0.0939 0.297 0.0939 0.297 Average 0.250 0.437 0.248 0.436 0.250 0.430 Stdev 0.337 0.427 0.339 0.424 0.343 0.420 p (t-test) 0.0033 0.0032 0.0047 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 76 75 75 76 73 78 sCr only Median 0.0939 0.291 0.0939 0.291 0.0939 0.291 Average 0.249 0.440 0.249 0.440 0.249 0.440 Stdev 0.336 0.428 0.336 0.428 0.336 0.428 p (t-test) 0.0027 0.0027 0.0027 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 77 74 77 74 77 74 UO only Median 0.119 0.415 0.119 0.415 0.112 0.373 Average 0.266 0.502 0.266 0.502 0.266 0.482 Stdev 0.343 0.445 0.343 0.445 0.349 0.433 p (t-test) 4.6E4 4.6E4 0.0011 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 100 50 100 50 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.63 0.63 0.66 0.63 0.63 0.66 0.63 0.63 0.65 SE 0.045 0.045 0.049 0.045 0.045 0.049 0.045 0.045 0.047 p Value 0.0057 0.0042 9.1E4 0.0040 0.0042 9.1E4 0.0042 0.0042 0.0012 nCohort Recovered 76 77 100 75 77 100 73 77 95 nCohort Non- 75 74 50 76 74 50 78 74 55 recovered Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 77% 78% 80% 78% 78% 80% 78% 78% 80% Specificity 28% 29% 28% 28% 29% 28% 29% 29% 28% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 60% 61% 66% 61% 61% 66% 60% 61% 65% Specificity 59% 60% 58% 60% 60% 58% 60% 60% 59% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 36% 36% 40% 36% 36% 40% 35% 36% 38% Specificity 86% 86% 82% 85% 86% 82% 85% 86% 82% OR Quartile 2 1.30 1.45 1.56 1.35 1.45 1.56 1.45 1.45 1.59 p Value 0.48 0.33 0.29 0.43 0.33 0.29 0.33 0.33 0.26 Lower limit of 0.623 0.690 0.686 0.645 0.690 0.686 0.692 0.690 0.716 95% CI Upper limit of 2.73 3.05 3.53 2.82 3.05 3.53 3.03 3.05 3.52 95% CI OR Quartile 3 2.18 2.30 2.68 2.30 2.30 2.68 2.30 2.30 2.72 p Value 0.019 0.012 0.0063 0.012 0.012 0.0063 0.012 0.012 0.0045 Lower limit of 1.14 1.20 1.32 1.20 1.20 1.32 1.20 1.20 1.36 95% CI Upper limit of 4.17 4.42 5.44 4.41 4.42 5.44 4.42 4.42 5.42 95% CI OR Quartile 4 3.32 3.45 3.04 3.21 3.45 3.04 2.98 3.45 2.83 p Value 0.0030 0.0023 0.0043 0.0040 0.0023 0.0043 0.0069 0.0023 0.0069 Lower limit of 1.50 1.56 1.42 1.45 1.56 1.42 1.35 1.56 1.33 95% CI Upper limit of 7.35 7.63 6.51 7.09 7.63 6.51 6.59 7.63 6.03 95% CI

TABLE-US-00138 TABLE 19.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.105 0.350 0.104 0.373 0.104 0.354 Average 0.235 0.498 0.233 0.496 0.232 0.494 Stdev 0.278 0.479 0.279 0.476 0.280 0.472 p (t-test) 3.6E5 3.5E5 3.7E5 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.44 1.80 1.44 1.80 1.44 1.80 n (Patient) 89 62 88 63 87 64 sCr only Median 0.0939 0.302 0.0939 0.302 0.0939 0.302 Average 0.228 0.469 0.228 0.469 0.228 0.469 Stdev 0.283 0.458 0.283 0.458 0.283 0.458 p (t-test) 1.3E4 1.3E4 1.3E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.44 1.80 1.44 1.80 1.44 1.80 n (Patient) 79 72 79 72 79 72 UO only Median 0.116 0.455 0.116 0.455 0.104 0.415 Average 0.250 0.524 0.250 0.524 0.248 0.518 Stdev 0.307 0.475 0.307 0.475 0.310 0.467 p (t-test) 3.5E5 3.5E5 4.0E5 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.44 1.80 1.44 1.80 1.44 1.80 n (Patient) 98 52 98 52 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.65 0.65 0.67 0.65 0.65 0.67 0.66 0.65 0.68 SE 0.046 0.045 0.048 0.046 0.045 0.048 0.046 0.045 0.047 p Value 0.0013 0.0011 2.4E4 9.0E4 0.0011 2.4E4 6.5E4 0.0011 1.1E4 nCohort Recovered 89 79 98 88 79 98 87 79 96 nCohort Non- 62 72 52 63 72 52 64 72 54 recovered Cutoff Quartile 2 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 0.0475 0.0475 0.0489 Sensitivity 79% 79% 81% 79% 79% 81% 80% 79% 81% Specificity 28% 29% 29% 28% 29% 29% 29% 29% 29% Cutoff Quartile 3 0.163 0.163 0.164 0.163 0.163 0.164 0.163 0.163 0.164 Sensitivity 61% 62% 65% 62% 62% 65% 62% 62% 67% Specificity 57% 61% 58% 58% 61% 58% 59% 61% 59% Cutoff Quartile 4 0.535 0.535 0.536 0.535 0.535 0.536 0.535 0.535 0.536 Sensitivity 40% 39% 42% 40% 39% 42% 39% 39% 41% Specificity 85% 87% 84% 85% 87% 84% 85% 87% 83% OR Quartile 2 1.47 1.56 1.68 1.53 1.56 1.68 1.58 1.56 1.81 p Value 0.32 0.24 0.21 0.28 0.24 0.21 0.24 0.24 0.15 Lower limit of 0.684 0.739 0.742 0.709 0.739 0.742 0.736 0.739 0.801 95% CI Upper limit of 3.17 3.30 3.80 3.28 3.30 3.80 3.40 3.30 4.10 95% CI OR Quartile 3 2.12 2.58 2.63 2.24 2.58 2.63 2.36 2.58 2.92 p Value 0.026 0.0047 0.0067 0.017 0.0047 0.0067 0.011 0.0047 0.0026 Lower limit of 1.10 1.34 1.31 1.16 1.34 1.31 1.22 1.34 1.46 95% CI Upper limit of 4.12 4.98 5.28 4.34 4.98 5.28 4.58 4.98 5.87 95% CI OR Quartile 4 3.95 4.39 3.76 3.80 4.39 3.76 3.65 4.39 3.44 p Value 5.3E4 3.7E4 7.3E4 7.5E4 3.7E4 7.3E4 0.0011 3.7E4 0.0015 Lower limit of 1.82 1.94 1.74 1.75 1.94 1.74 1.68 1.94 1.60 95% CI Upper limit of 8.59 9.92 8.10 8.24 9.92 8.10 7.92 9.92 7.38 95% CI

Example 20. Use of Fibroblast Growth Factor 23 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0183] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0184] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0185] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00139 TABLE 20.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0106 0.0232 0.0118 0.0303 0.0126 0.0611 Average 0.0668 0.185 0.0650 0.201 0.0651 0.216 Stdev 0.137 0.342 0.134 0.355 0.132 0.371 p (t-test) 0.0058 0.0018 7.8E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 87 43 91 39 95 35 sCr only Median 0.0106 0.0267 0.0122 0.0232 0.0122 0.0303 Average 0.0658 0.189 0.0666 0.203 0.0654 0.214 Stdev 0.137 0.345 0.134 0.364 0.133 0.372 p (t-test) 0.0045 0.0022 0.0010 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 87 42 92 37 94 35 UO only Median 0.0183 0.0773 0.0183 0.131 0.0183 0.131 Average 0.0739 0.309 0.0729 0.345 0.0729 0.345 Stdev 0.139 0.480 0.138 0.499 0.138 0.499 p (t-test) 4.4E5 5.4E6 5.4E6 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 111 18 113 16 113 16 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.66 0.66 0.65 0.66 0.65 0.67 0.66 0.66 0.67 SE 0.053 0.053 0.075 0.054 0.056 0.078 0.056 0.056 0.078 p Value 0.0031 0.0024 0.048 0.0029 0.0084 0.029 0.0041 0.0050 0.029 nCohort 87 87 111 91 92 113 95 94 113 Non- persistent nCohort 43 42 18 39 37 16 35 35 16 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 95% 95% 94% 95% 95% 94% 94% 94% 94% Specificity 17% 17% 14% 16% 16% 14% 16% 16% 14% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 65% 64% 61% 64% 62% 62% 66% 66% 62% Specificity 57% 56% 51% 56% 54% 51% 56% 55% 51% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 35% 36% 50% 38% 35% 56% 40% 37% 56% Specificity 79% 79% 78% 80% 78% 79% 80% 79% 79% OR Quartile 4.27 4.17 2.86 3.65 3.41 2.47 3.09 3.13 2.47 2 p Value 0.062 0.067 0.32 0.096 0.12 0.40 0.15 0.14 0.40 Lower limit 0.930 0.907 0.356 0.793 0.739 0.305 0.670 0.678 0.305 of 95% CI Upper limit 19.6 19.2 23.0 16.8 15.7 20.0 14.3 14.5 20.0 of 95% CI OR Quartile 2.52 2.32 1.66 2.28 1.96 1.76 2.42 2.37 1.76 3 p Value 0.017 0.030 0.33 0.037 0.092 0.30 0.032 0.036 0.30 Lower limit 1.18 1.09 0.599 1.05 0.896 0.598 1.08 1.06 0.598 of 95% CI Upper limit 5.38 4.96 4.59 4.94 4.27 5.16 5.42 5.32 5.16 of 95% CI OR Quartile 2.05 2.13 3.62 2.53 1.95 4.77 2.67 2.19 4.77 4 p Value 0.083 0.070 0.014 0.027 0.12 0.0048 0.023 0.070 0.0048 Lower limit 0.910 0.941 1.30 1.11 0.844 1.61 1.15 0.939 1.61 of 95% CI Upper limit 4.63 4.82 10.1 5.79 4.50 14.1 6.19 5.09 14.1 of 95% CI

TABLE-US-00140 TABLE 20.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00378 0.0509 0.00847 0.0611 0.0104 0.0651 Average 0.0627 0.169 0.0607 0.186 0.0599 0.199 Stdev 0.140 0.312 0.135 0.328 0.133 0.340 p (t-test) 0.0098 0.0028 0.0011 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 77 53 83 47 87 43 sCr only Median 0.00547 0.0509 0.00781 0.0605 0.00847 0.0608 Average 0.0621 0.173 0.0607 0.184 0.0604 0.194 Stdev 0.139 0.318 0.136 0.328 0.134 0.337 p (t-test) 0.0078 0.0033 0.0018 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 78 51 82 47 85 44 UO only Median 0.0181 0.0955 0.0181 0.105 0.0181 0.105 Average 0.0726 0.256 0.0716 0.277 0.0716 0.277 Stdev 0.142 0.425 0.141 0.438 0.141 0.438 p (t-test) 3.9E4 1.1E4 1.1E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 105 24 107 22 107 22 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.69 0.69 0.67 0.69 0.69 0.68 0.69 0.70 0.68 SE 0.048 0.049 0.065 0.050 0.050 0.067 0.051 0.051 0.067 p Value 8.3E5 1.3E4 0.011 9.3E5 8.9E5 0.0063 1.4E4 1.1E4 0.0063 nCohort 77 78 105 83 82 107 87 85 107 Non- persistent nCohort 53 51 24 47 47 22 43 44 22 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 94% 94% 96% 96% 96% 95% 95% 95% 95% Specificity 18% 18% 15% 18% 18% 15% 17% 18% 15% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 68% 67% 62% 66% 66% 64% 67% 68% 64% Specificity 62% 60% 52% 59% 59% 52% 59% 59% 52% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 38% 37% 54% 43% 40% 59% 44% 41% 59% Specificity 83% 82% 81% 84% 83% 81% 84% 82% 81% OR Quartile 2 3.70 3.50 4.13 4.96 5.04 3.69 4.27 4.50 3.69 p Value 0.049 0.059 0.18 0.039 0.037 0.22 0.062 0.053 0.22 Lower limit 1.01 0.952 0.521 1.08 1.10 0.463 0.930 0.980 0.463 of 95% CI Upper limit 13.6 12.9 32.8 22.8 23.1 29.4 19.6 20.7 29.4 of 95% CI OR Quartile 3 3.51 3.03 1.83 2.79 2.74 1.92 2.93 3.06 1.92 p Value 8.7E4 0.0032 0.19 0.0069 0.0082 0.18 0.0060 0.0043 0.18 Lower limit 1.68 1.45 0.737 1.33 1.30 0.745 1.36 1.42 0.745 of 95% CI Upper limit 7.33 6.34 4.56 5.88 5.77 4.96 6.32 6.59 4.96 of 95% CI OR Quartile 4 2.98 2.71 5.02 3.99 3.30 6.28 4.13 3.23 6.28 p Value 0.0086 0.016 7.6E4 0.0010 0.0043 2.3E4 8.2E4 0.0051 2.3E4 Lower limit 1.32 1.21 1.96 1.74 1.45 2.36 1.80 1.42 2.36 of 95% CI Upper limit 6.74 6.10 12.8 9.12 7.47 16.7 9.47 7.33 16.7 of 95% CI

TABLE-US-00141 TABLE 20.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00293 0.0534 0.00378 0.0605 0.00734 0.0608 Average 0.0572 0.166 0.0555 0.179 0.0554 0.187 Stdev 0.136 0.302 0.132 0.314 0.130 0.321 p (t-test) 0.0071 0.0025 0.0014 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 72 58 77 53 80 50 sCr only Median 0.00310 0.0582 0.00378 0.0608 0.00715 0.0608 Average 0.0553 0.176 0.0542 0.187 0.0546 0.192 Stdev 0.134 0.311 0.130 0.321 0.129 0.326 p (t-test) 0.0033 0.0013 9.6E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 75 54 79 50 81 48 UO only Median 0.0182 0.0611 0.0181 0.0955 0.0181 0.0955 Average 0.0736 0.221 0.0718 0.245 0.0718 0.245 Stdev 0.144 0.394 0.143 0.410 0.143 0.410 p (t-test) 0.0024 5.4E4 5.4E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 100 29 103 26 103 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.71 0.65 0.71 0.72 0.68 0.71 0.72 0.68 SE 0.046 0.047 0.061 0.047 0.048 0.063 0.048 0.048 0.063 p Value 1.1E5 4.8E6 0.015 8.2E6 3.3E6 0.0041 2.0E5 6.1E6 0.0041 nCohort 72 75 100 77 79 103 80 81 103 Non- persistent nCohort 58 54 29 53 50 26 50 48 26 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 95% 94% 97% 96% 96% 96% 96% 96% 96% Specificity 19% 19% 16% 19% 19% 16% 19% 19% 16% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 67% 69% 59% 66% 68% 62% 66% 69% 62% Specificity 64% 63% 52% 61% 61% 52% 60% 60% 52% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 38% 39% 48% 42% 42% 54% 42% 42% 54% Specificity 85% 84% 81% 86% 85% 82% 85% 84% 82% OR 4.43 3.90 5.33 6.17 5.62 4.60 5.54 5.23 4.60 Quartile 2 p Value 0.025 0.040 0.11 0.019 0.026 0.15 0.027 0.033 0.15 Lower limit 1.21 1.06 0.676 1.35 1.23 0.581 1.21 1.14 0.581 of 95% CI Upper limit 16.2 14.3 42.1 28.2 25.8 36.4 25.4 24.0 36.4 of 95% CI OR 3.63 3.65 1.53 3.05 3.29 1.76 2.91 3.37 1.76 Quartile 3 p Value 5.3E4 6.1E4 0.32 0.0028 0.0018 0.21 0.0045 0.0016 0.21 Lower limit 1.75 1.74 0.665 1.47 1.56 0.732 1.39 1.58 0.732 of 95% CI Upper limit 7.53 7.66 3.54 6.32 6.94 4.25 6.08 7.17 4.25 of 95% CI OR 3.39 3.34 3.98 4.26 4.04 5.16 4.10 3.74 5.16 Quartile 4 p Value 0.0041 0.0042 0.0022 7.3E4 0.0010 4.6E4 8.8E4 0.0017 4.6E4 Lower limit 1.47 1.46 1.65 1.84 1.76 2.06 1.79 1.64 2.06 of 95% CI Upper limit 7.79 7.62 9.62 9.87 9.29 12.9 9.43 8.53 12.9 of 95% CI

TABLE-US-00142 TABLE 20.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non- Non- Non- persistent Persistent persistent Persistent persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.00276 0.0559 0.00344 0.0608 0.00547 0.0608 Average 0.0571 0.165 0.0554 0.177 0.0557 0.181 Stdev 0.137 0.300 0.133 0.311 0.131 0.316 p (t-test) 0.0079 0.0028 0.0022 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 71 59 76 54 78 52 sCr only Median 0.00310 0.0582 0.00378 0.0608 0.00715 0.0608 Average 0.0560 0.171 0.0548 0.181 0.0552 0.186 Stdev 0.135 0.307 0.132 0.316 0.131 0.321 p (t-test) 0.0050 0.0021 0.0016 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 73 56 77 52 79 50 UO only Median 0.0147 0.0559 0.0133 0.0621 0.0133 0.0621 Average 0.0752 0.198 0.0733 0.217 0.0733 0.217 Stdev 0.147 0.374 0.145 0.388 0.145 0.388 p (t-test) 0.0082 0.0027 0.0027 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 96 33 99 30 99 30 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.71 0.71 0.65 0.72 0.72 0.68 0.71 0.71 0.68 SE 0.046 0.047 0.058 0.047 0.047 0.059 0.047 0.048 0.059 p Value 5.1E6 7.1E6 0.0084 3.9E6 5.3E6 0.0024 7.4E6 9.9E6 0.0024 nCohort 71 73 96 76 77 99 78 79 99 Non- persistent nCohort 59 56 33 54 52 30 52 50 30 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 95% 95% 97% 96% 96% 97% 96% 96% 97% Specificity 20% 19% 17% 20% 19% 16% 19% 19% 16% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 68% 68% 64% 67% 67% 67% 67% 68% 67% Specificity 65% 63% 54% 62% 61% 55% 62% 61% 55% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 37% 38% 42% 41% 40% 47% 40% 40% 47% Specificity 85% 84% 80% 86% 84% 81% 85% 84% 81% OR 4.58 4.19 6.40 6.39 6.05 5.59 5.95 5.62 5.59 Quartile 2 p Value 0.022 0.031 0.078 0.017 0.020 0.10 0.022 0.026 0.10 Lower limit 1.25 1.14 0.814 1.40 1.32 0.710 1.30 1.23 0.710 of 95% CI Upper limit 16.8 15.4 50.3 29.3 27.7 44.0 27.3 25.8 44.0 of 95% CI OR 3.87 3.60 2.07 3.24 3.23 2.40 3.29 3.29 2.40 Quartile 3 p Value 2.9E4 6.4E4 0.081 0.0016 0.0019 0.045 0.0015 0.0018 0.045 Lower limit 1.86 1.72 0.915 1.56 1.54 1.02 1.58 1.56 1.02 of 95% CI Upper limit 8.05 7.50 4.67 6.73 6.75 5.65 6.89 6.94 5.65 of 95% CI OR 3.24 3.05 2.99 4.06 3.67 3.68 3.73 3.38 3.68 Quartile 4 p Value 0.0056 0.0078 0.012 0.0010 0.0021 0.0035 0.0018 0.0036 0.0035 Lower limit 1.41 1.34 1.27 1.76 1.60 1.54 1.63 1.49 1.54 of 95% CI Upper limit 7.45 6.94 7.01 9.40 8.40 8.83 8.53 7.69 8.83 of 95% CI

TABLE-US-00143 TABLE 20.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00276 0.0559 0.00344 0.0608 0.00547 0.0608 Average 0.0571 0.165 0.0554 0.177 0.0557 0.181 Stdev 0.137 0.300 0.133 0.311 0.131 0.316 p (t-test) 0.0079 0.0028 0.0022 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 71 59 76 54 78 52 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00344 0.0559 0.00547 0.0605 0.00734 0.0605 Average 0.0568 0.168 0.0555 0.178 0.0559 0.182 Stdev 0.136 0.305 0.133 0.314 0.131 0.319 p (t-test) 0.0066 0.0029 0.0023 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 72 57 76 53 78 51 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0130 0.0611 0.0130 0.0631 0.0130 0.0631 Average 0.0667 0.214 0.0656 0.226 0.0656 0.226 Stdev 0.136 0.369 0.135 0.377 0.135 0.377 p (t-test) 0.0011 4.9E4 4.9E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 94 35 96 33 96 33 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or sCr UO sCr only UO only UO sCr only UO only UO only UO only AUC 0.71 0.70 0.68 0.72 0.70 0.69 0.71 0.70 0.69 SE 0.046 0.047 0.056 0.047 0.048 0.056 0.047 0.048 0.056 p Value 5.1E6 2.1E5 0.0011 3.9E6 1.7E5 6.2E4 7.4E6 3.0E5 6.2E4 nCohort Non- 71 72 94 76 76 96 78 78 96 persistent nCohort 59 57 35 54 53 33 52 51 33 Persistent Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 95% 95% 97% 96% 96% 97% 96% 96% 97% Specificity 20% 19% 17% 20% 20% 17% 19% 19% 17% Cutoff Quartile 3 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Sensitivity 68% 67% 66% 67% 66% 67% 67% 67% 67% Specificity 65% 62% 55% 62% 61% 55% 62% 60% 55% Cutoff Quartile 4 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Sensitivity 37% 37% 46% 41% 40% 48% 40% 39% 48% Specificity 85% 83% 82% 86% 84% 82% 85% 83% 82% OR Quartile 2 4.58 4.34 6.97 6.39 6.27 6.40 5.95 5.83 6.40 p Value 0.022 0.027 0.065 0.017 0.018 0.078 0.022 0.023 0.078 Lower limit 1.25 1.18 0.889 1.40 1.37 0.814 1.30 1.27 0.814 of 95% CI Upper limit 16.8 16.0 54.7 29.3 28.7 50.3 27.3 26.7 50.3 of 95% CI OR Quartile 3 3.87 3.33 2.37 3.24 2.98 2.47 3.29 3.03 2.47 p Value 2.9E4 0.0012 0.036 0.0016 0.0034 0.033 0.0015 0.0032 0.033 Lower limit 1.86 1.61 1.06 1.56 1.43 1.08 1.58 1.45 1.08 of 95% CI Upper limit 8.05 6.91 5.32 6.73 6.19 5.64 6.89 6.34 5.64 of 95% CI OR Quartile 4 3.24 2.92 3.81 4.06 3.50 4.37 3.73 3.23 4.37 p Value 0.0056 0.011 0.0020 0.0010 0.0030 7.8E4 0.0018 0.0051 7.8E4 Lower limit 1.41 1.28 1.63 1.76 1.53 1.85 1.63 1.42 1.85 of 95% CI Upper limit 7.45 6.63 8.90 9.40 8.00 10.3 8.53 7.32 10.3 of 95% CI

TABLE-US-00144 TABLE 20.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.133 0.204 0.134 0.204 0.136 0.271 Average 0.283 0.447 0.295 0.449 0.293 0.481 Stdev 0.339 0.461 0.350 0.465 0.347 0.480 p (t-test) 0.014 0.026 0.0093 Min 0.00300 0.00169 0.00300 0.00169 0.00169 0.00660 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 96 55 104 47 111 40 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.128 0.196 0.132 0.187 0.134 0.226 Average 0.278 0.442 0.297 0.431 0.292 0.461 Stdev 0.337 0.458 0.353 0.460 0.348 0.474 p (t-test) 0.013 0.052 0.018 Min 0.00300 0.00169 0.00300 0.00169 0.00169 0.00660 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 94 56 103 47 108 42 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.148 0.579 0.148 0.579 0.150 0.644 Average 0.303 0.632 0.303 0.632 0.303 0.651 Stdev 0.355 0.530 0.355 0.530 0.353 0.539 p (t-test) 5.7E4 5.7E4 3.7E4 Min 0.00169 0.0348 0.00169 0.0348 0.00169 0.0348 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 131 19 131 19 132 18 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.59 0.68 0.58 0.57 0.68 0.60 0.59 0.68 SE 0.049 0.049 0.071 0.051 0.051 0.071 0.054 0.053 0.073 p Value 0.077 0.063 0.011 0.13 0.18 0.011 0.058 0.094 0.012 nCohort Non- 96 94 131 104 103 131 111 108 132 persistent nCohort 55 56 19 47 47 19 40 42 18 Persistent Cutoff 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Quartile 2 Sensitivity 76% 77% 79% 74% 74% 79% 78% 76% 78% Specificity 26% 27% 26% 25% 25% 26% 26% 26% 26% Cutoff 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Quartile 3 Sensitivity 56% 57% 68% 57% 57% 68% 60% 60% 67% Specificity 53% 54% 53% 53% 53% 53% 53% 54% 52% Cutoff 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Quartile 4 Sensitivity 38% 39% 53% 38% 38% 53% 40% 40% 56% Specificity 82% 83% 79% 81% 81% 79% 80% 81% 79% OR Quartile 2 1.14 1.20 1.31 0.972 0.985 1.31 1.22 1.12 1.21 p Value 0.74 0.65 0.65 0.94 0.97 0.65 0.65 0.79 0.75 Lower limit 0.526 0.554 0.408 0.440 0.446 0.408 0.518 0.488 0.374 of 95% CI Upper limit 2.46 2.59 4.24 2.15 2.17 4.24 2.86 2.57 3.94 of 95% CI OR Quartile 3 1.46 1.58 2.41 1.52 1.55 2.41 1.70 1.71 2.19 p Value 0.26 0.18 0.093 0.24 0.22 0.093 0.16 0.15 0.14 Lower limit 0.751 0.812 0.864 0.756 0.771 0.864 0.817 0.828 0.776 of 95% CI Upper limit 2.85 3.08 6.73 3.04 3.10 6.73 3.55 3.52 6.18 of 95% CI OR Quartile 4 2.87 3.15 4.09 2.61 2.58 4.09 2.70 2.82 4.64 p Value 0.0062 0.0030 0.0054 0.014 0.015 0.0054 0.013 0.0092 0.0031 Lower limit 1.35 1.48 1.51 1.21 1.20 1.51 1.23 1.29 1.68 of 95% CI Upper limit 6.11 6.74 11.0 5.60 5.53 11.0 5.92 6.14 12.9 of 95% CI

TABLE-US-00145 TABLE 20.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.128 0.249 0.128 0.249 0.130 0.297 Average 0.266 0.451 0.272 0.459 0.269 0.492 Stdev 0.330 0.451 0.333 0.458 0.328 0.472 p (t-test) 0.0041 0.0043 9.2E4 Min 0.00300 0.00169 0.00300 0.00169 0.00169 0.00660 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 88 63 94 57 101 50 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.128 0.196 0.130 0.187 0.136 0.204 Average 0.269 0.439 0.277 0.441 0.276 0.462 Stdev 0.330 0.452 0.335 0.458 0.330 0.473 p (t-test) 0.0084 0.013 0.0057 Min 0.00300 0.00169 0.00300 0.00169 0.00169 0.00660 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 88 62 93 57 99 51 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.147 0.526 0.147 0.526 0.147 0.530 Average 0.297 0.565 0.297 0.565 0.297 0.575 Stdev 0.356 0.487 0.356 0.487 0.354 0.494 p (t-test) 0.0012 0.0012 9.0E4 Min 0.00169 0.0348 0.00169 0.0348 0.00169 0.0348 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 123 27 123 27 124 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.60 0.68 0.60 0.59 0.68 0.63 0.60 0.68 SE 0.047 0.047 0.061 0.048 0.048 0.061 0.049 0.050 0.062 p Value 0.024 0.044 0.0036 0.029 0.062 0.0036 0.0087 0.045 0.0041 nCohort Non- 88 88 123 94 93 123 101 99 124 persistent nCohort Persistent 63 62 27 57 57 27 50 51 26 Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 77% 85% 77% 77% 85% 80% 78% 85% Specificity 27% 27% 28% 27% 27% 28% 28% 27% 27% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 57% 56% 67% 58% 56% 67% 60% 57% 65% Specificity 55% 55% 54% 54% 54% 54% 54% 54% 53% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 38% 39% 44% 39% 39% 44% 40% 39% 46% Specificity 84% 84% 79% 83% 83% 79% 82% 82% 79% OR Quartile 2 1.31 1.29 2.20 1.23 1.24 2.20 1.53 1.36 2.08 p Value 0.48 0.52 0.17 0.60 0.58 0.17 0.31 0.45 0.21 Lower limit of 95% 0.616 0.603 0.707 0.568 0.576 0.707 0.677 0.612 0.667 CI Upper limit of 95% CI 2.80 2.74 6.82 2.65 2.69 6.82 3.48 3.04 6.47 OR Quartile 3 1.60 1.56 2.32 1.63 1.49 2.32 1.79 1.52 2.15 p Value 0.16 0.19 0.060 0.15 0.24 0.060 0.096 0.23 0.089 Lower limit of 95% 0.834 0.809 0.965 0.839 0.767 0.965 0.901 0.769 0.890 CI Upper limit of 95% CI 3.07 2.99 5.56 3.17 2.89 5.56 3.57 3.00 5.19 OR Quartile 4 3.25 3.34 2.98 3.06 3.02 2.98 3.07 2.90 3.23 p Value 0.0025 0.0021 0.014 0.0038 0.0042 0.014 0.0038 0.0060 0.0093 Lower limit of 95% 1.51 1.55 1.25 1.44 1.42 1.25 1.44 1.36 1.33 CI Upper limit of 95% CI 6.99 7.18 7.15 6.54 6.45 7.15 6.58 6.20 7.82

TABLE-US-00146 TABLE 20.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.105 0.263 0.116 0.249 0.128 0.293 Average 0.261 0.443 0.265 0.446 0.265 0.472 Stdev 0.334 0.439 0.336 0.443 0.328 0.459 p (t-test) 0.0044 0.0050 0.0015 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 83 68 86 65 94 57 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.104 0.226 0.116 0.226 0.130 0.249 Average 0.262 0.432 0.265 0.438 0.267 0.456 Stdev 0.336 0.437 0.335 0.443 0.328 0.460 p (t-test) 0.0078 0.0072 0.0040 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 82 68 86 64 93 57 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.136 0.434 0.136 0.434 0.141 0.480 Average 0.288 0.533 0.288 0.533 0.288 0.540 Stdev 0.350 0.473 0.350 0.473 0.349 0.478 p (t-test) 0.0011 0.0011 9.0E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 115 35 115 35 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.61 0.66 0.61 0.61 0.66 0.62 0.60 0.66 SE 0.046 0.046 0.055 0.047 0.047 0.055 0.048 0.048 0.056 p Value 0.013 0.018 0.0041 0.015 0.022 0.0041 0.011 0.034 0.0048 nCohort Non- 83 82 115 86 86 115 94 93 116 persistent nCohort 68 68 35 65 64 35 57 57 34 Persistent Cutoff 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Quartile 2 Sensitivity 78% 78% 83% 78% 78% 83% 79% 77% 82% Specificity 28% 28% 28% 28% 28% 28% 28% 27% 28% Cutoff 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Quartile 3 Sensitivity 59% 59% 66% 58% 58% 66% 60% 58% 65% Specificity 57% 57% 55% 56% 56% 55% 55% 55% 54% Cutoff 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Quartile 4 Sensitivity 37% 37% 43% 37% 38% 43% 39% 39% 44% Specificity 84% 84% 80% 84% 84% 80% 83% 83% 80% OR Quartile 2 1.35 1.38 1.86 1.41 1.38 1.86 1.43 1.24 1.78 p Value 0.43 0.40 0.21 0.37 0.40 0.21 0.37 0.58 0.25 Lower limit 0.641 0.651 0.707 0.662 0.648 0.707 0.657 0.576 0.673 of 95% CI Upper limit 2.86 2.91 4.91 3.00 2.95 4.91 3.13 2.69 4.70 of 95% CI OR Quartile 3 1.87 1.92 2.32 1.78 1.73 2.32 1.83 1.67 2.18 p Value 0.060 0.050 0.036 0.083 0.100 0.036 0.076 0.13 0.054 Lower limit 0.974 1.000 1.06 0.927 0.900 1.06 0.939 0.858 0.986 of 95% CI Upper limit 3.57 3.68 5.11 3.41 3.33 5.11 3.57 3.25 4.81 of 95% CI OR Quartile 4 3.13 3.09 3.00 3.01 3.09 3.00 3.06 3.02 3.19 p Value 0.0037 0.0042 0.0079 0.0046 0.0038 0.0079 0.0038 0.0042 0.0053 Lower limit 1.45 1.43 1.33 1.40 1.44 1.33 1.44 1.42 1.41 of 95% CI Upper limit 6.76 6.67 6.75 6.45 6.63 6.75 6.54 6.45 7.22 of 95% CI

TABLE-US-00147 TABLE 20.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.105 0.263 0.105 0.269 0.127 0.291 Average 0.263 0.435 0.265 0.443 0.264 0.462 Stdev 0.338 0.436 0.337 0.440 0.331 0.452 p (t-test) 0.0071 0.0054 0.0023 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 81 70 85 66 91 60 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.104 0.249 0.104 0.226 0.116 0.269 Average 0.262 0.430 0.266 0.432 0.265 0.450 Stdev 0.338 0.434 0.339 0.437 0.333 0.450 p (t-test) 0.0084 0.0097 0.0044 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 81 69 84 66 90 60 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.136 0.396 0.133 0.415 0.136 0.434 Average 0.289 0.495 0.286 0.506 0.287 0.511 Stdev 0.354 0.458 0.353 0.458 0.352 0.463 p (t-test) 0.0040 0.0023 0.0020 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 109 41 110 40 111 39 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.61 0.63 0.61 0.61 0.64 0.62 0.61 0.64 SE 0.046 0.046 0.053 0.046 0.047 0.053 0.047 0.048 0.054 p Value 0.018 0.016 0.012 0.013 0.018 0.0067 0.013 0.019 0.0078 nCohort Non- 81 81 109 85 84 110 91 90 111 persistent nCohort 70 69 41 66 66 40 60 60 39 Persistent Cutoff 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Quartile 2 Sensitivity 77% 78% 78% 79% 79% 80% 78% 78% 79% Specificity 27% 28% 27% 28% 29% 27% 27% 28% 27% Cutoff 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Quartile 3 Sensitivity 59% 59% 63% 59% 59% 65% 60% 60% 64% Specificity 57% 58% 55% 56% 57% 55% 56% 57% 55% Cutoff 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Quartile 4 Sensitivity 36% 36% 39% 36% 36% 40% 38% 38% 41% Specificity 84% 84% 80% 84% 83% 80% 84% 83% 80% OR Quartile 2 1.26 1.43 1.29 1.46 1.49 1.50 1.37 1.39 1.44 p Value 0.54 0.35 0.56 0.33 0.31 0.37 0.42 0.40 0.42 Lower limit 0.599 0.675 0.549 0.686 0.697 0.621 0.636 0.645 0.594 of 95% CI Upper limit 2.64 3.02 3.02 3.11 3.17 3.62 2.95 3.00 3.47 of 95% CI OR Quartile 3 1.86 2.02 2.12 1.87 1.93 2.31 1.91 1.96 2.18 p Value 0.061 0.034 0.046 0.059 0.049 0.029 0.055 0.047 0.043 Lower limit 0.972 1.05 1.01 0.977 1.00 1.09 0.987 1.01 1.03 of 95% CI Upper limit 3.55 3.89 4.44 3.60 3.70 4.90 3.71 3.81 4.63 of 95% CI OR Quartile 4 2.91 2.97 2.53 2.90 2.86 2.67 3.15 3.11 2.81 p Value 0.0065 0.0056 0.020 0.0062 0.0069 0.015 0.0031 0.0035 0.010 Lower limit 1.35 1.38 1.16 1.35 1.33 1.21 1.47 1.45 1.28 of 95% CI Upper limit 6.27 6.42 5.54 6.21 6.12 5.85 6.73 6.65 6.20 of 95% CI

TABLE-US-00148 TABLE 20.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.104 0.249 0.105 0.226 0.116 0.288 Average 0.263 0.428 0.268 0.430 0.264 0.453 Stdev 0.341 0.431 0.342 0.434 0.334 0.446 p (t-test) 0.0098 0.011 0.0033 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 78 73 81 70 88 63 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.104 0.249 0.104 0.226 0.116 0.269 Average 0.260 0.427 0.265 0.429 0.264 0.446 Stdev 0.339 0.431 0.340 0.434 0.333 0.446 p (t-test) 0.0091 0.011 0.0050 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 79 71 82 68 88 62 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.141 0.348 0.141 0.348 0.147 0.396 Average 0.290 0.486 0.290 0.486 0.290 0.490 Stdev 0.355 0.456 0.355 0.456 0.354 0.461 p (t-test) 0.0060 0.0060 0.0053 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 108 42 108 42 109 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.61 0.63 0.60 0.61 0.63 0.62 0.61 0.63 SE 0.046 0.046 0.052 0.046 0.046 0.052 0.047 0.047 0.053 p Value 0.021 0.019 0.014 0.024 0.022 0.014 0.013 0.024 0.016 nCohort Non- 78 79 108 81 82 108 88 88 109 persistent nCohort 73 71 42 70 68 42 63 62 41 Persistent Cutoff 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Quartile 2 Sensitivity 77% 77% 79% 77% 78% 79% 78% 77% 78% Specificity 27% 28% 27% 27% 28% 27% 27% 27% 27% Cutoff 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Quartile 3 Sensitivity 59% 59% 62% 59% 59% 62% 60% 60% 61% Specificity 58% 58% 55% 57% 57% 55% 57% 57% 54% Cutoff 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Quartile 4 Sensitivity 36% 37% 38% 36% 37% 38% 38% 39% 39% Specificity 85% 85% 80% 84% 84% 80% 84% 84% 80% OR Quartile 2 1.21 1.33 1.35 1.26 1.38 1.35 1.31 1.29 1.29 p Value 0.61 0.46 0.49 0.54 0.40 0.49 0.48 0.52 0.56 Lower limit 0.580 0.631 0.575 0.599 0.651 0.575 0.616 0.603 0.549 of 95% CI Upper limit 2.54 2.79 3.15 2.64 2.91 3.15 2.80 2.74 3.02 of 95% CI OR Quartile 3 1.95 2.02 1.96 1.86 1.92 1.96 2.00 1.95 1.84 p Value 0.042 0.034 0.071 0.061 0.050 0.071 0.039 0.048 0.10 Lower limit 1.02 1.05 0.944 0.972 1.000 0.944 1.04 1.01 0.887 of 95% CI Upper limit 3.73 3.87 4.06 3.55 3.68 4.06 3.86 3.77 3.83 of 95% CI OR Quartile 4 3.04 3.23 2.41 2.91 3.09 2.41 3.25 3.34 2.53 p Value 0.0052 0.0033 0.027 0.0065 0.0042 0.027 0.0025 0.0021 0.020 Lower limit 1.40 1.48 1.10 1.35 1.43 1.10 1.51 1.55 1.16 of 95% CI Upper limit 6.63 7.05 5.24 6.27 6.67 5.24 6.99 7.18 5.54 of 95% CI

Example 21. Use of Fibroblast Growth Factor 23 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0186] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Fibroblast growth factor 23 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0187] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0188] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00149 TABLE 21.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00106 0.0509 0.00547 0.0303 0.0104 0.0230 Average 0.0416 0.150 0.0548 0.162 0.0615 0.163 Stdev 0.134 0.272 0.132 0.297 0.134 0.308 p (t-test) 0.0082 0.0080 0.013 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 53 77 68 62 73 57 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00242 0.0534 0.00715 0.0406 0.0104 0.0267 Average 0.0409 0.154 0.0528 0.167 0.0592 0.171 Stdev 0.131 0.277 0.131 0.301 0.132 0.314 p (t-test) 0.0058 0.0050 0.0068 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 55 74 69 60 75 54 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0181 0.0223 0.0185 0.0611 0.0185 0.0611 Average 0.0774 0.212 0.0756 0.250 0.0749 0.270 Stdev 0.145 0.404 0.142 0.438 0.141 0.454 p (t-test) 0.0060 9.1E4 3.3E4 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 101 28 106 23 108 21 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.73 0.72 0.62 0.66 0.67 0.62 0.62 0.63 0.62 SE 0.044 0.044 0.062 0.048 0.048 0.068 0.050 0.050 0.070 p Value 2.4E7 9.0E7 0.063 7.3E4 4.0E4 0.081 0.012 0.0071 0.085 nCohort Non- 53 55 101 68 69 106 73 75 108 persistent nCohort 77 74 28 62 60 23 57 54 21 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 91% 91% 96% 90% 90% 96% 89% 89% 95% Specificity 19% 18% 16% 16% 16% 15% 15% 15% 15% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 66% 65% 61% 65% 65% 57% 61% 63% 57% Specificity 74% 69% 52% 63% 62% 51% 59% 59% 51% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 35% 36% 39% 34% 35% 43% 33% 33% 48% Specificity 89% 89% 78% 82% 83% 78% 81% 80% 79% OR Quartile 2 2.33 2.13 5.08 1.80 1.71 3.91 1.51 1.38 3.48 p Value 0.11 0.15 0.12 0.28 0.32 0.20 0.45 0.56 0.24 Lower limit 0.824 0.754 0.644 0.623 0.590 0.492 0.522 0.475 0.436 of 95% CI Upper limit 6.57 6.00 40.1 5.20 4.93 31.1 4.36 3.98 27.8 of 95% CI OR Quartile 3 5.46 4.13 1.71 3.13 3.07 1.35 2.28 2.41 1.38 p Value 1.6E5 1.9E4 0.22 0.0018 0.0023 0.52 0.023 0.016 0.50 Lower limit 2.52 1.96 0.727 1.53 1.49 0.544 1.12 1.18 0.539 of 95% CI Upper limit 11.8 8.69 4.00 6.40 6.31 3.35 4.63 4.95 3.55 of 95% CI OR Quartile 4 4.23 4.69 2.32 2.39 2.56 2.78 2.11 2.00 3.36 p Value 0.0036 0.0018 0.064 0.036 0.024 0.034 0.068 0.090 0.015 Lower limit 1.60 1.78 0.951 1.06 1.13 1.08 0.945 0.899 1.27 of 95% CI Upper limit 11.2 12.4 5.68 5.40 5.80 7.14 4.70 4.45 8.88 of 95% CI

TABLE-US-00150 TABLE 21.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000547 0.0494 0.00293 0.0406 0.00547 0.0267 Average 0.0259 0.153 0.0401 0.166 0.0457 0.168 Stdev 0.0673 0.277 0.0863 0.298 0.0926 0.305 p (t-test) 0.0023 0.0017 0.0023 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 48 82 62 68 66 64 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000806 0.0559 0.00293 0.0509 0.00378 0.0303 Average 0.0250 0.160 0.0393 0.171 0.0445 0.172 Stdev 0.0647 0.284 0.0850 0.304 0.0921 0.309 p (t-test) 9.9E4 0.0011 0.0016 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 52 77 64 65 67 62 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0181 0.0217 0.0185 0.0219 0.0185 0.0219 Average 0.0787 0.179 0.0766 0.202 0.0759 0.213 Stdev 0.149 0.362 0.146 0.386 0.144 0.397 p (t-test) 0.027 0.0085 0.0047 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 93 36 98 31 100 29 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.74 0.61 0.69 0.70 0.61 0.67 0.67 0.61 SE 0.043 0.043 0.057 0.046 0.046 0.060 0.047 0.047 0.062 p Value 1.6E8 2.2E8 0.047 2.7E5 2.2E5 0.064 5.1E4 2.5E4 0.069 nCohort Non- 48 52 93 62 64 98 66 67 100 persistent nCohort 82 77 36 68 65 31 64 62 29 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 91% 91% 97% 91% 91% 97% 91% 90% 97% Specificity 21% 19% 17% 18% 17% 16% 17% 16% 16% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 65% 65% 58% 65% 65% 55% 62% 63% 55% Specificity 75% 71% 53% 66% 64% 51% 62% 61% 51% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 34% 36% 39% 37% 37% 42% 38% 37% 45% Specificity 90% 90% 80% 87% 86% 80% 86% 85% 80% OR Quartile 2 2.82 2.38 7.27 2.23 2.04 5.85 1.93 1.83 5.33 p Value 0.051 0.10 0.059 0.14 0.19 0.093 0.22 0.26 0.11 Lower limit 0.995 0.842 0.927 0.771 0.706 0.744 0.669 0.634 0.676 of 95% CI Upper limit 7.99 6.73 57.0 6.44 5.90 46.1 5.59 5.30 42.1 of 95% CI OR Quartile 3 5.48 4.57 1.56 3.58 3.26 1.26 2.73 2.67 1.28 p Value 2.7E5 9.1E5 0.26 5.5E4 0.0013 0.57 0.0055 0.0068 0.56 Lower limit 2.48 2.13 0.716 1.74 1.58 0.562 1.34 1.31 0.558 of 95% CI Upper limit 12.1 9.78 3.39 7.38 6.69 2.85 5.56 5.45 2.94 of 95% CI OR Quartile 4 4.46 5.37 2.48 3.92 3.58 2.82 3.80 3.36 3.25 p Value 0.0045 0.0014 0.034 0.0026 0.0039 0.019 0.0025 0.0050 0.0087 Lower limit 1.59 1.91 1.07 1.61 1.50 1.18 1.60 1.44 1.35 of 95% CI Upper limit 12.5 15.1 5.73 9.57 8.51 6.70 9.04 7.84 7.84 of 95% CI

TABLE-US-00151 TABLE 21.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000547 0.0494 0.00293 0.0406 0.00344 0.0303 Average 0.0259 0.153 0.0401 0.166 0.0453 0.165 Stdev 0.0673 0.277 0.0863 0.298 0.0940 0.301 p (t-test) 0.0023 0.0017 0.0030 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 48 82 62 68 64 66 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00106 0.0534 0.00310 0.0406 0.00378 0.0303 Average 0.0255 0.158 0.0399 0.169 0.0450 0.167 Stdev 0.0652 0.283 0.0856 0.302 0.0933 0.305 p (t-test) 0.0013 0.0014 0.0025 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 51 78 63 66 65 64 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0144 0.0230 0.0181 0.0431 0.0181 0.0431 Average 0.0792 0.166 0.0771 0.183 0.0763 0.192 Stdev 0.153 0.342 0.149 0.361 0.148 0.370 p (t-test) 0.049 0.019 0.012 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 88 41 93 36 95 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.73 0.63 0.69 0.69 0.63 0.68 0.67 0.63 SE 0.043 0.043 0.054 0.046 0.046 0.057 0.047 0.047 0.058 p Value 1.6E8 9.1E8 0.017 2.7E5 5.7E5 0.025 1.8E4 3.5E4 0.027 nCohort Non- 48 51 88 62 63 93 64 65 95 persistent nCohort 82 78 41 68 66 36 66 64 34 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 91% 91% 98% 91% 91% 97% 91% 91% 97% Specificity 21% 20% 18% 18% 17% 17% 17% 17% 17% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 65% 64% 61% 65% 64% 58% 64% 62% 59% Specificity 75% 71% 55% 66% 63% 53% 64% 62% 53% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 34% 36% 37% 37% 36% 39% 36% 36% 41% Specificity 90% 90% 80% 87% 86% 80% 86% 85% 80% OR Quartile 2 2.82 2.47 8.89 2.23 2.12 7.27 2.08 1.97 6.68 p Value 0.051 0.088 0.037 0.14 0.17 0.059 0.18 0.21 0.071 Lower limit 0.995 0.875 1.14 0.771 0.732 0.927 0.718 0.681 0.851 of 95% CI Upper limit 7.99 7.00 69.5 6.44 6.12 57.0 6.00 5.69 52.5 of 95% CI OR Quartile 3 5.48 4.29 1.88 3.58 3.04 1.56 3.12 2.67 1.59 p Value 2.7E5 1.7E4 0.10 5.5E4 0.0024 0.26 0.0018 0.0069 0.25 Lower limit 2.48 2.01 0.881 1.74 1.49 0.716 1.52 1.31 0.718 of 95% CI Upper limit 12.1 9.16 3.99 7.38 6.24 3.39 6.38 5.43 3.51 of 95% CI OR Quartile 4 4.46 5.15 2.24 3.92 3.43 2.48 3.49 3.09 2.80 p Value 0.0045 0.0019 0.053 0.0026 0.0053 0.034 0.0046 0.0090 0.017 Lower limit 1.59 1.83 0.988 1.61 1.44 1.07 1.47 1.32 1.20 of 95% CI Upper limit 12.5 14.5 5.09 9.57 8.15 5.73 8.29 7.19 6.54 of 95% CI

TABLE-US-00152 TABLE 21.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000547 0.0494 0.00276 0.0509 0.00310 0.0303 Average 0.0259 0.153 0.0397 0.164 0.0451 0.163 Stdev 0.0673 0.277 0.0869 0.296 0.0948 0.299 p (t-test) 0.0023 0.0019 0.0033 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 48 82 61 69 63 67 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00106 0.0534 0.00293 0.0509 0.00344 0.0303 Average 0.0255 0.158 0.0395 0.167 0.0448 0.166 Stdev 0.0652 0.283 0.0862 0.300 0.0940 0.303 p (t-test) 0.0013 0.0016 0.0027 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 51 78 62 67 64 65 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0106 0.0231 0.0133 0.0267 0.0133 0.0267 Average 0.0807 0.157 0.0791 0.168 0.0782 0.175 Stdev 0.155 0.331 0.152 0.345 0.150 0.353 p (t-test) 0.078 0.044 0.031 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 85 44 89 40 91 38 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.73 0.64 0.70 0.69 0.63 0.68 0.68 0.63 SE 0.043 0.043 0.053 0.045 0.046 0.055 0.047 0.047 0.055 p Value 1.6E8 9.1E8 0.0095 1.2E5 2.7E5 0.015 9.6E5 1.9E4 0.016 nCohort Non- 48 51 85 61 62 89 63 64 91 persistent nCohort 82 78 44 69 67 40 67 65 38 Persistent Cutoff 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Quartile 2 Sensitivity 91% 91% 98% 91% 91% 98% 91% 91% 97% Specificity 21% 20% 19% 18% 18% 18% 17% 17% 18% Cutoff 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Quartile 3 Sensitivity 65% 64% 64% 65% 64% 62% 64% 63% 63% Specificity 75% 71% 56% 67% 65% 55% 65% 62% 55% Cutoff 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Quartile 4 Sensitivity 34% 36% 34% 36% 36% 35% 36% 35% 37% Specificity 90% 90% 79% 87% 85% 79% 86% 84% 79% OR Quartile 2 2.82 2.47 9.97 2.31 2.19 8.55 2.15 2.04 7.89 p Value 0.051 0.088 0.028 0.12 0.15 0.041 0.16 0.19 0.049 Lower limit 0.995 0.875 1.28 0.799 0.758 1.09 0.744 0.706 1.01 of 95% CI Upper limit 7.99 7.00 77.9 6.68 6.34 66.9 6.22 5.90 61.8 of 95% CI OR Quartile 3 5.48 4.29 2.27 3.84 3.26 2.04 3.34 2.85 2.09 p Value 2.7E5 1.7E4 0.032 2.9E4 0.0013 0.067 0.0010 0.0041 0.063 Lower limit 2.48 2.01 1.07 1.85 1.58 0.951 1.63 1.39 0.960 of 95% CI Upper limit 12.1 9.16 4.80 7.97 6.70 4.38 6.86 5.81 4.55 of 95% CI OR Quartile 4 4.46 5.15 1.93 3.76 3.29 1.98 3.35 2.96 2.21 p Value 0.0045 0.0019 0.11 0.0035 0.0070 0.10 0.0061 0.012 0.061 Lower limit 1.59 1.83 0.855 1.54 1.38 0.870 1.41 1.27 0.963 of 95% CI Upper limit 12.5 14.5 4.34 9.17 7.81 4.52 7.95 6.88 5.07 of 95% CI

TABLE-US-00153 TABLE 21.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.000547 0.0494 0.00259 0.0406 0.00293 0.0303 Average 0.0259 0.153 0.0400 0.162 0.0454 0.161 Stdev 0.0673 0.277 0.0876 0.294 0.0955 0.297 p (t-test) 0.0023 0.0024 0.0041 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 48 82 60 70 62 68 sCr only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00106 0.0534 0.00293 0.0509 0.00344 0.0303 Average 0.0255 0.158 0.0395 0.167 0.0448 0.166 Stdev 0.0652 0.283 0.0862 0.300 0.0940 0.303 p (t-test) 0.0013 0.0016 0.0027 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.401 1.70 0.459 1.70 0.459 1.70 n (Patient) 51 78 62 67 64 65 UO only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.00847 0.0267 0.0116 0.0303 0.0116 0.0303 Average 0.0712 0.171 0.0704 0.179 0.0697 0.186 Stdev 0.144 0.330 0.142 0.340 0.140 0.347 p (t-test) 0.019 0.012 0.0076 Min 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 1.63E6 Max 0.878 1.70 0.878 1.70 0.878 1.70 n (Patient) 83 46 86 43 88 41 24 48 72 Persistence Period sCr or sCr or sCr or Duration (hr) UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.74 0.73 0.66 0.70 0.69 0.66 0.68 0.68 0.66 SE 0.043 0.043 0.051 0.045 0.046 0.052 0.046 0.047 0.053 p Value 1.6E8 9.1E8 0.0013 8.3E6 2.7E5 0.0020 7.1E5 1.9E4 0.0023 nCohort Non- 48 51 83 60 62 86 62 64 88 persistent nCohort Persistent 82 78 46 70 67 43 68 65 41 Cutoff Quartile 2 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 1.90E6 Sensitivity 91% 91% 98% 91% 91% 98% 91% 91% 98% Specificity 21% 20% 19% 18% 18% 19% 18% 17% 18% Cutoff Quartile 3 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 0.0190 0.0186 0.0194 Sensitivity 65% 64% 65% 66% 64% 65% 65% 63% 66% Specificity 75% 71% 58% 68% 65% 57% 66% 62% 57% Cutoff Quartile 4 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 0.0929 0.0908 0.0936 Sensitivity 34% 36% 37% 36% 36% 37% 35% 35% 39% Specificity 90% 90% 81% 87% 85% 80% 85% 84% 81% OR Quartile 2 2.82 2.47 10.7 2.39 2.19 9.60 2.23 2.04 8.89 p Value 0.051 0.088 0.024 0.11 0.15 0.031 0.14 0.19 0.037 Lower limit of 95% 0.995 0.875 1.38 0.828 0.758 1.23 0.771 0.706 1.14 CI Upper limit of 95% CI 7.99 7.00 83.9 6.93 6.34 75.0 6.44 5.90 69.5 OR Quartile 3 5.48 4.29 2.57 4.14 3.26 2.47 3.58 2.85 2.54 p Value 2.7E5 1.7E4 0.013 1.5E4 0.0013 0.019 5.5E4 0.0041 0.018 Lower limit of 95% 2.48 2.01 1.22 1.98 1.58 1.16 1.74 1.39 1.17 CI Upper limit of 95% CI 12.1 9.16 5.43 8.62 6.70 5.28 7.38 5.81 5.49 OR Quartile 4 4.46 5.15 2.45 3.61 3.29 2.41 3.21 2.96 2.67 p Value 0.0045 0.0019 0.030 0.0047 0.0070 0.035 0.0081 0.012 0.019 Lower limit of 95% 1.59 1.83 1.09 1.48 1.38 1.06 1.35 1.27 1.18 CI Upper limit of 95% CI 12.5 14.5 5.52 8.80 7.81 5.43 7.62 6.88 6.07

TABLE-US-00154 TABLE 21.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0752 0.288 0.104 0.282 0.127 0.271 Average 0.253 0.387 0.269 0.416 0.281 0.423 Stdev 0.398 0.387 0.359 0.416 0.355 0.429 p (t-test) 0.049 0.021 0.028 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 50 101 75 76 85 66 sCr only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0752 0.282 0.0939 0.276 0.128 0.226 Average 0.251 0.386 0.258 0.416 0.289 0.406 Stdev 0.391 0.388 0.349 0.419 0.363 0.424 p (t-test) 0.044 0.014 0.070 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 52 98 73 77 86 64 UO only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.128 0.353 0.131 0.556 0.147 0.579 Average 0.294 0.495 0.292 0.556 0.297 0.584 Stdev 0.364 0.445 0.357 0.469 0.352 0.505 p (t-test) 0.0064 9.2E4 7.7E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 112 38 120 30 125 25 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.64 0.64 0.65 0.60 0.61 0.67 0.58 0.57 0.66 SE 0.046 0.046 0.054 0.046 0.046 0.058 0.047 0.048 0.064 p Value 0.0023 0.0024 0.0067 0.023 0.013 0.0029 0.076 0.13 0.012 nCohort Non- 50 52 112 75 73 120 85 86 125 persistent nCohort Persistent 101 98 38 76 77 30 66 64 25 Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 79% 79% 76% 78% 80% 74% 75% 76% Specificity 32% 33% 27% 27% 29% 27% 25% 26% 26% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 59% 60% 68% 59% 60% 73% 59% 59% 68% Specificity 68% 69% 56% 59% 60% 56% 56% 57% 54% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 29% 30% 42% 33% 34% 50% 33% 33% 52% Specificity 82% 83% 80% 83% 84% 81% 81% 80% 80% OR Quartile 2 1.69 1.78 1.37 1.17 1.43 1.45 0.946 1.03 1.09 p Value 0.18 0.13 0.48 0.67 0.35 0.45 0.88 0.94 0.87 Lower limit of 95% 0.791 0.838 0.566 0.561 0.680 0.545 0.451 0.490 0.400 CI Upper limit of 95% CI 3.61 3.79 3.32 2.45 2.99 3.88 1.98 2.17 2.97 OR Quartile 3 3.11 3.40 2.79 2.06 2.25 3.48 1.87 1.94 2.45 p Value 0.0019 7.8E4 0.0100 0.029 0.015 0.0058 0.059 0.049 0.053 Lower limit of 95% 1.52 1.67 1.28 1.08 1.17 1.43 0.977 1.00 0.987 CI Upper limit of 95% CI 6.36 6.95 6.07 3.94 4.33 8.43 3.60 3.73 6.10 OR Quartile 4 1.83 2.01 2.98 2.34 2.59 4.22 2.16 1.98 4.33 p Value 0.16 0.10 0.0072 0.030 0.017 8.8E4 0.044 0.072 0.0014 Lower limit of 95% 0.792 0.868 1.34 1.09 1.19 1.81 1.02 0.942 1.76 CI Upper limit of 95% CI 4.25 4.65 6.59 5.03 5.65 9.85 4.55 4.17 10.6

TABLE-US-00155 TABLE 21.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.288 0.0914 0.293 0.104 0.302 Average 0.240 0.392 0.241 0.431 0.250 0.445 Stdev 0.390 0.389 0.341 0.418 0.334 0.431 p (t-test) 0.025 0.0029 0.0021 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 49 102 70 81 79 72 sCr only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.288 0.0847 0.291 0.104 0.293 Average 0.237 0.392 0.239 0.426 0.258 0.429 Stdev 0.383 0.390 0.342 0.416 0.342 0.427 p (t-test) 0.022 0.0033 0.0074 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 51 99 70 80 79 71 UO only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.105 0.373 0.112 0.526 0.133 0.530 Average 0.272 0.505 0.272 0.554 0.278 0.574 Stdev 0.352 0.438 0.344 0.455 0.340 0.481 p (t-test) 6.8E4 8.8E5 8.4E5 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 103 47 111 39 116 34 Persistence Period 24 48 72 Duration (hr) UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.65 0.68 0.64 0.64 0.70 0.62 0.61 0.69 SE 0.046 0.045 0.049 0.045 0.045 0.052 0.046 0.046 0.055 p Value 7.2E4 7.7E4 3.0E4 0.0022 0.0017 1.1E4 0.0061 0.013 7.5E4 nCohort Non- 49 51 103 70 70 111 79 79 116 persistent nCohort Persistent 102 99 47 81 80 39 72 71 34 Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 79% 83% 78% 79% 85% 76% 77% 82% Specificity 33% 33% 29% 29% 30% 29% 27% 28% 28% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 60% 61% 68% 60% 61% 72% 61% 61% 68% Specificity 69% 71% 58% 61% 63% 58% 59% 59% 55% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 29% 30% 40% 35% 35% 46% 36% 35% 47% Specificity 84% 84% 82% 86% 86% 82% 85% 84% 81% OR Quartile 2 1.76 1.86 2.00 1.40 1.59 2.23 1.17 1.33 1.78 p Value 0.14 0.11 0.12 0.37 0.22 0.10 0.67 0.46 0.25 Lower limit of 95% 0.824 0.872 0.838 0.670 0.757 0.851 0.560 0.631 0.673 CI Upper limit of 95% CI 3.77 3.95 4.79 2.93 3.33 5.83 2.45 2.79 4.70 OR Quartile 3 3.37 3.69 2.98 2.44 2.67 3.47 2.31 2.26 2.57 p Value 0.0010 4.1E4 0.0033 0.0077 0.0035 0.0021 0.012 0.015 0.022 Lower limit of 95% 1.63 1.79 1.44 1.27 1.38 1.57 1.20 1.17 1.15 CI Upper limit of 95% CI 6.96 7.62 6.16 4.70 5.18 7.66 4.43 4.34 5.76 OR Quartile 4 2.14 2.34 3.00 3.17 3.23 3.90 3.16 2.76 3.80 p Value 0.087 0.055 0.0050 0.0053 0.0046 7.8E4 0.0039 0.0097 0.0014 Lower limit of 95% 0.895 0.981 1.39 1.41 1.43 1.76 1.45 1.28 1.68 CI Upper limit of 95% CI 5.09 5.57 6.46 7.13 7.28 8.63 6.89 5.95 8.61

TABLE-US-00156 TABLE 21.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.288 0.0890 0.291 0.104 0.297 Average 0.240 0.392 0.243 0.427 0.250 0.434 Stdev 0.390 0.389 0.343 0.416 0.338 0.426 p (t-test) 0.025 0.0039 0.0039 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 49 102 69 82 75 76 sCr only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.288 0.0804 0.288 0.0939 0.293 Average 0.237 0.392 0.241 0.423 0.249 0.430 Stdev 0.383 0.390 0.344 0.414 0.338 0.424 p (t-test) 0.022 0.0044 0.0045 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 51 99 69 81 75 75 UO only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.104 0.384 0.112 0.476 0.133 0.501 Average 0.264 0.497 0.266 0.528 0.273 0.543 Stdev 0.351 0.430 0.344 0.445 0.340 0.467 p (t-test) 5.0E4 1.5E4 1.6E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 98 52 105 45 110 40 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.65 0.65 0.68 0.64 0.64 0.69 0.62 0.62 0.68 SE 0.046 0.045 0.047 0.045 0.045 0.049 0.045 0.046 0.052 p Value 7.2E4 7.7E4 1.3E4 0.0025 0.0019 1.1E4 0.0085 0.0071 7.6E4 nCohort Non- 49 51 98 69 69 105 75 75 110 persistent nCohort Persistent 102 99 52 82 81 45 76 75 40 Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 79% 83% 78% 79% 84% 76% 77% 82% Specificity 33% 33% 30% 29% 30% 30% 27% 28% 28% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 60% 61% 67% 60% 60% 69% 59% 60% 65% Specificity 69% 71% 59% 61% 62% 58% 59% 60% 55% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 29% 30% 40% 34% 35% 44% 36% 36% 45% Specificity 84% 84% 83% 86% 86% 83% 85% 85% 82% OR Quartile 2 1.76 1.86 2.01 1.45 1.65 2.27 1.17 1.33 1.85 p Value 0.14 0.11 0.10 0.32 0.19 0.076 0.67 0.45 0.19 Lower limit of 95% 0.824 0.872 0.868 0.694 0.785 0.917 0.561 0.634 0.741 CI Upper limit of 95% CI 3.77 3.95 4.65 3.03 3.46 5.64 2.45 2.78 4.62 OR Quartile 3 3.37 3.69 2.99 2.31 2.53 3.07 2.06 2.25 2.31 p Value 0.0010 4.1E4 0.0024 0.012 0.0058 0.0030 0.029 0.015 0.029 Lower limit of 95% 1.63 1.79 1.47 1.20 1.31 1.46 1.08 1.17 1.09 CI Upper limit of 95% CI 6.96 7.62 6.05 4.45 4.90 6.44 3.94 4.32 4.90 OR Quartile 4 2.14 2.34 3.23 3.06 3.12 3.87 3.21 3.27 3.68 p Value 0.087 0.055 0.0026 0.0069 0.0061 6.4E4 0.0040 0.0035 0.0012 Lower limit of 95% 0.895 0.981 1.51 1.36 1.38 1.78 1.45 1.48 1.67 CI Upper limit of 95% CI 5.09 5.57 6.91 6.88 7.02 8.41 7.09 7.25 8.11

TABLE-US-00157 TABLE 21.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.288 0.0847 0.288 0.0988 0.293 Average 0.240 0.392 0.242 0.425 0.250 0.432 Stdev 0.390 0.389 0.346 0.414 0.340 0.424 p (t-test) 0.025 0.0042 0.0041 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 49 102 68 83 74 77 sCr only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.288 0.0794 0.288 0.0914 0.291 Average 0.237 0.392 0.240 0.421 0.248 0.428 Stdev 0.383 0.390 0.346 0.412 0.340 0.422 p (t-test) 0.022 0.0047 0.0048 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 51 99 68 82 74 76 UO only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.105 0.370 0.119 0.415 0.136 0.434 Average 0.269 0.476 0.268 0.498 0.275 0.508 Stdev 0.355 0.428 0.347 0.441 0.342 0.461 p (t-test) 0.0018 6.5E4 8.2E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 95 55 100 50 105 45 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.65 0.65 0.65 0.64 0.64 0.66 0.62 0.63 0.64 SE 0.046 0.045 0.047 0.045 0.045 0.049 0.045 0.045 0.051 p Value 7.2E4 7.7E4 0.0012 0.0020 0.0015 0.0010 0.0072 0.0059 0.0055 nCohort Non- 49 51 95 68 68 100 74 74 105 persistent nCohort Persistent 102 99 55 83 82 50 77 76 45 Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 79% 80% 78% 79% 80% 77% 78% 78% Specificity 33% 33% 28% 29% 31% 28% 27% 28% 27% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 60% 61% 65% 60% 61% 66% 60% 61% 62% Specificity 69% 71% 59% 62% 63% 58% 59% 61% 55% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 29% 30% 38% 34% 34% 42% 35% 36% 42% Specificity 84% 84% 82% 85% 85% 83% 85% 85% 82% OR Quartile 2 1.76 1.86 1.59 1.50 1.71 1.56 1.21 1.38 1.27 p Value 0.14 0.11 0.26 0.28 0.16 0.29 0.61 0.40 0.57 Lower limit of 95% 0.824 0.872 0.716 0.719 0.814 0.686 0.582 0.657 0.558 CI Upper limit of 95% CI 3.77 3.95 3.52 3.15 3.59 3.53 2.53 2.88 2.90 OR Quartile 3 3.37 3.69 2.72 2.45 2.69 2.68 2.18 2.38 2.03 p Value 0.0010 4.1E4 0.0045 0.0076 0.0035 0.0063 0.019 0.0095 0.052 Lower limit of 95% 1.63 1.79 1.36 1.27 1.38 1.32 1.14 1.24 0.994 CI Upper limit of 95% CI 6.96 7.62 5.42 4.72 5.22 5.44 4.17 4.58 4.15 OR Quartile 4 2.14 2.34 2.83 2.95 3.01 3.54 3.09 3.16 3.31 p Value 0.087 0.055 0.0069 0.0089 0.0078 0.0012 0.0053 0.0046 0.0024 Lower limit of 95% 0.895 0.981 1.33 1.31 1.34 1.64 1.40 1.43 1.53 CI Upper limit of 95% CI 5.09 5.57 6.03 6.64 6.77 7.61 6.84 6.98 7.16

TABLE-US-00158 TABLE 21.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0743 0.282 0.0784 0.291 0.0847 0.300 Average 0.245 0.387 0.236 0.423 0.243 0.429 Stdev 0.397 0.387 0.351 0.408 0.346 0.415 p (t-test) 0.041 0.0036 0.0035 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 47 104 65 86 70 81 sCr only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0752 0.282 0.0794 0.288 0.0914 0.291 Average 0.241 0.388 0.238 0.419 0.246 0.425 Stdev 0.386 0.389 0.348 0.410 0.342 0.419 p (t-test) 0.030 0.0048 0.0050 Min 0.00372 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 50 100 66 84 72 78 UO only 24 48 72 Non- Non- Non- Persistence Period persistent Persistent persistent Persistent persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0988 0.372 0.104 0.396 0.127 0.396 Average 0.258 0.483 0.256 0.500 0.263 0.504 Stdev 0.346 0.429 0.342 0.434 0.339 0.448 p (t-test) 5.6E4 2.0E4 3.2E4 Min 0.00300 0.00169 0.00300 0.00169 0.00300 0.00169 Max 1.80 1.55 1.80 1.55 1.80 1.55 n (Patient) 92 58 95 55 99 51 24 48 72 Persistence Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.65 0.65 0.67 0.65 0.64 0.68 0.64 0.62 0.66 SE 0.046 0.046 0.046 0.044 0.045 0.047 0.045 0.045 0.048 p Value 0.0013 0.0016 2.6E4 6.1E4 0.0015 1.1E4 0.0019 0.0059 6.5E4 nCohort Non- 47 50 92 65 66 95 70 72 99 persistent nCohort Persistent 104 100 58 86 84 55 81 78 51 Cutoff Quartile 2 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 0.0475 0.0472 0.0489 Sensitivity 78% 78% 81% 79% 79% 82% 78% 77% 80% Specificity 32% 32% 29% 31% 30% 29% 29% 28% 28% Cutoff Quartile 3 0.163 0.158 0.164 0.163 0.158 0.164 0.163 0.158 0.164 Sensitivity 60% 60% 66% 62% 61% 67% 62% 60% 65% Specificity 70% 70% 60% 65% 64% 60% 63% 61% 58% Cutoff Quartile 4 0.535 0.531 0.536 0.535 0.531 0.536 0.535 0.531 0.536 Sensitivity 29% 30% 40% 34% 35% 42% 35% 36% 41% Specificity 83% 84% 84% 86% 86% 84% 86% 86% 83% OR Quartile 2 1.65 1.67 1.77 1.68 1.59 1.88 1.40 1.28 1.62 p Value 0.20 0.19 0.16 0.17 0.22 0.13 0.37 0.51 0.25 Lower limit of 95% 0.765 0.781 0.801 0.801 0.761 0.833 0.670 0.613 0.714 CI Upper limit of 95% CI 3.56 3.57 3.93 3.52 3.34 4.25 2.93 2.68 3.66 OR Quartile 3 3.48 3.50 2.82 2.93 2.70 3.08 2.73 2.38 2.49 p Value 9.2E4 7.1E4 0.0029 0.0016 0.0034 0.0015 0.0029 0.0095 0.011 Lower limit of 95% 1.66 1.69 1.43 1.50 1.39 1.54 1.41 1.24 1.24 CI Upper limit of 95% CI 7.28 7.23 5.59 5.72 5.26 6.19 5.28 4.59 5.01 OR Quartile 4 1.98 2.25 3.37 3.17 3.34 3.83 3.17 3.47 3.38 p Value 0.13 0.067 0.0018 0.0068 0.0046 6.1E4 0.0053 0.0027 0.0018 Lower limit of 95% 0.827 0.944 1.57 1.38 1.45 1.78 1.41 1.54 1.57 CI Upper limit of 95% CI 4.72 5.36 7.24 7.29 7.69 8.27 7.13 7.82 7.25

Example 22. Use of Pro-Interleukin-16 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0189] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Pro-interleukin-16 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0190] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0191] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00159 TABLE 22.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0286 50.4 0.0279 49.8 0.0286 45.5 Average 45.7 240 35.8 234 40.2 229 Stdev 102 397 93.3 390 98.1 388 p (t-test) 2.9E4 7.2E4 0.0021 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 440 3020 440 3020 440 3020 n (Patient) 57 258 46 269 41 274 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0290 66.2 0.0290 65.3 0.0291 54.6 Average 50.6 252 51.9 250 54.9 246 Stdev 133 405 134 404 138 402 p (t-test) 2.7E5 4.4E5 1.1E4 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 822 3020 822 3020 822 3020 n (Patient) 76 238 74 240 70 244 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 23.9 0.0422 37.6 0.0422 41.2 Average 177 253 167 253 156 255 Stdev 299 459 290 445 266 445 p (t-test) 0.078 0.042 0.018 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 193 120 172 141 155 158 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.70 0.71 0.53 0.73 0.71 0.56 0.70 0.70 0.56 SE 0.034 0.031 0.034 0.035 0.031 0.033 0.038 0.032 0.032 p Value 2.1E9 3.6E12 0.32 3.5E11 6.9E12 0.092 1.1E7 2.9E10 0.078 nCohort Recovered 57 76 193 46 74 172 41 70 155 nCohort Non- 258 238 120 269 240 141 274 244 158 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 81% 82% 78% 81% 82% 81% 80% 82% 80% Specificity 42% 41% 24% 48% 42% 26% 44% 41% 26% Cutoff Quartile 3 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Sensitivity 56% 59% 52% 55% 58% 54% 54% 57% 54% Specificity 75% 78% 51% 80% 77% 53% 78% 76% 54% Cutoff Quartile 4 283 280 284 283 280 284 283 280 284 Sensitivity 29% 31% 28% 28% 30% 29% 28% 30% 29% Specificity 91% 92% 77% 93% 92% 78% 93% 91% 79% OR Quartile 2 3.10 3.21 1.13 3.92 3.40 1.50 3.12 3.22 1.47 p Value 2.8E4 5.3E5 0.66 4.3E5 2.5E5 0.14 0.0011 7.2E5 0.15 Lower limit of 95% 1.68 1.83 0.655 2.04 1.92 0.872 1.57 1.81 0.867 CI Upper limit of 95% CI 5.71 5.66 1.95 7.54 6.01 2.57 6.18 5.72 2.50 OR Quartile 3 3.88 4.96 1.16 5.10 4.69 1.31 4.24 4.20 1.34 p Value 4.5E5 1.6E7 0.51 3.1E5 4.3E7 0.23 2.7E4 3.1E6 0.19 Lower limit of 95% 2.02 2.73 0.738 2.37 2.58 0.841 1.95 2.30 0.861 CI Upper limit of 95% CI 7.44 9.02 1.84 11.0 8.55 2.05 9.22 7.67 2.09 OR Quartile 4 4.18 5.16 1.30 5.64 4.95 1.45 4.86 4.55 1.52 p Value 0.0034 2.5E4 0.32 0.0047 3.6E4 0.16 0.010 7.4E4 0.11 Lower limit of 95% 1.61 2.15 0.774 1.70 2.06 0.867 1.46 1.89 0.907 CI Upper limit of 95% CI 10.9 12.4 2.18 18.7 11.9 2.41 16.2 11.0 2.54

TABLE-US-00160 TABLE 22.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0289 88.7 0.0289 76.4 0.0289 68.1 Average 57.8 264 53.5 255 43.8 252 Stdev 159 411 160 404 109 404 p (t-test) 5.8E6 2.0E5 2.4E5 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 577 3020 n (Patient) 90 225 79 236 71 244 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0291 105 0.0291 94.3 0.0291 91.1 Average 65.3 276 66.5 273 58.6 272 Stdev 170 420 171 418 139 419 p (t-test) 1.2E6 2.1E6 1.3E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 822 3020 n (Patient) 106 209 104 211 99 216 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 45.5 0.0422 35.1 0.0422 35.1 Average 174 272 175 256 166 257 Stdev 299 480 298 460 278 459 p (t-test) 0.027 0.060 0.031 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 211 102 193 120 177 136 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.74 0.73 0.56 0.74 0.73 0.56 0.72 0.72 0.55 SE 0.029 0.028 0.035 0.029 0.028 0.034 0.031 0.029 0.033 p Value 2.2E16 6.7E16 0.073 4.4E16 2.0E15 0.094 1.2E12 8.2E15 0.12 nCohort Recovered 90 106 211 79 104 193 71 99 177 nCohort Non- 225 209 102 236 211 120 244 216 136 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 84% 85% 81% 84% 85% 82% 82% 85% 82% Specificity 42% 40% 25% 44% 40% 26% 42% 40% 27% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 60% 62% 56% 59% 62% 54% 57% 61% 54% Specificity 74% 74% 53% 76% 73% 52% 75% 73% 53% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 32% 33% 31% 31% 33% 30% 30% 32% 29% Specificity 91% 91% 78% 92% 90% 78% 93% 91% 78% OR Quartile 2 3.97 3.77 1.47 4.14 3.93 1.69 3.42 3.76 1.61 p Value 1.0E6 1.8E6 0.20 7.6E7 9.0E7 0.070 2.7E5 2.0E6 0.090 Lower limit of 95% 2.28 2.18 0.814 2.36 2.28 0.958 1.93 2.18 0.929 CI Upper limit of 95% CI 6.89 6.50 2.64 7.28 6.79 2.99 6.08 6.49 2.77 OR Quartile 3 4.37 4.58 1.41 4.53 4.36 1.30 3.96 4.11 1.28 p Value 1.1E7 6.6E9 0.16 3.0E7 2.1E8 0.26 5.1E6 9.8E8 0.28 Lower limit of 95% 2.54 2.74 0.874 2.54 2.60 0.822 2.19 2.44 0.820 CI Upper limit of 95% CI 7.53 7.67 2.26 8.06 7.29 2.05 7.16 6.91 2.01 OR Quartile 4 4.73 4.73 1.60 5.45 4.57 1.50 5.75 4.79 1.47 p Value 9.2E5 1.9E5 0.084 1.5E4 2.9E5 0.13 3.1E4 3.5E5 0.14 Lower limit of 95% 2.17 2.32 0.940 2.27 2.24 0.891 2.22 2.28 0.883 CI Upper limit of 95% CI 10.3 9.65 2.71 13.1 9.31 2.51 14.8 10.1 2.46

TABLE-US-00161 TABLE 22.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0318 93.6 0.0318 76.4 0.0318 70.0 Average 75.6 278 76.2 271 70.2 265 Stdev 172 427 173 422 146 420 p (t-test) 2.0E6 7.0E6 1.2E5 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 771 3020 n (Patient) 114 201 107 208 97 218 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 99.3 0.0328 88.7 0.0328 83.2 Average 85.8 285 87.9 281 80.9 280 Stdev 191 434 193 432 172 432 p (t-test) 1.8E6 4.3E6 2.5E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 894 3020 n (Patient) 127 188 124 191 119 196 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 88.0 0.0422 50.2 0.0422 50.2 Average 168 287 172 269 170 261 Stdev 289 493 293 476 288 464 p (t-test) 0.0077 0.027 0.032 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 213 100 203 110 189 124 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.69 0.68 0.58 0.69 0.68 0.57 0.67 0.68 0.56 SE 0.030 0.030 0.035 0.030 0.030 0.034 0.031 0.030 0.033 p Value 5.9E11 1.2E9 0.020 3.2E10 4.1E9 0.058 2.2E8 4.5E9 0.078 nCohort Recovered 114 127 213 107 124 203 97 119 189 nCohort Non- 201 188 100 208 191 110 218 196 124 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 84% 84% 81% 84% 84% 81% 82% 83% 81% Specificity 35% 33% 25% 36% 34% 25% 35% 34% 25% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 61% 62% 60% 60% 61% 57% 59% 61% 56% Specificity 69% 68% 54% 69% 67% 54% 69% 67% 54% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 33% 34% 31% 32% 34% 30% 31% 33% 30% Specificity 89% 88% 77% 89% 88% 77% 89% 88% 78% OR Quartile 2 2.75 2.50 1.41 2.94 2.64 1.42 2.48 2.50 1.42 p Value 2.1E4 7.6E4 0.25 8.9E5 3.7E4 0.23 0.0010 7.6E4 0.22 Lower limit of 95% 1.61 1.47 0.784 1.71 1.55 0.803 1.44 1.47 0.816 CI Upper limit of 95% CI 4.70 4.27 2.54 5.03 4.51 2.52 4.26 4.26 2.47 OR Quartile 3 3.56 3.46 1.79 3.38 3.20 1.55 3.18 3.17 1.52 p Value 3.6E7 3.0E7 0.018 1.5E6 1.5E6 0.065 8.2E6 2.3E6 0.072 Lower limit of 95% 2.18 2.15 1.11 2.06 1.99 0.974 1.91 1.97 0.963 CI Upper limit of 95% CI 5.80 5.56 2.91 5.54 5.14 2.48 5.28 5.11 2.40 OR Quartile 4 3.80 3.85 1.54 3.76 3.66 1.46 3.54 3.72 1.49 p Value 5.5E5 1.9E5 0.11 9.9E5 3.8E5 0.15 3.2E4 4.6E5 0.13 Lower limit of 95% 1.99 2.08 0.907 1.93 1.97 0.866 1.78 1.98 0.889 CI Upper limit of 95% CI 7.26 7.15 2.63 7.33 6.79 2.47 7.07 7.00 2.49

TABLE-US-00162 TABLE 22.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 108 0.0328 91.1 0.0328 75.1 Average 80.4 297 82.5 285 78.6 276 Stdev 179 440 181 434 161 430 p (t-test) 1.5E7 1.2E6 3.5E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 894 3020 n (Patient) 134 181 125 190 114 201 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 108 0.0328 108 0.0328 108 Average 85.0 301 86.2 297 78.7 299 Stdev 187 444 188 443 167 444 p (t-test) 1.5E7 2.9E7 8.5E8 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 894 3020 n (Patient) 140 175 138 177 135 180 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 62.9 0.0422 51.0 0.0422 52.6 Average 171 283 174 267 171 261 Stdev 292 493 296 478 291 467 p (t-test) 0.013 0.035 0.036 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 215 98 206 107 193 120 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.69 0.68 0.57 0.67 0.68 0.56 0.66 0.69 0.56 SE 0.029 0.030 0.035 0.030 0.030 0.035 0.031 0.029 0.034 p Value 1.4E10 9.6E10 0.037 5.4E9 1.8E9 0.10 2.6E7 2.2E10 0.100 nCohort Recovered 134 140 215 125 138 206 114 135 193 nCohort Non- 181 175 98 190 177 107 201 180 120 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 84% 84% 81% 84% 84% 79% 82% 84% 80% Specificity 33% 32% 25% 34% 33% 24% 32% 33% 25% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 62% 63% 59% 61% 62% 57% 59% 62% 57% Specificity 66% 66% 54% 66% 65% 53% 65% 66% 54% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 35% 36% 31% 34% 36% 30% 33% 36% 30% Specificity 89% 89% 77% 89% 88% 77% 89% 89% 78% OR Quartile 2 2.56 2.49 1.36 2.60 2.57 1.24 2.20 2.71 1.32 p Value 5.9E4 9.0E4 0.31 4.7E4 5.7E4 0.46 0.0037 2.8E4 0.32 Lower limit of 95% 1.50 1.45 0.755 1.52 1.50 0.703 1.29 1.58 0.761 CI Upper limit of 95% CI 4.38 4.26 2.45 4.43 4.41 2.18 3.75 4.65 2.30 OR Quartile 3 3.29 3.24 1.70 2.92 3.08 1.52 2.63 3.19 1.53 p Value 6.3E7 6.9E7 0.032 7.6E6 2.0E6 0.081 6.9E5 1.1E6 0.070 Lower limit of 95% 2.06 2.04 1.05 1.83 1.94 0.949 1.63 2.00 0.966 CI Upper limit of 95% CI 5.25 5.16 2.76 4.68 4.89 2.43 4.23 5.08 2.42 OR Quartile 4 4.34 4.36 1.49 4.12 4.21 1.44 3.80 4.41 1.50 p Value 3.2E6 1.9E6 0.14 1.1E5 3.2E6 0.17 5.5E5 2.4E6 0.13 Lower limit of 95% 2.34 2.38 0.875 2.19 2.30 0.853 1.99 2.38 0.891 CI Upper limit of 95% CI 8.05 7.99 2.55 7.75 7.72 2.44 7.26 8.18 2.51

TABLE-US-00163 TABLE 22.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0382 110 0.0382 108 0.0382 108 Average 133 310 135 303 135 303 Stdev 248 477 250 474 250 474 p (t-test) 2.4E5 6.1E5 6.1E5 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1350 3020 1350 3020 1350 3020 n (Patient) 187 128 184 131 184 131 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 148 0.0328 116 0.0328 114 Average 86.3 326 88.0 319 88.5 317 Stdev 178 463 179 461 180 460 p (t-test) 3.7E9 1.2E8 1.8E8 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 918 3020 918 3020 918 3020 n (Patient) 159 156 156 159 155 160 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0411 108 0.0422 88.0 0.0422 105 Average 156 306 159 298 159 293 Stdev 273 501 274 497 276 491 p (t-test) 6.9E4 0.0015 0.0021 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 210 103 207 106 204 109 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.69 0.60 0.64 0.68 0.59 0.64 0.68 0.59 SE 0.032 0.030 0.035 0.032 0.030 0.035 0.032 0.030 0.034 p Value 4.6E6 8.7E11 0.0028 2.3E5 8.3E10 0.011 2.3E5 1.0E9 0.012 nCohort Recovered 187 159 210 184 156 207 184 155 204 nCohort Non- 128 156 103 131 159 106 131 160 109 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 84% 84% 83% 84% 84% 81% 84% 84% 81% Specificity 28% 30% 26% 28% 30% 25% 28% 30% 25% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 64% 65% 61% 63% 64% 59% 63% 64% 60% Specificity 59% 65% 55% 59% 64% 55% 59% 64% 55% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 34% 38% 33% 33% 37% 32% 33% 37% 32% Specificity 81% 87% 79% 80% 87% 78% 80% 87% 78% OR Quartile 2 2.14 2.27 1.63 2.06 2.21 1.44 2.06 2.24 1.40 p Value 0.0095 0.0033 0.11 0.012 0.0042 0.21 0.012 0.0035 0.25 Lower limit of 95% CI 1.20 1.31 0.901 1.17 1.28 0.808 1.17 1.30 0.788 Upper limit of 95% CI 3.79 3.91 2.96 3.64 3.79 2.57 3.64 3.86 2.47 OR Quartile 3 2.60 3.47 1.94 2.38 3.20 1.76 2.38 3.11 1.80 p Value 5.3E5 1.4E7 0.0067 2.2E4 7.6E7 0.019 2.2E4 1.3E6 0.015 Lower limit of 95% CI 1.64 2.19 1.20 1.50 2.02 1.10 1.50 1.96 1.12 Upper limit of 95% CI 4.14 5.52 3.14 3.77 5.06 2.83 3.77 4.92 2.88 OR Quartile 4 2.12 4.23 1.81 2.01 4.01 1.70 2.01 3.94 1.72 p Value 0.0043 7.0E7 0.028 0.0080 1.7E6 0.048 0.0080 2.3E6 0.042 Lower limit of 95% CI 1.27 2.39 1.07 1.20 2.27 1.01 1.20 2.23 1.02 Upper limit of 95% CI 3.56 7.47 3.06 3.36 7.09 2.87 3.36 6.96 2.90

TABLE-US-00164 TABLE 22.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 133 124 133 124 124 124 Average 240 169 258 168 247 171 Stdev 425 145 462 143 481 146 p (t-test) 0.14 0.078 0.16 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 25 126 21 130 19 132 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 112 125 118 124 106 125 Average 211 169 215 169 219 169 Stdev 399 139 406 138 422 137 p (t-test) 0.35 0.31 0.28 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 29 121 28 122 26 124 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 127 123 128 123 125 124 Average 181 183 187 175 183 180 Stdev 247 164 255 158 261 160 p (t-test) 0.96 0.73 0.91 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 91 59 84 66 77 73 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.49 0.56 0.52 0.49 0.55 0.49 0.53 0.58 0.51 SE 0.063 0.058 0.049 0.068 0.059 0.048 0.070 0.060 0.047 p Value 0.88 0.30 0.63 0.91 0.36 0.89 0.64 0.21 0.76 nCohort Recovered 25 29 91 21 28 84 19 26 77 nCohort Non-recovered 126 121 59 130 122 66 132 124 73 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 75% 76% 80% 75% 76% 76% 76% 77% 77% Specificity 24% 31% 29% 29% 32% 26% 32% 35% 27% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 49% 50% 47% 49% 50% 47% 50% 51% 49% Specificity 44% 52% 48% 43% 50% 48% 47% 54% 49% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 25% 27% 27% 25% 27% 26% 26% 27% 26% Specificity 76% 83% 76% 76% 82% 75% 79% 81% 75% OR Quartile 2 0.928 1.43 1.57 1.22 1.52 1.11 1.44 1.73 1.24 p Value 0.88 0.43 0.26 0.70 0.36 0.79 0.49 0.23 0.58 Lower limit of 95% CI 0.341 0.586 0.718 0.438 0.620 0.527 0.507 0.699 0.590 Upper limit of 95% CI 2.53 3.48 3.42 3.42 3.72 2.33 4.11 4.30 2.59 OR Quartile 3 0.761 1.09 0.846 0.727 1.00 0.805 0.900 1.20 0.948 p Value 0.54 0.84 0.62 0.50 1.0 0.51 0.83 0.67 0.87 Lower limit of 95% CI 0.321 0.484 0.439 0.287 0.440 0.422 0.344 0.516 0.500 Upper limit of 95% CI 1.81 2.45 1.63 1.84 2.27 1.54 2.36 2.81 1.80 OR Quartile 4 1.08 1.80 1.17 1.09 1.71 1.04 1.30 1.52 1.07 p Value 0.88 0.27 0.69 0.88 0.32 0.92 0.66 0.43 0.85 Lower limit of 95% CI 0.396 0.634 0.552 0.370 0.599 0.496 0.404 0.531 0.514 Upper limit of 95% CI 2.94 5.11 2.47 3.20 4.86 2.18 4.19 4.37 2.24

TABLE-US-00165 TABLE 22.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 118 125 126 124 118 125 Average 189 178 199 175 194 177 Stdev 341 151 358 150 374 151 p (t-test) 0.78 0.56 0.71 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 40 111 36 115 32 119 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 118 125 124 124 112 125 Average 193 176 195 175 198 175 Stdev 334 145 338 145 351 143 p (t-test) 0.67 0.62 0.57 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 44 107 43 108 40 111 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 125 124 126 124 124 125 Average 174 198 180 184 176 190 Stdev 237 173 244 167 250 166 p (t-test) 0.53 0.90 0.69 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 100 50 93 57 85 65 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.56 0.56 0.57 0.54 0.56 0.52 0.57 0.58 0.55 SE 0.052 0.050 0.050 0.054 0.051 0.049 0.055 0.051 0.048 p Value 0.22 0.21 0.18 0.43 0.26 0.61 0.21 0.13 0.26 nCohort Recovered 40 44 100 36 43 93 32 40 85 nCohort Non-recovered 111 107 50 115 108 57 119 111 65 Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 77% 77% 84% 77% 77% 79% 77% 77% 80% Specificity 30% 30% 30% 31% 30% 28% 34% 32% 29% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 50% 50% 50% 50% 50% 49% 50% 51% 52% Specificity 50% 50% 50% 47% 49% 49% 50% 52% 52% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 29% 29% 32% 28% 29% 28% 28% 28% 29% Specificity 85% 84% 78% 83% 84% 76% 84% 82% 78% OR Quartile 2 1.40 1.38 2.25 1.43 1.44 1.46 1.78 1.66 1.67 p Value 0.41 0.43 0.067 0.39 0.37 0.35 0.18 0.21 0.19 Lower limit of 95% CI 0.626 0.626 0.944 0.625 0.653 0.666 0.766 0.746 0.775 Upper limit of 95% CI 3.14 3.02 5.36 3.29 3.17 3.18 4.16 3.68 3.59 OR Quartile 3 1.02 1.02 1.00 0.879 0.955 0.945 1.02 1.17 1.18 p Value 0.96 0.96 1.0 0.74 0.90 0.87 0.97 0.68 0.62 Lower limit of 95% CI 0.494 0.505 0.507 0.416 0.471 0.489 0.466 0.566 0.617 Upper limit of 95% CI 2.10 2.06 1.97 1.86 1.94 1.83 2.22 2.41 2.25 OR Quartile 4 2.30 2.16 1.67 1.93 2.07 1.26 2.07 1.83 1.43 p Value 0.090 0.098 0.19 0.18 0.12 0.55 0.17 0.20 0.34 Lower limit of 95% CI 0.879 0.868 0.781 0.733 0.833 0.595 0.736 0.732 0.685 Upper limit of 95% CI 6.00 5.35 3.57 5.07 5.15 2.67 5.83 4.56 3.00

TABLE-US-00166 TABLE 22.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 118 126 118 125 114 126 Average 175 183 182 180 176 182 Stdev 306 156 319 154 336 155 p (t-test) 0.83 0.96 0.88 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 50 101 46 105 40 111 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 114 129 114 126 112 127 Average 178 182 180 181 184 179 Stdev 304 149 310 148 319 147 p (t-test) 0.91 0.99 0.90 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 54 97 52 99 49 102 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 125 123 126 123 125 124 Average 177 191 180 185 179 185 Stdev 238 173 243 168 250 166 p (t-test) 0.69 0.88 0.86 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 98 52 94 56 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.58 0.60 0.53 0.57 0.59 0.52 0.59 0.59 0.53 SE 0.048 0.047 0.050 0.050 0.048 0.049 0.051 0.048 0.048 p Value 0.085 0.038 0.50 0.16 0.048 0.68 0.062 0.049 0.51 nCohort Recovered 50 54 98 46 52 94 40 49 86 nCohort Non-recovered 101 97 52 105 99 56 111 102 64 Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 77% 78% 77% 77% 79% 77% 77% 78% 78% Specificity 30% 31% 27% 30% 33% 27% 32% 33% 28% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 52% 54% 48% 51% 53% 48% 52% 53% 50% Specificity 54% 56% 49% 52% 54% 49% 55% 55% 50% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 31% 31% 31% 30% 30% 29% 30% 29% 28% Specificity 86% 85% 78% 85% 85% 77% 88% 84% 77% OR Quartile 2 1.45 1.66 1.20 1.48 1.80 1.20 1.66 1.76 1.38 p Value 0.34 0.18 0.64 0.32 0.12 0.65 0.21 0.14 0.40 Lower limit of 95% CI 0.678 0.785 0.549 0.680 0.849 0.554 0.746 0.824 0.648 Upper limit of 95% CI 3.12 3.52 2.64 3.21 3.83 2.59 3.68 3.77 2.95 OR Quartile 3 1.30 1.44 0.889 1.16 1.29 0.892 1.34 1.38 1.00 p Value 0.45 0.28 0.73 0.68 0.46 0.74 0.43 0.36 1.0 Lower limit of 95% CI 0.657 0.740 0.454 0.577 0.659 0.460 0.647 0.697 0.524 Upper limit of 95% CI 2.56 2.82 1.74 2.31 2.53 1.73 2.76 2.74 1.91 OR Quartile 4 2.72 2.57 1.54 2.33 2.39 1.31 2.96 2.14 1.29 p Value 0.030 0.032 0.27 0.067 0.049 0.48 0.037 0.087 0.50 Lower limit of 95% CI 1.10 1.08 0.721 0.942 1.01 0.618 1.07 0.895 0.616 Upper limit of 95% CI 6.72 6.12 3.27 5.78 5.69 2.77 8.23 5.09 2.71

TABLE-US-00167 TABLE 22.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 122 125 120 125 120 126 Average 191 174 199 171 197 173 Stdev 305 137 318 134 333 137 p (t-test) 0.65 0.46 0.54 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 58 93 53 98 47 104 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 118 129 116 127 116 127 Average 185 178 186 177 189 176 Stdev 302 136 304 136 309 135 p (t-test) 0.85 0.81 0.72 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 60 91 59 92 57 94 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 126 123 126 123 126 123 Average 179 186 182 181 182 182 Stdev 241 169 246 164 250 165 p (t-test) 0.85 0.97 1.00 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 96 54 92 58 86 64 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.56 0.59 0.52 0.55 0.59 0.51 0.56 0.58 0.52 SE 0.048 0.047 0.049 0.049 0.047 0.049 0.050 0.047 0.048 p Value 0.24 0.058 0.62 0.35 0.058 0.76 0.22 0.082 0.75 nCohort Recovered 58 60 96 53 59 92 47 57 86 nCohort Non-recovered 93 91 54 98 92 58 104 94 64 Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 76% 78% 78% 77% 78% 78% 77% 78% 78% Specificity 28% 30% 27% 28% 31% 27% 30% 30% 28% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 52% 54% 48% 51% 53% 48% 52% 53% 48% Specificity 52% 55% 49% 51% 54% 49% 53% 54% 49% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 30% 31% 30% 29% 30% 28% 29% 30% 27% Specificity 83% 83% 77% 81% 83% 76% 83% 82% 76% OR Quartile 2 1.23 1.52 1.30 1.29 1.58 1.29 1.41 1.48 1.38 p Value 0.59 0.27 0.51 0.51 0.23 0.51 0.38 0.31 0.40 Lower limit of 95% CI 0.582 0.724 0.594 0.603 0.752 0.598 0.652 0.700 0.648 Upper limit of 95% CI 2.60 3.20 2.85 2.75 3.32 2.79 3.07 3.12 2.95 OR Quartile 3 1.14 1.43 0.891 1.08 1.35 0.894 1.23 1.35 0.897 p Value 0.69 0.29 0.73 0.82 0.37 0.74 0.56 0.37 0.74 Lower limit of 95% CI 0.593 0.741 0.457 0.554 0.701 0.463 0.616 0.700 0.469 Upper limit of 95% CI 2.20 2.74 1.74 2.11 2.60 1.72 2.45 2.62 1.71 OR Quartile 4 2.07 2.22 1.42 1.72 2.14 1.21 1.98 1.99 1.12 p Value 0.080 0.054 0.37 0.19 0.066 0.61 0.13 0.096 0.77 Lower limit of 95% CI 0.917 0.987 0.667 0.761 0.952 0.573 0.827 0.884 0.533 Upper limit of 95% CI 4.66 5.00 3.01 3.89 4.83 2.56 4.72 4.50 2.35

TABLE-US-00168 TABLE 22.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 126 123 125 124 125 124 Average 160 204 160 204 160 204 Stdev 134 283 135 281 135 281 p (t-test) 0.21 0.22 0.22 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 844 2200 844 2200 844 2200 n (Patient) 81 70 80 71 80 71 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 116 129 112 129 112 129 Average 150 205 151 203 151 203 Stdev 141 260 144 257 144 257 p (t-test) 0.13 0.14 0.14 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 844 2200 844 2200 844 2200 n (Patient) 67 84 65 86 65 86 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 123 129 123 129 124 125 Average 156 226 157 223 158 219 Stdev 122 318 123 313 125 308 p (t-test) 0.057 0.070 0.092 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 844 2200 844 2200 844 2200 n (Patient) 95 55 93 57 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.53 0.61 0.57 0.54 0.61 0.57 0.54 0.61 0.56 SE 0.047 0.046 0.049 0.047 0.046 0.049 0.047 0.046 0.048 p Value 0.49 0.018 0.16 0.45 0.015 0.16 0.45 0.015 0.23 nCohort Recovered 81 67 95 80 65 93 80 65 91 nCohort Non-recovered 70 84 55 71 86 57 71 86 59 Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 76% 80% 78% 76% 80% 79% 76% 80% 80% Specificity 26% 31% 27% 26% 32% 28% 26% 32% 29% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 49% 55% 55% 49% 55% 54% 49% 55% 53% Specificity 48% 55% 53% 49% 55% 53% 49% 55% 52% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 29% 31% 33% 28% 30% 32% 28% 30% 31% Specificity 78% 82% 79% 78% 82% 78% 78% 82% 78% OR Quartile 2 1.09 1.80 1.35 1.13 1.94 1.46 1.13 1.94 1.57 p Value 0.82 0.12 0.45 0.74 0.081 0.35 0.74 0.081 0.26 Lower limit of 95% CI 0.521 0.857 0.617 0.540 0.922 0.666 0.540 0.922 0.718 Upper limit of 95% CI 2.28 3.78 2.95 2.37 4.07 3.18 2.37 4.07 3.42 OR Quartile 3 0.877 1.49 1.33 0.925 1.50 1.33 0.925 1.50 1.18 p Value 0.69 0.22 0.40 0.81 0.22 0.40 0.81 0.22 0.62 Lower limit of 95% CI 0.462 0.783 0.685 0.488 0.783 0.685 0.488 0.783 0.614 Upper limit of 95% CI 1.66 2.85 2.60 1.75 2.86 2.57 1.75 2.86 2.28 OR Quartile 4 1.40 2.05 1.82 1.35 1.91 1.68 1.35 1.91 1.56 p Value 0.37 0.069 0.12 0.42 0.10 0.17 0.42 0.10 0.24 Lower limit of 95% CI 0.670 0.945 0.863 0.647 0.880 0.799 0.647 0.880 0.741 Upper limit of 95% CI 2.93 4.47 3.86 2.82 4.16 3.55 2.82 4.16 3.28

Example 23. Use of Pro-Interleukin-16 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0192] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Pro-interleukin-16 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0193] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0194] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00169 TABLE 23.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0291 99.3 0.0291 83.2 0.0291 77.7 Average 61.8 278 64.2 273 63.3 271 Stdev 142 425 145 422 145 420 p (t-test) 5.2E7 1.7E6 2.5E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 862 3020 862 3020 862 3020 n (Patient) 107 208 103 212 100 215 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0318 108 0.0318 107 0.0305 106 Average 73.8 289 75.0 286 75.6 285 Stdev 171 434 172 433 173 432 p (t-test) 2.5E7 4.7E7 6.4E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 894 3020 894 3020 894 3020 n (Patient) 125 189 123 191 122 192 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 77.0 0.0422 41.2 0.0422 45.5 Average 179 269 169 277 172 264 Stdev 329 449 290 484 295 467 p (t-test) 0.051 0.014 0.034 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 2390 3020 1370 3020 1370 3020 n (Patient) 221 92 207 106 197 116 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.71 0.57 0.70 0.70 0.56 0.70 0.70 0.56 SE 0.029 0.029 0.036 0.030 0.029 0.035 0.030 0.029 0.034 p Value 4.1E13 6.6E13 0.042 5.0E12 1.5E12 0.067 6.3E12 1.6E12 0.066 nCohort Recovered 107 125 221 103 123 207 100 122 197 nCohort Non-recovered 208 189 92 212 191 106 215 192 116 Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 84% 85% 82% 84% 85% 82% 84% 85% 83% Specificity 37% 35% 25% 38% 36% 26% 38% 36% 26% Cutoff Quartile 3 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Sensitivity 62% 65% 58% 61% 64% 55% 60% 64% 55% Specificity 73% 72% 53% 72% 72% 52% 72% 71% 53% Cutoff Quartile 4 283 280 284 283 280 284 283 280 284 Sensitivity 33% 34% 32% 32% 34% 31% 32% 34% 30% Specificity 90% 89% 77% 89% 89% 78% 90% 89% 78% OR Quartile 2 3.17 3.00 1.46 3.19 3.11 1.58 3.15 3.17 1.72 p Value 2.9E5 6.7E5 0.22 2.7E5 3.9E5 0.13 3.3E5 2.9E5 0.065 Lower limit of 95% CI 1.84 1.75 0.795 1.86 1.81 0.877 1.83 1.85 0.967 Upper limit of 95% CI 5.43 5.14 2.69 5.48 5.34 2.83 5.42 5.45 3.06 OR Quartile 3 4.39 4.68 1.53 3.97 4.45 1.32 3.93 4.33 1.38 p Value 1.3E8 7.3E10 0.090 1.2E7 2.5E9 0.25 1.9E7 4.6E9 0.17 Lower limit of 95% CI 2.64 2.87 0.936 2.38 2.72 0.824 2.35 2.65 0.868 Upper limit of 95% CI 7.31 7.65 2.50 6.61 7.26 2.11 6.58 7.07 2.18 OR Quartile 4 4.24 4.16 1.57 3.95 4.02 1.58 4.25 3.95 1.50 p Value 3.9E5 9.9E6 0.10 9.2E5 1.6E5 0.087 7.0E5 2.0E5 0.12 Lower limit of 95% CI 2.13 2.21 0.916 1.98 2.14 0.935 2.08 2.10 0.894 Upper limit of 95% CI 8.43 7.82 2.70 7.86 7.56 2.68 8.68 7.43 2.53

TABLE-US-00170 TABLE 23.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0318 106 0.0328 99.3 0.0328 91.1 Average 91.1 290 92.5 287 93.1 282 Stdev 189 442 190 440 192 437 p (t-test) 1.5E6 2.8E6 5.8E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1120 3020 n (Patient) 135 180 133 182 129 186 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 108 0.0328 108 0.0328 108 Average 97.8 300 98.5 298 99.1 296 Stdev 203 449 204 449 204 448 p (t-test) 8.4E7 1.2E6 1.6E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1120 3020 n (Patient) 148 167 147 168 146 169 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 111 0.0422 106 0.0422 54.2 Average 170 298 169 292 172 271 Stdev 296 504 289 503 295 478 p (t-test) 0.0057 0.0065 0.025 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 225 88 219 94 206 107 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.68 0.68 0.60 0.67 0.68 0.58 0.67 0.68 0.57 SE 0.030 0.030 0.037 0.030 0.030 0.036 0.030 0.030 0.035 p Value 1.5E9 1.9E9 0.0080 5.5E9 2.8E9 0.022 9.9E9 3.1E9 0.034 nCohort Recovered 135 148 225 133 147 219 129 146 206 nCohort Non- 180 167 88 182 168 94 186 169 107 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 84% 84% 84% 84% 85% 84% 84% 85% 84% Specificity 33% 32% 26% 33% 32% 26% 33% 32% 27% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 63% 65% 61% 62% 64% 59% 61% 64% 57% Specificity 67% 66% 54% 66% 66% 53% 66% 66% 53% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 33% 35% 33% 33% 35% 32% 33% 34% 31% Specificity 86% 86% 78% 86% 86% 78% 86% 86% 78% OR Quartile 2 2.71 2.52 1.84 2.61 2.57 1.85 2.60 2.61 1.93 p Value 2.8E4 8.3E4 0.065 4.6E4 6.7E4 0.055 4.7E4 5.4E4 0.033 Lower limit of 95% CI 1.58 1.47 0.964 1.52 1.49 0.988 1.52 1.52 1.05 Upper limit of 95% CI 4.65 4.34 3.50 4.46 4.42 3.48 4.44 4.50 3.53 OR Quartile 3 3.37 3.59 1.88 3.20 3.49 1.62 3.06 3.40 1.52 p Value 3.6E7 7.5E8 0.014 1.1E6 1.3E7 0.054 2.9E6 2.4E7 0.081 Lower limit of 95% CI 2.11 2.25 1.14 2.01 2.19 0.992 1.91 2.14 0.949 Upper limit of 95% CI 5.39 5.71 3.11 5.11 5.56 2.64 4.89 5.41 2.43 OR Quartile 4 3.05 3.22 1.72 2.95 3.16 1.63 3.01 3.11 1.55 p Value 1.4E4 4.4E5 0.051 2.3E4 5.7E5 0.076 2.2E4 7.3E5 0.10 Lower limit of 95% CI 1.72 1.84 0.998 1.66 1.81 0.950 1.68 1.78 0.917 Upper limit of 95% CI 5.43 5.64 2.97 5.25 5.54 2.78 5.40 5.45 2.62

TABLE-US-00171 TABLE 23.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 113 0.0328 111 0.0328 108 Average 93.3 310 94.6 306 97.1 299 Stdev 193 455 194 454 196 451 p (t-test) 1.1E7 2.2E7 8.5E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1120 3020 n (Patient) 153 162 151 164 147 168 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 112 0.0328 111 0.0328 109 Average 102 311 103 309 103 307 Stdev 208 459 208 458 209 457 p (t-test) 3.1E7 4.3E7 6.1E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1120 3020 n (Patient) 160 155 159 156 158 157 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0401 115 0.0401 113 0.0422 88.0 Average 161 317 162 314 166 289 Stdev 284 511 285 509 289 489 p (t-test) 7.0E4 8.9E4 0.0056 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 223 90 222 91 211 102 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.69 0.68 0.62 0.68 0.68 0.62 0.67 0.67 0.59 SE 0.030 0.030 0.036 0.030 0.030 0.036 0.030 0.030 0.035 p Value 1.0E10 4.2E9 6.6E4 6.2E10 6.1E9 6.4E4 1.2E8 7.0E9 0.0094 nCohort Recovered 153 160 223 151 159 222 147 158 211 nCohort Non- 162 155 90 164 156 91 168 157 102 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 86% 85% 84% 85% 85% 85% 85% 85% 82% Specificity 33% 31% 26% 32% 31% 26% 32% 32% 26% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 64% 65% 64% 63% 64% 65% 62% 64% 60% Specificity 65% 64% 56% 64% 64% 56% 63% 63% 55% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 36% 36% 34% 35% 36% 34% 35% 36% 32% Specificity 86% 86% 78% 86% 86% 78% 86% 85% 78% OR Quartile 2 2.93 2.61 1.91 2.80 2.65 1.95 2.57 2.70 1.61 p Value 1.5E4 7.1E4 0.049 2.5E4 5.7E4 0.043 6.7E4 4.6E4 0.12 Lower limit of 95% CI 1.68 1.50 1.00 1.62 1.52 1.02 1.49 1.55 0.885 Upper limit of 95% CI 5.11 4.54 3.63 4.86 4.62 3.70 4.42 4.70 2.91 OR Quartile 3 3.29 3.20 2.27 3.11 3.11 2.33 2.80 3.02 1.78 p Value 4.4E7 7.6E7 0.0015 1.3E6 1.3E6 0.0010 1.0E5 2.3E6 0.018 Lower limit of 95% CI 2.07 2.02 1.37 1.97 1.96 1.41 1.77 1.91 1.10 Upper limit of 95% CI 5.22 5.07 3.77 4.93 4.92 3.87 4.42 4.79 2.88 OR Quartile 4 3.51 3.37 1.92 3.39 3.31 1.87 3.16 3.25 1.72 p Value 1.2E5 1.5E5 0.018 2.0E5 2.0E5 0.022 5.7E5 2.6E5 0.045 Lower limit of 95% CI 2.00 1.94 1.12 1.93 1.91 1.09 1.81 1.88 1.01 Upper limit of 95% CI 6.15 5.84 3.29 5.94 5.74 3.21 5.54 5.64 2.91

TABLE-US-00172 TABLE 23.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 166 0.0328 159 0.0328 116 Average 97.3 326 99.1 320 102 311 Stdev 203 465 205 463 207 459 p (t-test) 2.0E8 6.4E8 2.8E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1120 3020 n (Patient) 167 148 164 151 160 155 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 168 0.0328 166 0.0328 166 Average 102 327 102 325 103 323 Stdev 209 468 209 468 210 467 p (t-test) 3.4E8 5.0E8 7.4E8 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1120 3020 n (Patient) 171 144 170 145 169 146 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0411 108 0.0422 106 0.0422 62.9 Average 166 303 167 299 169 285 Stdev 289 506 289 505 292 490 p (t-test) 0.0029 0.0037 0.0096 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 222 91 221 92 213 100 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.69 0.60 0.69 0.69 0.60 0.67 0.68 0.58 SE 0.030 0.030 0.036 0.030 0.030 0.036 0.030 0.030 0.035 p Value 3.6E11 5.8E10 0.0043 3.3E10 8.9E10 0.0052 7.3E9 1.0E9 0.025 nCohort Recovered 167 171 222 164 170 221 160 169 213 nCohort Non- 148 144 91 151 145 92 155 146 100 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 86% 85% 84% 85% 86% 84% 85% 86% 81% Specificity 31% 30% 26% 31% 31% 26% 31% 31% 25% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 67% 67% 63% 66% 66% 62% 64% 66% 59% Specificity 65% 64% 55% 64% 64% 55% 63% 63% 54% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 38% 38% 33% 37% 38% 33% 36% 38% 32% Specificity 86% 86% 78% 86% 86% 78% 86% 86% 78% OR Quartile 2 2.73 2.56 1.75 2.65 2.60 1.78 2.41 2.65 1.41 p Value 5.0E4 0.0011 0.082 6.6E4 9.3E4 0.072 0.0017 7.5E4 0.25 Lower limit of 95% CI 1.55 1.45 0.932 1.51 1.48 0.950 1.39 1.50 0.784 Upper limit of 95% CI 4.82 4.51 3.29 4.63 4.58 3.35 4.18 4.66 2.54 OR Quartile 3 3.70 3.52 2.05 3.39 3.41 1.97 3.03 3.31 1.69 p Value 4.0E8 1.2E7 0.0051 2.4E7 2.3E7 0.0075 2.2E6 4.0E7 0.033 Lower limit of 95% CI 2.32 2.21 1.24 2.13 2.14 1.20 1.91 2.08 1.04 Upper limit of 95% CI 5.90 5.60 3.37 5.38 5.43 3.24 4.79 5.27 2.73 OR Quartile 4 3.81 3.79 1.74 3.61 3.72 1.70 3.37 3.65 1.66 p Value 2.0E6 1.8E6 0.045 4.8E6 2.5E6 0.054 1.5E5 3.4E6 0.060 Lower limit of 95% CI 2.20 2.19 1.01 2.08 2.15 0.991 1.94 2.11 0.978 Upper limit of 95% CI 6.61 6.54 2.98 6.27 6.42 2.91 5.84 6.31 2.83

TABLE-US-00173 TABLE 23.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0382 116 0.0382 112 0.0382 110 Average 137 325 139 319 140 317 Stdev 252 495 253 493 253 491 p (t-test) 1.2E5 2.3E5 3.3E5 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1350 3020 1350 3020 1350 3020 n (Patient) 202 113 200 115 199 116 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 166 0.0328 166 0.0328 166 Average 112 336 112 336 112 336 Stdev 215 484 215 484 215 484 p (t-test) 5.8E8 5.8E8 5.8E8 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 947 3020 947 3020 947 3020 n (Patient) 184 131 184 131 184 131 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0401 116 0.0401 112 0.0401 108 Average 153 324 153 321 155 314 Stdev 270 511 270 510 271 506 p (t-test) 1.3E4 1.8E4 3.4E4 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 1370 3020 n (Patient) 216 97 215 98 213 100 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.67 0.63 0.64 0.67 0.62 0.63 0.67 0.61 SE 0.033 0.031 0.035 0.033 0.031 0.035 0.033 0.031 0.035 p Value 5.7E6 2.5E8 3.1E4 1.8E5 2.5E8 3.8E4 4.9E5 2.5E8 0.0017 nCohort Recovered 202 184 216 200 184 215 199 184 213 nCohort Non- 113 131 97 115 131 98 116 131 100 recovered Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 85% 85% 85% 84% 85% 85% 84% 85% 83% Specificity 28% 29% 26% 28% 29% 27% 27% 29% 26% Cutoff Quartile 3 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 8.03 Sensitivity 65% 66% 64% 64% 66% 63% 64% 66% 62% Specificity 58% 61% 56% 58% 61% 56% 58% 61% 55% Cutoff Quartile 4 283 283 284 283 283 284 283 283 284 Sensitivity 35% 39% 35% 35% 39% 35% 34% 39% 34% Specificity 81% 85% 79% 80% 85% 79% 80% 85% 79% OR Quartile 2 2.17 2.25 1.96 2.04 2.25 2.00 1.90 2.25 1.70 p Value 0.012 0.0057 0.036 0.018 0.0057 0.031 0.031 0.0057 0.086 Lower limit of 95% CI 1.19 1.27 1.05 1.13 1.27 1.07 1.06 1.27 0.928 Upper limit of 95% CI 3.95 3.98 3.67 3.69 3.98 3.74 3.40 3.98 3.11 OR Quartile 3 2.67 3.15 2.26 2.49 3.15 2.18 2.41 3.15 2.03 p Value 5.9E5 1.6E6 0.0012 1.6E4 1.6E6 0.0019 2.5E4 1.6E6 0.0044 Lower limit of 95% CI 1.65 1.97 1.38 1.55 1.97 1.33 1.50 1.97 1.25 Upper limit of 95% CI 4.30 5.03 3.70 4.00 5.03 3.55 3.87 5.03 3.29 OR Quartile 4 2.29 3.55 2.05 2.20 3.55 2.01 2.16 3.55 1.92 p Value 0.0018 3.3E6 0.0080 0.0029 3.3E6 0.010 0.0036 3.3E6 0.015 Lower limit of 95% CI 1.36 2.08 1.21 1.31 2.08 1.18 1.29 2.08 1.13 Upper limit of 95% CI 3.85 6.06 3.49 3.70 6.06 3.41 3.63 6.06 3.26

TABLE-US-00174 TABLE 23.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 112 129 111 129 111 129 Average 178 182 178 182 182 180 Stdev 310 155 313 155 319 154 p (t-test) 0.91 0.92 0.97 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 49 102 48 103 46 105 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 111 129 111 129 112 129 Average 182 175 182 175 183 174 Stdev 310 140 310 140 313 140 p (t-test) 0.87 0.87 0.81 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 52 98 52 98 51 99 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 125 123 125 124 125 124 Average 182 180 176 191 180 184 Stdev 243 145 240 170 247 164 p (t-test) 0.94 0.69 0.93 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 675 2200 902 2200 902 n (Patient) 104 46 97 53 91 59 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.60 0.53 0.60 0.60 0.55 0.58 0.59 0.53 SE 0.048 0.048 0.052 0.048 0.048 0.050 0.049 0.048 0.049 p Value 0.065 0.044 0.58 0.048 0.044 0.35 0.087 0.068 0.54 nCohort Recovered 49 52 104 48 52 97 46 51 91 nCohort Non-recovered 102 98 46 103 98 53 105 99 59 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 77% 79% 78% 78% 79% 79% 77% 78% 78% Specificity 31% 33% 27% 31% 33% 28% 30% 31% 27% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 54% 54% 48% 54% 54% 49% 53% 54% 49% Specificity 57% 58% 49% 58% 58% 49% 57% 57% 49% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 28% 29% 30% 28% 29% 30% 28% 28% 27% Specificity 82% 81% 77% 81% 81% 77% 80% 80% 76% OR Quartile 2 1.52 1.78 1.33 1.58 1.78 1.47 1.48 1.60 1.34 p Value 0.29 0.13 0.50 0.24 0.13 0.34 0.32 0.22 0.46 Lower limit of 95% CI 0.705 0.838 0.582 0.735 0.838 0.663 0.680 0.750 0.621 Upper limit of 95% CI 3.26 3.79 3.02 3.40 3.79 3.27 3.21 3.41 2.89 OR Quartile 3 1.56 1.61 0.882 1.67 1.61 0.943 1.49 1.52 0.946 p Value 0.20 0.17 0.72 0.15 0.17 0.86 0.27 0.23 0.87 Lower limit of 95% CI 0.785 0.815 0.440 0.835 0.815 0.483 0.739 0.769 0.491 Upper limit of 95% CI 3.10 3.17 1.77 3.33 3.17 1.84 2.99 3.00 1.82 OR Quartile 4 1.77 1.68 1.46 1.70 1.68 1.47 1.57 1.62 1.17 p Value 0.19 0.21 0.34 0.22 0.21 0.31 0.30 0.25 0.69 Lower limit of 95% CI 0.761 0.742 0.671 0.731 0.742 0.693 0.674 0.714 0.552 Upper limit of 95% CI 4.10 3.80 3.17 3.94 3.80 3.14 3.65 3.66 2.47

TABLE-US-00175 TABLE 23.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 112 129 112 129 114 129 Average 162 194 162 194 164 192 Stdev 273 164 273 164 277 163 p (t-test) 0.37 0.37 0.44 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 64 87 64 87 62 89 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 112 129 112 129 114 129 Average 167 192 167 192 168 191 Stdev 275 157 275 157 277 156 p (t-test) 0.48 0.48 0.52 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 67 84 67 84 66 85 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 124 129 124 125 124 125 Average 171 207 172 202 176 191 Stdev 231 180 233 178 242 167 p (t-test) 0.35 0.45 0.68 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 105 45 103 47 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.63 0.63 0.59 0.63 0.63 0.57 0.61 0.62 0.56 SE 0.045 0.045 0.052 0.045 0.045 0.051 0.046 0.045 0.049 p Value 0.0056 0.0051 0.076 0.0056 0.0051 0.17 0.012 0.0090 0.24 nCohort Recovered 64 67 105 64 67 103 62 66 95 nCohort Non- 87 84 45 87 84 47 89 85 55 recovered Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 82% 82% 84% 82% 82% 83% 81% 81% 82% Specificity 34% 34% 30% 34% 34% 29% 34% 33% 29% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 56% 56% 53% 56% 56% 51% 55% 55% 51% Specificity 58% 57% 51% 58% 57% 50% 56% 56% 51% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 32% 32% 36% 32% 32% 34% 31% 32% 31% Specificity 84% 84% 79% 84% 84% 79% 84% 83% 78% OR Quartile 2 2.32 2.40 2.27 2.32 2.40 2.00 2.17 2.16 1.88 p Value 0.027 0.022 0.076 0.027 0.022 0.12 0.042 0.044 0.13 Lower limit of 95% CI 1.10 1.13 0.917 1.10 1.13 0.838 1.03 1.02 0.833 Upper limit of 95% CI 4.91 5.10 5.64 4.91 5.10 4.79 4.57 4.55 4.25 OR Quartile 3 1.77 1.66 1.21 1.77 1.66 1.06 1.59 1.58 1.06 p Value 0.087 0.12 0.59 0.087 0.12 0.86 0.17 0.17 0.87 Lower limit of 95% CI 0.920 0.871 0.601 0.920 0.871 0.534 0.826 0.826 0.545 Upper limit of 95% CI 3.39 3.18 2.44 3.39 3.18 2.12 3.05 3.01 2.06 OR Quartile 4 2.56 2.41 2.08 2.56 2.41 1.90 2.39 2.33 1.58 p Value 0.023 0.029 0.062 0.023 0.029 0.10 0.036 0.037 0.23 Lower limit of 95% CI 1.14 1.09 0.963 1.14 1.09 0.884 1.06 1.05 0.745 Upper limit of 95% CI 5.77 5.32 4.50 5.77 5.32 4.09 5.37 5.14 3.34

TABLE-US-00176 TABLE 23.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 120 129 118 129 118 129 Average 175 186 176 185 177 184 Stdev 275 145 277 144 280 142 p (t-test) 0.76 0.80 0.86 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 73 78 72 79 70 81 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 118 130 118 130 118 130 Average 172 189 172 189 172 189 Stdev 274 144 274 144 274 144 p (t-test) 0.65 0.65 0.65 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 74 77 74 77 74 77 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 125 124 125 124 125 124 Average 180 186 179 188 182 182 Stdev 236 167 238 165 246 155 p (t-test) 0.87 0.81 0.99 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 105 45 103 47 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.60 0.62 0.53 0.60 0.62 0.54 0.60 0.62 0.54 SE 0.046 0.045 0.052 0.046 0.045 0.051 0.046 0.045 0.049 p Value 0.022 0.0070 0.57 0.024 0.0070 0.49 0.024 0.0070 0.39 nCohort Recovered 73 74 105 72 74 103 70 74 96 nCohort Non- 78 77 45 79 77 47 81 77 54 recovered Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 81% 82% 76% 81% 82% 77% 81% 82% 80% Specificity 32% 32% 26% 32% 32% 26% 33% 32% 28% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 56% 57% 49% 56% 57% 49% 56% 57% 50% Specificity 56% 57% 50% 56% 57% 50% 56% 57% 50% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 32% 32% 31% 32% 32% 32% 31% 32% 30% Specificity 82% 82% 77% 82% 82% 78% 81% 82% 77% OR Quartile 2 1.93 2.16 1.07 2.00 2.16 1.16 2.15 2.16 1.53 p Value 0.085 0.046 0.87 0.069 0.046 0.71 0.045 0.046 0.30 Lower limit of 95% CI 0.914 1.01 0.477 0.947 1.01 0.520 1.02 1.01 0.689 Upper limit of 95% CI 4.09 4.60 2.40 4.24 4.60 2.60 4.56 4.60 3.40 OR Quartile 3 1.66 1.75 0.938 1.57 1.75 0.940 1.57 1.75 1.00 p Value 0.12 0.089 0.86 0.17 0.089 0.86 0.17 0.089 1.0 Lower limit of 95% CI 0.871 0.919 0.467 0.826 0.919 0.471 0.826 0.919 0.513 Upper limit of 95% CI 3.16 3.33 1.89 2.99 3.33 1.87 2.99 3.33 1.95 OR Quartile 4 2.18 2.26 1.52 2.10 2.26 1.63 1.96 2.26 1.42 p Value 0.046 0.037 0.29 0.057 0.037 0.21 0.085 0.037 0.37 Lower limit of 95% CI 1.01 1.05 0.700 0.978 1.05 0.756 0.911 1.05 0.667 Upper limit of 95% CI 4.68 4.85 3.32 4.52 4.85 3.52 4.21 4.85 3.01

TABLE-US-00177 TABLE 23.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 120 129 120 129 120 129 Average 177 185 178 184 179 182 Stdev 270 146 272 145 276 143 p (t-test) 0.83 0.86 0.93 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 76 75 75 76 73 78 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 116 129 116 129 116 129 Average 174 188 174 188 174 188 Stdev 269 145 269 145 269 145 p (t-test) 0.70 0.70 0.70 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 77 74 77 74 77 74 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 125 124 125 124 126 124 Average 182 181 182 181 184 177 Stdev 242 159 242 159 248 153 p (t-test) 0.99 0.99 0.83 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 100 50 100 50 95 55 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.59 0.62 0.53 0.59 0.62 0.53 0.59 0.62 0.53 SE 0.046 0.046 0.050 0.046 0.046 0.050 0.046 0.046 0.049 p Value 0.040 0.011 0.56 0.043 0.011 0.56 0.044 0.011 0.58 nCohort Recovered 76 77 100 75 77 100 73 77 95 nCohort Non-recovered 75 74 50 76 74 50 78 74 55 Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 81% 82% 78% 82% 82% 78% 82% 82% 80% Specificity 32% 32% 27% 32% 32% 27% 33% 32% 28% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 56% 58% 50% 55% 58% 50% 55% 58% 49% Specificity 55% 57% 50% 55% 57% 50% 55% 57% 49% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 31% 31% 30% 30% 31% 30% 29% 31% 27% Specificity 80% 81% 77% 80% 81% 77% 79% 81% 76% OR Quartile 2 2.01 2.26 1.31 2.08 2.26 1.31 2.24 2.26 1.59 p Value 0.070 0.037 0.51 0.057 0.037 0.51 0.037 0.037 0.26 Lower limit of 95% CI 0.944 1.05 0.588 0.978 1.05 0.588 1.05 1.05 0.716 Upper limit of 95% CI 4.28 4.85 2.92 4.44 4.85 2.92 4.77 4.85 3.52 OR Quartile 3 1.57 1.85 1.00 1.49 1.85 1.00 1.49 1.85 0.944 p Value 0.17 0.062 1.0 0.22 0.062 1.0 0.22 0.062 0.87 Lower limit of 95% CI 0.827 0.970 0.507 0.785 0.970 0.507 0.784 0.970 0.486 Upper limit of 95% CI 2.99 3.53 1.97 2.83 3.53 1.97 2.83 3.53 1.83 OR Quartile 4 1.80 1.86 1.43 1.74 1.86 1.43 1.62 1.86 1.17 p Value 0.12 0.10 0.35 0.15 0.10 0.35 0.21 0.10 0.68 Lower limit of 95% CI 0.851 0.882 0.669 0.822 0.882 0.669 0.765 0.882 0.551 Upper limit of 95% CI 3.80 3.94 3.08 3.67 3.94 3.08 3.42 3.94 2.50

TABLE-US-00178 TABLE 23.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 120 129 121 129 120 129 Average 155 218 155 217 155 215 Stdev 129 298 130 296 131 294 p (t-test) 0.076 0.085 0.091 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 844 2200 844 2200 844 2200 n (Patient) 89 62 88 63 87 64 sCr only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 120 129 120 129 120 129 Average 151 213 151 213 151 213 Stdev 134 278 134 278 134 278 p (t-test) 0.079 0.079 0.079 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 844 2200 844 2200 844 2200 n (Patient) 79 72 79 72 79 72 UO only Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort Median 123 127 123 127 123 127 Average 162 219 162 219 162 216 Stdev 132 320 132 320 133 314 p (t-test) 0.12 0.12 0.15 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 844 2200 844 2200 844 2200 n (Patient) 98 52 98 52 96 54 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.58 0.61 0.56 0.58 0.61 0.56 0.58 0.61 0.56 SE 0.048 0.046 0.050 0.048 0.046 0.050 0.047 0.046 0.049 p Value 0.099 0.021 0.27 0.11 0.021 0.27 0.094 0.021 0.26 nCohort Recovered 89 79 98 88 79 98 87 79 96 nCohort Non-recovered 62 72 52 63 72 52 64 72 54 Cutoff Quartile 2 94.3 94.3 97.2 94.3 94.3 97.2 94.3 94.3 97.2 Sensitivity 77% 82% 79% 78% 82% 79% 78% 82% 80% Specificity 27% 32% 28% 27% 32% 28% 28% 32% 28% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 55% 57% 54% 54% 57% 54% 55% 57% 54% Specificity 53% 56% 52% 52% 56% 52% 53% 56% 52% Cutoff Quartile 4 200 200 201 200 200 201 200 200 201 Sensitivity 32% 31% 31% 32% 31% 31% 31% 31% 30% Specificity 80% 80% 78% 80% 80% 78% 79% 80% 77% OR Quartile 2 1.27 2.10 1.42 1.31 2.10 1.42 1.36 2.10 1.53 p Value 0.54 0.057 0.39 0.48 0.057 0.39 0.43 0.057 0.30 Lower limit of 95% CI 0.594 0.978 0.637 0.616 0.978 0.637 0.639 0.978 0.689 Upper limit of 95% CI 2.70 4.52 3.15 2.80 4.52 3.15 2.90 4.52 3.40 OR Quartile 3 1.36 1.66 1.27 1.28 1.66 1.27 1.35 1.66 1.26 p Value 0.36 0.12 0.49 0.45 0.12 0.49 0.36 0.12 0.50 Lower limit of 95% CI 0.709 0.873 0.645 0.671 0.873 0.645 0.709 0.873 0.646 Upper limit of 95% CI 2.60 3.17 2.48 2.46 3.17 2.48 2.59 3.17 2.46 OR Quartile 4 1.88 1.73 1.54 1.81 1.73 1.54 1.74 1.73 1.42 p Value 0.096 0.15 0.27 0.12 0.15 0.27 0.14 0.15 0.37 Lower limit of 95% CI 0.894 0.824 0.721 0.862 0.824 0.721 0.831 0.824 0.667 Upper limit of 95% CI 3.95 3.64 3.27 3.80 3.64 3.27 3.65 3.64 3.01

Example 24. Use of Pro-Interleukin-16 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0195] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Pro-interleukin-16 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0196] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0197] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00179 TABLE 24.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0382 167 0.0382 177 0.0392 170 Average 145 313 146 340 161 332 Stdev 292 460 288 483 309 485 p (t-test) 9.3E5 1.3E5 2.9E4 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 2390 3020 2390 3020 2390 3020 n (Patient) 203 112 219 96 234 81 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0382 169 0.0382 183 0.0382 170 Average 144 317 145 342 157 338 Stdev 291 465 287 489 298 501 p (t-test) 6.1E5 1.3E5 1.2E4 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 2390 3020 2390 3020 2390 3020 n (Patient) 206 108 221 93 233 81 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 38.7 0.0422 108 0.0422 118 Average 199 255 196 276 196 284 Stdev 370 370 369 378 368 380 p (t-test) 0.37 0.22 0.18 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 3020 1390 3020 1390 3020 1390 n (Patient) 273 40 276 37 277 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.66 0.57 0.67 0.66 0.60 0.65 0.65 0.60 SE 0.033 0.033 0.050 0.034 0.035 0.052 0.037 0.037 0.052 p Value 9.8E7 1.2E6 0.15 1.4E6 3.4E6 0.066 8.1E5 7.5E5 0.049 nCohort Non- 203 206 273 219 221 276 234 233 277 persistent nCohort Persistent 112 108 40 96 93 37 81 81 36 Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 87% 86% 85% 86% 86% 86% 86% 86% 86% Specificity 29% 28% 24% 27% 27% 24% 26% 27% 24% Cutoff Quartile 3 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Sensitivity 67% 68% 60% 69% 68% 65% 68% 68% 67% Specificity 59% 59% 51% 58% 57% 52% 56% 56% 52% Cutoff Quartile 4 283 280 284 283 280 284 283 280 284 Sensitivity 35% 36% 32% 39% 38% 35% 38% 37% 36% Specificity 80% 81% 76% 81% 80% 76% 79% 79% 76% OR Quartile 2 2.59 2.43 1.81 2.41 2.29 2.05 2.29 2.31 1.98 p Value 0.0028 0.0053 0.20 0.0086 0.013 0.15 0.020 0.019 0.17 Lower limit of 95% CI 1.39 1.30 0.726 1.25 1.19 0.769 1.14 1.15 0.740 Upper limit of 95% CI 4.82 4.54 4.49 4.64 4.42 5.48 4.61 4.64 5.29 OR Quartile 3 2.93 3.03 1.58 3.04 2.84 1.98 2.69 2.72 2.17 p Value 1.3E5 9.1E6 0.19 1.8E5 6.1E5 0.060 2.7E4 2.4E4 0.039 Lower limit of 95% CI 1.81 1.86 0.803 1.83 1.70 0.971 1.58 1.59 1.04 Upper limit of 95% CI 4.75 4.94 3.10 5.05 4.73 4.06 4.59 4.63 4.50 OR Quartile 4 2.18 2.35 1.51 2.64 2.43 1.72 2.40 2.21 1.81 p Value 0.0034 0.0014 0.26 3.4E4 0.0011 0.14 0.0018 0.0048 0.11 Lower limit of 95% CI 1.29 1.39 0.737 1.55 1.42 0.831 1.39 1.27 0.867 Upper limit of 95% CI 3.66 3.96 3.09 4.50 4.14 3.57 4.16 3.83 3.77

TABLE-US-00180 TABLE 24.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0382 166 0.0382 181 0.0382 182 Average 117 329 122 353 140 349 Stdev 220 484 226 505 263 506 p (t-test) 3.0E7 4.8E8 2.3E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1510 3020 n (Patient) 184 131 202 113 217 98 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0382 166 0.0382 174 0.0382 174 Average 128 318 130 340 142 340 Stdev 242 484 241 503 261 511 p (t-test) 6.2E6 9.6E7 7.9E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1270 3020 1270 3020 1350 3020 n (Patient) 190 124 204 110 216 98 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 129 0.0422 170 0.0422 176 Average 171 357 171 367 171 374 Stdev 295 573 296 584 296 587 p (t-test) 4.4E4 3.3E4 2.2E4 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1510 3020 1510 3020 1510 3020 n (Patient) 254 59 258 55 259 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.68 0.66 0.63 0.68 0.67 0.64 0.67 0.66 0.65 SE 0.031 0.032 0.042 0.032 0.033 0.043 0.034 0.034 0.044 p Value 1.9E8 6.7E7 0.0020 2.1E8 3.2E7 0.0011 8.2E7 2.5E6 7.0E4 nCohort Non- 184 190 254 202 204 258 217 216 259 persistent nCohort Persistent 131 124 59 113 110 55 98 98 54 Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 86% 85% 88% 87% 86% 89% 87% 87% 89% Specificity 30% 29% 26% 29% 28% 26% 28% 28% 25% Cutoff Quartile 3 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Sensitivity 66% 65% 66% 68% 67% 69% 68% 68% 70% Specificity 61% 60% 54% 60% 59% 54% 58% 58% 54% Cutoff Quartile 4 283 280 284 283 280 284 283 280 284 Sensitivity 36% 35% 37% 39% 37% 38% 40% 38% 39% Specificity 83% 82% 78% 83% 81% 78% 82% 81% 78% OR Quartile 2 2.68 2.40 2.55 2.63 2.52 2.81 2.50 2.51 2.74 p Value 0.0011 0.0036 0.028 0.0023 0.0037 0.023 0.0061 0.0058 0.027 Lower limit of 95% CI 1.49 1.33 1.11 1.41 1.35 1.15 1.30 1.31 1.12 Upper limit of 95% CI 4.82 4.33 5.91 4.91 4.69 6.85 4.81 4.84 6.69 OR Quartile 3 2.97 2.83 2.25 3.20 3.00 2.61 2.99 3.03 2.79 p Value 4.7E6 1.5E5 0.0074 2.7E6 9.8E6 0.0025 2.0E5 1.7E5 0.0015 Lower limit of 95% CI 1.86 1.77 1.24 1.97 1.84 1.40 1.81 1.83 1.48 Upper limit of 95% CI 4.74 4.52 4.07 5.19 4.87 4.86 4.95 5.01 5.26 OR Quartile 4 2.66 2.44 2.06 3.04 2.60 2.13 2.92 2.51 2.21 p Value 2.4E4 7.8E4 0.020 3.3E5 3.5E4 0.016 7.3E5 6.5E4 0.012 Lower limit of 95% CI 1.58 1.45 1.12 1.80 1.54 1.15 1.72 1.48 1.19 Upper limit of 95% CI 4.48 4.09 3.76 5.14 4.38 3.95 4.97 4.27 4.10

TABLE-US-00181 TABLE 24.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 166 0.0328 179 0.0328 177 Average 104 329 108 351 134 335 Stdev 205 475 211 489 262 485 p (t-test) 3.5E8 4.3E9 2.7E6 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1510 3020 n (Patient) 174 141 189 126 204 111 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 167 0.0328 181 0.0355 179 Average 110 330 110 352 130 344 Stdev 213 482 213 496 245 502 p (t-test) 9.2E8 7.0E9 6.3E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1350 3020 n (Patient) 181 133 193 121 206 108 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 118 0.0411 159 0.0411 159 Average 172 327 172 339 172 339 Stdev 299 542 300 552 300 552 p (t-test) 0.0021 0.0013 0.0013 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1510 3020 1510 3020 1510 3020 n (Patient) 245 68 250 63 250 63 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.69 0.68 0.63 0.70 0.70 0.64 0.68 0.68 0.64 SE 0.030 0.031 0.040 0.031 0.031 0.041 0.032 0.033 0.041 p Value 1.4E10 3.7E9 0.0013 2.8E11 4.5E10 6.0E4 1.9E8 4.3E8 6.0E4 nCohort Non- 174 181 245 189 193 250 204 206 250 persistent nCohort Persistent 141 133 68 126 121 63 111 108 63 Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 87% 86% 88% 87% 87% 89% 87% 87% 89% Specificity 31% 30% 26% 30% 30% 26% 29% 29% 26% Cutoff Quartile 3 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Sensitivity 66% 66% 66% 69% 69% 70% 69% 69% 70% Specificity 63% 62% 54% 62% 62% 55% 60% 60% 55% Cutoff Quartile 4 283 280 284 283 280 284 283 280 284 Sensitivity 37% 38% 35% 40% 40% 37% 39% 39% 37% Specificity 84% 84% 78% 85% 84% 78% 82% 82% 78% OR Quartile 2 2.89 2.55 2.65 2.97 2.75 2.81 2.82 2.69 2.81 p Value 3.4E4 0.0016 0.016 4.7E4 0.0012 0.015 0.0014 0.0023 0.015 Lower limit of 95% CI 1.62 1.43 1.20 1.61 1.49 1.22 1.49 1.42 1.22 Upper limit of 95% CI 5.16 4.56 5.85 5.46 5.06 6.48 5.33 5.10 6.48 OR Quartile 3 3.25 3.17 2.32 3.71 3.51 2.81 3.44 3.44 2.81 p Value 6.6E7 1.3E6 0.0033 8.2E8 3.1E7 6.4E4 8.4E7 1.0E6 6.4E4 Lower limit of 95% CI 2.04 1.99 1.32 2.30 2.17 1.55 2.10 2.09 1.55 Upper limit of 95% CI 5.17 5.07 4.07 5.98 5.68 5.08 5.62 5.64 5.08 OR Quartile 4 3.18 3.16 1.88 3.63 3.44 1.99 2.95 2.91 1.99 p Value 2.2E5 2.1E5 0.033 2.1E6 4.9E6 0.023 5.3E5 6.9E5 0.023 Lower limit of 95% CI 1.86 1.86 1.05 2.13 2.02 1.10 1.75 1.72 1.10 Upper limit of 95% CI 5.43 5.36 3.37 6.18 5.83 3.60 4.99 4.92 3.60

TABLE-US-00182 TABLE 24.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 166 0.0328 177 0.0328 177 Average 100 331 108 348 125 344 Stdev 198 474 212 488 242 493 p (t-test) 1.7E8 6.8E9 2.4E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1350 3020 n (Patient) 172 143 188 127 200 115 sCr only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0328 166 0.0328 177 0.0328 177 Average 111 326 111 346 128 342 Stdev 214 480 213 494 242 499 p (t-test) 2.0E7 1.8E8 5.5E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1120 3020 1120 3020 1350 3020 n (Patient) 179 135 191 123 203 111 UO only Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort Median 0.0422 108 0.0422 108 0.0422 108 Average 169 322 172 325 172 325 Stdev 294 532 298 541 298 541 p (t-test) 0.0018 0.0024 0.0024 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1510 3020 1510 3020 1510 3020 n (Patient) 238 75 244 69 244 69 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.70 0.68 0.62 0.70 0.69 0.62 0.69 0.68 0.62 SE 0.030 0.031 0.039 0.031 0.031 0.040 0.032 0.033 0.040 p Value 7.5E11 9.2E9 0.0027 7.1E11 1.3E9 0.0028 2.9E9 3.7E8 0.0028 nCohort Non- 172 179 238 188 191 244 200 203 244 persistent nCohort Persistent 143 135 75 127 123 69 115 111 69 Cutoff Quartile 2 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Sensitivity 87% 86% 88% 87% 87% 88% 88% 87% 88% Specificity 31% 30% 26% 30% 30% 26% 30% 29% 26% Cutoff Quartile 3 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Sensitivity 66% 65% 63% 69% 67% 65% 70% 68% 65% Specificity 63% 61% 54% 62% 61% 54% 61% 60% 54% Cutoff Quartile 4 283 280 284 283 280 284 283 280 284 Sensitivity 37% 37% 35% 39% 39% 35% 39% 39% 35% Specificity 85% 84% 78% 85% 84% 77% 83% 82% 77% OR Quartile 2 2.99 2.64 2.64 3.02 2.84 2.71 3.02 2.84 2.71 p Value 2.2E4 0.0011 0.012 3.8E4 7.8E4 0.013 6.7E4 0.0013 0.013 Lower limit of 95% CI 1.67 1.48 1.24 1.64 1.55 1.23 1.60 1.50 1.23 Upper limit of 95% CI 5.34 4.71 5.61 5.55 5.24 5.98 5.70 5.37 5.98 OR Quartile 3 3.24 2.98 1.95 3.58 3.28 2.21 3.58 3.27 2.21 p Value 6.8E7 4.0E6 0.014 1.5E7 1.0E6 0.0052 3.2E7 2.0E6 0.0052 Lower limit of 95% CI 2.04 1.88 1.15 2.23 2.04 1.27 2.19 2.01 1.27 Upper limit of 95% CI 5.15 4.75 3.33 5.77 5.28 3.85 5.83 5.33 3.85 OR Quartile 4 3.31 3.04 1.85 3.56 3.30 1.83 3.14 2.93 1.83 p Value 1.3E5 3.8E5 0.033 2.9E6 9.3E6 0.040 2.0E5 5.9E5 0.040 Lower limit of 95% CI 1.93 1.79 1.05 2.09 1.95 1.03 1.86 1.74 1.03 Upper limit of 95% CI 5.66 5.17 3.26 6.06 5.60 3.27 5.31 4.96 3.27

TABLE-US-00183 TABLE 24.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0328 167 0.0328 182 0.0328 181 Average 91.7 334 96.6 355 116 350 Stdev 181 473 191 487 228 492 p (t-test) 2.5E9 2.9E10 2.5E8 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 918 3020 918 3020 1350 3020 n (Patient) 168 147 183 132 196 119 sCr only Median 0.0328 166 0.0328 177 0.0328 177 Average 104 328 105 348 122 344 Stdev 200 480 200 493 233 498 p (t-test) 5.1E8 4.2E9 1.6E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 918 3020 918 3020 1350 3020 n (Patient) 175 139 187 127 199 115 UO only Median 0.0401 121 0.0401 129 0.0401 129 Average 160 339 162 341 162 341 Stdev 283 530 286 534 286 534 p (t-test) 1.7E4 2.0E4 2.0E4 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 1510 3020 1510 3020 1510 3020 n (Patient) 233 80 236 77 236 77 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.70 0.68 0.64 0.72 0.69 0.64 0.70 0.68 0.64 SE 0.030 0.031 0.037 0.030 0.031 0.038 0.031 0.032 0.038 p Value 5.0E12 3.6E9 2.1E4 6.1E13 5.2E10 1.6E4 1.6E10 1.8E8 1.6E4 nCohort 168 175 233 183 187 236 196 199 236 Non- persistent nCohort 147 139 80 132 127 77 119 115 77 Persistent Cutoff 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 86% 86% 89% 88% 87% 90% 88% 87% 90% Specificity 32% 30% 27% 31% 30% 27% 30% 29% 27% Cutoff 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Quartile 3 Sensitivity 66% 65% 65% 69% 67% 66% 70% 68% 66% Specificity 64% 62% 55% 63% 61% 55% 62% 60% 55% Cutoff 283 280 284 283 280 284 283 280 284 Quartile 4 Sensitivity 37% 37% 38% 40% 39% 38% 39% 39% 38% Specificity 86% 85% 79% 86% 84% 79% 84% 83% 79% OR Quartile 2.93 2.58 2.92 3.28 2.77 3.21 3.23 2.74 3.21 2 p Value 2.4E4 0.0012 0.0051 1.3E4 8.7E4 0.0037 3.0E4 0.0015 0.0037 Lower limit 1.65 1.46 1.38 1.78 1.52 1.46 1.71 1.47 1.46 of 95% CI Upper limit 5.19 4.58 6.20 6.03 5.04 7.05 6.10 5.11 7.05 of 95% CI OR Quartile 3.40 2.96 2.26 3.84 3.23 2.41 3.72 3.20 2.41 3 p Value 2.3E7 4.2E6 0.0024 2.9E8 1.1E6 0.0014 1.2E7 2.4E6 0.0014 Lower limit 2.14 1.86 1.34 2.39 2.01 1.41 2.29 1.97 1.41 of 95% CI Upper limit 5.41 4.70 3.83 6.18 5.19 4.12 6.05 5.19 4.12 of 95% CI OR Quartile 3.59 3.28 2.25 4.05 3.54 2.25 3.35 3.12 2.25 4 p Value 4.6E6 1.4E5 0.0039 4.1E7 3.3E6 0.0044 7.3E6 2.2E5 0.0044 Lower limit 2.08 1.92 1.30 2.36 2.08 1.29 1.97 1.84 1.29 of 95% CI Upper limit 6.19 5.59 3.91 6.96 6.03 3.92 5.67 5.28 3.92 of 95% CI

TABLE-US-00184 TABLE 24.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 120 129 121 130 122 130 Average 175 190 172 200 179 184 Stdev 249 147 240 155 244 116 p (t-test) 0.68 0.47 0.91 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 526 n (Patient) 96 55 104 47 111 40 sCr only Median 119 129 120 129 121 129 Average 170 190 175 183 176 181 Stdev 246 145 246 115 242 114 p (t-test) 0.59 0.82 0.89 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 526 2200 526 n (Patient) 94 56 103 47 108 42 UO only Median 124 129 124 129 125 126 Average 180 194 180 194 181 189 Stdev 228 122 228 122 227 123 p (t-test) 0.79 0.79 0.88 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 478 2200 478 2200 478 n (Patient) 131 19 131 19 132 18 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.60 0.61 0.60 0.61 0.61 0.60 0.60 0.60 0.58 SE 0.049 0.048 0.073 0.051 0.051 0.073 0.054 0.053 0.075 p Value 0.034 0.019 0.16 0.026 0.038 0.16 0.064 0.063 0.26 nCohort 96 94 131 104 103 131 111 108 132 Non- persistent nCohort 55 56 19 47 47 19 40 42 18 Persistent Cutoff 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Quartile 2 Sensitivity 85% 86% 84% 85% 85% 84% 85% 86% 83% Specificity 31% 32% 27% 30% 30% 27% 29% 30% 27% Cutoff 124 124 125 124 124 125 124 124 125 Quartile 3 Sensitivity 56% 57% 53% 57% 57% 53% 57% 57% 50% Specificity 53% 54% 50% 53% 53% 50% 52% 53% 50% Cutoff 200 199 201 200 199 201 200 199 201 Quartile 4 Sensitivity 35% 34% 42% 38% 36% 42% 38% 36% 39% Specificity 80% 80% 77% 81% 80% 77% 79% 79% 77% OR Quartile 2.67 2.81 1.94 2.43 2.46 1.94 2.30 2.53 1.80 2 p Value 0.026 0.019 0.31 0.055 0.052 0.31 0.090 0.058 0.37 Lower limit 1.12 1.18 0.534 0.980 0.994 0.534 0.879 0.969 0.492 of 95% CI Upper limit 6.34 6.68 7.08 6.01 6.09 7.08 6.00 6.58 6.61 of 95% CI OR Quartile 1.46 1.58 1.13 1.52 1.55 1.13 1.48 1.49 1.00 3 p Value 0.26 0.18 0.81 0.24 0.22 0.81 0.29 0.28 1.0 Lower limit 0.751 0.812 0.430 0.756 0.771 0.430 0.714 0.726 0.373 of 95% CI Upper limit 2.85 3.08 2.96 3.04 3.10 2.96 3.07 3.06 2.68 of 95% CI OR Quartile 2.14 2.03 2.45 2.61 2.21 2.45 2.30 2.05 2.07 4 p Value 0.047 0.064 0.079 0.014 0.042 0.079 0.039 0.071 0.17 Lower limit 1.01 0.959 0.903 1.21 1.03 0.903 1.04 0.940 0.741 of 95% CI Upper limit 4.52 4.28 6.64 5.60 4.75 6.64 5.05 4.49 5.80 of 95% CI

TABLE-US-00185 TABLE 24.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 119 130 119 130 120 130 Average 171 194 169 200 170 202 Stdev 253 153 245 159 239 164 p (t-test) 0.52 0.38 0.39 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 88 63 94 57 101 50 sCr only Median 117 131 118 130 120 129 Average 170 188 169 192 171 191 Stdev 253 141 247 145 241 149 p (t-test) 0.60 0.52 0.58 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 88 62 93 57 99 51 UO only Median 124 129 124 129 125 126 Average 171 229 171 229 172 227 Stdev 220 198 220 198 220 202 p (t-test) 0.21 0.21 0.24 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 123 27 123 27 124 26 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.61 0.62 0.62 0.62 0.62 0.62 0.61 0.61 0.60 SE 0.047 0.047 0.062 0.048 0.048 0.062 0.050 0.050 0.064 p Value 0.017 0.0091 0.063 0.011 0.011 0.063 0.022 0.030 0.11 nCohort 88 88 123 94 93 123 101 99 124 Non- persistent nCohort 63 62 27 57 57 27 50 51 26 Persistent Cutoff 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Quartile 2 Sensitivity 84% 85% 85% 86% 86% 85% 86% 86% 85% Specificity 32% 33% 28% 32% 32% 28% 31% 31% 27% Cutoff 124 124 125 124 124 125 124 124 125 Quartile 3 Sensitivity 57% 58% 52% 58% 58% 52% 58% 57% 50% Specificity 55% 56% 50% 54% 55% 50% 53% 54% 50% Cutoff 200 199 201 200 199 201 200 199 201 Quartile 4 Sensitivity 33% 34% 41% 35% 35% 41% 36% 33% 38% Specificity 81% 81% 78% 81% 81% 78% 80% 79% 77% OR 2.47 2.89 2.20 2.87 2.92 2.20 2.72 2.87 2.08 Quartile 2 p Value 0.029 0.013 0.17 0.017 0.015 0.17 0.030 0.022 0.21 Lower limit 1.10 1.26 0.707 1.21 1.23 0.707 1.10 1.16 0.667 of 95% CI Upper limit 5.57 6.67 6.82 6.81 6.92 6.82 6.72 7.07 6.47 of 95% CI OR Quartile 1.60 1.74 1.09 1.63 1.67 1.09 1.59 1.52 1.00 3 p Value 0.16 0.098 0.83 0.15 0.13 0.83 0.19 0.23 1.0 Lower limit 0.834 0.902 0.476 0.839 0.858 0.476 0.800 0.769 0.429 of 95% CI Upper limit 3.07 3.36 2.52 3.17 3.25 2.52 3.15 3.00 2.33 of 95% CI OR Quartile 2.09 2.14 2.44 2.28 2.25 2.44 2.28 1.86 2.14 4 p Value 0.053 0.046 0.046 0.031 0.034 0.046 0.033 0.11 0.095 Lower limit 0.992 1.01 1.02 1.08 1.07 1.02 1.07 0.872 0.875 of 95% CI Upper limit 4.40 4.51 5.88 4.82 4.76 5.88 4.86 3.95 5.25 of 95% CI

TABLE-US-00186 TABLE 24.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 120 129 120 129 123 129 Average 174 188 174 190 176 189 Stdev 260 149 256 152 246 159 p (t-test) 0.70 0.66 0.73 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 83 68 86 65 94 57 sCr only Median 118 129 118 129 123 129 Average 175 181 173 183 176 180 Stdev 262 137 256 140 248 145 p (t-test) 0.86 0.77 0.90 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 82 68 86 64 93 57 UO only Median 125 122 125 122 126 122 Average 175 204 175 204 176 201 Stdev 227 183 227 183 226 185 p (t-test) 0.49 0.49 0.55 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 115 35 115 35 116 34 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.60 0.60 0.55 0.59 0.60 0.55 0.56 0.56 0.54 SE 0.047 0.047 0.057 0.047 0.047 0.057 0.049 0.049 0.057 p Value 0.040 0.042 0.37 0.062 0.042 0.37 0.22 0.21 0.51 nCohort 83 82 115 86 86 115 94 93 116 Non- persistent nCohort 68 68 35 65 64 35 57 57 34 Persistent Cutoff 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Quartile 2 Sensitivity 82% 82% 77% 82% 83% 77% 79% 81% 76% Specificity 31% 32% 26% 30% 31% 26% 28% 29% 26% Cutoff 124 124 125 124 124 125 124 124 125 Quartile 3 Sensitivity 56% 56% 46% 55% 56% 46% 53% 53% 44% Specificity 54% 55% 49% 53% 55% 49% 51% 52% 48% Cutoff 200 199 201 200 199 201 200 199 201 Quartile 4 Sensitivity 31% 31% 34% 31% 31% 34% 32% 30% 32% Specificity 80% 79% 77% 79% 79% 77% 79% 77% 77% OR Quartile 2.13 2.17 1.19 1.91 2.20 1.19 1.43 1.71 1.13 2 p Value 0.057 0.051 0.70 0.10 0.051 0.70 0.37 0.19 0.78 Lower limit 0.979 0.995 0.488 0.880 0.998 0.488 0.657 0.772 0.463 of 95% CI Upper limit 4.63 4.72 2.91 4.16 4.87 2.91 3.13 3.79 2.77 of 95% CI OR Quartile 1.50 1.54 0.799 1.43 1.55 0.799 1.16 1.19 0.737 3 p Value 0.22 0.19 0.56 0.28 0.19 0.56 0.66 0.61 0.44 Lower limit 0.787 0.807 0.374 0.747 0.808 0.374 0.600 0.613 0.342 of 95% CI Upper limit 2.86 2.94 1.71 2.73 2.97 1.71 2.24 2.29 1.59 of 95% CI OR Quartile 1.73 1.71 1.79 1.68 1.72 1.79 1.71 1.46 1.58 4 p Value 0.15 0.16 0.17 0.17 0.15 0.17 0.16 0.32 0.29 Lower limit 0.827 0.814 0.784 0.801 0.818 0.784 0.810 0.690 0.682 of 95% CI Upper limit 3.64 3.59 4.07 3.52 3.60 4.07 3.60 3.08 3.64 of 95% CI

TABLE-US-00187 TABLE 24.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 120 129 120 129 123 127 Average 177 185 175 189 176 188 Stdev 263 149 257 151 250 156 p (t-test) 0.83 0.70 0.74 Min 28.8 0.0162 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 81 70 85 66 91 60 sCr only Median 116 129 118 129 122 127 Average 175 180 175 181 176 179 Stdev 263 136 259 139 251 142 p (t-test) 0.89 0.86 0.93 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 81 69 84 66 90 60 UO only Median 125 124 125 124 125 124 Average 178 191 176 196 177 194 Stdev 232 173 232 173 231 174 p (t-test) 0.74 0.63 0.69 Min 28.8 0.0162 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 109 41 110 40 111 39 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.58 0.60 0.54 0.59 0.59 0.55 0.56 0.56 0.54 SE 0.047 0.047 0.053 0.047 0.047 0.054 0.048 0.048 0.054 p Value 0.078 0.041 0.51 0.061 0.065 0.33 0.18 0.19 0.46 nCohort 81 81 109 85 84 110 91 90 111 Non- persistent nCohort 70 69 41 66 66 40 60 60 39 Persistent Cutoff 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Quartile 2 Sensitivity 81% 83% 76% 82% 82% 78% 80% 80% 77% Specificity 31% 32% 26% 31% 31% 26% 29% 29% 26% Cutoff 124 124 125 124 124 125 124 124 125 Quartile 3 Sensitivity 56% 57% 49% 56% 56% 50% 53% 53% 49% Specificity 54% 56% 50% 54% 55% 50% 52% 52% 50% Cutoff 200 199 201 200 199 201 200 199 201 Quartile 4 Sensitivity 30% 30% 32% 30% 30% 32% 32% 30% 31% Specificity 79% 79% 77% 79% 79% 77% 79% 78% 77% OR Quartile 1.96 2.25 1.07 1.98 2.02 1.23 1.60 1.62 1.18 2 p Value 0.085 0.042 0.87 0.084 0.077 0.63 0.24 0.22 0.71 Lower limit 0.911 1.03 0.466 0.912 0.927 0.525 0.734 0.745 0.500 of 95% CI Upper limit 4.21 4.89 2.46 4.31 4.39 2.90 3.49 3.54 2.78 of 95% CI OR Quartile 1.50 1.62 0.935 1.50 1.54 1.00 1.22 1.25 0.933 3 p Value 0.22 0.14 0.85 0.22 0.19 1.0 0.55 0.51 0.85 Lower limit 0.786 0.851 0.456 0.788 0.807 0.485 0.635 0.649 0.450 of 95% CI Upper limit 2.85 3.10 1.92 2.87 2.95 2.06 2.35 2.40 1.94 of 95% CI OR Quartile 1.61 1.65 1.56 1.62 1.59 1.64 1.76 1.50 1.45 4 p Value 0.21 0.19 0.27 0.20 0.22 0.23 0.14 0.28 0.37 Lower limit 0.770 0.785 0.704 0.773 0.761 0.737 0.836 0.714 0.647 of 95% CI Upper limit 3.38 3.46 3.45 3.39 3.34 3.64 3.69 3.15 3.26 of 95% CI

TABLE-US-00188 TABLE 24.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 116 129 116 129 122 129 Average 178 183 177 184 178 184 Stdev 268 146 263 149 253 154 p (t-test) 0.88 0.85 0.88 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 78 73 81 70 88 63 sCr only Median 115 129 116 129 120 129 Average 176 179 175 180 177 179 Stdev 267 134 262 137 254 140 p (t-test) 0.92 0.89 0.96 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 79 71 82 68 88 62 UO only Median 125 124 125 124 125 124 Average 178 192 178 192 179 189 Stdev 233 171 233 171 232 173 p (t-test) 0.73 0.73 0.79 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 108 42 108 42 109 41 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.60 0.60 0.54 0.59 0.60 0.54 0.56 0.57 0.53 SE 0.046 0.046 0.053 0.047 0.047 0.053 0.048 0.048 0.053 p Value 0.039 0.025 0.41 0.062 0.042 0.41 0.22 0.14 0.55 nCohort 78 79 108 81 82 108 88 88 109 Non- persistent nCohort 73 71 42 70 68 42 63 62 41 Persistent Cutoff 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Quartile 2 Sensitivity 82% 83% 76% 81% 82% 76% 79% 81% 76% Specificity 32% 33% 26% 31% 32% 26% 28% 30% 26% Cutoff 124 124 125 124 124 125 124 124 125 Quartile 3 Sensitivity 58% 58% 50% 57% 57% 50% 54% 55% 49% Specificity 56% 57% 50% 56% 56% 50% 52% 53% 50% Cutoff 200 199 201 200 199 201 200 199 201 Quartile 4 Sensitivity 29% 30% 33% 29% 29% 33% 30% 29% 32% Specificity 78% 78% 78% 78% 78% 78% 78% 77% 77% OR Quartile 2.18 2.41 1.12 1.96 2.17 1.12 1.53 1.75 1.07 2 p Value 0.046 0.027 0.79 0.085 0.051 0.79 0.28 0.16 0.87 Lower limit 1.01 1.11 0.488 0.911 0.995 0.488 0.709 0.802 0.466 of 95% CI Upper limit 4.68 5.25 2.57 4.21 4.72 2.57 3.28 3.81 2.46 of 95% CI OR Quartile 1.75 1.81 1.00 1.67 1.72 1.00 1.28 1.39 0.935 3 p Value 0.088 0.073 1.0 0.12 0.10 1.0 0.45 0.32 0.85 Lower limit 0.920 0.946 0.490 0.874 0.898 0.490 0.671 0.725 0.456 of 95% CI Upper limit 3.34 3.46 2.04 3.18 3.29 2.04 2.46 2.67 1.92 of 95% CI OR Quartile 1.45 1.53 1.75 1.40 1.48 1.75 1.57 1.39 1.56 4 p Value 0.33 0.26 0.16 0.37 0.30 0.16 0.23 0.38 0.27 Lower limit 0.692 0.731 0.798 0.670 0.708 0.798 0.748 0.663 0.704 of 95% CI Upper limit 3.03 3.21 3.84 2.93 3.10 3.84 3.29 2.92 3.45 of 95% CI

Example 25. Use of Pro-Interleukin-16 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0198] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Pro-interleukin-16 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0199] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0200] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00189 TABLE 25.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.0291 109 0.0382 91.1 0.0382 112 Average 57.4 293 129 280 128 304 Stdev 137 431 288 422 282 440 p (t-test) 2.0E8 2.3E4 2.1E5 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 862 3020 2390 3020 2390 3020 n (Patient) 118 197 157 158 178 137 sCr only Median 0.0318 108 0.0328 108 0.0382 129 Average 76.4 292 116 295 117 324 Stdev 175 437 222 460 222 483 p (t-test) 2.1E7 1.2E5 5.6E7 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 894 3020 1120 3020 1120 3020 n (Patient) 129 185 161 153 183 131 UO only Median 0.0422 113 0.0422 112 0.0422 170 Average 179 292 183 306 179 343 Stdev 326 479 330 502 326 525 p (t-test) 0.022 0.022 0.0038 Min 0.0108 0.0108 0.0108 0.0108 0.0108 0.0108 Max 2390 3020 2390 3020 2390 3020 n (Patient) 240 73 255 58 262 51 Persistence Period Duration (hr) 24 48 72 sCr or sCr UO sCr or sCr UO sCr or sCr UO UO only only UO only only UO only only AUC 0.73 0.71 0.60 0.65 0.65 0.60 0.65 0.66 0.63 SE 0.028 0.029 0.039 0.031 0.031 0.043 0.031 0.032 0.045 p Value 2.2E16 5.7E13 0.010 2.2E6 6.1E7 0.023 1.2E6 5.0E7 0.0043 nCohort 118 129 240 157 161 255 178 183 262 Non- persistent nCohort 197 185 73 158 153 58 137 131 51 Persistent Cutoff 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 84% 85% 84% 84% 84% 85% 85% 86% Specificity 36% 34% 25% 30% 30% 25% 29% 29% 25% Cutoff 8.03 6.95 8.03 8.03 6.95 8.03 8.03 6.95 8.03 Quartile 3 Sensitivity 65% 65% 62% 62% 63% 62% 64% 64% 67% Specificity 75% 72% 53% 62% 63% 53% 60% 60% 53% Cutoff 283 280 284 283 280 284 283 280 284 Quartile 4 Sensitivity 35% 35% 34% 33% 33% 34% 36% 37% 39% Specificity 91% 88% 78% 83% 83% 77% 83% 83% 77% OR Quartile 3.19 2.78 1.92 2.17 2.17 1.79 2.28 2.26 2.07 2 p Value 2.5E5 1.9E4 0.069 0.0051 0.0053 0.14 0.0043 0.0052 0.091 Lower limit 1.86 1.63 0.950 1.26 1.26 0.831 1.29 1.28 0.891 of 95% CI Upper limit 5.48 4.77 3.88 3.73 3.75 3.84 4.02 4.01 4.83 of 95% CI OR Quartile 5.44 4.88 1.84 2.64 2.92 1.81 2.62 2.69 2.26 3 p Value 6.0E11 2.2E10 0.026 2.9E5 4.8E6 0.046 3.9E5 2.8E5 0.011 Lower limit 3.28 2.99 1.08 1.68 1.84 1.01 1.66 1.69 1.20 of 95% CI Upper limit 9.04 7.97 3.14 4.16 4.61 3.25 4.15 4.28 4.25 of 95% CI OR Quartile 5.13 4.02 1.79 2.36 2.38 1.75 2.75 2.84 2.22 4 p Value 3.1E6 1.0E5 0.045 0.0015 0.0013 0.075 1.6E4 9.9E5 0.013 Lower limit 2.58 2.17 1.01 1.39 1.40 0.946 1.62 1.68 1.18 of 95% CI Upper limit 10.2 7.46 3.17 4.02 4.03 3.23 4.65 4.79 4.18 of 95% CI

TABLE-US-00190 TABLE 25.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort sCr or UO Median 0.0291 108 0.0328 108 Average 56.6 285 95.1 300 Stdev 138 426 193 450 p (t-test) 8.1E8 6.1E7 Min 0.0108 0.0108 0.0108 0.0108 Max 862 3020 1120 3020 n (Patient) 111 204 146 169 sCr only Median 0.0318 108 0.0328 108 Average 76.1 288 107 295 Stdev 176 434 213 454 p (t-test) 4.2E7 5.0E6 Min 0.0108 0.0108 0.0108 0.0108 Max 894 3020 1120 3020 n (Patient) 125 189 153 161 UO only Median 0.0401 115 0.0422 123 Average 164 307 168 324 Stdev 288 505 294 528 p (t-test) 0.0017 0.0012 Min 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1510 3020 n (Patient) 221 92 237 76 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO UO only only UO only only AUC 0.73 0.70 0.62 0.68 0.66 0.62 SE 0.028 0.029 0.036 0.030 0.030 0.038 p Value 4.4E16 1.4E12 0.0012 1.2E9 1.1E7 0.0019 nCohort 111 125 221 146 153 237 Non- persistent nCohort 204 189 92 169 161 76 Persistent Cutoff 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 85% 85% 85% 84% 86% Specificity 38% 35% 26% 32% 31% 26% Cutoff 8.03 6.95 8.03 8.03 6.95 8.03 Quartile 3 Sensitivity 64% 65% 62% 63% 63% 63% Specificity 75% 72% 55% 65% 64% 54% Cutoff 283 280 284 283 280 284 Quartile 4 Sensitivity 34% 34% 34% 34% 34% 34% Specificity 91% 89% 78% 86% 84% 78% OR 3.40 3.00 1.98 2.61 2.30 2.05 Quartile 2 p Value 9.6E6 6.7E5 0.037 5.4E4 0.0026 0.045 Lower limit 1.98 1.75 1.04 1.52 1.34 1.01 of 95% CI Upper limit 5.84 5.14 3.77 4.50 3.96 4.13 of 95% CI OR 5.21 4.68 1.97 3.21 3.08 2.01 Quartile 3 p Value 3.3E10 7.3E10 0.0075 7.3E7 1.7E6 0.0099 Lower limit 3.11 2.87 1.20 2.02 1.94 1.18 of 95% CI Upper limit 8.71 7.65 3.24 5.10 4.88 3.43 of 95% CI OR 5.16 4.16 1.83 3.11 2.79 1.81 Quartile 4 p Value 6.2E6 9.9E6 0.027 7.3E5 2.2E4 0.040 Lower limit 2.53 2.21 1.07 1.78 1.62 1.03 of 95% CI Upper limit 10.5 7.82 3.14 5.45 4.80 3.17 of 95% CI Persistence Period Duration (hr) 72 Non-persistent Persistent Cohort Cohort sCr or UO Median 0.0328 159 Average 94.8 324 Stdev 195 465 p (t-test) 1.7E8 Min 0.0108 0.0108 Max 1120 3020 n (Patient) 164 151 sCr only Median 0.0355 123 Average 106 315 Stdev 214 466 p (t-test) 3.7E7 Min 0.0108 0.0108 Max 1120 3020 n (Patient) 168 146 UO only Median 0.0422 170 Average 164 353 Stdev 291 545 p (t-test) 1.5E4 Min 0.0108 0.0108 Max 1510 3020 n (Patient) 244 69 Persistence Period Duration (hr) 72 sCr or sCr UO UO only only AUC 0.69 0.67 0.64 SE 0.030 0.031 0.039 p Value 1.1E10 1.3E8 2.7E4 nCohort 164 168 244 Non- persistent nCohort 151 146 69 Persistent Cutoff 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 86% 86% 87% Specificity 32% 31% 26% Cutoff 8.03 6.95 8.03 Quartile 3 Sensitivity 65% 64% 67% Specificity 63% 62% 55% Cutoff 283 280 284 Quartile 4 Sensitivity 38% 37% 38% Specificity 87% 85% 78% OR 2.87 2.67 2.32 Quartile 2 p Value 2.6E4 6.8E4 0.029 Lower limit 1.63 1.51 1.09 of 95% CI Upper limit 5.06 4.70 4.95 of 95% CI OR 3.21 3.01 2.40 Quartile 3 p Value 7.4E7 2.7E6 0.0022 Lower limit 2.02 1.90 1.37 of 95% CI Upper limit 5.08 4.78 4.20 of 95% CI OR 3.91 3.36 2.18 Quartile 4 p Value 1.6E6 1.2E5 0.0078 Lower limit 2.24 1.95 1.23 of 95% CI Upper limit 6.83 5.77 3.87 of 95% CI

TABLE-US-00191 TABLE 25.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort sCr or UO Median 0.0291 108 0.0328 106 Average 57.1 284 96.6 295 Stdev 138 426 195 448 p (t-test) 1.1E7 1.4E6 Min 0.0108 0.0108 0.0108 0.0108 Max 862 3020 1120 3020 n (Patient) 110 205 143 172 sCr only Median 0.0318 107 0.0328 99.3 Average 77.4 284 109 290 Stdev 178 432 215 451 p (t-test) 7.7E7 1.1E5 Min 0.0108 0.0108 0.0108 0.0108 Max 894 3020 1120 3020 n (Patient) 123 191 150 164 UO only Median 0.0401 108 0.0422 108 Average 164 292 162 315 Stdev 290 487 284 514 p (t-test) 0.0041 9.1E4 Min 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 n (Patient) 211 102 224 89 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr sCr UO UO only only UO only only AUC 0.73 0.70 0.61 0.68 0.66 0.62 SE 0.028 0.029 0.035 0.030 0.030 0.036 p Value 6.7E16 1.8E12 0.0014 2.6E9 1.1E7 0.0014 nCohort 110 123 211 143 150 224 Non- persistent nCohort 205 191 102 172 164 89 Persistent Cutoff 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 85% 84% 84% 84% 84% Specificity 38% 36% 27% 32% 31% 26% Cutoff 8.03 6.95 8.03 8.03 6.95 8.03 Quartile 3 Sensitivity 63% 64% 62% 63% 63% 63% Specificity 75% 72% 55% 65% 64% 55% Cutoff 283 280 284 283 280 284 Quartile 4 Sensitivity 34% 34% 32% 34% 34% 34% Specificity 91% 89% 78% 85% 84% 78% OR Quartile 3.47 3.11 1.94 2.55 2.42 1.87 2 p Value 7.0E6 3.9E5 0.034 7.0E4 0.0014 0.056 Lower limit 2.02 1.81 1.05 1.48 1.41 0.983 of 95% CI Upper limit 5.96 5.34 3.59 4.37 4.17 3.56 of 95% CI OR Quartile 5.08 4.45 2.01 3.14 3.00 2.07 3 p Value 6.1E10 2.5E9 0.0046 1.2E6 2.8E6 0.0048 Lower limit 3.03 2.72 1.24 1.98 1.90 1.25 of 95% CI Upper limit 8.49 7.26 3.26 4.98 4.75 3.42 of 95% CI OR Quartile 5.07 4.02 1.72 2.96 2.65 1.82 4 p Value 7.7E6 1.6E5 0.045 1.5E4 4.5E4 0.031 Lower limit 2.49 2.14 1.01 1.69 1.54 1.06 of 95% CI Upper limit 10.3 7.56 2.91 5.18 4.56 3.12 of 95% CI Persistence Period Duration (hr) 72 Non-persistent Persistent Cohort Cohort sCr or UO Median 0.0328 114 Average 96.7 312 Stdev 199 458 p (t-test) 1.3E7 Min 0.0108 0.0108 Max 1120 3020 n (Patient) 157 158 sCr only Median 0.0328 108 Average 109 304 Stdev 217 460 p (t-test) 2.2E6 Min 0.0108 0.0108 Max 1120 3020 n (Patient) 162 152 UO only Median 0.0401 144 Average 159 339 Stdev 281 529 p (t-test) 1.3E4 Min 0.0108 0.0108 Max 1370 3020 n (Patient) 231 82 Persistence Period Duration (hr) 72 sCr sCr UO UO only only AUC 0.69 0.67 0.64 SE 0.030 0.030 0.037 p Value 2.7E10 2.5E8 2.2E4 nCohort 157 162 231 Non- persistent nCohort 158 152 82 Persistent Cutoff 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 86% 85% Specificity 32% 31% 26% Cutoff 8.03 6.95 8.03 Quartile 3 Sensitivity 65% 64% 66% Specificity 64% 63% 55% Cutoff 283 280 284 Quartile 4 Sensitivity 36% 36% 37% Specificity 86% 85% 79% OR Quartile 2.74 2.71 2.05 2 p Value 3.7E4 4.8E4 0.039 Lower limit 1.57 1.55 1.04 of 95% CI Upper limit 4.78 4.76 4.04 of 95% CI OR Quartile 3.29 3.00 2.40 3 p Value 4.4E7 2.8E6 0.0011 Lower limit 2.07 1.89 1.42 of 95% CI Upper limit 5.21 4.75 4.05 of 95% CI OR Quartile 3.46 3.02 2.14 4 p Value 1.2E5 6.1E5 0.0065 Lower limit 1.99 1.76 1.24 of 95% CI Upper limit 6.04 5.18 3.71 of 95% CI

TABLE-US-00192 TABLE 25.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort sCr or UO Median 0.0291 107 0.0328 105 Average 57.5 283 97.3 293 Stdev 139 425 195 447 p (t-test) 1.5E7 2.0E6 Min 0.0108 0.0108 0.0108 0.0108 Max 862 3020 1120 3020 n (Patient) 109 206 142 173 sCr only Median 0.0318 107 0.0328 93.6 Average 77.4 284 110 288 Stdev 178 432 215 450 p (t-test) 7.7E7 1.5E5 Min 0.0108 0.0108 0.0108 0.0108 Max 894 3020 1120 3020 n (Patient) 123 191 149 165 UO only Median 0.0401 88.0 0.0422 88.0 Average 167 281 166 299 Stdev 292 481 286 505 p (t-test) 0.0094 0.0034 Min 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 n (Patient) 207 106 219 94 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO UO only only UO only only AUC 0.73 0.70 0.60 0.67 0.66 0.60 SE 0.028 0.029 0.034 0.030 0.030 0.036 p Value 4.4E16 1.8E12 0.0035 5.4E9 2.1E7 0.0055 nCohort 109 123 207 142 149 219 Non- persistent nCohort 206 191 106 173 165 94 Persistent Cutoff 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 85% 84% 84% 84% 84% Specificity 39% 36% 27% 32% 32% 26% Cutoff 8.03 6.95 8.03 8.03 6.95 8.03 Quartile 3 Sensitivity 64% 64% 61% 62% 62% 61% Specificity 75% 72% 56% 65% 64% 54% Cutoff 283 280 284 283 280 284 Quartile 4 Sensitivity 33% 34% 31% 34% 33% 32% Specificity 91% 89% 78% 85% 84% 78% OR Quartile 3.54 3.11 1.89 2.59 2.46 1.85 2 p Value 5.0E6 3.9E5 0.038 5.6E4 0.0011 0.055 Lower limit 2.06 1.81 1.04 1.51 1.43 0.988 of 95% CI Upper limit 6.09 5.34 3.46 4.45 4.24 3.48 of 95% CI OR Quartile 5.30 4.45 1.98 3.06 2.92 1.83 3 p Value 3.0E10 2.5E9 0.0050 2.1E6 4.7E6 0.016 Lower limit 3.16 2.72 1.23 1.93 1.85 1.12 of 95% CI Upper limit 8.92 7.26 3.19 4.85 4.63 3.00 of 95% CI OR Quartile 4.99 4.02 1.58 2.91 2.60 1.63 4 p Value 9.7E6 1.6E5 0.087 1.9E4 5.6E4 0.076 Lower limit 2.45 2.14 0.935 1.66 1.51 0.950 of 95% CI Upper limit 10.2 7.56 2.68 5.09 4.49 2.78 of 95% CI Persistence Period Duration (hr) 72 Non-persistent Persistent Cohort Cohort sCr or UO Median 0.0328 111 Average 97.9 308 Stdev 200 457 p (t-test) 2.6E7 Min 0.0108 0.0108 Max 1120 3020 n (Patient) 155 160 sCr only Median 0.0328 108 Average 110 302 Stdev 218 460 p (t-test) 3.0E6 Min 0.0108 0.0108 Max 1120 3020 n (Patient) 161 153 UO only Median 0.0422 106 Average 163 316 Stdev 283 517 p (t-test) 9.0E-4 Min 0.0108 0.0108 Max 1370 3020 n (Patient) 225 88 Persistence Period Duration (hr) 72 sCr or sCr UO UO only only AUC 0.68 0.67 0.61 SE 0.030 0.030 0.036 p Value 8.8E10 5.0E8 0.0016 nCohort 155 161 225 Non- persistent nCohort 160 153 88 Persistent Cutoff 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 86% 86% 85% Specificity 32% 32% 26% Cutoff 8.03 6.95 8.03 Quartile 3 Sensitivity 64% 63% 62% Specificity 64% 63% 55% Cutoff 283 280 284 Quartile 4 Sensitivity 36% 35% 34% Specificity 86% 84% 78% OR Quartile 2.84 2.76 2.05 2 p Value 2.3E4 3.8E4 0.033 Lower limit 1.63 1.58 1.06 of 95% CI Upper limit 4.94 4.84 3.97 of 95% CI OR Quartile 3.11 2.92 2.01 3 p Value 1.3E6 4.8E6 0.0068 Lower limit 1.96 1.84 1.21 of 95% CI Upper limit 4.92 4.61 3.33 of 95% CI OR Quartile 3.35 2.97 1.86 4 p Value 2.0E5 7.9E5 0.025 Lower limit 1.92 1.73 1.08 of 95% CI Upper limit 5.83 5.09 3.20 of 95% CI

TABLE-US-00193 TABLE 25.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort sCr or UO Median 0.0291 108 0.0318 106 Average 52.1 281 89.9 293 Stdev 136 422 178 446 p (t-test) 1.2E7 8.3E7 Min 0.0108 0.0108 0.0108 0.0108 Max 862 3020 862 3020 n (Patient) 105 210 137 178 sCr only Median 0.0291 107 0.0328 105 Average 74.3 283 101 291 Stdev 177 430 199 450 p (t-test) 7.1E7 3.8E6 Min 0.0108 0.0108 0.0108 0.0108 Max 894 3020 894 3020 n (Patient) 120 194 145 169 UO only Median 0.0382 110 0.0401 108 Average 152 302 153 314 Stdev 272 487 268 506 p (t-test) 5.6E4 2.8E4 Min 0.0108 0.0108 0.0108 0.0108 Max 1370 3020 1370 3020 n (Patient) 201 112 211 102 Persistence Period Duration (hr) 24 48 sCr or sCr UO sCr or sCr UO UO only only UO only only AUC 0.74 0.71 0.63 0.68 0.67 0.61 SE 0.028 0.029 0.034 0.030 0.030 0.035 p Value 0 1.5E13 1.7E4 1.5E9 1.6E8 0.0014 nCohort 105 120 201 137 145 211 Non- persistent nCohort 210 194 112 178 169 102 Persistent Cutoff 0.0279 0.0279 0.0279 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 85% 85% 84% 85% 83% Specificity 40% 37% 27% 33% 32% 26% Cutoff 8.03 6.95 8.03 8.03 6.95 8.03 Quartile 3 Sensitivity 64% 64% 63% 62% 63% 62% Specificity 77% 72% 57% 66% 65% 55% Cutoff 283 280 284 283 280 284 Quartile 4 Sensitivity 33% 34% 33% 33% 34% 33% Specificity 91% 89% 79% 85% 85% 79% OR Quartile 3.85 3.29 2.11 2.62 2.64 1.76 2 p Value 1.3E6 1.6E5 0.015 4.5E4 4.7E4 0.066 Lower limit 2.23 1.92 1.15 1.53 1.53 0.963 of 95% CI Upper limit 6.64 5.66 3.84 4.49 4.54 3.23 of 95% CI OR Quartile 5.95 4.67 2.32 3.17 3.10 2.01 3 p Value 6.6E11 1.2E9 5.3E4 1.1E6 1.6E6 0.0046 Lower limit 3.48 2.84 1.44 1.99 1.95 1.24 of 95% CI Upper limit 10.2 7.67 3.72 5.05 4.92 3.26 of 95% CI OR Quartile 5.33 4.24 1.87 2.90 2.85 1.84 4 p Value 9.5E6 1.2E5 0.019 2.4E4 2.2E4 0.023 Lower limit 2.54 2.22 1.11 1.64 1.63 1.09 of 95% CI Upper limit 11.2 8.11 3.14 5.12 4.95 3.12 of 95% CI Persistence Period Duration (hr) 72 Non-persistent Persistent Cohort Cohort sCr or UO Median 0.0328 111 Average 91.8 306 Stdev 185 455 p (t-test) 1.6E7 Min 0.0108 0.0108 Max 918 3020 n (Patient) 149 166 sCr only Median 0.0328 109 Average 102 305 Stdev 204 459 p (t-test) 7.1E7 Min 0.0108 0.0108 Max 918 3020 n (Patient) 157 157 UO only Median 0.0401 112 Average 151 329 Stdev 265 515 p (t-test) 6.8E5 Min 0.0108 0.0108 Max 1370 3020 n (Patient) 216 97 Persistence Period Duration (hr) 72 sCr or sCr UO UO only only AUC 0.68 0.68 0.63 SE 0.030 0.030 0.035 p Value 1.0E9 3.4E9 2.8E4 nCohort 149 157 216 Non- persistent nCohort 166 157 97 Persistent Cutoff 0.0279 0.0279 0.0279 Quartile 2 Sensitivity 85% 86% 85% Specificity 32% 32% 26% Cutoff 8.03 6.95 8.03 Quartile 3 Sensitivity 63% 64% 64% Specificity 64% 64% 56% Cutoff 283 280 284 Quartile 4 Sensitivity 35% 36% 35% Specificity 86% 85% 79% OR Quartile 2.68 2.95 1.96 2 p Value 4.1E4 1.6E4 0.036 Lower limit 1.55 1.68 1.05 of 95% CI Upper limit 4.63 5.17 3.67 of 95% CI OR Quartile 3.12 3.08 2.26 3 p Value 1.3E6 1.7E6 0.0012 Lower limit 1.97 1.94 1.38 of 95% CI Upper limit 4.94 4.88 3.70 of 95% CI OR Quartile 3.27 3.23 2.05 4 p Value 3.4E5 2.9E5 0.0080 Lower limit 1.87 1.86 1.21 of 95% CI Upper limit 5.74 5.60 3.49 of 95% CI

TABLE-US-00194 TABLE 25.6 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 111 129 120 129 120 129 Average 176 183 170 192 182 179 Stdev 307 156 261 162 269 123 p (t-test) 0.84 0.53 0.92 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 667 n (Patient) 50 101 75 76 85 66 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 111 129 116 129 120 129 Average 182 175 167 187 178 176 Stdev 310 140 264 152 267 109 p (t-test) 0.87 0.57 0.96 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 526 n (Patient) 52 98 73 77 86 64 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 125 123 126 122 125 124 Average 178 193 182 178 181 185 Stdev 235 155 233 143 228 153 p (t-test) 0.71 0.93 0.94 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 675 2200 667 2200 667 n (Patient) 112 38 120 30 125 25 24 48 72 Persistence Period sCr or sCr or sCr or sCr UO Duration (hr) UO sCr only UO only UO sCr only UO only UO only only AUC 0.60 0.60 0.56 0.60 0.61 0.52 0.59 0.60 0.54 SE 0.048 0.048 0.055 0.046 0.046 0.060 0.047 0.047 0.064 p Value 0.039 0.044 0.29 0.028 0.018 0.73 0.062 0.035 0.58 nCohort Non- 50 52 112 75 73 120 85 86 125 persistent nCohort Persistent 101 98 38 76 77 30 66 64 25 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 78% 79% 82% 83% 83% 80% 83% 83% 76% Specificity 32% 33% 28% 33% 34% 27% 32% 31% 26% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 54% 54% 47% 54% 55% 43% 55% 56% 48% Specificity 58% 58% 49% 53% 55% 48% 53% 55% 50% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 29% 29% 34% 32% 31% 30% 32% 33% 32% Specificity 82% 81% 78% 81% 81% 76% 80% 80% 76% OR Quartile 2 1.69 1.78 1.69 2.42 2.56 1.45 2.33 2.20 1.09 p Value 0.18 0.13 0.26 0.024 0.016 0.45 0.037 0.051 0.87 Lower limit of 95% CI 0.791 0.838 0.676 1.13 1.19 0.545 1.05 0.998 0.400 Upper limit of 95% CI 3.61 3.79 4.25 5.21 5.52 3.88 5.14 4.87 2.97 OR Quartile 3 1.65 1.61 0.868 1.34 1.45 0.715 1.35 1.55 0.908 p Value 0.15 0.17 0.71 0.37 0.25 0.42 0.36 0.19 0.83 Lower limit of 95% CI 0.833 0.815 0.416 0.706 0.765 0.320 0.708 0.808 0.385 Upper limit of 95% CI 3.27 3.17 1.81 2.54 2.77 1.60 2.57 2.97 2.15 OR Quartile 4 1.83 1.68 1.81 2.01 1.91 1.34 1.87 1.98 1.49 p Value 0.16 0.21 0.15 0.070 0.094 0.51 0.099 0.072 0.40 Lower limit of 95% CI 0.792 0.742 0.810 0.944 0.896 0.555 0.889 0.942 0.585 Upper limit of 95% CI 4.25 3.80 4.04 4.28 4.07 3.26 3.92 4.17 3.80

TABLE-US-00195 TABLE 25.7 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 114 129 120 129 Average 175 183 168 191 173 190 Stdev 310 155 269 159 265 148 p (t-test) 0.82 0.51 0.63 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 49 102 70 81 79 72 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 112 129 116 130 Average 181 176 166 188 170 185 Stdev 313 140 270 149 266 135 p (t-test) 0.89 0.54 0.67 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 51 99 70 80 79 71 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 125 124 126 122 125 124 Average 173 200 179 190 177 197 Stdev 233 178 231 176 226 186 p (t-test) 0.48 0.77 0.64 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 103 47 111 39 116 34 24 48 72 Persistence Period sCr or sCr or sCr or sCr UO Duration (hr) UO sCr only UO only UO sCr only UO only UO only only AUC 0.61 0.61 0.56 0.62 0.63 0.53 0.61 0.63 0.54 SE 0.048 0.047 0.051 0.045 0.045 0.054 0.046 0.046 0.057 p Value 0.023 0.027 0.23 0.011 0.0041 0.60 0.013 0.0047 0.48 nCohort Non- 49 51 103 70 70 111 79 79 116 persistent nCohort Persistent 102 99 47 81 80 39 72 71 34 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 78% 79% 83% 83% 84% 82% 83% 85% 79% Specificity 33% 33% 29% 34% 36% 28% 33% 34% 27% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 55% 55% 49% 56% 56% 46% 57% 58% 50% Specificity 59% 59% 50% 56% 57% 49% 56% 57% 50% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 29% 29% 32% 32% 32% 28% 33% 34% 29% Specificity 84% 82% 78% 83% 83% 76% 82% 82% 76% OR Quartile 2 1.76 1.86 2.00 2.50 2.86 1.77 2.45 2.83 1.41 p Value 0.14 0.11 0.12 0.018 0.0074 0.22 0.024 0.010 0.47 Lower limit of 95% CI 0.824 0.872 0.838 1.17 1.33 0.708 1.13 1.28 0.556 Upper limit of 95% CI 3.77 3.95 4.79 5.33 6.18 4.43 5.34 6.26 3.56 OR Quartile 3 1.77 1.71 0.940 1.57 1.71 0.812 1.66 1.81 1.00 p Value 0.11 0.12 0.86 0.17 0.10 0.58 0.12 0.073 1.0 Lower limit of 95% CI 0.885 0.865 0.471 0.826 0.897 0.391 0.873 0.946 0.466 Upper limit of 95% CI 3.52 3.40 1.87 2.99 3.28 1.69 3.17 3.46 2.15 OR Quartile 4 2.14 1.93 1.63 2.28 2.33 1.22 2.32 2.37 1.31 p Value 0.087 0.12 0.21 0.037 0.033 0.63 0.029 0.026 0.53 Lower limit of 95% CI 0.895 0.835 0.756 1.05 1.07 0.538 1.09 1.11 0.559 Upper limit of 95% CI 5.09 4.48 3.52 4.97 5.07 2.78 4.95 5.06 3.07

TABLE-US-00196 TABLE 25.8 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 116 129 120 129 Average 175 183 169 190 176 185 Stdev 310 155 271 159 272 145 p (t-test) 0.82 0.56 0.81 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 49 102 69 82 75 76 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 112 129 120 129 Average 181 176 167 186 174 181 Stdev 313 140 272 149 272 134 p (t-test) 0.89 0.59 0.86 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 51 99 69 81 75 75 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 126 122 127 122 125 123 Average 177 190 181 182 180 187 Stdev 238 173 236 167 231 175 p (t-test) 0.72 0.98 0.86 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 98 52 105 45 110 40 24 48 72 Persistence Period sCr or sCr or UO sCr or sCr UO Duration (hr) UO sCr only UO only UO sCr only only UO only only AUC 0.61 0.61 0.53 0.61 0.62 0.51 0.59 0.61 0.51 SE 0.048 0.047 0.050 0.046 0.045 0.052 0.046 0.046 0.054 p Value 0.023 0.027 0.56 0.017 0.0068 0.91 0.042 0.020 0.78 nCohort Non- 49 51 98 69 69 105 75 75 110 persistent nCohort Persistent 102 99 52 82 81 45 76 75 40 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 78% 79% 79% 82% 83% 78% 80% 81% 75% Specificity 33% 33% 28% 33% 35% 27% 31% 32% 25% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 55% 55% 46% 55% 56% 44% 55% 56% 48% Specificity 59% 59% 48% 55% 57% 48% 55% 56% 49% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 29% 29% 29% 32% 32% 27% 32% 32% 28% Specificity 84% 82% 77% 83% 83% 75% 81% 81% 75% OR Quartile 2 1.76 1.86 1.42 2.23 2.55 1.27 1.80 2.05 1.02 p Value 0.14 0.11 0.39 0.036 0.016 0.57 0.12 0.063 0.95 Lower limit of 95% CI 0.824 0.872 0.637 1.05 1.19 0.558 0.851 0.962 0.445 Upper limit of 95% CI 3.77 3.95 3.15 4.73 5.46 2.90 3.80 4.37 2.36 OR Quartile 3 1.77 1.71 0.790 1.49 1.62 0.727 1.49 1.62 0.872 p Value 0.11 0.12 0.49 0.22 0.14 0.37 0.22 0.14 0.71 Lower limit of 95% CI 0.885 0.865 0.403 0.783 0.851 0.361 0.785 0.850 0.423 Upper limit of 95% CI 3.52 3.40 1.55 2.84 3.10 1.47 2.83 3.09 1.80 OR Quartile 4 2.14 1.93 1.32 2.21 2.25 1.10 2.01 2.05 1.17 p Value 0.087 0.12 0.47 0.046 0.042 0.81 0.070 0.063 0.71 Lower limit of 95% CI 0.895 0.835 0.618 1.01 1.03 0.499 0.944 0.962 0.514 Upper limit of 95% CI 5.09 4.48 2.83 4.80 4.89 2.45 4.28 4.37 2.64

TABLE-US-00197 TABLE 25.9 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 114 129 120 129 Average 175 183 170 189 177 184 Stdev 310 155 273 158 273 145 p (t-test) 0.82 0.59 0.85 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 49 102 68 83 74 77 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 112 129 118 129 Average 181 176 168 186 175 180 Stdev 313 140 274 148 274 133 p (t-test) 0.89 0.61 0.89 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 51 99 68 82 74 76 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 127 122 128 122 126 124 Average 179 187 184 178 182 181 Stdev 242 168 242 160 236 166 p (t-test) 0.83 0.87 0.99 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 95 55 100 50 105 45 24 48 72 Persistence Period sCr or sCr or UO sCr or sCr UO Duration (hr) UO sCr only UO only UO sCr only only UO only only AUC 0.61 0.61 0.53 0.61 0.62 0.50 0.59 0.61 0.51 SE 0.048 0.047 0.049 0.046 0.045 0.050 0.046 0.046 0.052 p Value 0.023 0.027 0.59 0.017 0.0066 0.92 0.042 0.020 0.80 nCohort Non- 49 51 95 68 68 100 74 74 105 persistent nCohort Persistent 102 99 55 83 82 50 77 76 45 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 78% 79% 80% 82% 83% 78% 81% 82% 76% Specificity 33% 33% 28% 34% 35% 27% 31% 32% 26% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 55% 55% 47% 55% 56% 46% 56% 57% 49% Specificity 59% 59% 48% 56% 57% 48% 55% 57% 50% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 29% 29% 27% 31% 32% 26% 31% 32% 27% Specificity 84% 82% 76% 82% 82% 75% 81% 81% 75% OR Quartile 2 1.76 1.86 1.59 2.32 2.65 1.31 1.86 2.13 1.07 p Value 0.14 0.11 0.26 0.028 0.012 0.51 0.10 0.051 0.87 Lower limit of 95% CI 0.824 0.872 0.716 1.09 1.24 0.588 0.882 0.997 0.477 Upper limit of 95% CI 3.77 3.95 3.52 4.91 5.67 2.92 3.94 4.53 2.40 OR Quartile 3 1.77 1.71 0.842 1.57 1.72 0.786 1.57 1.71 0.938 p Value 0.11 0.12 0.61 0.17 0.10 0.49 0.17 0.10 0.86 Lower limit of 95% CI 0.885 0.865 0.433 0.826 0.898 0.398 0.827 0.896 0.467 Upper limit of 95% CI 3.52 3.40 1.64 3.00 3.29 1.55 2.99 3.26 1.89 OR Quartile 4 2.14 1.93 1.17 2.13 2.17 1.05 1.94 1.98 1.10 p Value 0.087 0.12 0.68 0.057 0.051 0.89 0.085 0.077 0.81 Lower limit of 95% CI 0.895 0.835 0.551 0.979 0.995 0.484 0.912 0.928 0.499 Upper limit of 95% CI 5.09 4.48 2.50 4.63 4.72 2.29 4.13 4.21 2.45

TABLE-US-00198 TABLE 25.10 Comparison of marker levels and the area under the ROC curve (AUC) in EDTA samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 110 129 112 129 114 129 Average 178 182 171 188 179 182 Stdev 316 154 279 155 281 141 p (t-test) 0.92 0.64 0.94 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 47 104 65 86 70 81 sCr only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 111 129 112 129 118 129 Average 184 174 170 183 177 178 Stdev 316 140 277 147 278 132 p (t-test) 0.81 0.70 0.99 Min 0.0162 12.8 0.0162 12.8 0.0162 12.8 Max 2200 902 2200 902 2200 902 n (Patient) 50 100 66 84 72 78 UO only 24 48 72 Persistence Period Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 125 124 126 124 124 125 Average 177 189 183 179 182 181 Stdev 245 165 247 154 243 159 p (t-test) 0.74 0.91 0.97 Min 28.8 0.0162 28.8 0.0162 28.8 0.0162 Max 2200 902 2200 902 2200 902 n (Patient) 92 58 95 55 99 51 24 48 72 Persistence Period sCr or sCr sCr or UO UO sCr or sCr UO Duration (hr) UO only UO only sCr only only UO only only AUC 0.60 0.59 0.55 0.62 0.62 0.53 0.60 0.60 0.53 SE 0.048 0.048 0.049 0.045 0.046 0.049 0.046 0.046 0.050 p Value 0.034 0.053 0.32 0.0073 0.011 0.55 0.023 0.031 0.50 nCohort Non- 47 50 92 65 66 95 70 72 99 persistent nCohort Persistent 104 100 58 86 84 55 81 78 51 Cutoff Quartile 2 94.3 93.2 97.2 94.3 93.2 97.2 94.3 93.2 97.2 Sensitivity 78% 78% 81% 83% 82% 80% 81% 81% 78% Specificity 32% 32% 29% 35% 35% 28% 33% 32% 27% Cutoff Quartile 3 124 124 125 124 124 125 124 124 125 Sensitivity 55% 54% 50% 57% 56% 49% 57% 56% 51% Specificity 60% 58% 50% 58% 58% 49% 57% 57% 51% Cutoff Quartile 4 200 199 201 200 199 201 200 199 201 Sensitivity 29% 29% 29% 30% 31% 27% 30% 31% 27% Specificity 83% 82% 77% 82% 82% 76% 80% 81% 76% OR Quartile 2 1.65 1.67 1.77 2.59 2.46 1.59 2.15 1.97 1.36 p Value 0.20 0.19 0.16 0.013 0.019 0.26 0.045 0.076 0.45 Lower limit of 95% CI 0.765 0.781 0.801 1.22 1.16 0.716 1.02 0.931 0.612 Upper limit of 95% CI 3.56 3.57 3.93 5.51 5.23 3.52 4.56 4.17 3.04 OR Quartile 3 1.79 1.62 1.00 1.86 1.72 0.944 1.75 1.71 1.06 p Value 0.10 0.17 1.0 0.061 0.10 0.87 0.089 0.10 0.86 Lower limit of 95% CI 0.888 0.817 0.518 0.971 0.899 0.486 0.918 0.897 0.540 Upper limit of 95% CI 3.60 3.22 1.93 3.58 3.31 1.83 3.34 3.27 2.09 OR Quartile 4 1.98 1.86 1.40 1.91 2.02 1.17 1.68 1.84 1.18 p Value 0.13 0.15 0.37 0.10 0.077 0.68 0.18 0.11 0.67 Lower limit of 95% CI 0.827 0.803 0.665 0.880 0.927 0.551 0.791 0.864 0.549 Upper limit of 95% CI 4.72 4.31 2.96 4.16 4.39 2.50 3.58 3.92 2.55

Example 26. Use of CXC Motif Chemokine 9 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0201] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CXC motif chemokine 9 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0202] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0203] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00199 TABLE 26.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 140 747 121 677 111 650 Average 892 14300 774 13800 811 13500 Stdev 2160 38000 1910 37300 2020 37000 p (t-test) 0.0082 0.019 0.029 Min 0.00285 0.00568 0.00285 0.00389 0.00285 0.00389 Max 10500 150000 9930 150000 9930 150000 n (Patient) 57 259 46 270 41 275 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 188 779 206 769 208 763 Average 914 15400 937 15300 964 15000 Stdev 1970 39300 1990 39200 2040 38900 p (t-test) 0.0015 0.0019 0.0028 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 10500 150000 10500 150000 10500 150000 n (Patient) 76 239 74 241 70 245 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 290 1130 287 970 279 952 Average 10100 14900 8880 15700 7840 16000 Stdev 33100 37500 30800 39000 28200 40100 p (t-test) 0.23 0.083 0.037 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00389 Max 150000 150000 150000 150000 150000 150000 n (Patient) 194 120 173 141 156 158 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.69 0.67 0.64 0.71 0.66 0.63 0.71 0.65 0.64 SE 0.035 0.033 0.033 0.037 0.034 0.032 0.038 0.035 0.031 p Value 2.3E8 4.5E7 1.4E5 1.3E8 2.8E6 2.1E5 1.2E8 8.3E6 6.1E6 nCohort 57 76 194 46 74 173 41 70 156 Recovered nCohort Non- 259 239 120 270 241 141 275 245 158 recovered Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 79% 78% 87% 79% 78% 84% 79% 78% 84% Specificity 42% 36% 32% 46% 34% 33% 49% 34% 35% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 56% 57% 63% 55% 56% 61% 55% 56% 61% Specificity 75% 71% 58% 78% 70% 59% 80% 70% 61% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 29% 30% 35% 28% 29% 33% 28% 29% 32% Specificity 93% 89% 81% 93% 89% 82% 93% 89% 81% OR Quartile 2 2.70 1.98 3.13 3.07 1.77 2.66 3.49 1.80 2.82 p Value 0.0013 0.017 2.3E4 7.0E4 0.050 5.5E4 3.0E4 0.046 1.7E4 Lower limit 1.47 1.13 1.71 1.60 1.00 1.53 1.77 1.01 1.64 of 95% CI Upper limit 4.94 3.47 5.73 5.87 3.12 4.63 6.86 3.21 4.83 of 95% CI OR Quartile 3 3.85 3.24 2.41 4.37 3.06 2.25 4.95 2.96 2.41 p Value 5.0E5 3.6E5 2.3E4 9.5E5 8.9E5 4.8E4 1.0E4 1.9E4 1.4E4 Lower limit 2.01 1.86 1.51 2.08 1.75 1.43 2.21 1.67 1.53 of 95% CI Upper limit 7.37 5.66 3.85 9.16 5.36 3.54 11.1 5.23 3.79 of 95% CI OR Quartile 4 5.40 3.59 2.28 5.62 3.45 2.20 4.84 3.16 2.03 p Value 0.0017 0.0014 0.0018 0.0048 0.0020 0.0029 0.010 0.0041 0.0083 Lower limit 1.89 1.64 1.36 1.69 1.57 1.31 1.45 1.44 1.20 of 95% CI Upper limit 15.5 7.86 3.84 18.6 7.55 3.70 16.1 6.94 3.43 of 95% CI

TABLE-US-00200 TABLE 26.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 156 836 147 781 130 763 Average 1110 16200 928 15500 989 15000 Stdev 3160 40300 2100 39500 2200 38900 p (t-test) 4.6E4 0.0011 0.0026 Min 0.00285 0.00568 0.00285 0.00389 0.00285 0.00389 Max 24200 150000 10500 150000 10500 150000 n (Patient) 90 226 79 237 71 245 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 208 852 210 836 211 819 Average 1170 17300 1190 17100 1230 16700 Stdev 2970 41600 3000 41400 3070 41000 p (t-test) 8.4E5 1.1E4 2.1E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 24200 150000 24200 150000 24200 150000 n (Patient) 106 210 104 212 99 217 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 294 1200 308 841 294 841 Average 10800 14400 10900 13700 10100 14400 Stdev 34100 36400 34100 36100 32300 37900 p (t-test) 0.40 0.49 0.28 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00389 Max 150000 150000 150000 150000 150000 150000 n (Patient) 212 102 194 120 178 136 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.70 0.67 0.64 0.69 0.67 0.61 0.69 0.66 0.61 SE 0.030 0.031 0.034 0.032 0.031 0.033 0.033 0.031 0.032 p Value 1.9E11 1.2E8 5.9E5 8.5E10 8.1E8 0.0012 7.3E9 3.1E7 5.6E4 nCohort 90 106 212 79 104 194 71 99 178 Recovered nCohort Non- 226 210 102 237 212 120 245 217 136 recovered Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 81% 80% 88% 80% 79% 85% 80% 79% 85% Specificity 40% 35% 32% 41% 34% 31% 42% 34% 33% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 59% 60% 64% 57% 59% 59% 56% 58% 60% Specificity 73% 69% 57% 72% 68% 56% 72% 68% 57% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 31% 31% 35% 30% 31% 32% 29% 30% 29% Specificity 91% 88% 80% 91% 88% 79% 90% 87% 78% OR Quartile 2 2.84 2.14 3.47 2.75 1.94 2.60 2.93 2.00 2.65 p Value 1.4E4 0.0043 2.7E4 3.2E4 0.014 0.0014 2.0E4 0.010 6.7E4 Lower limit 1.66 1.27 1.78 1.59 1.15 1.45 1.66 1.18 1.51 of 95% CI Upper limit 4.85 3.62 6.76 4.78 3.27 4.67 5.15 3.39 4.64 of 95% CI OR Quartile 3 4.01 3.25 2.29 3.49 3.09 1.82 3.29 2.90 1.98 p Value 4.2E7 3.0E6 8.4E4 1.0E5 8.0E6 0.011 5.0E5 3.0E5 0.0032 Lower limit 2.34 1.98 1.41 2.00 1.88 1.15 1.85 1.76 1.26 of 95% CI Upper limit 6.85 5.34 3.73 6.08 5.07 2.89 5.85 4.78 3.11 of 95% CI OR Quartile 4 4.70 3.28 2.14 4.49 3.16 1.73 3.81 2.89 1.49 p Value 9.9E5 3.4E4 0.0045 3.5E4 5.1E4 0.038 0.0015 0.0014 0.13 Lower limit 2.16 1.71 1.27 1.97 1.65 1.03 1.66 1.51 0.890 of 95% CI Upper limit 10.2 6.28 3.63 10.2 6.06 2.90 8.70 5.54 2.48 of 95% CI

TABLE-US-00201 TABLE 26.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 194 892 208 849 204 763 Average 2930 16900 3120 16400 3370 15700 Stdev 14800 41200 15300 40600 16000 39800 p (t-test) 5.3E4 0.0012 0.0036 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 114 202 107 209 97 219 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 211 934 225 892 234 856 Average 1700 18700 1740 18400 1790 18000 Stdev 4990 43500 5050 43200 5140 42700 p (t-test) 1.5E5 2.4E5 5.0E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 43100 150000 43100 150000 43100 150000 n (Patient) 127 189 124 192 119 197 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 308 1130 333 801 298 841 Average 10800 14400 11300 13100 11200 13100 Stdev 34000 36800 34700 35300 34400 35600 p (t-test) 0.40 0.66 0.64 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 214 100 204 110 190 124 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.68 0.67 0.62 0.66 0.65 0.59 0.65 0.64 0.60 SE 0.030 0.030 0.035 0.031 0.031 0.034 0.032 0.031 0.033 p Value 2.1E9 2.9E8 7.0E4 2.5E7 5.5E7 0.011 2.4E6 4.0E6 0.0027 nCohort 114 127 214 107 124 204 97 119 190 Recovered nCohort Non- 202 189 100 209 192 110 219 197 124 recovered Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 81% 81% 84% 80% 80% 81% 79% 79% 82% Specificity 36% 34% 29% 35% 32% 28% 35% 32% 30% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 60% 60% 63% 58% 59% 59% 57% 58% 60% Specificity 68% 65% 56% 65% 64% 55% 65% 63% 57% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 32% 32% 33% 31% 31% 30% 30% 30% 28% Specificity 87% 85% 79% 86% 85% 77% 86% 84% 77% OR Quartile 2 2.42 2.18 2.19 2.10 1.87 1.68 2.09 1.79 1.99 p Value 8.5E4 0.0032 0.012 0.0053 0.017 0.070 0.0066 0.028 0.015 Lower limit 1.44 1.30 1.19 1.25 1.12 0.957 1.23 1.06 1.14 of 95% CI Upper limit 4.08 3.65 4.03 3.54 3.13 2.96 3.55 2.99 3.46 of 95% CI OR Quartile 3 3.11 2.71 2.17 2.60 2.51 1.76 2.42 2.34 2.02 p Value 4.1E6 2.7E5 0.0018 1.1E4 1.1E4 0.018 4.8E4 3.6E4 0.0028 Lower limit 1.92 1.70 1.33 1.60 1.58 1.10 1.47 1.47 1.27 of 95% CI Upper limit 5.04 4.32 3.54 4.22 4.00 2.81 3.97 3.74 3.19 of 95% CI OR Quartile 4 3.06 2.64 1.80 2.71 2.51 1.47 2.50 2.31 1.30 p Value 3.9E4 9.4E4 0.030 0.0016 0.0017 0.15 0.0047 0.0045 0.31 Lower limit 1.65 1.49 1.06 1.46 1.41 0.872 1.32 1.29 0.779 of 95% CI Upper limit 5.68 4.70 3.05 5.03 4.47 2.48 4.73 4.10 2.19 of 95% CI

TABLE-US-00202 TABLE 26.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 209 999 209 860 208 821 Average 2730 18600 2910 17800 3130 16800 Stdev 13700 43100 14200 42200 14800 41200 p (t-test) 4.9E5 1.8E4 7.1E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 134 182 125 191 114 202 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 213 1040 225 999 216 970 Average 1610 20100 1640 19800 1660 19500 Stdev 4780 44800 4810 44600 4860 44300 p (t-test) 2.0E6 2.8E6 4.6E6 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 43100 150000 43100 150000 43100 150000 n (Patient) 140 176 138 178 135 181 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 324 946 339 781 321 772 Average 10800 14600 11200 13400 11100 13400 Stdev 33800 37100 34500 35700 34100 36200 p (t-test) 0.38 0.61 0.57 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 216 98 207 107 194 120 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.68 0.68 0.61 0.66 0.67 0.59 0.65 0.67 0.59 SE 0.030 0.030 0.035 0.030 0.030 0.034 0.031 0.030 0.033 p Value 1.1E9 1.3E9 0.0027 1.4E7 1.3E8 0.0094 1.5E6 2.9E8 0.0070 nCohort 134 140 216 125 138 207 114 135 194 Recovered nCohort Non- 182 176 98 191 178 107 202 181 120 recovered Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 82% 82% 84% 81% 81% 82% 81% 81% 82% Specificity 35% 34% 29% 34% 33% 29% 35% 33% 30% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 62% 62% 61% 59% 61% 59% 58% 61% 59% Specificity 66% 65% 55% 64% 64% 55% 64% 64% 56% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 32% 33% 32% 31% 33% 29% 30% 32% 28% Specificity 85% 85% 78% 84% 85% 77% 83% 84% 76% OR Quartile 2 2.53 2.44 2.11 2.26 2.20 1.89 2.26 2.16 2.01 p Value 4.7E4 8.0E4 0.017 0.0020 0.0029 0.031 0.0021 0.0035 0.015 Lower limit 1.50 1.45 1.15 1.35 1.31 1.06 1.34 1.29 1.15 of 95% CI Upper limit 4.26 4.11 3.89 3.79 3.69 3.38 3.80 3.62 3.53 of 95% CI OR Quartile 3 3.06 3.02 1.94 2.58 2.87 1.72 2.45 2.81 1.82 p Value 2.4E6 2.7E6 0.0078 6.8E5 7.4E6 0.024 2.1E4 1.2E5 0.011 Lower limit 1.92 1.90 1.19 1.62 1.81 1.07 1.53 1.77 1.15 of 95% CI Upper limit 4.87 4.79 3.15 4.10 4.55 2.76 3.94 4.46 2.89 of 95% CI OR Quartile 4 2.73 2.79 1.62 2.35 2.69 1.35 2.11 2.56 1.22 p Value 5.1E4 3.4E4 0.076 0.0033 5.3E4 0.26 0.011 0.0010 0.45 Lower limit 1.55 1.59 0.950 1.33 1.54 0.797 1.19 1.46 0.726 of 95% CI Upper limit 4.82 4.88 2.76 4.14 4.72 2.29 3.76 4.48 2.05 of 95% CI

TABLE-US-00203 TABLE 26.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 308 926 313 822 313 822 Average 8920 16200 9050 15900 9050 15900 Stdev 30600 39800 30800 39500 30800 39500 p (t-test) 0.066 0.085 0.085 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 188 128 185 131 185 131 sCr only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 252 1130 250 1030 249 1050 Average 3650 20300 3720 19900 3730 19800 Stdev 15000 45600 15200 45300 15200 45100 p (t-test) 1.6E5 2.7E5 3.1E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 120000 150000 120000 150000 120000 150000 n (Patient) 160 156 157 159 156 160 UO only 24 48 72 Non- Non- Non- Recovery Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 328 1070 333 841 321 860 Average 10300 15300 10500 14900 10500 14600 Stdev 32800 38700 33000 38200 33200 37700 p (t-test) 0.24 0.29 0.32 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 211 103 208 106 205 109 24 48 72 Recovery Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.62 0.67 0.60 0.61 0.66 0.60 0.61 0.66 0.61 SE 0.032 0.030 0.035 0.032 0.030 0.034 0.032 0.030 0.034 p Value 3.2E4 2.6E8 0.0027 4.2E4 1.4E7 0.0044 4.2E4 8.4E8 0.0018 nCohort 188 160 211 185 157 208 185 156 205 Recovered nCohort Non- 128 156 103 131 159 106 131 160 109 recovered Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 82% 83% 83% 82% 83% 82% 82% 83% 83% Specificity 30% 33% 29% 30% 33% 29% 30% 33% 29% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 61% 63% 61% 60% 62% 60% 60% 62% 61% Specificity 57% 63% 55% 57% 62% 55% 57% 63% 56% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 31% 33% 31% 31% 33% 30% 31% 32% 30% Specificity 79% 83% 78% 79% 83% 77% 79% 83% 78% OR Quartile 2 1.94 2.48 1.92 2.04 2.42 1.86 2.04 2.46 1.96 p Value 0.018 8.8E4 0.030 0.011 0.0011 0.037 0.011 8.8E4 0.023 Lower limit 1.12 1.45 1.07 1.18 1.42 1.04 1.18 1.45 1.10 of 95% CI Upper limit 3.35 4.23 3.46 3.53 4.12 3.32 3.53 4.19 3.50 of 95% CI OR Quartile 3 2.11 2.97 1.96 2.04 2.74 1.88 2.04 2.82 2.04 p Value 0.0014 3.0E6 0.0060 0.0022 1.4E5 0.0090 0.0022 8.6E6 0.0032 Lower limit 1.33 1.88 1.21 1.29 1.74 1.17 1.29 1.78 1.27 of 95% CI Upper limit 3.33 4.70 3.17 3.21 4.32 3.03 3.21 4.44 3.28 of 95% CI OR Quartile 4 1.74 2.46 1.57 1.65 2.34 1.48 1.65 2.30 1.50 p Value 0.035 8.8E4 0.093 0.057 0.0017 0.14 0.057 0.0021 0.13 Lower limit 1.04 1.45 0.927 0.985 1.38 0.875 0.985 1.35 0.889 of 95% CI Upper limit 2.90 4.19 2.67 2.75 3.98 2.51 2.75 3.91 2.53 of 95% CI

Example 27. Use of CXC Motif Chemokine 9 for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0204] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CXC motif chemokine 9 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0205] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0206] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00204 TABLE 27.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. sCr or UO 24 48 72 Recovery Non- Non- Non- Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 169 892 156 865 143 858 Average 3260 16400 3370 16100 3470 15800 Stdev 18300 40100 18700 39700 19100 39400 p (t-test) 0.0014 0.0022 0.0033 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 108 208 104 212 100 216 sCr only 24 48 72 Recovery Non- Non- Non- Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 210 934 208 913 208 871 Average 3250 17600 3300 17500 3350 17300 Stdev 17100 41800 17200 41600 17400 41400 p (t-test) 2.9E4 3.8E4 4.9E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 126 189 124 191 122 193 UO only 24 48 72 Recovery Non- Non- Non- Period Recovered recovered Recovered recovered Recovered recovered Duration (hr) Cohort Cohort Cohort Cohort Cohort Cohort Median 298 1250 294 1200 294 1130 Average 10800 14700 10500 14900 10200 15000 Stdev 33700 37500 33300 37700 32600 38400 p (t-test) 0.37 0.28 0.24 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 222 92 208 106 198 116 Recovery 24 48 72 Period sCr or sCr UO sCr or sCr UO sCr or sCr UO Duration (hr) UO only only UO only only UO only only AUC 0.70 0.67 0.66 0.70 0.67 0.65 0.71 0.67 0.64 SE 0.029 0.030 0.035 0.029 0.030 0.034 0.029 0.030 0.033 p Value 7.5E12 9.2E9 8.0E6 5.3E12 1.4E8 1.1E5 1.7E12 3.2E8 3.1E5 nCohort 108 126 222 104 124 208 100 122 198 Recovered nCohort Non- 208 189 92 212 191 106 216 193 116 recovered Cutoff 109 108 110 109 108 110 109 108 110 Quartile 2 Sensitivity 83% 82% 89% 83% 82% 89% 84% 82% 87% Specificity 41% 36% 31% 42% 36% 32% 44% 36% 32% Cutoff 485 480 489 485 480 489 485 480 489 Quartile 3 Sensitivity 61% 60% 68% 60% 60% 66% 59% 59% 64% Specificity 70% 65% 58% 70% 65% 58% 70% 64% 58% Cutoff 2650 2520 2790 2650 2520 2790 2650 2520 2790 Quartile 4 Sensitivity 33% 33% 39% 33% 32% 37% 32% 32% 34% Specificity 91% 87% 81% 90% 86% 81% 90% 86% 80% OR Quartile 2 3.40 2.53 3.70 3.71 2.63 3.72 4.06 2.55 3.22 p Value 5.7E6 4.6E4 3.4E4 1.4E6 2.7E4 1.1E4 2.9E7 4.3E4 2.2E4 Lower limit 2.00 1.51 1.81 2.18 1.56 1.91 2.38 1.51 1.73 of 95% CI Upper limit 5.76 4.26 7.56 6.31 4.43 7.26 6.94 4.28 5.97 of 95% CI OR Quartile 3 3.65 2.83 2.96 3.52 2.69 2.70 3.39 2.56 2.44 p Value 3.5E7 1.3E5 3.6E5 9.0E7 3.4E5 6.3E5 2.3E6 8.3E5 2.1E4 Lower limit 2.22 1.77 1.77 2.13 1.69 1.66 2.05 1.60 1.52 of 95% CI Upper limit 6.00 4.52 4.95 5.81 4.30 4.40 5.63 4.08 3.91 of 95% CI OR Quartile 4 4.86 3.13 2.68 4.54 3.03 2.44 4.22 2.92 2.15 p Value 1.3E5 1.7E4 3.1E4 3.2E5 2.6E4 8.3E4 7.5E5 4.1E4 0.0039 Lower limit 2.39 1.73 1.57 2.22 1.67 1.45 2.07 1.61 1.28 of 95% CI Upper limit 9.91 5.67 4.57 9.25 5.48 4.13 8.62 5.30 3.61 of 95% CI

TABLE-US-00205 TABLE 27.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 206 1130 191 1060 166 1050 Average 3470 18200 3520 18000 3620 17600 Stdev 16900 42600 17000 42400 17400 41900 p (t-test) 1.6E4 2.1E4 4.1E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 136 180 134 182 129 187 sCr only Median 216 1190 213 1130 213 1060 Average 3390 19500 3410 19400 3450 19100 Stdev 16200 44000 16200 43900 16300 43700 p (t-test) 3.3E5 3.9E5 5.3E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 149 167 148 168 146 170 UO only Median 294 1350 294 1230 294 1210 Average 10500 15800 10100 16400 9940 15900 Stdev 33400 38300 32400 39800 31900 39800 p (t-test) 0.23 0.14 0.15 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 226 88 220 94 207 107 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.70 0.68 0.66 0.70 0.68 0.65 0.71 0.68 0.64 SE 0.029 0.030 0.036 0.029 0.030 0.035 0.029 0.030 0.034 p Value 1.6E12 4.1E10 5.7E6 2.2E12 5.8E10 1.9E5 4.8E13 1.6E9 5.8E5 nCohort Recovered 136 149 226 134 148 220 129 146 207 nCohort Non-recovered 180 167 88 182 168 94 187 170 107 Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 84% 83% 89% 84% 83% 88% 84% 83% 86% Specificity 37% 34% 31% 37% 34% 31% 39% 34% 31% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 64% 63% 69% 63% 63% 67% 63% 62% 64% Specificity 68% 65% 58% 68% 65% 57% 68% 64% 57% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 35% 34% 40% 35% 34% 38% 34% 34% 35% Specificity 88% 85% 81% 88% 85% 80% 88% 85% 80% OR Quartile 2 3.03 2.58 3.43 3.14 2.63 3.38 3.45 2.53 2.74 p Value 4.0E5 4.3E4 7.5E4 2.3E5 3.4E4 5.6E4 4.9E6 5.3E4 0.0014 Lower limit of 95% CI 1.78 1.52 1.67 1.85 1.55 1.69 2.03 1.50 1.48 Upper limit of 95% CI 5.14 4.38 7.02 5.33 4.46 6.74 5.87 4.28 5.10 OR Quartile 3 3.83 3.24 3.06 3.63 3.16 2.72 3.59 2.99 2.46 p Value 2.6E8 5.8E7 2.9E5 8.2E8 1.0E6 1.0E4 1.3E7 2.9E6 2.6E4 Lower limit of 95% CI 2.39 2.04 1.81 2.27 1.99 1.64 2.23 1.89 1.52 Upper limit of 95% CI 6.14 5.14 5.17 5.82 5.00 4.52 5.77 4.74 3.98 OR Quartile 4 4.04 2.99 2.73 3.90 2.94 2.55 3.59 2.84 2.08 p Value 6.1E6 1.1E4 2.6E4 1.0E5 1.4E4 5.6E4 3.5E5 2.2E4 0.0062 Lower limit of 95% CI 2.21 1.72 1.59 2.13 1.69 1.50 1.96 1.63 1.23 Upper limit of 95% CI 7.39 5.21 4.68 7.15 5.12 4.35 6.57 4.95 3.50

TABLE-US-00206 TABLE 27.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 213 1210 213 1200 209 1130 Average 4910 18500 4970 18300 5090 17900 Stdev 21400 42900 21600 42600 21800 42200 p (t-test) 4.6E4 6.0E4 0.0010 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 154 162 152 164 148 168 sCr only Median 234 1210 241 1210 248 1200 Average 3900 20200 3930 20000 3950 19900 Stdev 17500 44900 17600 44800 17600 44700 p (t-test) 2.6E5 3.1E5 3.6E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 161 155 160 156 159 157 UO only Median 317 1200 313 1200 317 1130 Average 10700 15100 10700 15000 10600 14900 Stdev 33500 38100 33600 37900 33000 38500 p (t-test) 0.31 0.33 0.30 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 224 90 223 91 212 102 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.68 0.62 0.68 0.68 0.62 0.68 0.67 0.61 SE 0.030 0.030 0.036 0.030 0.030 0.036 0.030 0.030 0.035 p Value 4.9E10 2.4E9 8.5E4 1.5E9 3.4E9 6.7E4 1.6E9 8.9E9 0.0014 nCohort Recovered 154 161 224 152 160 223 148 159 212 nCohort Non-recovered 162 155 90 164 156 91 168 157 102 Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 83% 83% 83% 83% 83% 84% 83% 82% 83% Specificity 33% 32% 29% 34% 32% 29% 34% 32% 29% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 65% 65% 64% 64% 64% 65% 63% 64% 62% Specificity 66% 64% 56% 65% 64% 56% 65% 64% 56% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 35% 34% 34% 34% 34% 34% 33% 34% 31% Specificity 85% 84% 79% 85% 84% 78% 84% 84% 78% OR Quartile 2 2.37 2.26 2.00 2.45 2.30 2.04 2.63 2.18 2.07 p Value 0.0014 0.0026 0.030 8.7E4 0.0021 0.025 3.4E4 0.0039 0.018 Lower limit of 95% CI 1.40 1.33 1.07 1.45 1.35 1.09 1.55 1.28 1.14 Upper limit of 95% CI 4.02 3.84 3.74 4.16 3.91 3.81 4.46 3.69 3.76 OR Quartile 3 3.51 3.23 2.29 3.32 3.14 2.35 3.16 3.06 2.03 p Value 1.1E7 6.0E7 0.0013 3.4E7 1.0E6 9.0E4 1.0E6 1.8E6 0.0041 Lower limit of 95% CI 2.21 2.04 1.38 2.10 1.98 1.42 1.99 1.93 1.25 Upper limit of 95% CI 5.58 5.12 3.80 5.27 4.97 3.90 5.00 4.83 3.29 OR Quartile 4 3.01 2.70 1.93 2.91 2.65 1.88 2.72 2.61 1.60 p Value 8.3E5 2.8E4 0.017 1.4E4 3.5E4 0.021 3.5E4 4.5E4 0.080 Lower limit of 95% CI 1.74 1.58 1.12 1.68 1.55 1.10 1.57 1.53 0.945 Upper limit of 95% CI 5.21 4.61 3.30 5.03 4.53 3.23 4.70 4.45 2.72

TABLE-US-00207 TABLE 27.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 225 1210 216 1200 209 1190 Average 5120 19600 5210 19200 5320 18700 Stdev 21200 44400 21300 44000 21600 43500 p (t-test) 2.0E4 3.2E4 5.7E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 168 148 165 151 161 155 sCr only Median 241 1210 248 1210 249 1210 Average 4780 20400 4810 20200 4840 20100 Stdev 19300 45600 19400 45500 19400 45400 p (t-test) 6.1E5 7.2E5 8.6E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 172 144 171 145 170 146 UO only Median 328 1070 324 965 324 841 Average 10800 14800 10800 14700 10500 15000 Stdev 33500 37900 33600 37700 32800 38800 p (t-test) 0.35 0.38 0.29 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 223 91 222 92 214 100 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.68 0.61 0.68 0.68 0.61 0.68 0.67 0.60 SE 0.030 0.030 0.036 0.030 0.030 0.036 0.030 0.031 0.035 p Value 1.2E9 5.9E9 0.0031 2.7E9 8.3E9 0.0029 3.3E9 2.1E8 0.0031 nCohort Recovered 168 172 223 165 171 222 161 170 214 nCohort Non-recovered 148 144 91 151 145 92 155 146 100 Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 84% 83% 84% 84% 83% 84% 85% 83% 84% Specificity 33% 32% 29% 33% 32% 29% 34% 32% 29% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 66% 65% 63% 65% 65% 63% 64% 64% 61% Specificity 64% 63% 55% 64% 63% 55% 63% 62% 55% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 34% 33% 32% 33% 33% 32% 32% 33% 30% Specificity 83% 82% 78% 82% 82% 77% 82% 82% 77% OR Quartile 2 2.51 2.35 2.04 2.65 2.39 2.08 2.83 2.25 2.19 p Value 8.7E4 0.0020 0.025 4.5E4 0.0017 0.022 1.7E4 0.0031 0.012 Lower limit of 95% CI 1.46 1.37 1.09 1.54 1.39 1.11 1.64 1.32 1.19 Upper limit of 95% CI 4.33 4.05 3.81 4.55 4.11 3.88 4.88 3.86 4.03 OR Quartile 3 3.34 3.17 2.06 3.24 3.08 2.12 3.06 2.99 1.92 p Value 3.3E7 9.6E7 0.0046 5.9E7 1.7E6 0.0032 1.8E6 2.9E6 0.0081 Lower limit of 95% CI 2.10 2.00 1.25 2.04 1.94 1.29 1.93 1.89 1.19 Upper limit of 95% CI 5.30 5.03 3.40 5.13 4.88 3.49 4.83 4.74 3.12 OR Quartile 4 2.45 2.27 1.62 2.32 2.23 1.58 2.17 2.20 1.44 p Value 8.5E4 0.0020 0.082 0.0017 0.0025 0.096 0.0038 0.0030 0.18 Lower limit of 95% CI 1.45 1.35 0.941 1.37 1.33 0.922 1.28 1.31 0.846 Upper limit of 95% CI 4.14 3.83 2.78 3.92 3.76 2.72 3.66 3.70 2.46

TABLE-US-00208 TABLE 27.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 313 1070 313 860 317 841 Average 9530 16100 9620 15800 9670 15700 Stdev 31400 39900 31500 39600 31600 39500 p (t-test) 0.11 0.13 0.14 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 203 113 201 115 200 116 sCr only Median 265 1250 265 1250 265 1250 Average 4590 22200 4590 22200 4590 22200 Stdev 18400 47600 18400 47600 18400 47600 p (t-test) 7.0E6 7.0E6 7.0E6 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 185 131 185 131 185 131 UO only Median 339 1070 333 965 355 841 Average 10400 15400 10400 15300 10500 15000 Stdev 32600 39400 32700 39200 32800 38800 p (t-test) 0.24 0.25 0.29 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 217 97 216 98 214 100 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.61 0.67 0.60 0.61 0.67 0.60 0.61 0.67 0.59 SE 0.034 0.031 0.035 0.033 0.031 0.035 0.033 0.031 0.035 p Value 6.3E4 2.6E8 0.0045 8.4E4 2.6E8 0.0040 0.0010 2.6E8 0.0070 nCohort Recovered 203 185 217 201 185 216 200 185 214 nCohort Non-recovered 113 131 97 115 131 98 116 131 100 Cutoff Quartile 2 109 109 110 109 109 110 109 109 110 Sensitivity 83% 84% 82% 83% 84% 83% 84% 84% 82% Specificity 30% 31% 29% 30% 31% 29% 30% 31% 29% Cutoff Quartile 3 485 485 489 485 485 489 485 485 489 Sensitivity 62% 66% 61% 62% 66% 61% 61% 66% 60% Specificity 57% 61% 55% 57% 61% 55% 56% 61% 55% Cutoff Quartile 4 2650 2650 2790 2650 2650 2790 2650 2650 2790 Sensitivity 30% 34% 31% 30% 34% 31% 29% 34% 30% Specificity 78% 82% 77% 78% 82% 77% 78% 82% 77% OR Quartile 2 2.08 2.39 1.88 2.15 2.39 1.92 2.19 2.39 1.82 p Value 0.013 0.0023 0.039 0.0094 0.0023 0.033 0.0079 0.0023 0.048 Lower limit of 95% CI 1.16 1.37 1.03 1.21 1.37 1.05 1.23 1.37 1.01 Upper limit of 95% CI 3.70 4.19 3.43 3.83 4.19 3.50 3.90 4.19 3.28 OR Quartile 3 2.13 3.00 1.89 2.11 3.00 1.94 2.05 3.00 1.81 p Value 0.0017 3.9E6 0.011 0.0017 3.9E6 0.0078 0.0026 3.9E6 0.016 Lower limit of 95% CI 1.33 1.88 1.16 1.32 1.88 1.19 1.29 1.88 1.12 Upper limit of 95% CI 3.41 4.78 3.07 3.38 4.78 3.15 3.27 4.78 2.93 OR Quartile 4 1.51 2.32 1.54 1.46 2.32 1.50 1.43 2.32 1.44 p Value 0.12 0.0014 0.12 0.16 0.0014 0.13 0.18 0.0014 0.18 Lower limit of 95% CI 0.898 1.38 0.899 0.865 1.38 0.881 0.849 1.38 0.846 Upper limit of 95% CI 2.54 3.90 2.62 2.45 3.90 2.57 2.40 3.90 2.46

Example 28. Use of CXC Motif Chemokine 9 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0207] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CXC motif chemokine 9 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0208] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0209] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00209 TABLE 28.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 241 1500 250 2030 272 1720 Average 7260 20300 7000 23100 9610 18500 Stdev 27000 44500 26300 47300 31600 42200 p (t-test) 0.0013 1.4E4 0.047 Min 0.00285 0.0155 0.00285 0.0155 0.00285 0.0155 Max 150000 150000 150000 150000 150000 150000 n (Patient) 204 112 220 96 235 81 sCr only Median 254 1500 258 1840 290 1680 Average 7140 21000 7100 23300 9010 20200 Stdev 26800 45200 26200 47900 30300 44600 p (t-test) 7.4E4 1.4E4 0.012 Min 0.00285 0.0155 0.00285 0.0155 0.00285 0.0155 Max 150000 150000 150000 150000 150000 150000 n (Patient) 207 108 222 93 234 81 UO only Median 391 1640 412 1720 417 1700 Average 11000 18400 10900 19900 10900 20400 Stdev 33500 43200 33300 44600 33200 45100 p (t-test) 0.21 0.14 0.12 Min 0.00285 0.0155 0.00285 0.0155 0.00285 0.0155 Max 150000 150000 150000 150000 150000 150000 n (Patient) 274 40 277 37 278 36 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.70 0.68 0.74 0.73 0.70 0.71 0.69 0.69 SE 0.032 0.032 0.049 0.032 0.033 0.050 0.035 0.036 0.051 p Value 5.7E11 7.8E10 1.6E4 2.4E14 8.7E12 9.4E5 2.2E9 7.0E8 1.4E4 nCohort Non-persistent 204 207 274 220 222 277 235 234 278 nCohort Persistent 112 108 40 96 93 37 81 81 36 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 89% 88% 95% 92% 90% 95% 93% 90% 94% Specificity 33% 32% 28% 32% 32% 28% 31% 30% 28% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 71% 70% 80% 77% 75% 81% 77% 74% 81% Specificity 62% 60% 54% 62% 60% 54% 59% 58% 54% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 39% 41% 38% 45% 44% 41% 40% 40% 42% Specificity 83% 83% 77% 84% 83% 77% 80% 80% 77% OR Quartile 2 4.08 3.42 7.43 5.24 4.30 6.74 5.63 3.97 6.51 p Value 3.6E5 2.0E4 0.0066 2.9E5 1.2E4 0.0099 1.1E4 5.4E4 0.011 Lower limit of 95% CI 2.09 1.79 1.75 2.41 2.04 1.58 2.35 1.82 1.53 Upper limit of 95% CI 7.93 6.55 31.5 11.4 9.04 28.7 13.5 8.68 27.8 OR Quartile 3 4.04 3.62 4.77 5.45 4.63 5.06 4.72 3.97 4.85 p Value 3.9E8 4.2E7 1.6E4 1.4E9 3.0E8 2.0E4 1.3E7 1.5E6 3.1E4 Lower limit of 95% CI 2.45 2.20 2.12 3.15 2.69 2.15 2.66 2.26 2.06 Upper limit of 95% CI 6.64 5.96 10.7 9.42 7.97 11.9 8.41 6.95 11.5 OR Quartile 4 3.12 3.38 1.97 4.15 3.82 2.27 2.61 2.60 2.39 p Value 2.2E5 6.4E6 0.057 2.2E7 1.1E6 0.024 6.0E4 6.4E4 0.018 Lower limit of 95% CI 1.85 1.99 0.979 2.42 2.23 1.11 1.51 1.50 1.16 Upper limit of 95% CI 5.28 5.73 3.96 7.10 6.54 4.63 4.52 4.50 4.90

TABLE-US-00210 TABLE 28.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 234 1250 234 1680 252 1640 Average 6840 19000 6570 21400 9040 18200 Stdev 26200 43200 25300 45800 31100 41200 p (t-test) 0.0021 2.4E4 0.030 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 185 131 203 113 218 98 sCr only Median 254 1230 250 1640 272 1390 Average 6720 19800 6540 21900 8410 19600 Stdev 25800 44300 25200 46400 29600 43400 p (t-test) 0.0010 1.7E4 0.0081 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 191 124 205 110 217 98 UO only Median 328 1320 339 1380 355 1350 Average 11400 14500 11200 15300 11200 15600 Stdev 34500 36400 34300 37600 34200 37900 p (t-test) 0.54 0.43 0.40 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 255 59 259 55 260 54 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.67 0.66 0.72 0.71 0.65 0.70 0.69 0.65 SE 0.031 0.032 0.042 0.031 0.032 0.043 0.033 0.034 0.043 p Value 6.7E10 6.1E8 2.0E4 7.9E13 3.9E11 3.3E4 6.8E10 2.3E8 4.6E4 nCohort Non-persistent 185 191 255 203 205 259 218 217 260 nCohort Persistent 131 124 59 113 110 55 98 98 54 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 86% 85% 92% 89% 88% 91% 91% 89% 91% Specificity 33% 31% 29% 33% 32% 29% 32% 31% 28% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 69% 67% 71% 73% 72% 71% 74% 71% 70% Specificity 63% 61% 55% 63% 61% 54% 61% 59% 54% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 37% 38% 37% 42% 42% 38% 39% 39% 39% Specificity 84% 83% 78% 84% 84% 78% 81% 81% 78% OR Quartile 2 3.09 2.53 4.42 4.15 3.54 4.00 4.68 3.61 3.90 p Value 1.6E4 0.0016 0.0023 2.9E5 1.3E4 0.0046 4.6E5 2.6E4 0.0054 Lower limit of 95% CI 1.72 1.42 1.70 2.13 1.85 1.53 2.23 1.81 1.49 Upper limit of 95% CI 5.54 4.50 11.5 8.07 6.78 10.4 9.82 7.19 10.2 OR Quartile 3 3.78 3.13 3.01 4.72 4.06 2.91 4.57 3.66 2.81 p Value 4.2E8 2.3E6 4.5E4 1.8E9 4.3E8 9.0E4 1.9E8 7.8E7 0.0014 Lower limit of 95% CI 2.35 1.95 1.63 2.85 2.46 1.55 2.69 2.19 1.49 Upper limit of 95% CI 6.07 5.03 5.56 7.83 6.71 5.48 7.76 6.14 5.30 OR Quartile 4 3.09 3.03 2.07 3.81 3.75 2.14 2.73 2.72 2.22 p Value 2.8E5 3.5E5 0.019 8.3E7 1.1E6 0.016 2.0E4 2.2E4 0.012 Lower limit of 95% CI 1.82 1.79 1.13 2.24 2.20 1.15 1.61 1.60 1.19 Upper limit of 95% CI 5.23 5.13 3.78 6.47 6.37 3.97 4.64 4.62 4.12

TABLE-US-00211 TABLE 28.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 234 1250 234 1520 254 1380 Average 6290 18800 5880 20900 8800 17600 Stdev 24600 43300 23700 45400 30400 41100 p (t-test) 0.0014 1.4E4 0.032 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 175 141 190 126 205 111 sCr only Median 252 1210 249 1440 272 1380 Average 6150 19700 5790 21700 8020 19300 Stdev 24200 44400 23400 46200 28700 43500 p (t-test) 5.7E4 7.0E5 0.0062 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 182 133 194 121 207 108 UO only Median 333 1210 339 1320 339 1320 Average 11100 14900 11000 15900 11000 15900 Stdev 34000 38000 33700 39300 33700 39300 p (t-test) 0.43 0.32 0.32 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 246 68 251 63 251 63 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.67 0.63 0.71 0.71 0.63 0.68 0.68 0.63 SE 0.030 0.031 0.040 0.030 0.031 0.041 0.032 0.033 0.041 p Value 1.3E9 4.7E8 0.0012 1.3E12 2.6E11 0.0010 1.3E8 6.2E8 0.0010 nCohort Non-persistent 175 182 246 190 194 251 205 207 251 nCohort Persistent 141 133 68 126 121 63 111 108 63 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 84% 83% 85% 87% 86% 86% 86% 86% 86% Specificity 33% 31% 28% 33% 32% 28% 31% 31% 28% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 67% 66% 68% 71% 70% 68% 71% 69% 68% Specificity 64% 62% 55% 64% 62% 55% 61% 60% 55% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 36% 37% 35% 40% 40% 37% 36% 37% 37% Specificity 84% 84% 78% 85% 85% 78% 81% 81% 78% OR Quartile 2 2.61 2.30 2.26 3.11 2.87 2.32 2.90 2.77 2.32 p Value 6.8E4 0.0032 0.028 1.9E4 5.1E4 0.029 7.4E4 0.0013 0.029 Lower limit of 95% CI 1.50 1.32 1.09 1.71 1.58 1.09 1.56 1.49 1.09 Upper limit of 95% CI 4.55 4.01 4.68 5.63 5.21 4.95 5.40 5.16 4.95 OR Quartile 3 3.67 3.13 2.54 4.49 3.91 2.58 3.94 3.40 2.58 p Value 5.2E8 1.7E6 0.0012 1.6E9 3.8E8 0.0015 6.8E8 1.3E6 0.0015 Lower limit of 95% CI 2.30 1.96 1.44 2.76 2.41 1.44 2.39 2.07 1.44 Upper limit of 95% CI 5.86 4.99 4.48 7.30 6.36 4.64 6.48 5.57 4.64 OR Quartile 4 2.98 2.96 1.89 3.65 3.72 2.00 2.40 2.53 2.00 p Value 5.6E5 5.5E5 0.031 1.9E6 1.3E6 0.022 0.0010 5.0E4 0.022 Lower limit of 95% CI 1.75 1.75 1.06 2.14 2.19 1.11 1.42 1.50 1.11 Upper limit of 95% CI 5.06 5.00 3.39 6.22 6.33 3.62 4.04 4.28 3.62

TABLE-US-00212 TABLE 28.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 234 1250 234 1440 254 1380 Average 6340 18600 5910 20800 7480 19600 Stdev 24800 43100 23700 45200 27300 44000 p (t-test) 0.0017 1.7E4 0.0028 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 173 143 189 127 201 115 sCr only Median 259 1210 250 1400 272 1380 Average 6220 19400 5850 21300 7410 20100 Stdev 24300 44200 23600 45900 27100 44700 p (t-test) 7.8E4 1.0E4 0.0018 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 180 135 192 123 204 111 UO only Median 328 1200 339 1210 339 1210 Average 11200 14400 11000 15500 11000 15500 Stdev 34300 36800 33900 38200 33900 38200 p (t-test) 0.48 0.35 0.35 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 239 75 245 69 245 69 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.66 0.62 0.71 0.69 0.62 0.69 0.67 0.62 SE 0.030 0.031 0.038 0.030 0.031 0.040 0.032 0.033 0.040 p Value 1.9E9 3.3E7 0.0012 6.6E12 3.7E10 0.0017 6.1E9 1.5E7 0.0017 nCohort Non-persistent 173 180 239 189 192 245 201 204 245 nCohort Persistent 143 135 75 127 123 69 115 111 69 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 84% 82% 85% 86% 85% 86% 86% 85% 86% Specificity 32% 31% 28% 32% 31% 28% 31% 30% 28% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 67% 65% 67% 71% 69% 67% 70% 68% 67% Specificity 64% 61% 55% 64% 62% 55% 62% 60% 55% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 36% 36% 35% 39% 40% 35% 37% 37% 35% Specificity 84% 83% 78% 85% 84% 78% 82% 81% 78% OR Quartile 2 2.50 2.04 2.31 2.89 2.49 2.31 2.82 2.41 2.31 p Value 0.0011 0.010 0.019 3.8E4 0.0019 0.024 7.9E4 0.0038 0.024 Lower limit of 95% CI 1.44 1.18 1.15 1.61 1.40 1.12 1.54 1.33 1.12 Upper limit of 95% CI 4.32 3.50 4.65 5.18 4.43 4.78 5.18 4.38 4.78 OR Quartile 3 3.66 2.94 2.47 4.33 3.65 2.41 3.84 3.23 2.41 p Value 5.4E8 5.1E6 0.0011 3.1E9 1.3E7 0.0020 8.1E8 2.5E6 0.0020 Lower limit of 95% CI 2.29 1.85 1.43 2.67 2.25 1.38 2.35 1.98 1.38 Upper limit of 95% CI 5.83 4.68 4.25 7.03 5.90 4.23 6.27 5.27 4.23 OR Quartile 4 3.09 2.85 1.86 3.58 3.58 1.84 2.55 2.56 1.84 p Value 3.4E5 9.6E5 0.031 2.6E6 2.6E6 0.039 4.3E4 4.2E4 0.039 Lower limit of 95% CI 1.81 1.68 1.06 2.10 2.10 1.03 1.51 1.52 1.03 Upper limit of 95% CI 5.27 4.82 3.28 6.10 6.08 3.29 4.29 4.31 3.29

TABLE-US-00213 TABLE 28.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 234 1210 225 1420 250 1380 Average 5600 19100 5230 21200 7610 19000 Stdev 22400 43900 21600 45900 27500 43400 p (t-test) 5.2E4 4.9E5 0.0048 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 169 147 184 132 197 119 sCr only Median 252 1210 249 1400 268 1380 Average 5500 20000 5170 21800 6790 20700 Stdev 22000 45000 21300 46700 25400 45700 p (t-test) 2.2E4 2.4E5 5.6E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 176 139 188 127 200 115 UO only Median 308 1290 321 1320 321 1320 Average 10700 15500 10700 16000 10700 16000 Stdev 33400 38800 33200 39500 33200 39500 p (t-test) 0.29 0.25 0.25 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 234 80 237 77 237 77 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.66 0.64 0.71 0.70 0.64 0.68 0.67 0.64 SE 0.030 0.031 0.037 0.030 0.031 0.038 0.032 0.032 0.038 p Value 3.8E9 1.3E7 1.6E4 3.1E12 1.3E10 3.3E4 1.4E8 6.9E8 3.3E4 nCohort Non-persistent 169 176 234 184 188 237 197 200 237 nCohort Persistent 147 139 80 132 127 77 119 115 77 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 83% 82% 86% 86% 84% 86% 86% 84% 86% Specificity 32% 31% 29% 33% 31% 29% 31% 30% 29% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 66% 65% 69% 70% 69% 68% 69% 68% 68% Specificity 64% 61% 56% 64% 62% 56% 61% 60% 56% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 36% 36% 34% 39% 39% 34% 36% 37% 34% Specificity 85% 84% 78% 85% 85% 78% 82% 82% 78% OR Quartile 2 2.29 2.02 2.57 2.88 2.45 2.41 2.76 2.36 2.41 p Value 0.0025 0.011 0.0079 3.2E4 0.0020 0.013 8.4E4 0.0040 0.013 Lower limit of 95% CI 1.34 1.18 1.28 1.62 1.39 1.20 1.52 1.32 1.20 Upper limit of 95% CI 3.93 3.46 5.15 5.12 4.32 4.85 5.00 4.25 4.85 OR Quartile 3 3.43 2.92 2.85 4.11 3.58 2.61 3.53 3.16 2.61 p Value 1.8E7 5.5E6 1.4E4 6.8E9 1.5E7 5.0E4 3.1E7 3.0E6 5.0E4 Lower limit of 95% CI 2.16 1.84 1.66 2.55 2.23 1.52 2.18 1.95 1.52 Upper limit of 95% CI 5.46 4.63 4.88 6.63 5.77 4.49 5.72 5.12 4.49 OR Quartile 4 3.10 2.85 1.78 3.78 3.56 1.77 2.53 2.53 1.77 p Value 3.6E5 1.0E4 0.042 1.2E6 2.9E6 0.047 4.7E4 4.7E4 0.047 Lower limit of 95% CI 1.81 1.68 1.02 2.21 2.09 1.01 1.50 1.51 1.01 Upper limit of 95% CI 5.30 4.83 3.11 6.47 6.06 3.11 4.26 4.27 3.11

Example 29. Use of CXC Motif Chemokine 9 for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0210] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. CXC motif chemokine 9 is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0211] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0212] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00214 TABLE 29.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 173 1030 225 1210 234 1380 Average 4240 16500 4980 18800 4990 20900 Stdev 22100 39900 21300 43300 20400 45900 p (t-test) 0.0023 3.8E4 4.7E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 119 197 158 158 179 137 sCr only Median 210 934 242 1190 249 1250 Average 4320 17200 4780 19400 4790 21900 Stdev 21200 41000 20900 43900 20000 46800 p (t-test) 0.0011 1.7E4 1.4E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00683 Max 150000 150000 150000 150000 150000 150000 n (Patient) 130 185 162 153 184 131 UO only Median 294 1840 308 1780 321 1720 Average 10300 17400 10500 18200 10700 18400 Stdev 32700 41100 32900 42100 33000 42900 p (t-test) 0.13 0.13 0.15 Min 0.00285 0.0155 0.00285 0.0155 0.00285 0.0155 Max 150000 150000 150000 150000 150000 150000 n (Patient) 241 73 256 58 263 51 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.67 0.71 0.69 0.67 0.70 0.70 0.69 0.69 SE 0.029 0.030 0.037 0.030 0.030 0.041 0.030 0.031 0.044 p Value 3.3E13 1.9E8 2.6E8 4.2E10 1.2E8 1.2E6 6.7E11 5.3E10 8.0E6 nCohort Non-persistent 119 130 241 158 162 256 179 184 263 nCohort Persistent 197 185 73 158 153 58 137 131 51 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 84% 82% 93% 84% 84% 93% 86% 86% 92% Specificity 39% 35% 31% 34% 33% 29% 34% 33% 29% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 62% 61% 75% 64% 63% 78% 68% 68% 78% Specificity 70% 65% 58% 64% 62% 56% 64% 62% 56% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 35% 33% 45% 35% 35% 45% 36% 36% 43% Specificity 91% 86% 81% 85% 84% 79% 84% 83% 78% OR Quartile 2 3.37 2.52 6.03 2.76 2.56 5.59 3.13 3.11 4.69 p Value 6.5E6 4.9E4 2.1E4 2.2E4 6.3E4 0.0013 1.0E4 1.4E4 0.0041 Lower limit of 95% CI 1.99 1.50 2.33 1.61 1.49 1.96 1.76 1.74 1.63 Upper limit of 95% CI 5.71 4.24 15.6 4.74 4.39 16.0 5.57 5.59 13.5 OR Quartile 3 3.75 2.80 4.16 3.14 2.87 4.45 3.71 3.53 4.54 p Value 9.5E8 1.4E5 2.2E6 1.0E6 6.3E6 1.1E5 4.8E8 1.7E7 3.0E5 Lower limit of 95% CI 2.31 1.76 2.31 1.98 1.82 2.29 2.32 2.20 2.23 Upper limit of 95% CI 6.09 4.46 7.51 4.97 4.53 8.65 5.93 5.67 9.23 OR Quartile 4 5.18 3.06 3.50 3.22 2.77 3.11 2.97 2.66 2.74 p Value 2.7E6 1.8E4 1.3E5 3.0E5 1.9E4 2.1E4 5.3E5 2.4E4 0.0016 Lower limit of 95% CI 2.61 1.71 1.99 1.86 1.62 1.71 1.75 1.58 1.46 Upper limit of 95% CI 10.3 5.49 6.13 5.58 4.74 5.67 5.04 4.48 5.13

TABLE-US-00215 TABLE 29.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 164 979 209 1190 209 1250 Average 3140 16700 5050 17800 4640 19800 Stdev 18000 40400 21900 42100 20700 44100 p (t-test) 8.6E4 0.0010 9.2E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 112 204 147 169 165 151 sCr only Median 209 934 225 1070 216 1230 Average 3250 17600 4000 19400 3760 21300 Stdev 17100 41800 17900 44200 17100 46000 p (t-test) 2.9E4 7.1E5 6.1E6 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 126 189 154 161 169 146 UO only Median 286 1350 298 1290 315 1250 Average 10500 15400 10700 15800 10900 15700 Stdev 33600 37600 33800 37900 33900 38100 p (t-test) 0.26 0.27 0.31 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 222 92 238 76 245 69 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.67 0.67 0.69 0.68 0.66 0.70 0.69 0.65 SE 0.029 0.030 0.035 0.029 0.030 0.038 0.029 0.030 0.039 p Value 1.7E13 8.9E9 4.8E7 6.4E11 4.0E9 1.9E5 3.1E12 7.6E11 1.2E4 nCohort Non-persistent 112 126 222 147 154 238 165 169 245 nCohort Persistent 204 189 92 169 161 76 151 146 69 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 83% 82% 90% 85% 84% 89% 86% 86% 88% Specificity 40% 36% 32% 36% 34% 30% 35% 34% 29% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 61% 60% 70% 64% 63% 71% 68% 66% 71% Specificity 71% 65% 58% 66% 63% 57% 66% 64% 56% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 34% 33% 40% 34% 34% 39% 36% 36% 38% Specificity 91% 87% 81% 86% 84% 79% 85% 84% 78% OR Quartile 2 3.36 2.53 4.25 3.10 2.72 3.61 3.36 3.11 3.11 p Value 6.8E6 4.6E4 1.4E4 3.6E5 2.4E4 0.0013 2.3E5 7.3E5 0.0047 Lower limit of 95% CI 1.98 1.51 2.02 1.81 1.60 1.65 1.91 1.78 1.42 Upper limit of 95% CI 5.69 4.26 8.94 5.30 4.65 7.91 5.88 5.45 6.83 OR Quartile 3 3.79 2.83 3.17 3.43 2.86 3.22 4.05 3.50 3.11 p Value 1.3E7 1.3E5 1.3E5 1.8E7 6.4E6 4.1E5 5.0E9 1.3E7 1.2E4 Lower limit of 95% CI 2.31 1.77 1.89 2.16 1.81 1.84 2.54 2.20 1.74 Upper limit of 95% CI 6.21 4.52 5.32 5.46 4.53 5.62 6.48 5.58 5.54 OR Quartile 4 5.21 3.13 2.88 3.14 2.81 2.52 3.12 2.91 2.19 p Value 5.4E6 1.7E4 1.1E4 6.5E5 2.0E4 0.0012 3.7E5 8.6E5 0.0074 Lower limit of 95% CI 2.56 1.73 1.69 1.79 1.63 1.44 1.82 1.71 1.23 Upper limit of 95% CI 10.6 5.67 4.92 5.49 4.84 4.39 5.35 4.96 3.89

TABLE-US-00216 TABLE 29.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 166 970 209 1060 213 1210 Average 3170 16600 5150 17500 4830 18900 Stdev 18100 40300 22100 41800 21200 43300 p (t-test) 9.7E4 0.0015 2.8E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 111 205 144 172 158 158 sCr only Median 210 913 250 1010 250 1200 Average 3310 17500 4080 19100 3890 20500 Stdev 17200 41600 18100 43900 17400 45300 p (t-test) 3.8E4 1.2E4 1.9E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 124 191 151 164 163 152 UO only Median 294 1230 302 1210 318 1210 Average 11000 14000 10600 15300 10800 15200 Stdev 34400 36000 33400 38200 33500 38400 p (t-test) 0.48 0.28 0.33 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 212 102 225 89 232 82 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.66 0.65 0.68 0.66 0.64 0.69 0.67 0.63 SE 0.029 0.030 0.034 0.030 0.030 0.036 0.030 0.030 0.037 p Value 7.0E13 5.7E8 1.9E5 4.5E10 5.4E8 1.4E4 3.3E10 1.9E8 7.2E4 nCohort Non-persistent 111 124 212 144 151 225 158 163 232 nCohort Persistent 205 191 102 172 164 89 158 152 82 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 83% 81% 86% 84% 82% 85% 84% 82% 84% Specificity 40% 35% 31% 35% 33% 29% 34% 32% 28% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 61% 60% 66% 63% 62% 66% 65% 64% 66% Specificity 70% 65% 58% 65% 62% 56% 65% 63% 56% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 34% 32% 36% 34% 34% 36% 34% 34% 34% Specificity 91% 86% 80% 85% 84% 79% 84% 83% 78% OR Quartile 2 3.19 2.29 2.78 2.82 2.30 2.43 2.56 2.17 2.11 p Value 1.6E5 0.0018 0.0016 1.2E4 0.0018 0.0079 5.6E4 0.0042 0.026 Lower limit of 95% CI 1.88 1.36 1.47 1.66 1.36 1.26 1.50 1.28 1.09 Upper limit of 95% CI 5.40 3.84 5.25 4.79 3.90 4.67 4.37 3.69 4.07 OR Quartile 3 3.69 2.69 2.59 3.17 2.64 2.55 3.51 2.95 2.42 p Value 2.2E7 3.4E5 1.4E4 9.6E7 2.8E5 3.5E4 1.1E7 3.8E6 9.9E4 Lower limit of 95% CI 2.25 1.69 1.59 2.00 1.68 1.53 2.21 1.86 1.43 Upper limit of 95% CI 6.05 4.30 4.24 5.03 4.17 4.25 5.57 4.66 4.08 OR Quartile 4 5.12 3.03 2.30 2.98 2.67 2.13 2.76 2.62 1.84 p Value 6.7E6 2.6E4 0.0019 1.3E4 4.0E4 0.0061 2.2E4 3.9E4 0.030 Lower limit of 95% CI 2.52 1.67 1.36 1.70 1.55 1.24 1.61 1.54 1.06 Upper limit of 95% CI 10.4 5.48 3.90 5.22 4.60 3.65 4.74 4.46 3.20

TABLE-US-00217 TABLE 29.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 169 952 209 1050 213 1200 Average 3200 16500 5190 17400 4890 18700 Stdev 18200 40200 22200 41700 21300 43100 p (t-test) 0.0011 0.0017 3.7E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 110 206 143 173 156 160 sCr only Median 210 913 252 970 252 1190 Average 3310 17500 4110 19000 3920 20300 Stdev 17200 41600 18100 43800 17500 45200 p (t-test) 3.8E4 1.4E4 2.3E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 124 191 150 165 162 153 UO only Median 298 1210 317 1130 333 965 Average 11200 13400 10900 14500 11100 14200 Stdev 34700 35400 33800 37300 33900 37300 p (t-test) 0.59 0.39 0.48 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 208 106 220 94 226 88 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.66 0.63 0.68 0.66 0.62 0.68 0.67 0.60 SE 0.029 0.030 0.034 0.030 0.030 0.035 0.030 0.030 0.036 p Value 1.8E12 5.7E8 1.1E4 1.6E9 1.6E7 8.1E4 1.4E9 5.9E8 0.0040 nCohort Non-persistent 110 124 208 143 150 220 156 162 226 nCohort Persistent 206 191 106 173 165 94 160 153 88 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 83% 81% 85% 83% 82% 85% 83% 82% 84% Specificity 39% 35% 30% 35% 33% 30% 33% 31% 29% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 61% 60% 64% 62% 61% 64% 64% 63% 62% Specificity 70% 65% 57% 65% 62% 56% 65% 62% 55% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 33% 32% 35% 34% 33% 34% 34% 34% 32% Specificity 91% 86% 80% 85% 84% 79% 84% 83% 77% OR Quartile 2 3.03 2.29 2.44 2.67 2.18 2.40 2.46 2.05 2.13 p Value 3.5E5 0.0018 0.0040 2.6E4 0.0034 0.0072 8.8E4 0.0076 0.020 Lower limit of 95% CI 1.79 1.36 1.33 1.58 1.29 1.27 1.45 1.21 1.13 Upper limit of 95% CI 5.12 3.84 4.49 4.52 3.68 4.53 4.19 3.47 4.05 OR Quartile 3 3.60 2.69 2.39 3.09 2.57 2.24 3.32 2.87 2.03 p Value 3.8E7 3.4E5 4.0E4 1.6E6 4.6E5 0.0015 3.4E7 6.3E6 0.0061 Lower limit of 95% CI 2.20 1.69 1.48 1.95 1.63 1.36 2.09 1.82 1.22 Upper limit of 95% CI 5.90 4.30 3.88 4.90 4.06 3.68 5.26 4.53 3.36 OR Quartile 4 5.04 3.03 2.12 2.93 2.62 1.90 2.67 2.57 1.60 p Value 8.5E6 2.6E4 0.0049 1.7E4 5.0E4 0.019 3.6E4 4.9E4 0.091 Lower limit of 95% CI 2.47 1.67 1.26 1.67 1.52 1.11 1.56 1.51 0.927 Upper limit of 95% CI 10.3 5.48 3.58 5.13 4.52 3.24 4.58 4.38 2.77

TABLE-US-00218 TABLE 29.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 164 952 208 952 222 1060 Average 3280 16200 5350 17000 5060 18000 Stdev 18500 39900 22600 41200 21700 42400 p (t-test) 0.0017 0.0031 8.4E4 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 106 210 138 178 150 166 sCr only Median 209 924 242 970 249 1190 Average 3350 17200 4190 18500 3990 19800 Stdev 17500 41300 18400 43300 17700 44700 p (t-test) 5.3E4 2.3E4 4.4E5 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 121 194 146 169 158 157 UO only Median 286 1230 308 1200 321 1190 Average 10700 14100 10500 15000 10300 15600 Stdev 33700 36800 33000 38400 32600 39300 p (t-test) 0.41 0.29 0.22 Min 0.00285 0.00568 0.00285 0.00568 0.00285 0.00568 Max 150000 150000 150000 150000 150000 150000 n (Patient) 202 112 212 102 217 97 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.67 0.65 0.67 0.66 0.63 0.67 0.67 0.62 SE 0.029 0.030 0.033 0.030 0.030 0.034 0.030 0.030 0.035 p Value 1.0E12 1.8E8 1.0E5 5.1E9 7.2E8 2.2E4 1.0E8 2.9E8 6.5E4 nCohort Non-persistent 106 121 202 138 146 212 150 158 217 nCohort Persistent 210 194 112 178 169 102 166 157 97 Cutoff Quartile 2 109 108 110 109 108 110 109 108 110 Sensitivity 82% 81% 86% 83% 82% 85% 83% 82% 85% Specificity 40% 36% 31% 36% 34% 30% 34% 32% 29% Cutoff Quartile 3 485 480 489 485 480 489 485 480 489 Sensitivity 60% 60% 65% 61% 61% 64% 63% 63% 63% Specificity 71% 65% 58% 64% 62% 57% 64% 63% 56% Cutoff Quartile 4 2650 2520 2790 2650 2520 2790 2650 2520 2790 Sensitivity 33% 32% 35% 33% 33% 33% 33% 34% 32% Specificity 92% 87% 80% 86% 84% 79% 84% 84% 78% OR Quartile 2 3.07 2.42 2.72 2.72 2.34 2.51 2.54 2.20 2.29 p Value 3.0E5 8.5E4 0.0012 1.9E4 0.0014 0.0037 5.5E4 0.0035 0.0093 Lower limit of 95% CI 1.81 1.44 1.48 1.61 1.39 1.35 1.50 1.30 1.23 Upper limit of 95% CI 5.20 4.07 4.99 4.59 3.95 4.67 4.31 3.72 4.26 OR Quartile 3 3.70 2.80 2.63 2.87 2.58 2.29 2.98 2.86 2.14 p Value 3.2E7 1.9E5 7.6E5 7.4E6 4.5E5 8.4E4 3.0E6 6.4E6 0.0025 Lower limit of 95% CI 2.24 1.75 1.63 1.81 1.64 1.41 1.89 1.81 1.31 Upper limit of 95% CI 6.11 4.48 4.24 4.55 4.07 3.73 4.72 4.52 3.49 OR Quartile 4 5.39 3.16 2.16 2.93 2.65 1.86 2.60 2.59 1.65 p Value 8.3E6 2.0E4 0.0037 2.1E4 5.0E4 0.022 5.6E4 5.0E4 0.065 Lower limit of 95% CI 2.57 1.72 1.29 1.66 1.53 1.10 1.51 1.52 0.970 Upper limit of 95% CI 11.3 5.78 3.64 5.16 4.59 3.14 4.48 4.42 2.82

Example 30. Use of Hepatocyte Growth Factor-Like Protein for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0213] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Hepatocyte growth factor-like protein is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0214] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0215] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00219 TABLE 30.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.147 0.297 0.150 0.277 0.147 0.272 Average 0.673 3.81 0.701 3.70 0.739 3.64 Stdev 1.79 18.0 1.93 17.7 2.04 17.6 p (t-test) 0.20 0.25 0.29 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 55 257 46 266 41 271 sCr only Median 0.164 0.308 0.165 0.306 0.164 0.310 Average 0.714 4.05 0.722 4.03 0.653 4.00 Stdev 1.73 18.7 1.74 18.7 1.68 18.5 p (t-test) 0.13 0.13 0.14 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 73 238 72 239 68 243 UO only Median 0.182 0.440 0.176 0.350 0.181 0.322 Average 1.38 6.33 1.41 5.58 1.16 5.38 Stdev 5.00 25.7 5.24 23.8 3.46 22.9 p (t-test) 0.010 0.027 0.024 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 54.5 176 54.5 176 27.3 176 n (Patient) 192 118 172 138 155 155 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.63 0.61 0.65 0.63 0.61 0.65 0.63 0.62 0.63 SE 0.039 0.036 0.033 0.041 0.036 0.032 0.043 0.036 0.031 p Value 5.2E4 0.0027 2.1E6 0.0019 0.0036 3.4E6 0.0021 7.7E4 3.7E5 nCohort Recovered 55 73 192 46 72 172 41 68 155 nCohort Non-recovered 257 238 118 266 239 138 271 243 155 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 78% 77% 88% 77% 77% 86% 77% 77% 83% Specificity 40% 32% 33% 39% 32% 34% 39% 34% 34% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 54% 54% 63% 53% 54% 60% 53% 54% 58% Specificity 67% 63% 58% 67% 62% 58% 68% 65% 58% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 28% 29% 36% 27% 28% 33% 27% 28% 32% Specificity 87% 86% 81% 87% 86% 81% 85% 87% 82% OR Quartile 2 2.39 1.53 3.71 2.21 1.57 3.27 2.16 1.75 2.50 p Value 0.0055 0.15 4.9E5 0.018 0.13 5.8E5 0.029 0.062 8.1E4 Lower limit of 95% CI 1.29 0.858 1.97 1.14 0.879 1.84 1.08 0.973 1.46 Upper limit of 95% CI 4.43 2.73 7.00 4.26 2.80 5.83 4.30 3.14 4.29 OR Quartile 3 2.38 2.02 2.30 2.33 1.95 2.10 2.41 2.18 1.92 p Value 0.0056 0.011 5.0E4 0.012 0.015 0.0015 0.014 0.0062 0.0047 Lower limit of 95% CI 1.29 1.18 1.44 1.20 1.14 1.33 1.20 1.25 1.22 Upper limit of 95% CI 4.41 3.46 3.69 4.52 3.36 3.31 4.84 3.81 3.01 OR Quartile 4 2.62 2.52 2.39 2.47 2.47 2.19 2.11 2.60 2.16 p Value 0.025 0.012 0.0011 0.048 0.015 0.0033 0.11 0.013 0.0044 Lower limit of 95% CI 1.13 1.22 1.42 1.01 1.19 1.30 0.852 1.22 1.27 Upper limit of 95% CI 6.06 5.20 4.04 6.08 5.09 3.69 5.23 5.53 3.67

TABLE-US-00220 TABLE 30.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.147 0.319 0.149 0.311 0.149 0.310 Average 0.622 4.28 0.642 4.15 0.679 4.02 Stdev 1.64 19.2 1.70 18.9 1.79 18.6 p (t-test) 0.078 0.10 0.13 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 87 225 79 233 71 241 sCr only Median 0.163 0.321 0.164 0.320 0.153 0.321 Average 0.707 4.52 0.713 4.50 0.668 4.43 Stdev 1.68 19.9 1.69 19.9 1.65 19.7 p (t-test) 0.054 0.056 0.061 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 103 209 102 210 97 215 UO only Median 0.207 0.372 0.217 0.322 0.217 0.321 Average 1.77 6.37 1.82 5.65 1.36 5.80 Stdev 6.02 27.4 6.24 25.5 3.66 24.6 p (t-test) 0.021 0.047 0.019 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 54.5 176 54.5 176 27.3 176 n (Patient) 209 101 193 117 177 133 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.66 0.63 0.63 0.64 0.63 0.61 0.64 0.64 0.59 SE 0.033 0.032 0.035 0.034 0.032 0.033 0.035 0.032 0.033 p Value 1.4E6 4.2E5 2.8E4 2.2E5 6.2E5 0.0013 6.0E5 7.8E6 0.0042 nCohort Recovered 87 103 209 79 102 193 71 97 177 nCohort Non-recovered 225 209 101 233 210 117 241 215 133 Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 81% 79% 86% 80% 80% 84% 79% 80% 81% Specificity 40% 34% 31% 39% 34% 31% 39% 36% 30% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 56% 56% 61% 55% 56% 59% 54% 56% 57% Specificity 64% 62% 56% 63% 62% 55% 63% 64% 55% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 31% 31% 37% 30% 31% 34% 29% 31% 33% Specificity 90% 87% 80% 90% 87% 80% 89% 88% 81% OR Quartile 2 2.85 1.99 2.74 2.56 2.03 2.27 2.49 2.26 1.85 p Value 1.5E4 0.011 0.0019 8.9E4 0.0087 0.0055 0.0017 0.0027 0.026 Lower limit of 95% CI 1.66 1.17 1.45 1.47 1.20 1.27 1.41 1.33 1.07 Upper limit of 95% CI 4.90 3.37 5.18 4.45 3.44 4.05 4.39 3.85 3.17 OR Quartile 3 2.26 2.09 1.98 2.07 2.03 1.79 2.03 2.28 1.65 p Value 0.0018 0.0028 0.0056 0.0068 0.0040 0.014 0.011 0.0011 0.030 Lower limit of 95% CI 1.35 1.29 1.22 1.22 1.25 1.12 1.18 1.39 1.05 Upper limit of 95% CI 3.77 3.38 3.22 3.49 3.30 2.85 3.50 3.74 2.60 OR Quartile 4 3.83 3.12 2.37 3.81 3.07 2.12 3.22 3.14 2.08 p Value 4.1E4 6.0E4 0.0014 8.1E4 7.4E4 0.0048 0.0035 8.3E4 0.0058 Lower limit of 95% CI 1.82 1.63 1.39 1.74 1.60 1.26 1.47 1.61 1.24 Upper limit of 95% CI 8.08 5.99 4.02 8.34 5.89 3.57 7.08 6.13 3.50

TABLE-US-00221 TABLE 30.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.153 0.322 0.158 0.321 0.158 0.320 Average 0.677 4.69 0.678 4.59 0.708 4.39 Stdev 1.78 20.3 1.81 20.1 1.89 19.6 p (t-test) 0.039 0.046 0.067 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 111 201 106 206 96 216 sCr only Median 0.169 0.321 0.172 0.320 0.169 0.322 Average 0.758 4.91 0.770 4.86 0.736 4.77 Stdev 1.81 21.0 1.82 20.9 1.80 20.6 p (t-test) 0.029 0.032 0.035 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 124 188 122 190 117 195 UO only Median 0.239 0.325 0.238 0.322 0.238 0.322 Average 2.40 5.09 2.45 4.77 2.02 5.17 Stdev 10.9 24.4 11.1 23.3 10.3 22.8 p (t-test) 0.18 0.24 0.099 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 133 176 133 176 133 176 n (Patient) 210 100 201 109 187 123 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.65 0.62 0.60 0.65 0.62 0.59 0.64 0.62 0.60 SE 0.031 0.032 0.035 0.032 0.032 0.034 0.032 0.032 0.033 p Value 1.0E6 8.9E5 0.0063 4.5E6 2.9E4 0.0064 1.5E5 1.0E4 0.0038 nCohort Recovered 111 124 210 106 122 201 96 117 187 nCohort Non-recovered 201 188 100 206 190 109 216 195 123 Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 82% 80% 84% 81% 79% 83% 80% 79% 81% Specificity 37% 32% 30% 36% 32% 29% 36% 32% 29% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 57% 57% 58% 57% 56% 58% 56% 57% 57% Specificity 63% 60% 54% 63% 60% 54% 64% 62% 55% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 32% 32% 34% 32% 32% 34% 31% 32% 34% Specificity 88% 86% 79% 89% 86% 80% 89% 86% 81% OR Quartile 2 2.60 1.88 2.20 2.32 1.82 1.97 2.31 1.86 1.81 p Value 3.7E4 0.017 0.012 0.0017 0.024 0.022 0.0021 0.019 0.035 Lower limit of 95% CI 1.54 1.12 1.19 1.37 1.08 1.10 1.35 1.11 1.04 Upper limit of 95% CI 4.39 3.16 4.05 3.92 3.06 3.52 3.93 3.14 3.15 OR Quartile 3 2.28 2.02 1.61 2.26 1.92 1.62 2.22 2.11 1.58 p Value 6.8E4 0.0028 0.053 9.1E4 0.0056 0.044 0.0016 0.0017 0.049 Lower limit of 95% CI 1.42 1.27 0.995 1.40 1.21 1.01 1.35 1.32 1.00 Upper limit of 95% CI 3.68 3.21 2.60 3.66 3.05 2.60 3.64 3.38 2.51 OR Quartile 4 3.60 3.02 1.94 3.69 2.92 2.01 3.47 2.94 2.17 p Value 1.1E4 2.7E4 0.014 1.3E4 4.2E4 0.0093 4.1E4 5.0E4 0.0034 Lower limit of 95% CI 1.88 1.67 1.14 1.89 1.61 1.19 1.74 1.60 1.29 Upper limit of 95% CI 6.90 5.49 3.30 7.20 5.30 3.39 6.93 5.40 3.66

TABLE-US-00222 TABLE 30.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.165 0.356 0.165 0.333 0.164 0.321 Average 0.879 4.98 0.898 4.82 0.953 4.57 Stdev 2.88 21.3 2.96 20.9 3.09 20.3 p (t-test) 0.029 0.039 0.061 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 27.3 176 27.3 176 27.3 176 n (Patient) 131 181 124 188 113 199 sCr only Median 0.169 0.344 0.170 0.339 0.169 0.341 Average 0.932 5.08 0.945 5.03 0.919 4.98 Stdev 2.87 21.6 2.88 21.5 2.88 21.3 p (t-test) 0.026 0.029 0.031 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 27.3 176 27.3 176 27.3 176 n (Patient) 137 175 135 177 132 180 UO only Median 0.239 0.333 0.232 0.333 0.238 0.322 Average 2.11 5.77 2.14 5.44 1.98 5.33 Stdev 10.2 25.1 10.4 24.1 10.2 23.2 p (t-test) 0.068 0.094 0.081 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 133 176 133 176 133 176 n (Patient) 212 98 204 106 191 119 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.66 0.64 0.61 0.65 0.63 0.61 0.64 0.63 0.60 SE 0.031 0.031 0.035 0.031 0.031 0.034 0.031 0.031 0.033 p Value 2.5E7 6.0E6 0.0028 1.2E6 2.3E5 0.0010 7.0E6 1.8E5 0.0021 nCohort Recovered 131 137 212 124 135 204 113 132 191 nCohort Non-recovered 181 175 98 188 177 106 199 180 119 Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 83% 82% 83% 82% 81% 83% 81% 81% 82% Specificity 36% 34% 29% 35% 33% 29% 36% 33% 29% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 58% 58% 58% 57% 58% 58% 56% 58% 57% Specificity 61% 61% 54% 61% 60% 54% 61% 61% 54% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 34% 34% 37% 34% 33% 37% 32% 33% 35% Specificity 88% 86% 80% 88% 86% 81% 88% 86% 81% OR Quartile 2 2.71 2.26 1.92 2.49 2.18 2.04 2.49 2.15 1.83 p Value 2.1E4 0.0022 0.033 6.2E4 0.0033 0.018 6.3E4 0.0040 0.034 Lower limit of 95% CI 1.60 1.34 1.05 1.48 1.30 1.13 1.48 1.28 1.05 Upper limit of 95% CI 4.58 3.81 3.51 4.20 3.67 3.67 4.21 3.61 3.20 OR Quartile 3 2.17 2.15 1.62 2.14 2.04 1.68 2.02 2.11 1.59 p Value 9.5E4 0.0010 0.051 0.0013 0.0022 0.032 0.0034 0.0014 0.048 Lower limit of 95% CI 1.37 1.36 0.997 1.35 1.29 1.05 1.26 1.33 1.00 Upper limit of 95% CI 3.43 3.39 2.62 3.40 3.22 2.70 3.23 3.33 2.53 OR Quartile 4 3.74 3.16 2.35 3.66 3.05 2.46 3.35 3.17 2.35 p Value 2.0E5 9.4E5 0.0016 3.9E5 1.5E4 8.0E4 1.8E4 1.1E4 0.0014 Lower limit of 95% CI 2.04 1.77 1.38 1.97 1.71 1.45 1.78 1.76 1.39 Upper limit of 95% CI 6.87 5.63 4.00 6.80 5.44 4.17 6.32 5.69 3.96

TABLE-US-00223 TABLE 30.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.202 0.372 0.195 0.356 0.195 0.356 Average 2.03 5.06 2.06 4.95 2.06 4.95 Stdev 10.8 22.1 10.9 21.9 10.9 21.9 p (t-test) 0.11 0.13 0.13 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 133 176 133 176 133 176 n (Patient) 185 127 182 130 182 130 sCr only Median 0.181 0.342 0.178 0.331 0.175 0.339 Average 1.96 4.58 2.00 4.49 1.97 4.50 Stdev 11.1 20.4 11.2 20.2 11.2 20.2 p (t-test) 0.16 0.18 0.17 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 133 176 133 176 133 176 n (Patient) 157 155 154 158 153 159 UO only Median 0.217 0.339 0.217 0.331 0.217 0.322 Average 2.15 5.51 2.18 5.37 2.19 5.25 Stdev 10.3 24.5 10.4 24.1 10.5 23.8 p (t-test) 0.091 0.11 0.12 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 133 176 133 176 133 176 n (Patient) 207 103 204 106 201 109 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.64 0.63 0.60 0.64 0.62 0.60 0.64 0.63 0.60 SE 0.032 0.031 0.035 0.032 0.031 0.034 0.032 0.031 0.034 p Value 1.4E5 3.7E5 0.0042 1.6E5 9.8E5 0.0031 1.6E5 4.5E5 0.0043 nCohort Recovered 185 157 207 182 154 204 182 153 201 nCohort Non-recovered 127 155 103 130 158 106 130 159 109 Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 82% 82% 82% 82% 82% 82% 82% 82% 81% Specificity 30% 32% 29% 30% 32% 29% 30% 32% 28% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 62% 59% 60% 62% 58% 60% 62% 58% 60% Specificity 58% 59% 55% 58% 58% 55% 58% 59% 55% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 38% 34% 35% 37% 34% 35% 37% 34% 35% Specificity 84% 84% 80% 84% 84% 80% 84% 84% 80% OR Quartile 2 1.91 2.12 1.76 2.01 2.08 1.86 2.01 2.11 1.66 p Value 0.021 0.0054 0.056 0.013 0.0066 0.036 0.013 0.0054 0.080 Lower limit of 95% CI 1.10 1.25 0.985 1.16 1.23 1.04 1.16 1.25 0.942 Upper limit of 95% CI 3.32 3.60 3.15 3.49 3.51 3.33 3.49 3.58 2.92 OR Quartile 3 2.31 2.12 1.85 2.23 1.96 1.89 2.23 2.01 1.82 p Value 3.9E4 0.0011 0.012 6.3E4 0.0034 0.0088 6.3E4 0.0023 0.013 Lower limit of 95% CI 1.45 1.35 1.15 1.41 1.25 1.17 1.41 1.28 1.14 Upper limit of 95% CI 3.67 3.33 3.00 3.54 3.07 3.05 3.54 3.16 2.92 OR Quartile 4 3.14 2.74 2.11 2.97 2.60 2.13 2.97 2.76 2.15 p Value 2.4E5 2.6E4 0.0055 5.7E5 5.2E4 0.0048 5.7E5 2.6E4 0.0041 Lower limit of 95% CI 1.85 1.60 1.24 1.75 1.52 1.26 1.75 1.60 1.27 Upper limit of 95% CI 5.34 4.71 3.58 5.04 4.47 3.61 5.04 4.77 3.64

Example 31. Use of Hepatocyte Growth Factor-Like Protein for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0216] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Hepatocyte growth factor-like protein is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0217] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0218] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00224 TABLE 31.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.147 0.321 0.149 0.321 0.148 0.321 Average 0.680 4.57 0.645 4.51 0.658 4.45 Stdev 1.62 20.0 1.56 19.8 1.58 19.7 p (t-test) 0.048 0.051 0.058 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 105 207 101 211 98 214 sCr only Median 0.164 0.321 0.164 0.321 0.164 0.321 Average 0.693 4.95 0.701 4.90 0.708 4.85 Stdev 1.57 21.0 1.58 20.9 1.59 20.8 p (t-test) 0.025 0.028 0.031 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 123 188 121 190 119 192 UO only Median 0.205 0.502 0.202 0.505 0.212 0.336 Average 2.40 5.33 2.46 4.85 2.29 4.95 Stdev 12.8 22.9 13.2 21.5 12.9 21.2 p (t-test) 0.15 0.23 0.17 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 218 92 205 105 196 114 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.64 0.63 0.64 0.64 0.63 0.64 0.64 0.63 0.61 SE 0.032 0.032 0.035 0.032 0.032 0.034 0.032 0.032 0.034 p Value 5.5E6 6.4E5 5.6E5 5.9E6 7.1E5 2.1E5 1.2E5 7.9E5 7.7E4 nCohort Recovered 105 123 218 101 121 205 98 119 196 nCohort Non-recovered 207 188 92 211 190 105 214 192 114 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 80% 79% 89% 81% 79% 89% 80% 79% 85% Specificity 35% 31% 31% 37% 31% 32% 37% 32% 31% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 57% 57% 63% 56% 57% 63% 56% 57% 59% Specificity 64% 60% 56% 63% 60% 57% 63% 61% 55% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 31% 32% 36% 31% 32% 35% 30% 32% 33% Specificity 87% 86% 79% 87% 86% 80% 87% 86% 80% OR Quartile 2 2.20 1.65 3.72 2.40 1.72 3.68 2.38 1.78 2.58 p Value 0.0033 0.057 3.3E4 0.0012 0.041 1.3E4 0.0014 0.029 0.0019 Lower limit of 95% CI 1.30 0.985 1.82 1.41 1.02 1.89 1.40 1.06 1.42 Upper limit of 95% CI 3.73 2.78 7.61 4.07 2.88 7.18 4.05 3.00 4.69 OR Quartile 3 2.34 1.99 2.13 2.24 2.00 2.21 2.20 2.01 1.75 p Value 5.8E4 0.0034 0.0031 0.0012 0.0033 0.0013 0.0017 0.0032 0.019 Lower limit of 95% CI 1.44 1.26 1.29 1.37 1.26 1.36 1.34 1.26 1.10 Upper limit of 95% CI 3.79 3.17 3.51 3.64 3.18 3.57 3.59 3.20 2.79 OR Quartile 4 2.91 2.99 2.15 3.01 2.89 2.18 2.85 2.79 1.95 p Value 9.8E4 3.1E4 0.0053 9.1E4 4.8E4 0.0038 0.0016 7.4E4 0.012 Lower limit of 95% CI 1.54 1.65 1.26 1.57 1.59 1.29 1.49 1.54 1.16 Upper limit of 95% CI 5.49 5.44 3.68 5.78 5.25 3.69 5.48 5.07 3.29

TABLE-US-00225 TABLE 31.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.164 0.372 0.165 0.372 0.164 0.372 Average 0.665 5.19 0.674 5.13 0.644 5.06 Stdev 1.70 21.5 1.72 21.3 1.68 21.1 p (t-test) 0.016 0.018 0.019 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 133 179 131 181 127 185 sCr only Median 0.169 0.380 0.170 0.372 0.170 0.372 Average 0.694 5.52 0.698 5.49 0.704 5.42 Stdev 1.68 22.2 1.69 22.2 1.70 22.1 p (t-test) 0.0094 0.0100 0.011 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 12.3 176 n (Patient) 146 166 145 167 143 169 UO only Median 0.210 0.536 0.212 0.512 0.217 0.372 Average 2.45 5.32 2.48 5.11 2.32 5.13 Stdev 12.7 23.4 12.8 22.8 12.7 22.0 p (t-test) 0.17 0.20 0.16 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 222 88 217 93 205 105 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.66 0.64 0.65 0.66 0.64 0.63 0.66 0.64 0.62 SE 0.030 0.031 0.036 0.031 0.031 0.035 0.031 0.031 0.034 p Value 1.1E7 2.9E6 4.8E5 3.0E7 4.4E6 1.4E4 2.3E7 5.1E6 7.9E4 nCohort Recovered 133 146 222 131 145 217 127 143 205 nCohort Non-recovered 179 166 88 181 167 93 185 169 105 Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 82% 80% 89% 82% 80% 87% 82% 80% 85% Specificity 34% 30% 31% 34% 30% 30% 35% 31% 30% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 60% 60% 64% 59% 59% 62% 59% 59% 59% Specificity 63% 61% 55% 63% 61% 55% 63% 61% 55% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 35% 36% 39% 35% 36% 38% 35% 36% 36% Specificity 89% 88% 80% 89% 88% 80% 89% 87% 80% OR Quartile 2 2.26 1.67 3.44 2.35 1.70 2.95 2.35 1.76 2.41 p Value 0.0021 0.050 7.3E4 0.0014 0.043 0.0016 0.0013 0.031 0.0047 Lower limit of 95% CI 1.34 0.999 1.68 1.39 1.02 1.51 1.40 1.05 1.31 Upper limit of 95% CI 3.81 2.81 7.06 3.95 2.86 5.78 3.97 2.96 4.44 OR Quartile 3 2.55 2.31 2.17 2.42 2.25 2.05 2.44 2.25 1.74 p Value 7.3E5 3.1E4 0.0028 1.8E4 4.7E4 0.0047 1.6E4 4.7E4 0.023 Lower limit of 95% CI 1.61 1.46 1.31 1.53 1.43 1.25 1.53 1.43 1.08 Upper limit of 95% CI 4.04 3.64 3.62 3.84 3.54 3.37 3.88 3.55 2.80 OR Quartile 4 4.27 4.03 2.55 4.13 3.96 2.44 4.27 3.82 2.34 p Value 4.2E6 3.2E6 7.1E4 7.0E6 4.3E6 0.0011 6.9E6 7.3E6 0.0016 Lower limit of 95% CI 2.30 2.24 1.48 2.22 2.20 1.43 2.27 2.13 1.38 Upper limit of 95% CI 7.93 7.23 4.38 7.66 7.11 4.17 8.04 6.87 3.96

TABLE-US-00226 TABLE 31.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.169 0.388 0.169 0.388 0.165 0.372 Average 0.869 5.50 0.870 5.44 0.851 5.35 Stdev 2.73 22.5 2.75 22.4 2.75 22.1 p (t-test) 0.012 0.014 0.016 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 27.3 176 27.3 176 27.3 176 n (Patient) 151 161 149 163 145 167 sCr only Median 0.172 0.401 0.175 0.388 0.178 0.380 Average 0.873 5.71 0.878 5.67 0.883 5.64 Stdev 2.68 23.0 2.69 22.9 2.70 22.9 p (t-test) 0.0091 0.0097 0.010 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 27.3 176 27.3 176 27.3 176 n (Patient) 158 154 157 155 156 156 UO only Median 0.232 0.358 0.238 0.344 0.240 0.321 Average 3.09 3.71 3.10 3.67 2.96 3.89 Stdev 15.5 18.7 15.5 18.6 15.5 18.3 p (t-test) 0.76 0.78 0.64 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 220 90 219 91 208 102 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.66 0.65 0.61 0.66 0.64 0.60 0.66 0.64 0.59 SE 0.031 0.031 0.036 0.031 0.031 0.036 0.031 0.031 0.035 p Value 3.6E7 2.1E6 0.0037 2.7E7 3.3E6 0.0062 3.7E7 5.1E6 0.0089 nCohort Recovered 151 158 220 149 157 219 145 156 208 nCohort Non-recovered 161 154 90 163 155 91 167 156 102 Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 82% 81% 86% 82% 81% 85% 82% 81% 84% Specificity 32% 30% 30% 33% 31% 29% 33% 31% 30% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 61% 61% 60% 61% 61% 59% 60% 60% 57% Specificity 62% 61% 54% 62% 61% 54% 62% 60% 53% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 36% 36% 36% 36% 36% 35% 36% 36% 34% Specificity 87% 86% 79% 87% 86% 79% 88% 86% 79% OR Quartile 2 2.19 1.80 2.48 2.26 1.83 2.27 2.26 1.87 2.28 p Value 0.0036 0.027 0.0065 0.0024 0.023 0.012 0.0023 0.019 0.0081 Lower limit of 95% CI 1.29 1.07 1.29 1.34 1.09 1.20 1.34 1.11 1.24 Upper limit of 95% CI 3.70 3.04 4.78 3.84 3.10 4.31 3.82 3.15 4.20 OR Quartile 3 2.63 2.43 1.77 2.64 2.36 1.71 2.50 2.30 1.51 p Value 3.3E5 1.3E4 0.025 3.3E5 2.1E4 0.035 8.2E5 3.2E4 0.091 Lower limit of 95% CI 1.67 1.54 1.07 1.67 1.50 1.04 1.59 1.46 0.936 Upper limit of 95% CI 4.16 3.82 2.91 4.17 3.72 2.80 3.95 3.62 2.43 OR Quartile 4 3.69 3.53 2.09 3.88 3.47 2.04 3.96 3.41 2.00 p Value 7.2E6 9.1E6 0.0076 4.2E6 1.2E5 0.0096 4.3E6 1.6E5 0.0100 Lower limit of 95% CI 2.09 2.02 1.22 2.18 1.99 1.19 2.20 1.95 1.18 Upper limit of 95% CI 6.52 6.17 3.58 6.92 6.06 3.50 7.11 5.95 3.40

TABLE-US-00227 TABLE 31.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.175 0.388 0.172 0.388 0.169 0.380 Average 2.67 3.92 2.71 3.85 2.74 3.79 Stdev 16.8 16.0 17.0 15.8 17.2 15.6 p (t-test) 0.50 0.54 0.57 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 165 147 162 150 158 154 sCr only Median 0.181 0.388 0.182 0.380 0.183 0.372 Average 2.65 3.99 2.66 3.96 2.68 3.93 Stdev 16.6 16.2 16.7 16.1 16.7 16.1 p (t-test) 0.47 0.49 0.50 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 169 143 168 144 167 145 UO only Median 0.238 0.372 0.232 0.358 0.240 0.321 Average 2.84 4.29 2.85 4.25 2.92 3.99 Stdev 15.1 19.4 15.2 19.3 15.4 18.5 p (t-test) 0.48 0.50 0.59 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 219 91 218 92 210 100 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.64 0.61 0.65 0.64 0.61 0.65 0.64 0.60 SE 0.031 0.031 0.036 0.031 0.032 0.036 0.031 0.032 0.035 p Value 1.1E6 7.1E6 0.0025 7.7E7 1.1E5 0.0025 1.1E6 1.7E5 0.0044 nCohort Recovered 165 169 219 162 168 218 158 167 210 nCohort Non- 147 143 91 150 144 92 154 145 100 recovered Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 82% 81% 84% 83% 81% 84% 82% 81% 84% Specificity 32% 30% 29% 32% 30% 29% 32% 31% 30% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 62% 62% 59% 62% 61% 60% 61% 61% 57% Specificity 61% 60% 54% 61% 60% 54% 61% 59% 53% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 37% 37% 37% 37% 37% 37% 37% 37% 36% Specificity 86% 85% 80% 86% 85% 80% 87% 85% 80% OR Quartile 2 2.14 1.86 2.05 2.25 1.89 2.09 2.24 1.92 2.20 p Value 0.0054 0.023 0.025 0.0030 0.019 0.021 0.0030 0.016 0.012 Lower limit of 95% 1.25 1.09 1.09 1.32 1.11 1.12 1.32 1.13 1.19 CI Upper limit of 95% CI 3.66 3.16 3.83 3.85 3.22 3.90 3.82 3.27 4.05 OR Quartile 3 2.50 2.38 1.71 2.56 2.31 1.75 2.43 2.25 1.51 p Value 8.3E5 2.0E4 0.035 5.3E5 3.1E4 0.026 1.3E4 4.7E4 0.090 Lower limit of 95% 1.58 1.51 1.04 1.62 1.47 1.07 1.54 1.43 0.938 CI Upper limit of 95% CI 3.95 3.75 2.80 4.05 3.64 2.88 3.82 3.54 2.45 OR Quartile 4 3.69 3.39 2.37 3.79 3.33 2.32 3.83 3.27 2.25 p Value 3.7E6 1.1E5 0.0017 2.9E6 1.4E5 0.0022 3.0E6 1.9E5 0.0027 Lower limit of 95% 2.12 1.97 1.39 2.17 1.93 1.35 2.18 1.9 1.32 CI Upper limit of 95% CI 6.42 5.84 4.06 6.62 5.74 3.97 6.74 5.63 3.82

TABLE-US-00228 TABLE 31.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Non- Non- Non- Recovered recovered Recovered recovered Recovered recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.214 0.350 0.210 0.350 0.212 0.344 Average 2.95 3.81 2.97 3.76 2.99 3.73 Stdev 15.8 17.5 15.9 17.4 15.9 17.3 p (t-test) 0.66 0.68 0.70 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 200 112 198 114 197 115 sCr only Median 0.190 0.364 0.190 0.364 0.190 0.364 Average 2.87 3.81 2.87 3.81 2.87 3.81 Stdev 16.2 16.8 16.2 16.8 16.2 16.8 p (t-test) 0.62 0.62 0.62 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 182 130 182 130 182 130 UO only Median 0.226 0.339 0.221 0.331 0.221 0.331 Average 2.92 4.04 2.93 4.00 2.95 3.94 Stdev 15.3 18.8 15.4 18.7 15.4 18.5 p (t-test) 0.58 0.60 0.62 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 213 97 212 98 210 100 Recovery Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.61 0.62 0.60 0.61 0.62 0.60 0.61 0.62 0.60 SE 0.034 0.032 0.035 0.034 0.032 0.035 0.034 0.032 0.035 p Value 0.0011 1.9E4 0.0066 6.8E4 1.9E4 0.0064 7.6E4 1.9E4 0.0050 nCohort Recovered 200 182 213 198 182 212 197 182 210 nCohort Non- 112 130 97 114 130 98 115 130 100 recovered Cutoff Quartile 2 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 0.0928 0.0928 0.0938 Sensitivity 81% 82% 82% 82% 82% 83% 82% 82% 83% Specificity 28% 30% 29% 29% 30% 29% 29% 30% 29% Cutoff Quartile 3 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 0.251 Sensitivity 61% 62% 60% 61% 62% 60% 61% 62% 60% Specificity 56% 59% 54% 57% 59% 55% 56% 59% 55% Cutoff Quartile 4 1.17 1.17 1.16 1.17 1.17 1.16 1.17 1.17 1.16 Sensitivity 36% 35% 35% 36% 35% 35% 36% 35% 35% Specificity 81% 82% 79% 81% 82% 79% 81% 82% 80% OR Quartile 2 1.73 1.86 1.89 1.79 1.86 1.92 1.82 1.86 2.00 p Value 0.058 0.025 0.038 0.043 0.025 0.033 0.037 0.025 0.024 Lower limit of 95% 0.982 1.08 1.03 1.02 1.08 1.05 1.04 1.08 1.10 CI Upper limit of 95% CI 3.04 3.21 3.45 3.15 3.21 3.51 3.20 3.21 3.65 OR Quartile 3 1.97 2.36 1.78 2.07 2.36 1.83 2.01 2.36 1.82 p Value 0.0049 2.7E4 0.021 0.0024 2.7E4 0.015 0.0035 2.7E4 0.016 Lower limit of 95% 1.23 1.49 1.09 1.29 1.49 1.12 1.26 1.49 1.12 CI Upper limit of 95% CI 3.15 3.74 2.90 3.32 3.74 2.97 3.21 3.74 2.95 OR Quartile 4 2.37 2.57 2.07 2.44 2.57 2.03 2.40 2.57 2.09 p Value 0.0012 4.2E4 0.0073 8.2E4 4.2E4 0.0092 0.0011 4.2E4 0.0064 Lower limit of 95% 1.40 1.52 1.22 1.45 1.52 1.19 1.42 1.52 1.23 CI Upper limit of 95% CI 4.00 4.34 3.53 4.12 4.34 3.45 4.04 4.34 3.55

Example 32. Use of Hepatocyte Growth Factor-Like Protein for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0219] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Hepatocyte growth factor-like protein is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0220] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0221] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00229 TABLE 32.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.170 0.873 0.178 1.18 0.190 1.13 Average 1.52 6.42 1.45 7.41 1.61 8.04 Stdev 12.0 22.0 11.6 23.6 11.3 25.6 p (t-test) 0.011 0.0030 0.0024 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 201 111 217 95 232 80 sCr only Median 0.180 0.870 0.183 1.02 0.192 0.872 Average 1.57 6.49 1.52 7.41 1.70 7.79 Stdev 11.9 22.4 11.5 24.0 11.4 25.6 p (t-test) 0.012 0.0038 0.0041 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 204 107 219 92 231 80 UO only Median 0.241 1.17 0.246 1.25 0.244 1.31 Average 2.69 7.15 2.67 7.69 2.66 7.90 Stdev 14.0 27.8 13.9 28.9 13.9 29.3 p (t-test) 0.11 0.082 0.072 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 270 40 273 37 274 36 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.71 0.69 0.67 0.75 0.72 0.67 0.72 0.69 0.68 SE 0.032 0.033 0.049 0.032 0.034 0.051 0.035 0.036 0.051 p Value 4.1E11 7.1E9 4.7E4 2.6E14 8.4E11 6.5E4 1.7E10 2.3E7 3.7E4 nCohort Non- 201 204 270 217 219 273 232 231 274 persistent nCohort Persistent 111 107 40 95 92 37 80 80 36 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 86% 84% 90% 89% 88% 89% 91% 88% 89% Specificity 31% 30% 27% 31% 31% 27% 31% 29% 27% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 68% 66% 65% 73% 71% 62% 71% 69% 64% Specificity 60% 58% 52% 60% 58% 52% 57% 56% 52% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 45% 44% 50% 51% 47% 54% 49% 44% 56% Specificity 86% 85% 79% 86% 84% 79% 83% 81% 79% OR Quartile 2 2.65 2.26 3.40 3.88 3.25 3.07 4.60 2.92 2.96 p Value 0.0017 0.0077 0.025 2.0E4 8.6E4 0.040 2.9E4 0.0036 0.047 Lower limit of 95% 1.44 1.24 1.17 1.90 1.62 1.05 2.02 1.42 1.01 CI Upper limit of 95% CI 4.87 4.11 9.88 7.93 6.49 8.96 10.5 6.00 8.66 OR Quartile 3 3.28 2.76 2.03 3.97 3.39 1.75 3.33 2.83 1.90 p Value 2.0E6 4.5E5 0.045 2.9E7 4.9E6 0.12 1.8E5 1.6E4 0.080 Lower limit of 95% 2.01 1.69 1.02 2.34 2.01 0.867 1.92 1.65 0.926 CI Upper limit of 95% CI 5.36 4.50 4.06 6.71 5.71 3.55 5.77 4.86 3.91 OR Quartile 4 5.06 4.37 3.66 6.37 4.61 4.36 4.71 3.40 4.66 p Value 6.1E9 8.7E8 2.1E4 7.4E11 4.1E8 4.6E5 5.1E8 1.4E5 2.7E5 Lower limit of 95% 2.93 2.55 1.84 3.65 2.67 2.15 2.70 1.96 2.27 CI Upper limit of 95% CI 8.75 7.50 7.25 11.1 7.97 8.86 8.22 5.91 9.55

TABLE-US-00230 TABLE 32.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.167 0.655 0.172 0.989 0.183 1.07 Average 1.58 5.61 1.48 6.43 1.64 6.85 Stdev 12.6 20.4 12.1 21.9 11.8 23.3 p (t-test) 0.033 0.010 0.0094 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 182 130 200 112 215 97 sCr only Median 0.183 0.563 0.184 0.870 0.192 0.747 Average 1.67 5.71 1.59 6.37 1.76 6.58 Stdev 12.4 21.0 12.0 22.2 11.8 23.4 p (t-test) 0.034 0.014 0.016 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 188 123 202 109 214 97 UO only Median 0.238 1.07 0.240 1.16 0.240 1.17 Average 2.80 5.25 2.77 5.59 2.76 5.70 Stdev 14.5 23.0 14.4 23.8 14.4 24.0 p (t-test) 0.31 0.25 0.23 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 251 59 255 55 256 54 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.68 0.65 0.65 0.72 0.68 0.65 0.72 0.67 0.65 SE 0.031 0.032 0.042 0.031 0.033 0.043 0.033 0.034 0.043 p Value 3.5E9 1.9E6 3.9E4 2.9E12 1.6E8 6.1E4 5.2E11 8.7E7 3.9E4 nCohort Non- 182 188 251 200 202 255 215 214 256 persistent nCohort Persistent 130 123 59 112 109 55 97 97 54 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 82% 80% 86% 86% 83% 85% 89% 85% 85% Specificity 30% 29% 28% 31% 30% 27% 31% 29% 27% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 65% 63% 64% 70% 67% 62% 70% 66% 63% Specificity 61% 58% 53% 61% 59% 53% 59% 57% 53% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 42% 40% 46% 46% 43% 49% 47% 42% 50% Specificity 87% 85% 80% 87% 85% 80% 85% 83% 80% OR Quartile 2 2.01 1.66 2.47 2.70 2.14 2.22 3.54 2.28 2.16 p Value 0.013 0.068 0.026 0.0014 0.012 0.050 3.4E4 0.0096 0.058 Lower limit of 95% 1.16 0.962 1.11 1.47 1.19 1.00 1.77 1.22 0.973 CI Upper limit of 95% CI 3.49 2.87 5.46 4.95 3.85 4.94 7.06 4.26 4.81 OR Quartile 3 2.95 2.31 2.07 3.59 2.91 1.79 3.38 2.57 1.90 p Value 5.8E6 4.3E4 0.015 3.8E7 1.8E5 0.055 3.2E6 2.1E4 0.038 Lower limit of 95% 1.85 1.45 1.15 2.19 1.79 0.987 2.03 1.56 1.04 CI Upper limit of 95% CI 4.72 3.68 3.73 5.87 4.73 3.26 5.65 4.24 3.47 OR Quartile 4 4.68 3.63 3.31 5.80 4.18 3.86 5.16 3.50 4.02 p Value 4.6E8 2.4E6 8.6E5 5.3E10 1.9E7 1.5E5 4.3E9 4.7E6 9.4E6 Lower limit of 95% 2.69 2.12 1.82 3.33 2.44 2.09 2.98 2.05 2.17 CI Upper limit of 95% CI 8.13 6.20 6.01 10.1 7.17 7.11 8.92 5.99 7.44

TABLE-US-00231 TABLE 32.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.169 0.534 0.172 0.726 0.185 0.704 Average 1.67 5.19 1.57 5.75 1.74 6.01 Stdev 13.0 19.6 12.5 20.7 12.2 21.9 p (t-test) 0.059 0.027 0.028 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 171 141 186 126 201 111 sCr only Median 0.178 0.534 0.181 0.579 0.190 0.534 Average 1.71 5.35 1.63 5.87 1.80 6.05 Stdev 12.8 20.2 12.3 21.2 12.1 22.3 p (t-test) 0.053 0.027 0.030 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 178 133 191 120 204 107 UO only Median 0.241 0.466 0.246 0.893 0.246 0.893 Average 2.90 4.59 2.85 4.92 2.85 4.92 Stdev 14.8 21.5 14.6 22.3 14.6 22.3 p (t-test) 0.46 0.37 0.37 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 242 68 247 63 247 63 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.65 0.61 0.69 0.67 0.61 0.68 0.65 0.61 SE 0.031 0.032 0.040 0.031 0.032 0.041 0.033 0.034 0.041 p Value 7.3E8 4.0E6 0.0055 6.6E10 7.6E8 0.0058 4.0E8 4.3E6 0.0058 nCohort Non- 171 178 242 186 191 247 201 204 247 persistent nCohort Persistent 141 133 68 126 120 63 111 107 63 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 82% 80% 85% 85% 83% 84% 86% 84% 84% Specificity 31% 29% 28% 32% 30% 28% 31% 30% 28% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 64% 62% 59% 67% 66% 57% 66% 64% 57% Specificity 61% 59% 52% 61% 60% 52% 59% 57% 52% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 38% 38% 40% 41% 40% 43% 41% 39% 43% Specificity 86% 84% 79% 86% 84% 79% 84% 82% 79% OR Quartile 2 2.08 1.70 2.27 2.62 2.18 2.01 2.92 2.26 2.01 p Value 0.0077 0.053 0.027 0.0011 0.0074 0.061 7.1E4 0.0077 0.061 Lower limit of 95% 1.21 0.993 1.10 1.47 1.23 0.969 1.57 1.24 0.969 CI Upper limit of 95% CI 3.58 2.90 4.69 4.66 3.86 4.18 5.43 4.11 4.18 OR Quartile 3 2.81 2.39 1.58 3.17 2.85 1.43 2.73 2.44 1.43 p Value 1.2E5 2.1E4 0.10 1.8E6 1.5E5 0.21 4.4E5 3.0E4 0.21 Lower limit of 95% 1.77 1.51 0.915 1.97 1.77 0.821 1.69 1.51 0.821 CI Upper limit of 95% CI 4.45 3.79 2.72 5.08 4.59 2.51 4.42 3.96 2.51 OR Quartile 4 3.80 3.23 2.47 4.32 3.58 2.88 3.74 3.02 2.88 p Value 1.9E6 1.8E5 0.0021 1.4E7 2.9E6 4.0E4 1.3E6 4.4E5 4.0E4 Lower limit of 95% 2.20 1.89 1.39 2.51 2.10 1.60 2.19 1.78 1.60 CI Upper limit of 95% CI 6.58 5.51 4.39 7.46 6.10 5.18 6.38 5.12 5.18

TABLE-US-00232 TABLE 32.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.169 0.534 0.175 0.704 0.185 0.606 Average 1.68 5.13 1.58 5.70 1.76 5.83 Stdev 13.1 19.5 12.5 20.6 12.3 21.6 p (t-test) 0.065 0.029 0.034 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 169 143 185 127 197 115 sCr only Median 0.183 0.413 0.182 0.552 0.190 0.534 Average 1.73 5.27 1.65 5.73 1.82 5.87 Stdev 12.9 20.1 12.4 21.0 12.2 21.9 p (t-test) 0.060 0.032 0.037 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 176 135 188 123 200 111 UO only Median 0.238 0.606 0.240 0.893 0.240 0.893 Average 2.72 4.98 2.67 5.37 2.67 5.37 Stdev 14.6 21.3 14.4 22.2 14.4 22.2 p (t-test) 0.30 0.23 0.23 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 235 75 241 69 241 69 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.67 0.64 0.63 0.69 0.67 0.63 0.67 0.65 0.63 SE 0.031 0.032 0.038 0.031 0.032 0.040 0.032 0.033 0.040 p Value 9.5E8 1.4E5 0.0010 2.2E9 2.2E7 0.0016 9.7E8 5.2E6 0.0016 nCohort Non- 169 176 235 185 188 241 197 200 241 persistent nCohort Persistent 143 135 75 127 123 69 115 111 69 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 82% 80% 85% 84% 83% 84% 85% 84% 84% Specificity 31% 29% 29% 31% 30% 28% 31% 30% 28% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 64% 61% 61% 66% 65% 59% 65% 64% 59% Specificity 62% 59% 54% 61% 60% 53% 59% 57% 53% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 38% 37% 41% 41% 39% 43% 41% 39% 43% Specificity 86% 84% 80% 86% 84% 80% 84% 82% 80% OR Quartile 2 2.00 1.63 2.32 2.44 2.11 2.03 2.59 2.21 2.03 p Value 0.011 0.072 0.018 0.0021 0.0092 0.048 0.0018 0.0081 0.048 Lower limit of 95% 1.17 0.958 1.15 1.38 1.20 1.00 1.42 1.23 1.00 CI Upper limit of 95% CI 3.42 2.78 4.67 4.32 3.71 4.10 4.70 3.99 4.10 OR Quartile 3 2.80 2.25 1.83 3.07 2.74 1.63 2.69 2.40 1.63 p Value 1.2E5 5.2E4 0.025 3.2E6 2.7E5 0.077 5.0E5 3.3E4 0.077 Lower limit of 95% 1.77 1.42 1.08 1.91 1.71 0.948 1.67 1.49 0.948 CI Upper limit of 95% CI 4.44 3.56 3.12 4.91 4.39 2.81 4.33 3.87 2.81 OR Quartile 4 3.97 3.11 2.82 4.24 3.37 3.09 3.70 2.98 3.09 p Value 1.1E6 3.1E5 2.9E4 2.0E7 7.7E6 1.1E4 1.6E6 5.0E5 1.1E4 Lower limit of 95% 2.28 1.82 1.61 2.46 1.98 1.75 2.17 1.76 1.75 CI Upper limit of 95% CI 6.90 5.30 4.93 7.31 5.74 5.48 6.31 5.05 5.48

TABLE-US-00233 TABLE 32.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.169 0.413 0.172 0.579 0.183 0.545 Average 1.71 5.00 1.61 5.51 1.78 5.65 Stdev 13.3 19.3 12.7 20.3 12.4 21.2 p (t-test) 0.077 0.038 0.043 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 165 147 180 132 193 119 sCr only Median 0.183 0.388 0.182 0.545 0.190 0.413 Average 1.76 5.13 1.68 5.56 1.85 5.68 Stdev 13.0 19.8 12.6 20.7 12.3 21.6 p (t-test) 0.072 0.040 0.047 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 172 139 184 127 196 115 UO only Median 0.221 0.466 0.238 0.545 0.238 0.545 Average 2.75 4.75 2.72 4.92 2.72 4.92 Stdev 14.8 20.6 14.7 21.0 14.7 21.0 p (t-test) 0.35 0.31 0.31 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 230 80 233 77 233 77 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.66 0.63 0.63 0.68 0.66 0.62 0.67 0.64 0.62 SE 0.031 0.032 0.038 0.031 0.032 0.038 0.032 0.033 0.038 p Value 1.7E7 2.8E5 8.0E4 3.7E9 5.7E7 0.0011 9.5E8 1.2E5 0.0011 nCohort Non- 165 172 230 180 184 233 193 196 233 persistent nCohort Persistent 147 139 80 132 127 77 119 115 77 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 82% 80% 85% 84% 83% 84% 85% 83% 84% Specificity 31% 29% 29% 32% 30% 28% 31% 30% 28% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 63% 61% 62% 66% 65% 61% 66% 63% 61% Specificity 62% 59% 54% 62% 60% 54% 60% 58% 54% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 38% 37% 40% 40% 39% 42% 40% 38% 42% Specificity 87% 84% 80% 86% 84% 80% 84% 83% 80% OR Quartile 2 1.99 1.62 2.28 2.45 2.09 2.14 2.53 2.18 2.14 p Value 0.011 0.072 0.017 0.0018 0.0095 0.028 0.0019 0.0085 0.028 Lower limit of 95% 1.17 0.957 1.16 1.40 1.20 1.09 1.41 1.22 1.09 CI Upper limit of 95% CI 3.39 2.76 4.49 4.30 3.64 4.22 4.55 3.88 4.22 OR Quartile 3 2.79 2.24 1.98 3.11 2.71 1.81 2.80 2.37 1.81 p Value 1.2E5 5.4E4 0.010 2.1E6 3.0E5 0.026 2.1E5 3.7E4 0.026 Lower limit of 95% 1.76 1.42 1.18 1.95 1.70 1.07 1.74 1.47 1.07 CI Upper limit of 95% CI 4.41 3.53 3.34 4.97 4.33 3.07 4.51 3.80 3.07 OR Quartile 4 4.00 3.11 2.67 4.16 3.36 2.89 3.67 2.95 2.89 p Value 1.2E6 3.3E5 4.9E4 3.3E7 8.7E6 1.8E4 1.8E6 5.7E5 1.8E4 Lower limit of 95% 2.29 1.82 1.54 2.41 1.97 1.66 2.15 1.74 1.66 CI Upper limit of 95% CI 6.99 5.32 4.63 7.19 5.73 5.04 6.27 5.00 5.04

Example 33. Use of Hepatocyte Growth Factor-Like Protein for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0222] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Hepatocyte growth factor-like protein is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0223] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0224] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00234 TABLE 33.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.148 0.325 0.165 0.388 0.169 0.529 Average 0.639 4.81 0.710 5.78 0.864 6.36 Stdev 1.54 20.5 1.70 22.8 2.59 24.4 p (t-test) 0.030 0.0062 0.0032 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 116 196 155 157 176 136 sCr only Median 0.165 0.321 0.170 0.401 0.178 0.469 Average 0.727 5.02 0.724 5.92 0.894 6.57 Stdev 1.62 21.2 1.69 23.2 2.56 24.9 p (t-test) 0.024 0.0051 0.0026 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 127 184 159 152 181 130 UO only Median 0.203 0.704 0.217 0.870 0.232 1.11 Average 2.24 6.61 2.29 7.44 2.75 5.84 Stdev 12.3 25.6 12.0 28.4 14.3 24.5 p (t-test) 0.047 0.030 0.22 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 237 73 251 59 258 52 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.62 0.68 0.66 0.65 0.68 0.67 0.65 0.68 SE 0.031 0.032 0.038 0.031 0.031 0.041 0.031 0.032 0.044 p Value 1.1E6 1.2E4 1.2E6 2.6E7 2.4E6 1.4E5 4.3E8 1.2E6 4.1E5 nCohort Non- 116 127 237 155 159 251 176 181 258 persistent nCohort Persistent 196 184 73 157 152 59 136 130 52 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 80% 79% 92% 81% 80% 93% 84% 82% 92% Specificity 34% 31% 30% 31% 30% 29% 32% 30% 29% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 58% 57% 68% 62% 61% 68% 65% 64% 67% Specificity 64% 59% 56% 62% 60% 54% 61% 60% 53% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 33% 33% 44% 38% 38% 44% 38% 37% 48% Specificity 88% 86% 81% 88% 87% 79% 85% 83% 79% OR Quartile 2 2.04 1.65 4.87 1.90 1.64 5.75 2.42 2.03 4.83 p Value 0.0073 0.058 4.2E4 0.016 0.064 0.0011 0.0018 0.012 0.0035 Lower limit of 95% 1.21 0.983 2.02 1.12 0.973 2.01 1.39 1.17 1.68 CI Upper limit of 95% CI 3.43 2.76 11.7 3.21 2.76 16.4 4.22 3.52 13.9 OR Quartile 3 2.45 1.88 2.73 2.63 2.40 2.49 2.91 2.61 2.37 p Value 2.1E4 0.0072 4.0E4 3.3E5 1.6E4 0.0029 6.5E6 5.2E5 0.0072 Lower limit of 95% 1.53 1.19 1.57 1.67 1.52 1.37 1.83 1.64 1.26 CI Upper limit of 95% CI 3.93 2.97 4.77 4.15 3.79 4.54 4.63 4.16 4.44 OR Quartile 4 3.53 2.93 3.24 4.31 3.94 3.02 3.57 2.95 3.58 p Value 9.4E5 3.3E4 4.3E5 7.5E7 1.9E6 3.0E4 4.0E6 6.3E5 5.9E5 Lower limit of 95% 1.87 1.63 1.84 2.42 2.24 1.66 2.08 1.74 1.92 CI Upper limit of 95% CI 6.66 5.27 5.69 7.69 6.93 5.48 6.14 5.00 6.67

TABLE-US-00235 TABLE 33.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.149 0.321 0.165 0.380 0.165 0.529 Average 0.649 4.66 0.685 5.47 0.840 5.87 Stdev 1.58 20.2 1.69 22.1 2.65 23.3 p (t-test) 0.039 0.010 0.0066 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 109 203 144 168 162 150 sCr only Median 0.165 0.321 0.170 0.380 0.172 0.505 Average 0.726 4.93 0.736 5.65 0.892 5.98 Stdev 1.64 21.0 1.73 22.6 2.66 23.7 p (t-test) 0.027 0.0082 0.0063 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 123 188 151 160 166 145 UO only Median 0.202 0.575 0.212 0.630 0.221 0.798 Average 2.33 5.48 2.37 5.99 2.86 4.65 Stdev 12.8 22.9 12.4 25.0 14.9 21.2 p (t-test) 0.12 0.095 0.43 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 218 92 233 77 240 70 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.65 0.62 0.66 0.66 0.64 0.66 0.68 0.65 0.65 SE 0.032 0.032 0.035 0.031 0.031 0.038 0.030 0.031 0.039 p Value 3.6E6 1.3E4 3.9E6 2.2E7 6.5E6 3.1E5 4.2E9 6.6E7 1.0E4 nCohort Non- 109 123 218 144 151 233 162 166 240 persistent nCohort Persistent 203 188 92 168 160 77 150 145 70 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 80% 79% 89% 81% 79% 90% 84% 81% 89% Specificity 35% 31% 31% 32% 30% 30% 33% 31% 29% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 57% 56% 65% 61% 60% 65% 64% 63% 64% Specificity 63% 59% 56% 62% 60% 55% 63% 61% 54% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 32% 32% 40% 36% 36% 40% 38% 37% 43% Specificity 88% 86% 81% 88% 87% 80% 87% 86% 80% OR Quartile 2 2.18 1.65 3.72 1.99 1.63 3.70 2.63 1.94 3.19 p Value 0.0036 0.057 3.3E4 0.0093 0.063 0.0011 5.2E4 0.015 0.0039 Lower limit of 95% 1.29 0.985 1.82 1.19 0.973 1.69 1.52 1.14 1.45 CI Upper limit of 95% CI 3.68 2.78 7.61 3.36 2.74 8.11 4.53 3.30 7.01 OR Quartile 3 2.30 1.89 2.43 2.58 2.28 2.26 3.02 2.62 2.13 p Value 6.5E4 0.0069 5.9E4 5.1E5 3.9E4 0.0028 2.6E6 3.9E5 0.0072 Lower limit of 95% 1.43 1.19 1.46 1.63 1.44 1.32 1.91 1.66 1.23 CI Upper limit of 95% CI 3.71 2.99 4.03 4.07 3.58 3.85 4.79 4.14 3.69 OR Quartile 4 3.48 2.99 2.90 4.26 3.72 2.67 4.12 3.51 3.00 p Value 1.7E4 3.1E4 1.0E4 1.9E6 6.2E6 5.5E4 9.1E7 7.1E6 1.6E4 Lower limit of 95% 1.82 1.65 1.70 2.35 2.11 1.53 2.34 2.03 1.70 CI Upper limit of 95% CI 6.66 5.44 4.97 7.73 6.59 4.65 7.24 6.07 5.30

TABLE-US-00236 TABLE 33.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.149 0.321 0.165 0.372 0.170 0.388 Average 0.654 4.64 0.674 5.39 0.854 5.64 Stdev 1.59 20.2 1.69 21.9 2.70 22.8 p (t-test) 0.041 0.011 0.0099 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 108 204 141 171 155 157 sCr only Median 0.169 0.320 0.172 0.372 0.178 0.388 Average 0.736 4.87 0.727 5.57 0.901 5.77 Stdev 1.65 20.9 1.73 22.4 2.70 23.2 p (t-test) 0.030 0.0093 0.0089 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 121 190 148 163 160 151 UO only Median 0.214 0.358 0.226 0.344 0.240 0.336 Average 2.18 5.49 2.24 5.81 2.77 4.65 Stdev 12.5 22.4 12.2 23.9 14.8 20.4 p (t-test) 0.097 0.085 0.38 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 208 102 221 89 228 82 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.62 0.63 0.66 0.64 0.62 0.66 0.64 0.61 SE 0.032 0.032 0.034 0.031 0.031 0.036 0.031 0.031 0.037 p Value 5.5E6 2.6E4 1.5E4 2.4E7 6.9E6 0.0015 2.4E7 4.8E6 0.0040 nCohort Non- 108 121 208 141 148 221 155 160 228 persistent nCohort Persistent 204 190 102 171 163 89 157 151 82 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 80% 79% 86% 81% 80% 87% 82% 81% 85% Specificity 35% 31% 31% 33% 30% 30% 32% 31% 29% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 57% 56% 61% 60% 60% 60% 62% 61% 59% Specificity 63% 59% 55% 62% 60% 54% 62% 60% 53% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 32% 32% 37% 36% 36% 36% 37% 36% 38% Specificity 88% 86% 81% 89% 87% 79% 87% 86% 79% OR Quartile 2 2.23 1.72 2.79 2.10 1.72 2.73 2.19 1.86 2.38 p Value 0.0028 0.041 0.0016 0.0052 0.040 0.0034 0.0036 0.021 0.012 Lower limit of 95% 1.32 1.02 1.48 1.25 1.02 1.39 1.29 1.10 1.21 CI Upper limit of 95% CI 3.76 2.88 5.28 3.54 2.89 5.36 3.73 3.14 4.67 OR Quartile 3 2.24 1.79 1.92 2.51 2.22 1.72 2.63 2.34 1.60 p Value 9.6E4 0.013 0.0082 8.0E5 5.9E4 0.034 3.3E5 2.5E4 0.073 Lower limit of 95% 1.39 1.13 1.18 1.59 1.41 1.04 1.67 1.48 0.958 CI Upper limit of 95% CI 3.62 2.84 3.10 3.98 3.49 2.83 4.15 3.69 2.66 OR Quartile 4 3.42 2.89 2.49 4.44 3.85 2.14 3.95 3.41 2.34 p Value 2.1E4 4.8E4 7.1E4 1.4E6 4.8E6 0.0060 2.3E6 1.3E5 0.0024 Lower limit of 95% 1.78 1.59 1.47 2.42 2.16 1.24 2.24 1.96 1.35 CI Upper limit of 95% CI 6.55 5.25 4.23 8.15 6.87 3.67 7.00 5.93 4.06

TABLE-US-00237 TABLE 33.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.149 0.321 0.167 0.372 0.170 0.388 Average 0.659 4.62 0.679 5.36 0.862 5.57 Stdev 1.59 20.1 1.69 21.9 2.71 22.6 p (t-test) 0.043 0.012 0.011 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 107 205 140 172 153 159 sCr only Median 0.169 0.320 0.175 0.372 0.181 0.380 Average 0.736 4.87 0.732 5.54 0.907 5.73 Stdev 1.65 20.9 1.74 22.4 2.71 23.1 p (t-test) 0.030 0.0099 0.0095 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 121 190 147 164 159 152 UO only Median 0.217 0.336 0.221 0.336 0.239 0.336 Average 2.20 5.31 2.27 5.56 2.82 4.40 Stdev 12.7 22.0 12.4 23.2 15.0 19.7 p (t-test) 0.11 0.11 0.45 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 204 106 216 94 222 88 Persistence Period Duration (hr) 24 48 72 sCr or sCr or sCr or UO sCr only UO only UO sCr only UO only UO sCr only UO only AUC 0.64 0.62 0.62 0.65 0.64 0.61 0.66 0.64 0.61 SE 0.032 0.032 0.034 0.031 0.031 0.036 0.031 0.031 0.036 p Value 1.0E5 2.6E4 4.2E4 5.9E7 1.5E5 0.0015 4.4E7 1.0E5 0.0036 nCohort Non- 107 121 204 140 147 216 153 159 222 persistent nCohort Persistent 205 190 106 172 164 94 159 152 88 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 80% 79% 84% 81% 79% 85% 82% 80% 84% Specificity 35% 31% 30% 32% 30% 30% 32% 30% 29% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 57% 56% 59% 60% 59% 60% 62% 61% 59% Specificity 63% 59% 55% 62% 60% 54% 62% 60% 54% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 32% 32% 37% 36% 36% 36% 36% 36% 38% Specificity 88% 86% 81% 89% 87% 80% 87% 86% 80% OR Quartile 2 2.11 1.72 2.23 2.00 1.63 2.41 2.11 1.76 2.14 p Value 0.0052 0.041 0.0086 0.0092 0.063 0.0070 0.0054 0.035 0.020 Lower limit of 95% 1.25 1.02 1.23 1.19 0.974 1.27 1.25 1.04 1.13 CI Upper limit of 95% CI 3.57 2.88 4.07 3.35 2.74 4.56 3.58 2.97 4.06 OR Quartile 3 2.18 1.79 1.78 2.45 2.16 1.74 2.63 2.28 1.67 p Value 0.0014 0.013 0.017 1.2E4 8.8E4 0.027 3.3E5 3.9E4 0.045 Lower limit of 95% 1.35 1.13 1.11 1.55 1.37 1.07 1.67 1.45 1.01 CI Upper limit of 95% CI 3.53 2.84 2.87 3.87 3.40 2.85 4.16 3.58 2.75 OR Quartile 4 3.36 2.89 2.46 4.37 3.79 2.22 3.82 3.35 2.36 p Value 2.6E4 4.8E4 8.0E4 1.9E6 6.3E6 0.0036 4.1E6 1.7E5 0.0019 Lower limit of 95% 1.75 1.59 1.45 2.38 2.12 1.30 2.16 1.93 1.37 CI Upper limit of 95% CI 6.43 5.25 4.17 8.01 6.75 3.78 6.75 5.82 4.06

TABLE-US-00238 TABLE 33.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 0.149 0.321 0.165 0.344 0.165 0.372 Average 0.674 4.54 0.695 5.22 0.880 5.38 Stdev 1.62 19.9 1.72 21.6 2.77 22.2 p (t-test) 0.051 0.016 0.015 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 103 209 135 177 147 165 sCr only Median 0.165 0.321 0.169 0.364 0.170 0.372 Average 0.746 4.80 0.742 5.41 0.921 5.59 Stdev 1.67 20.7 1.76 22.1 2.74 22.9 p (t-test) 0.034 0.012 0.012 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 12.3 176 12.3 176 27.3 176 n (Patient) 118 193 143 168 155 156 UO only Median 0.210 0.325 0.214 0.325 0.217 0.328 Average 2.26 5.04 2.34 5.15 2.92 4.03 Stdev 12.8 21.4 12.6 22.3 15.3 18.8 p (t-test) 0.15 0.16 0.58 Min 8.78E6 0.00541 8.78E6 0.00541 8.78E6 0.00541 Max 170 176 170 176 170 176 n (Patient) 198 112 208 102 213 97 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.64 0.62 0.62 0.65 0.64 0.61 0.66 0.64 0.61 SE 0.032 0.032 0.034 0.031 0.031 0.035 0.031 0.031 0.035 p Value 1.1E5 1.5E4 4.7E4 8.7E7 6.6E6 0.0013 3.4E7 4.9E6 0.0026 nCohort Non-persistent 103 118 198 135 143 208 147 155 213 nCohort Persistent 209 193 112 177 168 102 165 156 97 Cutoff Quartile 2 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 0.0928 0.0927 0.0938 Sensitivity 80% 79% 84% 81% 80% 85% 82% 81% 85% Specificity 35% 32% 30% 33% 31% 30% 33% 31% 30% Cutoff Quartile 3 0.251 0.250 0.251 0.251 0.250 0.251 0.251 0.250 0.251 Sensitivity 57% 56% 61% 60% 60% 61% 62% 62% 61% Specificity 64% 60% 56% 63% 62% 55% 63% 61% 55% Cutoff Quartile 4 1.17 1.16 1.16 1.17 1.16 1.16 1.17 1.16 1.16 Sensitivity 31% 32% 35% 35% 35% 34% 36% 35% 35% Specificity 87% 86% 80% 88% 87% 79% 87% 85% 79% OR Quartile 2 2.14 1.82 2.27 2.03 1.75 2.52 2.18 1.88 2.30 p Value 0.0048 0.024 0.0063 0.0074 0.034 0.0036 0.0036 0.018 0.0091 Lower limit of 95% CI 1.26 1.08 1.26 1.21 1.04 1.35 1.29 1.12 1.23 Upper limit of 95% CI 3.62 3.06 4.09 3.42 2.94 4.70 3.69 3.18 4.29 OR Quartile 3 2.36 1.96 1.97 2.54 2.41 1.92 2.79 2.53 1.89 p Value 5.5E4 0.0046 0.0048 7.5E5 1.6E4 0.0082 1.2E5 6.6E5 0.011 Lower limit of 95% CI 1.45 1.23 1.23 1.60 1.53 1.18 1.76 1.60 1.16 Upper limit of 95% CI 3.84 3.12 3.16 4.02 3.81 3.10 4.41 4.00 3.09 OR Quartile 4 3.12 2.75 2.18 4.01 3.53 2.00 3.75 3.13 2.07 p Value 6.0E4 9.1E4 0.0035 7.2E6 1.8E5 0.0100 7.3E6 5.1E5 0.0073 Lower limit of 95% CI 1.63 1.51 1.29 2.19 1.98 1.18 2.10 1.80 1.22 Upper limit of 95% CI 5.99 4.99 3.68 7.35 6.29 3.40 6.68 5.42 3.53

Example 34. Use of Tumor Necrosis Factor Receptor Superfamily Member 11B for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 from RIFLE I and F

[0225] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Tumor necrosis factor receptor superfamily member 11B is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0226] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is risk of injury (R), injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0227] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00239 TABLE 34.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 376 987 347 1020 318 987 Average 849 2060 657 2050 657 2040 Stdev 1010 3760 811 3710 836 3690 p (t-test) 0.15 0.12 0.13 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3170 30700 3170 30700 n (Patient) 21 104 18 107 17 108 sCr only Median 364 1040 364 1040 364 1040 Average 767 2030 767 2030 767 2030 Stdev 941 3730 941 3730 941 3730 p (t-test) 0.10 0.10 0.10 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 24 100 24 100 24 100 UO only Median 711 1550 629 1690 569 1650 Average 1350 2830 1200 2840 1220 2590 Stdev 3460 3380 3540 3200 3750 3040 p (t-test) 0.025 0.0096 0.029 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 81 43 74 50 66 58 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.67 0.70 0.69 0.72 0.70 0.75 0.72 0.70 0.75 SE 0.059 0.054 0.052 0.057 0.054 0.046 0.058 0.054 0.045 p Value 0.0050 2.1E4 2.4E4 1.3E4 2.1E4 2.9E8 1.2E4 2.1E4 4.3E8 nCohort Recovered 21 24 81 18 24 74 17 24 66 nCohort Non-recovered 104 100 43 107 100 50 108 100 58 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 80% 81% 88% 79% 81% 90% 80% 81% 88% Specificity 48% 50% 32% 50% 50% 35% 53% 50% 36% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 55% 56% 67% 55% 56% 72% 55% 56% 67% Specificity 71% 75% 59% 78% 75% 65% 76% 75% 65% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 27% 28% 40% 28% 28% 44% 28% 28% 40% Specificity 81% 88% 83% 89% 88% 88% 88% 88% 88% OR Quartile 2 3.59 4.26 3.59 3.86 4.26 4.88 4.40 4.26 4.16 p Value 0.011 0.0026 0.016 0.011 0.0026 0.0028 0.0062 0.0026 0.0028 Lower limit of 95% CI 1.35 1.66 1.27 1.37 1.66 1.72 1.52 1.66 1.63 Upper limit of 95% CI 9.58 11.0 10.2 10.9 11.0 13.8 12.7 11.0 10.6 OR Quartile 3 3.03 3.82 3.01 4.30 3.82 4.75 3.91 3.82 3.84 p Value 0.033 0.0090 0.0054 0.015 0.0090 9.1E5 0.024 0.0090 4.1E4 Lower limit of 95% CI 1.09 1.40 1.39 1.33 1.40 2.18 1.20 1.40 1.82 Upper limit of 95% CI 8.43 10.4 6.55 13.9 10.4 10.4 12.8 10.4 8.09 OR Quartile 4 1.57 2.72 3.13 3.12 2.72 5.67 2.88 2.72 4.76 p Value 0.45 0.13 0.0078 0.15 0.13 1.4E4 0.18 0.13 7.5E4 Lower limit of 95% CI 0.485 0.752 1.35 0.675 0.752 2.32 0.622 0.752 1.92 Upper limit of 95% CI 5.06 9.85 7.25 14.4 9.85 13.9 13.4 9.85 11.8

TABLE-US-00240 TABLE 34.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 451 1120 506 1110 396 1110 Average 775 2220 789 2200 788 2180 Stdev 871 3940 882 3920 912 3890 p (t-test) 0.042 0.049 0.059 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 32 93 31 94 29 96 sCr only Median 527 1120 527 1120 527 1120 Average 810 2280 810 2280 810 2280 Stdev 860 4020 860 4020 860 4020 p (t-test) 0.032 0.032 0.032 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 36 89 36 89 36 89 UO only Median 719 1470 685 1670 633 1350 Average 1360 2990 1270 3010 1300 2690 Stdev 3370 3540 3390 3440 3560 3240 p (t-test) 0.016 0.0082 0.029 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 86 38 82 42 74 50 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.68 0.69 0.69 0.68 0.73 0.69 0.68 0.71 SE 0.050 0.050 0.054 0.051 0.050 0.050 0.052 0.050 0.049 p Value 1.1E4 2.2E4 3.7E4 2.5E4 2.2E4 7.4E6 1.8E4 2.2E4 1.7E5 nCohort Recovered 32 36 86 31 36 82 29 36 74 nCohort Non-recovered 93 89 38 94 89 42 96 89 50 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 82% 82% 89% 81% 82% 90% 81% 82% 88% Specificity 44% 42% 31% 42% 42% 33% 45% 42% 34% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 59% 60% 68% 59% 60% 71% 58% 60% 66% Specificity 75% 72% 58% 74% 72% 61% 76% 72% 61% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 29% 30% 42% 29% 30% 45% 28% 30% 40% Specificity 84% 86% 83% 84% 86% 85% 83% 86% 85% OR Quartile 2 3.48 3.26 3.89 3.05 3.26 4.66 3.52 3.26 3.74 p Value 0.0052 0.0068 0.019 0.013 0.0068 0.0075 0.0058 0.0068 0.0083 Lower limit of 95% CI 1.45 1.39 1.25 1.27 1.39 1.51 1.44 1.39 1.40 Upper limit of 95% CI 8.34 7.67 12.1 7.35 7.67 14.4 8.60 7.67 9.97 OR Quartile 3 4.34 3.83 3.01 4.05 3.83 3.91 4.40 3.83 3.01 p Value 0.0014 0.0018 0.0075 0.0024 0.0018 8.8E4 0.0021 0.0018 0.0039 Lower limit of 95% CI 1.76 1.65 1.34 1.64 1.65 1.75 1.71 1.65 1.43 Upper limit of 95% CI 10.7 8.90 6.75 10.0 8.90 8.72 11.3 8.90 6.37 OR Quartile 4 2.21 2.70 3.44 2.10 2.70 4.82 1.88 2.70 3.82 p Value 0.14 0.063 0.0044 0.17 0.063 3.5E4 0.24 0.063 0.0021 Lower limit of 95% CI 0.770 0.948 1.47 0.729 0.948 2.03 0.650 0.948 1.62 Upper limit of 95% CI 6.34 7.69 8.07 6.03 7.69 11.4 5.43 7.69 8.97

TABLE-US-00241 TABLE 34.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 548 1220 561 1220 548 1150 Average 820 2440 830 2410 844 2350 Stdev 810 4200 817 4180 842 4120 p (t-test) 0.012 0.015 0.023 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 45 80 44 81 41 84 sCr only Median 597 1220 597 1220 619 1220 Average 824 2500 824 2500 835 2470 Stdev 782 4270 782 4270 786 4250 p (t-test) 0.0084 0.0084 0.010 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 48 77 48 77 47 78 UO only Median 732 1290 711 1290 677 1290 Average 1410 2890 1340 2910 1330 2680 Stdev 3380 3560 3380 3510 3540 3280 p (t-test) 0.029 0.018 0.034 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 86 38 83 41 75 49 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.68 0.67 0.67 0.68 0.68 0.67 0.67 0.69 SE 0.048 0.048 0.055 0.048 0.048 0.053 0.049 0.048 0.050 p Value 1.6E4 2.2E4 0.0025 3.5E4 2.2E4 4.6E4 7.7E4 5.1E4 8.7E5 nCohort Recovered 45 48 86 44 48 83 41 47 75 nCohort Non-recovered 80 77 38 81 77 41 84 78 49 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 84% 83% 87% 83% 83% 88% 82% 82% 88% Specificity 40% 38% 30% 39% 38% 31% 39% 36% 33% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 60% 61% 66% 59% 61% 68% 58% 60% 65% Specificity 67% 67% 57% 66% 67% 59% 66% 66% 60% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 32% 35% 39% 32% 35% 39% 31% 35% 37% Specificity 87% 90% 81% 86% 90% 82% 85% 89% 83% OR Quartile 2 3.44 2.95 2.86 3.01 2.95 3.28 2.94 2.59 3.58 p Value 0.0041 0.011 0.049 0.0098 0.011 0.026 0.012 0.025 0.011 Lower limit of 95% CI 1.48 1.28 1.00 1.31 1.28 1.16 1.27 1.13 1.35 Upper limit of 95% CI 7.97 6.81 8.15 6.96 6.81 9.33 6.82 5.94 9.55 OR Quartile 3 3.00 3.13 2.55 2.81 3.13 3.10 2.70 2.94 2.82 p Value 0.0048 0.0030 0.021 0.0081 0.0030 0.0049 0.012 0.0051 0.0065 Lower limit of 95% CI 1.40 1.47 1.15 1.31 1.47 1.41 1.24 1.38 1.34 Upper limit of 95% CI 6.44 6.67 5.64 6.04 6.67 6.84 5.88 6.25 5.97 OR Quartile 4 3.13 4.64 2.85 2.99 4.64 2.90 2.61 4.45 2.77 p Value 0.022 0.0037 0.015 0.028 0.0037 0.013 0.055 0.0048 0.017 Lower limit of 95% CI 1.18 1.65 1.22 1.12 1.65 1.25 0.980 1.58 1.20 Upper limit of 95% CI 8.33 13.1 6.66 7.97 13.1 6.72 6.98 12.6 6.37

TABLE-US-00242 TABLE 34.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 561 1280 561 1220 548 1200 Average 809 2550 822 2500 835 2430 Stdev 793 4320 807 4270 829 4210 p (t-test) 0.0056 0.0083 0.013 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 50 75 48 77 45 80 sCr only Median 575 1290 575 1290 597 1280 Average 800 2580 800 2580 810 2550 Stdev 773 4340 773 4340 778 4320 p (t-test) 0.0045 0.0045 0.0057 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 51 74 51 74 50 75 UO only Median 702 1310 702 1290 685 1290 Average 1350 2870 1360 2780 1340 2640 Stdev 3400 3480 3440 3420 3570 3260 p (t-test) 0.021 0.029 0.041 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 82 42 80 44 74 50 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.70 0.70 0.68 0.69 0.70 0.68 0.68 0.69 0.69 SE 0.046 0.046 0.053 0.047 0.046 0.052 0.048 0.047 0.050 p Value 1.8E5 1.3E5 5.5E4 6.2E5 1.3E5 6.6E4 1.5E4 3.8E5 1.8E4 nCohort Recovered 50 51 82 48 51 80 45 50 74 nCohort Non-recovered 75 74 42 77 74 44 80 75 50 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 85% 85% 88% 84% 85% 89% 84% 84% 88% Specificity 40% 39% 32% 40% 39% 32% 40% 38% 34% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 61% 62% 67% 60% 62% 66% 59% 61% 64% Specificity 66% 67% 59% 65% 67% 59% 64% 66% 59% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 35% 36% 38% 34% 36% 36% 32% 36% 36% Specificity 88% 90% 82% 88% 90% 81% 87% 90% 82% OR Quartile 2 3.88 3.70 3.44 3.55 3.70 3.76 3.44 3.22 3.74 p Value 0.0019 0.0026 0.020 0.0033 0.0026 0.013 0.0041 0.0065 0.0083 Lower limit of 95% CI 1.65 1.58 1.21 1.52 1.58 1.32 1.48 1.39 1.40 Upper limit of 95% CI 9.11 8.66 9.75 8.26 8.66 10.6 7.97 7.46 9.97 OR Quartile 3 3.08 3.29 2.82 2.71 3.29 2.75 2.58 3.08 2.61 p Value 0.0032 0.0018 0.0089 0.0090 0.0018 0.0095 0.014 0.0032 0.011 Lower limit of 95% CI 1.46 1.55 1.30 1.28 1.55 1.28 1.21 1.46 1.24 Upper limit of 95% CI 6.50 6.94 6.14 5.71 6.94 5.92 5.49 6.50 5.47 OR Quartile 4 3.89 5.29 2.75 3.57 5.29 2.48 3.13 5.06 2.64 p Value 0.0064 0.0017 0.018 0.011 0.0017 0.033 0.022 0.0022 0.022 Lower limit of 95% CI 1.47 1.87 1.19 1.34 1.87 1.08 1.18 1.79 1.15 Upper limit of 95% CI 10.3 14.9 6.35 9.48 14.9 5.69 8.33 14.3 6.06

TABLE-US-00243 TABLE 34.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 671 1310 682 1290 682 1290 Average 1320 2650 1330 2610 1330 2610 Stdev 3540 3260 3560 3240 3560 3240 p (t-test) 0.036 0.043 0.043 Min 45.2 57.6 45.2 57.6 45.2 57.6 Max 30700 14400 30700 14400 30700 14400 n (Patient) 75 50 74 51 74 51 sCr only Median 597 1290 597 1290 597 1290 Average 1320 2380 1320 2380 1320 2380 Stdev 3870 2980 3870 2980 3870 2980 p (t-test) 0.086 0.086 0.086 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 30700 14400 30700 14400 30700 14400 n (Patient) 62 63 62 63 62 63 UO only Median 694 1330 702 1310 694 1330 Average 1350 2830 1360 2780 1340 2790 Stdev 3430 3450 3450 3420 3460 3390 p (t-test) 0.025 0.030 0.025 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 81 43 80 44 79 45 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.68 0.68 0.68 0.67 0.68 0.68 0.67 0.68 0.69 SE 0.050 0.047 0.052 0.050 0.047 0.052 0.050 0.047 0.051 p Value 3.8E4 9.5E5 4.4E4 5.5E4 9.5E5 6.6E4 5.5E4 9.5E5 2.2E4 nCohort Recovered 75 62 81 74 62 80 74 62 79 nCohort Non-recovered 50 63 43 51 63 44 51 63 45 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 84% 84% 88% 84% 84% 89% 84% 84% 89% Specificity 31% 34% 32% 31% 34% 32% 31% 34% 33% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 66% 63% 67% 65% 63% 66% 65% 63% 67% Specificity 60% 63% 59% 59% 63% 59% 59% 63% 59% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 38% 40% 37% 37% 40% 36% 37% 40% 38% Specificity 83% 89% 81% 82% 89% 81% 82% 89% 82% OR Quartile 2 2.32 2.71 3.59 2.42 2.71 3.76 2.42 2.71 3.92 p Value 0.067 0.022 0.016 0.054 0.022 0.013 0.054 0.022 0.010 Lower limit of 95% CI 0.943 1.15 1.27 0.984 1.15 1.32 0.984 1.15 1.39 Upper limit of 95% CI 5.72 6.39 10.2 5.97 6.39 10.6 5.97 6.39 11.1 OR Quartile 3 2.91 2.95 3.01 2.69 2.95 2.75 2.69 2.95 2.94 p Value 0.0050 0.0036 0.0054 0.0086 0.0036 0.0095 0.0086 0.0036 0.0058 Lower limit of 95% CI 1.38 1.43 1.39 1.28 1.43 1.28 1.28 1.43 1.37 Upper limit of 95% CI 6.14 6.10 6.55 5.63 6.10 5.92 5.63 6.10 6.32 OR Quartile 4 2.92 5.17 2.61 2.79 5.17 2.48 2.79 5.17 2.82 p Value 0.011 5.7E4 0.024 0.015 5.7E4 0.033 0.015 5.7E4 0.015 Lower limit of 95% CI 1.28 2.03 1.13 1.22 2.03 1.08 1.22 2.03 1.22 Upper limit of 95% CI 6.68 13.2 6.01 6.36 13.2 5.69 6.36 13.2 6.49

Example 35. Use of Tumor Necrosis Factor Receptor Superfamily Member 11B for Evaluating Renal Status in Patients Admitted to the ICU: Recovery to RIFLE 0 and R from RIFLE I and F

[0228] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Tumor necrosis factor receptor superfamily member 11B is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0229] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a recovered and a non-recovered population. Recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-recovered indicates those patients whose maximum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the recovery period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered non-recovered.

[0230] The ability to distinguish the recovered and non-recovered cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00244 TABLE 35.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 575 1170 575 1170 667 1140 Average 880 2360 880 2360 903 2320 Stdev 863 4170 863 4170 878 4130 p (t-test) 0.023 0.023 0.032 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 43 82 43 82 41 84 sCr only Median 575 1180 575 1180 597 1170 Average 875 2380 875 2380 884 2360 Stdev 842 4240 842 4240 849 4210 p (t-test) 0.016 0.016 0.019 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 49 75 49 75 48 76 UO only Median 711 1670 702 1670 702 1660 Average 1410 3020 1360 2920 1370 2760 Stdev 3440 3390 3480 3300 3570 3190 p (t-test) 0.020 0.019 0.033 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 89 35 84 40 80 44 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.65 0.66 0.72 0.65 0.66 0.72 0.64 0.65 0.71 SE 0.050 0.049 0.054 0.050 0.049 0.052 0.051 0.049 0.051 p Value 0.0026 0.0011 4.2E5 0.0026 0.0011 2.5E5 0.0076 0.0018 4.5E5 nCohort Recovered 43 49 89 43 49 84 41 48 80 nCohort Non-recovered 82 75 35 82 75 40 84 76 44 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 82% 83% 91% 82% 83% 90% 81% 83% 86% Specificity 37% 37% 31% 37% 37% 32% 37% 38% 31% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 60% 61% 71% 60% 61% 70% 58% 61% 68% Specificity 67% 67% 58% 67% 67% 60% 66% 67% 60% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 30% 32% 46% 30% 32% 45% 30% 32% 43% Specificity 84% 86% 83% 84% 86% 85% 83% 85% 85% OR Quartile 2 2.65 2.77 4.90 2.65 2.77 4.26 2.45 2.91 2.88 p Value 0.022 0.017 0.014 0.022 0.017 0.012 0.036 0.012 0.035 Lower limit of 95% CI 1.15 1.20 1.38 1.15 1.20 1.38 1.06 1.26 1.08 Upper limit of 95% CI 6.10 6.37 17.4 6.10 6.37 13.2 5.66 6.70 7.69 OR Quartile 3 3.08 3.27 3.51 3.08 3.27 3.43 2.70 3.07 3.21 p Value 0.0045 0.0021 0.0036 0.0045 0.0021 0.0027 0.012 0.0037 0.0032 Lower limit of 95% CI 1.42 1.54 1.51 1.42 1.54 1.53 1.24 1.44 1.48 Upper limit of 95% CI 6.68 6.97 8.19 6.68 6.97 7.67 5.88 6.53 6.99 OR Quartile 4 2.26 2.82 4.15 2.26 2.82 4.47 2.06 2.70 4.31 p Value 0.089 0.030 0.0013 0.089 0.030 6.3E4 0.13 0.037 8.3E4 Lower limit of 95% CI 0.884 1.11 1.75 0.884 1.11 1.89 0.805 1.06 1.83 Upper limit of 95% CI 5.75 7.20 9.88 5.75 7.20 10.5 5.26 6.89 10.1

TABLE-US-00245 TABLE 35.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 621 1290 621 1290 669 1280 Average 828 2630 828 2630 844 2570 Stdev 783 4420 783 4420 794 4370 p (t-test) 0.0036 0.0036 0.0057 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 54 71 54 71 52 73 sCr only Median 643 1290 643 1290 667 1290 Average 845 2730 845 2730 852 2690 Stdev 781 4530 781 4530 786 4510 p (t-test) 0.0023 0.0023 0.0028 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 58 67 58 67 57 68 UO only Median 732 1470 719 1670 702 1490 Average 1470 2910 1400 3000 1410 2740 Stdev 3430 3470 3420 3450 3540 3260 p (t-test) 0.040 0.019 0.044 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 90 34 88 36 82 42 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.69 0.68 0.69 0.69 0.71 0.67 0.68 0.70 SE 0.047 0.047 0.056 0.047 0.047 0.054 0.048 0.047 0.052 p Value 5.8E5 6.1E5 0.0012 5.8E5 6.1E5 1.4E4 2.5E4 1.2E4 1.4E4 nCohort Recovered 54 58 90 54 58 88 52 57 82 nCohort Non-recovered 71 67 34 71 67 36 73 68 42 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 85% 85% 91% 85% 85% 92% 84% 85% 88% Specificity 37% 36% 31% 37% 36% 32% 37% 37% 32% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 63% 64% 68% 63% 64% 69% 62% 63% 69% Specificity 67% 66% 57% 67% 66% 58% 65% 65% 60% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 37% 39% 41% 37% 39% 44% 36% 38% 40% Specificity 89% 90% 81% 89% 90% 83% 88% 89% 83% OR Quartile 2 3.21 3.24 4.67 3.21 3.24 5.13 2.93 3.38 3.44 p Value 0.0070 0.0074 0.017 0.0070 0.0074 0.011 0.012 0.0055 0.020 Lower limit of 95% CI 1.37 1.37 1.32 1.37 1.37 1.45 1.27 1.43 1.21 Upper limit of 95% CI 7.49 7.64 16.6 7.49 7.64 18.2 6.76 8.00 9.75 OR Quartile 3 3.46 3.40 2.73 3.46 3.40 3.13 3.04 3.18 3.31 p Value 0.0011 0.0011 0.018 0.0011 0.0011 0.0067 0.0033 0.0020 0.0029 Lower limit of 95% CI 1.65 1.63 1.19 1.65 1.63 1.37 1.45 1.53 1.50 Upper limit of 95% CI 7.28 7.11 6.28 7.28 7.11 7.15 6.37 6.63 7.29 OR Quartile 4 4.62 5.50 3.01 4.62 5.50 3.89 4.24 5.26 3.30 p Value 0.0021 6.3E4 0.012 0.0021 6.3E4 0.0020 0.0037 8.7E4 0.0055 Lower limit of 95% CI 1.74 2.07 1.27 1.74 2.07 1.65 1.60 1.98 1.42 Upper limit of 95% CI 12.3 14.6 7.13 12.3 14.6 9.21 11.3 14.0 7.67

TABLE-US-00246 TABLE 35.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 619 1320 619 1320 667 1300 Average 837 2820 837 2820 849 2750 Stdev 779 4610 779 4610 789 4560 p (t-test) 0.0012 0.0012 0.0020 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 61 64 61 64 59 66 sCr only Median 619 1320 619 1320 619 1320 Average 831 2830 831 2830 831 2830 Stdev 769 4610 769 4610 769 4610 p (t-test) 0.0011 0.0011 0.0011 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 61 64 61 64 61 64 UO only Median 732 1290 732 1290 719 1290 Average 1490 2850 1490 2850 1450 2730 Stdev 3440 3480 3440 3480 3500 3340 p (t-test) 0.051 0.051 0.056 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 90 34 90 34 84 40 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.70 0.71 0.67 0.70 0.71 0.67 0.69 0.71 0.67 SE 0.046 0.046 0.057 0.046 0.046 0.057 0.047 0.046 0.054 p Value 1.1E5 8.2E6 0.0027 1.1E5 8.2E6 0.0027 4.2E5 8.2E6 0.0012 nCohort Recovered 61 61 90 61 61 90 59 61 84 nCohort Non-recovered 64 64 34 64 64 34 66 64 40 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 86% 86% 88% 86% 86% 88% 85% 86% 88% Specificity 36% 36% 30% 36% 36% 30% 36% 36% 31% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 66% 66% 68% 66% 66% 68% 64% 66% 68% Specificity 66% 66% 57% 66% 66% 57% 64% 66% 58% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 39% 41% 41% 39% 41% 41% 38% 41% 38% Specificity 89% 90% 81% 89% 90% 81% 88% 90% 81% OR Quartile 2 3.45 3.45 3.21 3.45 3.45 3.21 3.09 3.45 3.14 p Value 0.0057 0.0057 0.044 0.0057 0.0057 0.044 0.0099 0.0057 0.032 Lower limit of 95% CI 1.43 1.43 1.03 1.43 1.43 1.03 1.31 1.43 1.10 Upper limit of 95% CI 8.29 8.29 10.0 8.29 8.29 10.0 7.30 8.29 8.92 OR Quartile 3 3.64 3.64 2.73 3.64 3.64 2.73 3.17 3.64 2.91 p Value 6.1E4 6.1E4 0.018 6.1E4 6.1E4 0.018 0.0020 6.1E4 0.0082 Lower limit of 95% CI 1.74 1.74 1.19 1.74 1.74 1.19 1.52 1.74 1.32 Upper limit of 95% CI 7.61 7.61 6.28 7.61 7.61 6.28 6.58 7.61 6.41 OR Quartile 4 4.95 6.27 3.01 4.95 6.27 3.01 4.53 6.27 2.55 p Value 7.9E4 2.4E4 0.012 7.9E4 2.4E4 0.012 0.0015 2.4E4 0.029 Lower limit of 95% CI 1.94 2.36 1.27 1.94 2.36 1.27 1.78 2.36 1.10 Upper limit of 95% CI 12.6 16.7 7.13 12.6 16.7 7.13 11.5 16.7 5.91

TABLE-US-00247 TABLE 35.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 643 1310 643 1310 669 1290 Average 988 2760 988 2760 1000 2690 Stdev 1410 4610 1410 4610 1430 4550 p (t-test) 0.0040 0.0040 0.0063 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 10300 30700 10300 30700 10300 30700 n (Patient) 64 61 64 61 62 63 sCr only Median 643 1310 643 1310 643 1310 Average 982 2770 982 2770 982 2770 Stdev 1410 4610 1410 4610 1410 4610 p (t-test) 0.0037 0.0037 0.0037 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 10300 30700 10300 30700 10300 30700 n (Patient) 64 61 64 61 64 61 UO only Median 711 1290 711 1290 719 1250 Average 1440 2780 1440 2780 1470 2630 Stdev 3480 3370 3480 3370 3540 3290 p (t-test) 0.048 0.048 0.080 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 85 39 85 39 82 42 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.70 0.68 0.69 0.70 0.68 0.68 0.70 0.66 SE 0.047 0.047 0.054 0.047 0.047 0.054 0.048 0.047 0.053 p Value 3.8E5 2.8E5 9.7E4 3.8E5 2.8E5 9.7E4 1.3E4 2.8E5 0.0025 nCohort Recovered 64 64 85 64 64 85 62 64 82 nCohort Non-recovered 61 61 39 61 61 39 63 61 42 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 87% 87% 90% 87% 87% 90% 86% 87% 88% Specificity 36% 36% 32% 36% 36% 32% 35% 36% 32% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 66% 66% 67% 66% 66% 67% 63% 66% 64% Specificity 64% 64% 58% 64% 64% 58% 63% 64% 57% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 39% 41% 38% 39% 41% 38% 38% 41% 36% Specificity 88% 89% 81% 88% 89% 81% 87% 89% 80% OR Quartile 2 3.72 3.72 4.07 3.72 3.72 4.07 3.30 3.72 3.44 p Value 0.0043 0.0043 0.015 0.0043 0.0043 0.015 0.0076 0.0043 0.020 Lower limit of 95% CI 1.51 1.51 1.31 1.51 1.51 1.31 1.37 1.51 1.21 Upper limit of 95% CI 9.16 9.16 12.6 9.16 9.16 12.6 7.93 9.16 9.75 OR Quartile 3 3.40 3.40 2.72 3.40 3.40 2.72 2.95 3.40 2.42 p Value 0.0011 0.0011 0.013 0.0011 0.0011 0.013 0.0036 0.0011 0.024 Lower limit of 95% CI 1.63 1.63 1.23 1.63 1.63 1.23 1.43 1.63 1.12 Upper limit of 95% CI 7.08 7.08 6.01 7.08 7.08 6.01 6.10 7.08 5.21 OR Quartile 4 4.54 5.65 2.70 4.54 5.65 2.70 4.15 5.65 2.29 p Value 0.0010 2.9E4 0.021 0.0010 2.9E4 0.021 0.0019 2.9E4 0.051 Lower limit of 95% CI 1.84 2.22 1.16 1.84 2.22 1.16 1.69 2.22 0.995 Upper limit of 95% CI 11.2 14.4 6.27 11.2 14.4 6.27 10.2 14.4 5.28

TABLE-US-00248 TABLE 35.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the recovered and non-recovered cohorts where recovery starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Recovery Period Duration (hr) 24 48 72 Recovered Non-recovered Recovered Non-recovered Recovered Non-recovered Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 671 1350 671 1350 674 1330 Average 1420 2700 1420 2700 1430 2660 Stdev 3530 3250 3530 3250 3550 3230 p (t-test) 0.051 0.051 0.061 Min 45.2 57.6 45.2 57.6 45.2 57.6 Max 30700 14400 30700 14400 30700 14400 n (Patient) 83 42 83 42 82 43 sCr only Median 619 1350 619 1350 619 1350 Average 1400 2490 1400 2490 1400 2490 Stdev 3740 3000 3740 3000 3740 3000 p (t-test) 0.086 0.086 0.086 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 30700 14400 30700 14400 30700 14400 n (Patient) 73 52 73 52 73 52 UO only Median 711 1290 711 1290 719 1290 Average 1540 2570 1540 2570 1550 2520 Stdev 3590 3200 3590 3200 3610 3180 p (t-test) 0.13 0.13 0.15 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 85 39 85 39 84 40 Recovery Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.70 0.70 0.66 0.70 0.70 0.66 0.69 0.70 0.66 SE 0.052 0.048 0.054 0.052 0.048 0.054 0.052 0.048 0.054 p Value 1.1E4 2.3E5 0.0025 1.1E4 2.3E5 0.0025 1.8E4 2.3E5 0.0035 nCohort Recovered 83 73 85 83 73 85 82 73 84 nCohort Non-recovered 42 52 39 42 52 39 43 52 40 Cutoff Quartile 2 376 376 375 376 376 375 376 376 375 Sensitivity 90% 88% 90% 90% 88% 90% 91% 88% 90% Specificity 33% 34% 32% 33% 34% 32% 33% 34% 32% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 71% 69% 67% 71% 69% 67% 70% 69% 65% Specificity 60% 63% 58% 60% 63% 58% 60% 63% 57% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 38% 42% 36% 38% 42% 36% 37% 42% 35% Specificity 81% 86% 80% 81% 86% 80% 80% 86% 80% OR Quartile 2 4.58 3.99 4.07 4.58 3.99 4.07 4.79 3.99 4.26 p Value 0.0082 0.0055 0.015 0.0082 0.0055 0.015 0.0065 0.0055 0.012 Lower limit of 95% CI 1.48 1.50 1.31 1.48 1.50 1.31 1.55 1.50 1.38 Upper limit of 95% CI 14.2 10.6 12.6 14.2 10.6 12.6 14.8 10.6 13.2 OR Quartile 3 3.79 3.83 2.72 3.79 3.83 2.72 3.43 3.83 2.48 p Value 0.0011 5.0E4 0.013 0.0011 5.0E4 0.013 0.0021 5.0E4 0.023 Lower limit of 95% CI 1.70 1.80 1.23 1.70 1.80 1.23 1.56 1.80 1.13 Upper limit of 95% CI 8.44 8.17 6.01 8.44 8.17 6.01 7.52 8.17 5.40 OR Quartile 4 2.58 4.62 2.24 2.58 4.62 2.24 2.44 4.62 2.12 p Value 0.025 5.2E4 0.061 0.025 5.2E4 0.061 0.034 5.2E4 0.079 Lower limit of 95% CI 1.13 1.95 0.964 1.13 1.95 0.964 1.07 1.95 0.916 Upper limit of 95% CI 5.90 11.0 5.20 5.90 11.0 5.20 5.58 11.0 4.92

Example 36. Use of Tumor Necrosis Factor Receptor Superfamily Member 11B for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE F

[0231] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Tumor necrosis factor receptor superfamily member 11B is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0232] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0), risk of injury (R), or injury (I) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0233] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00249 TABLE 36.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 677 1650 669 1670 669 1880 Average 1170 3210 1140 3430 1140 3700 Stdev 1760 5250 1740 5390 1710 5620 p (t-test) 0.0017 5.1E4 1.5E4 Min 45.2 90.5 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 83 42 86 39 90 35 sCr only Median 674 1650 667 1670 671 1670 Average 1060 3210 1070 3460 1080 3570 Stdev 1460 5250 1480 5510 1470 5650 p (t-test) 7.3E4 2.6E4 1.9E4 Min 45.2 90.5 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 82 42 87 37 89 35 UO only Median 745 2690 763 2380 763 2380 Average 1510 4090 1580 3770 1580 3770 Stdev 3280 4030 3350 3930 3350 3930 p (t-test) 0.0041 0.019 0.019 Min 45.2 409 45.2 409 45.2 409 Max 30700 14400 30700 14400 30700 14400 n (Patient) 107 17 108 16 108 16 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.72 0.73 0.77 0.76 0.77 0.75 0.78 0.76 0.75 SE 0.051 0.050 0.070 0.050 0.050 0.074 0.050 0.052 0.074 p Value 1.9E5 8.0E6 1.4E4 1.5E7 1.2E7 7.5E4 3.9E8 5.6E7 7.5E4 nCohort Non-persistent 83 82 107 86 87 108 90 89 108 nCohort Persistent 42 42 17 39 37 16 35 35 16 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 93% 93% 100% 97% 97% 100% 97% 97% 100% Specificity 34% 34% 29% 35% 34% 29% 33% 34% 29% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 71% 71% 76% 77% 78% 75% 80% 77% 75% Specificity 60% 61% 54% 62% 62% 54% 61% 61% 54% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 45% 45% 59% 49% 49% 56% 51% 49% 56% Specificity 84% 85% 80% 85% 85% 80% 84% 84% 80% OR Quartile 2 6.62 6.74 14.4 20.4 18.9 13.4 17.0 17.3 13.4 p Value 0.0033 0.0030 0.066 0.0037 0.0046 0.074 0.0064 0.0061 0.074 Lower limit of 95% CI 1.88 1.91 0.841 2.66 2.47 0.781 2.22 2.26 0.781 Upper limit of 95% CI 23.3 23.8 247 156 145 230 130 133 230 OR Quartile 3 3.79 3.91 3.85 5.35 5.93 3.48 6.29 5.21 3.48 p Value 0.0011 8.8E4 0.026 1.4E4 9.6E5 0.041 1.1E4 3.1E4 0.041 Lower limit of 95% CI 1.70 1.75 1.18 2.26 2.42 1.06 2.48 2.12 1.06 Upper limit of 95% CI 8.44 8.72 12.6 12.7 14.5 11.5 15.9 12.8 11.5 OR Quartile 4 4.45 4.82 5.85 5.33 5.39 5.03 5.75 5.06 5.03 p Value 5.6E4 3.5E4 0.0013 1.4E4 1.6E4 0.0038 8.8E5 2.8E4 0.0038 Lower limit of 95% CI 1.90 2.03 1.99 2.25 2.25 1.68 2.40 2.11 1.68 Upper limit of 95% CI 10.4 11.4 17.2 12.6 12.9 15.0 13.8 12.1 15.0

TABLE-US-00250 TABLE 36.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 671 1310 643 1360 643 1640 Average 1090 2920 1060 3170 1060 3370 Stdev 1530 4910 1490 5100 1460 5290 p (t-test) 0.0033 8.2E4 3.1E4 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 73 52 78 47 82 43 sCr only Median 671 1280 619 1360 643 1500 Average 1090 2780 1050 3000 1050 3120 Stdev 1530 4850 1500 4990 1480 5140 p (t-test) 0.0061 0.0017 0.0010 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 73 51 77 47 80 44 UO only Median 745 1670 763 1440 763 1440 Average 1460 3630 1540 3370 1540 3370 Stdev 3260 4000 3330 3890 3330 3890 p (t-test) 0.0068 0.025 0.025 Min 45.2 201 45.2 201 45.2 201 Max 30700 14400 30700 14400 30700 14400 n (Patient) 101 23 102 22 102 22 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.68 0.71 0.73 0.74 0.69 0.74 0.74 0.69 SE 0.049 0.050 0.065 0.048 0.048 0.067 0.049 0.049 0.067 p Value 1.5E4 2.9E4 0.0015 1.1E6 7.5E7 0.0050 5.2E7 1.3E6 0.0050 nCohort Non-persistent 73 73 101 78 77 102 82 80 102 nCohort Persistent 52 51 23 47 47 22 43 44 22 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 90% 90% 96% 96% 96% 95% 95% 95% 95% Specificity 36% 36% 30% 37% 38% 29% 35% 36% 29% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 65% 65% 70% 70% 70% 68% 72% 70% 68% Specificity 60% 60% 54% 62% 62% 54% 61% 61% 54% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 40% 39% 48% 43% 43% 45% 44% 43% 45% Specificity 85% 85% 80% 85% 86% 79% 84% 85% 79% OR Quartile 2 5.20 5.09 9.30 13.3 13.6 8.75 11.2 11.9 8.75 p Value 0.0019 0.0022 0.033 6.5E4 6.0E4 0.038 0.0015 0.0011 0.038 Lower limit of 95% CI 1.84 1.80 1.20 3.00 3.07 1.13 2.53 2.69 1.13 Upper limit of 95% CI 14.7 14.4 72.1 59.0 60.3 68.0 49.8 53.0 68.0 OR Quartile 3 2.87 2.78 2.73 3.77 3.90 2.51 4.04 3.77 2.51 p Value 0.0052 0.0068 0.042 7.7E4 5.9E4 0.065 6.4E4 9.7E4 0.065 Lower limit of 95% CI 1.37 1.33 1.04 1.74 1.79 0.943 1.81 1.71 0.943 Upper limit of 95% CI 6.00 5.84 7.21 8.18 8.48 6.67 8.99 8.29 6.67 OR Quartile 4 3.82 3.64 3.71 4.07 4.44 3.21 4.20 4.31 3.21 p Value 0.0019 0.0030 0.0070 0.0011 6.9E4 0.018 8.6E4 8.3E4 0.018 Lower limit of 95% CI 1.64 1.55 1.43 1.75 1.88 1.22 1.81 1.83 1.22 Upper limit of 95% CI 8.91 8.53 9.63 9.48 10.5 8.45 9.78 10.1 8.45

TABLE-US-00251 TABLE 36.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 667 1310 575 1500 561 1640 Average 1070 2820 1030 3020 1020 3140 Stdev 1560 4750 1530 4870 1510 4990 p (t-test) 0.0049 0.0014 7.3E4 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 69 56 73 52 76 49 sCr only Median 669 1290 597 1350 597 1350 Average 1080 2700 1040 2890 1040 2960 Stdev 1550 4730 1520 4860 1510 4950 p (t-test) 0.0085 0.0026 0.0020 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 70 54 74 50 76 48 UO only Median 736 1290 740 1260 740 1260 Average 1470 3260 1550 3030 1550 3030 Stdev 3320 3790 3400 3660 3400 3660 p (t-test) 0.018 0.054 0.054 Min 45.2 201 45.2 201 45.2 201 Max 30700 14400 30700 14400 30700 14400 n (Patient) 97 27 98 26 98 26 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.70 0.68 0.69 0.75 0.74 0.68 0.76 0.74 0.68 SE 0.048 0.049 0.061 0.046 0.047 0.063 0.046 0.047 0.063 p Value 4.2E5 1.8E4 0.0016 4.7E8 4.1E7 0.0049 1.4E8 4.7E7 0.0049 nCohort Non-persistent 69 70 97 73 74 98 76 76 98 nCohort Persistent 56 54 27 52 50 26 49 48 26 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 89% 89% 93% 94% 94% 92% 94% 94% 92% Specificity 36% 36% 30% 38% 38% 30% 37% 37% 30% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 66% 65% 70% 71% 70% 69% 73% 71% 69% Specificity 62% 61% 56% 64% 64% 55% 64% 63% 55% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 39% 39% 41% 42% 42% 38% 43% 42% 38% Specificity 86% 86% 79% 86% 86% 79% 86% 86% 79% OR Quartile 2 4.73 4.44 5.33 10.2 9.54 5.04 8.94 8.75 5.04 p Value 0.0018 0.0028 0.029 3.0E4 4.4E4 0.035 6.4E4 7.3E4 0.035 Lower limit of 95% CI 1.78 1.67 1.18 2.89 2.71 1.12 2.54 2.49 1.12 Upper limit of 95% CI 12.6 11.8 24.0 35.7 33.6 22.7 31.5 30.8 22.7 OR Quartile 3 3.22 2.93 2.98 4.46 4.06 2.76 5.03 4.16 2.76 p Value 0.0019 0.0042 0.020 1.4E4 3.5E4 0.031 6.1E5 3.2E4 0.031 Lower limit of 95% CI 1.54 1.40 1.19 2.07 1.88 1.10 2.28 1.91 1.10 Upper limit of 95% CI 6.73 6.13 7.47 9.61 8.76 6.95 11.1 9.06 6.95 OR Quartile 4 3.82 3.82 2.65 4.62 4.63 2.29 4.43 4.22 2.29 p Value 0.0022 0.0024 0.036 5.2E4 5.6E4 0.079 6.3E4 0.0010 0.079 Lower limit of 95% CI 1.62 1.61 1.06 1.95 1.94 0.908 1.89 1.79 0.908 Upper limit of 95% CI 9.01 9.06 6.59 11.0 11.1 5.78 10.4 9.96 5.78

TABLE-US-00252 TABLE 36.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 643 1330 561 1640 561 1640 Average 985 2890 942 3090 950 3160 Stdev 1390 4740 1360 4860 1350 4940 p (t-test) 0.0020 5.0E4 3.6E4 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 68 57 72 53 74 51 sCr only Median 667 1290 575 1360 575 1360 Average 998 2770 955 2980 963 3050 Stdev 1380 4720 1360 4850 1350 4930 p (t-test) 0.0035 9.6E4 7.1E4 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 69 55 73 51 75 49 UO only Median 711 1330 719 1310 719 1310 Average 1420 3190 1500 2990 1500 2990 Stdev 3340 3650 3420 3530 3420 3530 p (t-test) 0.014 0.042 0.042 Min 45.2 201 45.2 201 45.2 201 Max 30700 14400 30700 14400 30700 14400 n (Patient) 93 31 94 30 94 30 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.70 0.71 0.76 0.75 0.69 0.76 0.75 0.69 SE 0.047 0.048 0.057 0.044 0.046 0.059 0.045 0.046 0.059 p Value 7.8E6 3.9E5 2.6E4 3.6E9 4.0E8 9.7E4 4.3E9 4.8E8 9.7E4 nCohort Non-persistent 68 69 93 72 73 94 74 75 94 nCohort Persistent 57 55 31 53 51 30 51 49 30 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 89% 89% 94% 94% 94% 93% 94% 94% 93% Specificity 37% 36% 31% 39% 38% 31% 38% 37% 31% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 67% 65% 71% 72% 71% 70% 73% 71% 70% Specificity 63% 62% 57% 65% 64% 56% 65% 64% 56% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 40% 40% 39% 43% 43% 37% 43% 43% 37% Specificity 87% 87% 80% 88% 88% 79% 86% 87% 79% OR Quartile 2 4.94 4.64 6.57 10.6 9.96 6.25 9.74 9.13 6.25 p Value 0.0014 0.0021 0.014 2.3E4 3.4E4 0.017 3.9E4 5.7E4 0.017 Lower limit of 95% CI 1.86 1.74 1.47 3.02 2.83 1.39 2.77 2.60 1.39 Upper limit of 95% CI 13.2 12.4 29.4 37.3 35.0 28.0 34.2 32.1 28.0 OR Quartile 3 3.44 3.13 3.24 4.76 4.34 3.02 4.88 4.44 3.02 p Value 0.0011 0.0024 0.0087 7.1E5 1.9E4 0.014 6.6E5 1.7E4 0.014 Lower limit of 95% CI 1.64 1.50 1.35 2.21 2.01 1.25 2.24 2.04 1.25 Upper limit of 95% CI 7.20 6.56 7.79 10.3 9.37 7.28 10.6 9.68 7.28 OR Quartile 4 4.43 4.44 2.46 5.37 5.39 2.14 4.86 4.88 2.14 p Value 8.9E4 9.5E4 0.045 2.0E4 2.1E4 0.094 3.5E4 3.8E4 0.094 Lower limit of 95% CI 1.84 1.84 1.02 2.22 2.21 0.878 2.04 2.03 0.878 Upper limit of 95% CI 10.7 10.8 5.94 13.0 13.2 5.23 11.6 11.7 5.23

TABLE-US-00253 TABLE 36.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 643 1330 561 1640 561 1640 Average 985 2890 942 3090 950 3160 Stdev 1390 4740 1360 4860 1350 4940 p (t-test) 0.0020 5.0E4 3.6E4 Min 45.2 51.6 45.2 127 45.2 127 Max 10300 30700 10300 30700 10300 30700 n (Patient) 68 57 72 53 74 51 sCr only Median 669 1290 597 1350 597 1350 Average 1010 2730 967 2920 974 2990 Stdev 1390 4690 1360 4810 1350 4900 p (t-test) 0.0048 0.0014 0.0010 Min 45.2 51.6 45.2 93.3 45.2 93.3 Max 10300 30700 10300 30700 10300 30700 n (Patient) 68 56 72 52 74 50 UO only Median 694 1360 702 1350 702 1350 Average 1410 3100 1500 2910 1500 2910 Stdev 3380 3550 3460 3430 3460 3430 p (t-test) 0.017 0.049 0.049 Min 45.2 201 45.2 201 45.2 201 Max 30700 14400 30700 14400 30700 14400 n (Patient) 91 33 92 32 92 32 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.71 0.68 0.72 0.76 0.74 0.70 0.76 0.74 0.70 SE 0.047 0.049 0.055 0.044 0.047 0.057 0.045 0.047 0.057 p Value 7.8E6 1.8E4 7.6E5 3.6E9 4.6E7 3.2E4 4.3E9 5.6E7 3.2E4 nCohort Non-persistent 68 68 91 72 72 92 74 74 92 nCohort Persistent 57 56 33 53 52 32 51 50 32 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 89% 88% 94% 94% 92% 94% 94% 92% 94% Specificity 37% 35% 32% 39% 38% 32% 38% 36% 32% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 67% 64% 73% 72% 69% 72% 73% 70% 72% Specificity 63% 62% 58% 65% 64% 58% 65% 64% 58% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 40% 39% 39% 43% 42% 38% 43% 42% 38% Specificity 87% 87% 80% 88% 88% 79% 86% 86% 79% OR Quartile 2 4.94 3.82 7.25 10.6 7.20 6.90 9.74 6.61 6.90 p Value 0.0014 0.0050 0.0095 2.3E4 5.9E4 0.011 3.9E4 0.0010 0.011 Lower limit of 95% CI 1.86 1.50 1.62 3.02 2.33 1.54 2.77 2.14 1.54 Upper limit of 95% CI 13.2 9.73 32.4 37.3 22.2 30.9 34.2 20.4 30.9 OR Quartile 3 3.44 2.91 3.72 4.76 3.98 3.47 4.88 4.06 3.47 p Value 0.0011 0.0043 0.0032 7.1E5 3.7E4 0.0053 6.6E5 3.5E4 0.0053 Lower limit of 95% CI 1.64 1.40 1.55 2.21 1.86 1.45 2.24 1.88 1.45 Upper limit of 95% CI 7.20 6.05 8.90 10.3 8.51 8.33 10.6 8.76 8.33 OR Quartile 4 4.43 4.24 2.64 5.37 5.13 2.31 4.86 4.63 2.31 p Value 8.9E4 0.0013 0.029 2.0E4 3.1E4 0.062 3.5E4 5.6E4 0.062 Lower limit of 95% CI 1.84 1.75 1.11 2.22 2.11 0.960 2.04 1.94 0.960 Upper limit of 95% CI 10.7 10.3 6.28 13.0 12.5 5.53 11.6 11.1 5.53

Example 37. Use of Tumor Necrosis Factor Receptor Superfamily Member 11B for Evaluating Renal Status in Patients Admitted to the ICU: Persistent at RIFLE I or F

[0234] Patients from the intensive care unit (ICU) with RIFLE stage of injury (I) or failure (F) are enrolled in the following study. EDTA anti-coagulated blood samples (10 mL) and urine samples (50 mL) are collected from each patient at enrollment, and at every 12 hours up to day 3, and then every 24 hours thereafter up to day 7 while the subject is hospitalized. Tumor necrosis factor receptor superfamily member 11B is measured in the enrollment samples by standard immunoassay methods using commercially available assay reagents.

[0235] Kidney status is assessed by RIFLE criteria based on serum creatinine, urine output, or both serum creatinine and urine output. Two cohorts are defined to represent a persistent and a non-persistent population. Persistent indicates those patients whose minimum RIFLE stage during a period of 24, 48 or 72 hours is injury (I) or failure (F) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. Non-persistent indicates those patients who are not persistent at injury (I) or failure (F) and whose minimum RIFLE stage during a period of 24, 48 or 72 hours is non-injury (RIFLE 0) or risk of injury (R) where the persistence period can start from the time of sample collection to 24, 48, 72, 96 or 168 hours after sample collection. If a patient dies after injury (I) or failure (F) or is placed on renal replacement therapy (RRT) at any time from sample collection to 24, 48, 72, 96 or 168 hours after sample collection, the patient is considered persistent.

[0236] The ability to distinguish the persistent and non-persistent cohorts is determined using receiver operating characteristic (ROC) analysis.

TABLE-US-00254 TABLE 37.1 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 24 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 575 1170 671 1300 669 1330 Average 1020 2390 980 2800 970 2980 Stdev 1230 4280 1090 4730 1070 4900 p (t-test) 0.031 0.0031 0.0011 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 7050 30700 7050 30700 7050 30700 n (Patient) 49 76 65 60 70 55 sCr only Median 619 1160 667 1290 632 1330 Average 1020 2320 965 2690 991 2850 Stdev 1210 4260 1100 4660 1160 4860 p (t-test) 0.037 0.0044 0.0023 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 7050 30700 7050 30700 7050 30700 n (Patient) 51 73 65 59 71 53 UO only Median 719 1860 740 2230 763 1860 Average 1410 3430 1440 3820 1520 3620 Stdev 3320 3650 3240 4000 3300 4000 p (t-test) 0.0066 0.0033 0.013 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 96 28 102 22 104 20 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.64 0.63 0.75 0.66 0.67 0.74 0.68 0.69 0.71 SE 0.049 0.050 0.057 0.049 0.049 0.065 0.049 0.049 0.069 p Value 0.0043 0.0083 1.5E5 9.8E4 4.3E4 2.7E4 2.3E4 9.7E5 0.0029 nCohort Non-persistent 49 51 96 65 65 102 70 71 104 nCohort Persistent 76 73 28 60 59 22 55 53 20 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 83% 82% 96% 83% 85% 95% 85% 87% 95% Specificity 37% 35% 31% 32% 34% 29% 33% 34% 29% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 61% 60% 75% 63% 64% 73% 65% 68% 70% Specificity 65% 65% 57% 62% 63% 55% 61% 63% 54% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 30% 30% 50% 38% 37% 55% 40% 40% 50% Specificity 82% 82% 82% 86% 86% 81% 86% 86% 80% OR Quartile 2 2.81 2.52 12.3 2.39 2.84 8.75 2.88 3.36 7.70 p Value 0.015 0.029 0.016 0.046 0.019 0.038 0.022 0.011 0.052 Lower limit of 95% CI 1.22 1.10 1.59 1.01 1.18 1.13 1.17 1.32 0.986 Upper limit of 95% CI 6.47 5.78 94.6 5.61 6.83 68.0 7.07 8.55 60.1 OR Quartile 3 2.89 2.78 4.02 2.76 3.09 3.25 3.02 3.67 2.72 p Value 0.0054 0.0068 0.0039 0.0060 0.0026 0.023 0.0032 7.1E4 0.057 Lower limit of 95% CI 1.37 1.33 1.56 1.34 1.48 1.18 1.45 1.73 0.971 Upper limit of 95% CI 6.09 5.84 10.4 5.71 6.44 8.97 6.29 7.78 7.63 OR Quartile 4 1.93 2.01 4.65 3.87 3.70 5.24 4.00 4.00 3.95 p Value 0.14 0.12 9.1E4 0.0025 0.0036 8.8E4 0.0016 0.0017 0.0070 Lower limit of 95% CI 0.805 0.838 1.88 1.61 1.54 1.98 1.69 1.68 1.46 Upper limit of 95% CI 4.62 4.84 11.5 9.28 8.92 13.9 9.45 9.52 10.7

TABLE-US-00255 TABLE 37.2 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 48 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 534 1220 643 1290 643 1310 Average 810 2440 950 2690 947 2800 Stdev 829 4200 1120 4560 1100 4680 p (t-test) 0.011 0.0048 0.0025 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 7050 30700 7050 30700 n (Patient) 45 80 60 65 64 61 sCr only Median 561 1200 643 1290 619 1310 Average 846 2380 943 2580 922 2680 Stdev 826 4210 1110 4500 1090 4580 p (t-test) 0.014 0.0072 0.0037 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 7050 30700 7050 30700 n (Patient) 48 76 60 64 63 61 UO only Median 711 1330 736 1280 745 1220 Average 1440 2930 1480 3130 1570 2930 Stdev 3450 3410 3350 3690 3410 3630 p (t-test) 0.032 0.025 0.072 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 89 35 95 29 97 27 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.67 0.71 0.68 0.67 0.68 0.69 0.69 0.66 SE 0.047 0.048 0.055 0.048 0.048 0.060 0.047 0.047 0.063 p Value 4.4E5 3.5E4 1.4E4 2.1E4 2.9E4 0.0021 7.7E5 3.7E5 0.013 nCohort Non-persistent 45 48 89 60 60 95 64 63 97 nCohort Persistent 80 76 35 65 64 29 61 61 27 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 84% 83% 94% 85% 84% 93% 87% 87% 93% Specificity 40% 38% 33% 35% 35% 31% 36% 37% 30% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 62% 62% 71% 65% 64% 69% 66% 66% 67% Specificity 71% 69% 58% 65% 65% 56% 64% 65% 55% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 32% 33% 40% 37% 38% 41% 38% 39% 37% Specificity 87% 88% 81% 87% 88% 80% 86% 89% 78% OR Quartile 2 3.44 2.91 7.98 2.96 2.91 5.93 3.72 3.81 5.33 p Value 0.0041 0.012 0.0065 0.013 0.015 0.020 0.0043 0.0037 0.029 Lower limit of 95% CI 1.48 1.26 1.79 1.26 1.23 1.32 1.51 1.54 1.18 Upper limit of 95% CI 7.97 6.70 35.5 6.98 6.86 26.6 9.16 9.40 24.0 OR Quartile 3 4.10 3.57 3.51 3.39 3.31 2.80 3.40 3.55 2.41 p Value 4.4E4 0.0011 0.0036 0.0011 0.0014 0.022 0.0011 7.9E4 0.054 Lower limit of 95% CI 1.87 1.66 1.51 1.63 1.59 1.16 1.63 1.69 0.985 Upper limit of 95% CI 9.02 7.67 8.19 7.07 6.91 6.79 7.08 7.44 5.89 OR Quartile 4 3.13 3.43 2.82 3.80 4.54 2.82 3.70 5.19 2.13 p Value 0.022 0.014 0.018 0.0036 0.0015 0.023 0.0034 5.9E4 0.11 Lower limit of 95% CI 1.18 1.29 1.20 1.55 1.78 1.16 1.54 2.03 0.850 Upper limit of 95% CI 8.33 9.14 6.66 9.35 11.6 6.90 8.87 13.3 5.33

TABLE-US-00256 TABLE 37.3 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 72 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 534 1220 643 1290 643 1310 Average 810 2440 950 2690 937 2760 Stdev 829 4200 1120 4560 1100 4620 p (t-test) 0.011 0.0048 0.0031 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 7050 30700 7050 30700 n (Patient) 45 80 60 65 62 63 sCr only Median 561 1200 643 1290 643 1300 Average 846 2380 943 2580 931 2640 Stdev 826 4210 1110 4500 1100 4550 p (t-test) 0.014 0.0072 0.0048 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 7050 30700 7050 30700 n (Patient) 48 76 60 64 62 62 UO only Median 702 1310 732 1290 740 1250 Average 1460 2710 1500 2840 1590 2650 Stdev 3550 3260 3440 3490 3500 3400 p (t-test) 0.063 0.056 0.14 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 84 40 90 34 92 32 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.67 0.69 0.68 0.67 0.66 0.69 0.69 0.64 SE 0.047 0.048 0.053 0.048 0.048 0.057 0.047 0.048 0.059 p Value 4.4E5 3.5E4 2.9E4 2.1E4 2.9E4 0.0039 6.2E5 8.6E5 0.020 nCohort Non-persistent 45 48 84 60 60 90 62 62 92 nCohort Persistent 80 76 40 65 64 34 63 62 32 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 84% 83% 90% 85% 84% 88% 86% 85% 88% Specificity 40% 38% 32% 35% 35% 30% 35% 35% 29% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 62% 62% 70% 65% 64% 68% 65% 65% 66% Specificity 71% 69% 60% 65% 65% 57% 65% 65% 55% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 32% 33% 38% 37% 38% 38% 38% 39% 34% Specificity 87% 88% 81% 87% 88% 80% 87% 89% 78% OR Quartile 2 3.44 2.91 4.26 2.96 2.91 3.21 3.30 3.24 2.91 p Value 0.0041 0.012 0.012 0.013 0.015 0.044 0.0076 0.0087 0.066 Lower limit of 95% CI 1.48 1.26 1.38 1.26 1.23 1.03 1.37 1.35 0.930 Upper limit of 95% CI 7.97 6.70 13.2 6.98 6.86 10.0 7.93 7.79 9.09 OR Quartile 3 4.10 3.57 3.43 3.39 3.31 2.73 3.39 3.31 2.37 p Value 4.4E4 0.0011 0.0027 0.0011 0.0014 0.018 0.0011 0.0014 0.043 Lower limit of 95% CI 1.87 1.66 1.53 1.63 1.59 1.19 1.63 1.58 1.03 Upper limit of 95% CI 9.02 7.67 7.67 7.07 6.91 6.28 7.06 6.90 5.49 OR Quartile 4 3.13 3.43 2.55 3.80 4.54 2.48 4.15 4.96 1.89 p Value 0.022 0.014 0.029 0.0036 0.0015 0.040 0.0019 8.2E4 0.16 Lower limit of 95% CI 1.18 1.29 1.10 1.55 1.78 1.04 1.69 1.94 0.781 Upper limit of 95% CI 8.33 9.14 5.91 9.35 11.6 5.87 10.2 12.7 4.55

TABLE-US-00257 TABLE 37.4 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 96 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 534 1220 619 1300 619 1320 Average 810 2440 846 2750 837 2820 Stdev 829 4200 785 4560 779 4610 p (t-test) 0.011 0.0019 0.0012 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 45 80 59 66 61 64 sCr only Median 561 1200 619 1290 619 1310 Average 846 2380 840 2640 831 2710 Stdev 826 4210 775 4500 769 4550 p (t-test) 0.014 0.0029 0.0019 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 48 76 59 65 61 63 UO only Median 694 1290 719 1290 732 1250 Average 1410 2710 1450 2790 1550 2620 Stdev 3550 3240 3460 3420 3530 3330 p (t-test) 0.049 0.049 0.12 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 81 43 86 38 88 36 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.67 0.69 0.69 0.69 0.67 0.70 0.70 0.64 SE 0.047 0.048 0.052 0.047 0.047 0.055 0.046 0.047 0.057 p Value 4.4E5 3.5E4 1.9E4 4.5E5 6.2E5 0.0022 1.1E5 1.6E5 0.012 nCohort Non-persistent 45 48 81 59 59 86 61 61 88 nCohort Persistent 80 76 43 66 65 38 64 63 36 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 84% 83% 91% 85% 85% 89% 86% 86% 89% Specificity 40% 38% 33% 36% 36% 31% 36% 36% 31% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 62% 62% 67% 65% 65% 66% 66% 65% 64% Specificity 71% 69% 59% 66% 66% 57% 66% 66% 56% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 32% 33% 37% 38% 38% 37% 39% 40% 33% Specificity 87% 88% 81% 88% 90% 80% 89% 90% 78% OR Quartile 2 3.44 2.91 4.88 3.09 3.04 3.89 3.45 3.38 3.54 p Value 0.0041 0.012 0.0059 0.0099 0.011 0.019 0.0057 0.0065 0.029 Lower limit of 95% CI 1.48 1.26 1.58 1.31 1.29 1.25 1.43 1.41 1.14 Upper limit of 95% CI 7.97 6.70 15.1 7.30 7.18 12.1 8.29 8.14 11.0 OR Quartile 3 4.10 3.57 3.01 3.65 3.56 2.55 3.64 3.55 2.22 p Value 4.4E4 0.0011 0.0054 6.1E4 7.8E4 0.021 6.1E4 7.9E4 0.050 Lower limit of 95% CI 1.87 1.66 1.39 1.74 1.70 1.15 1.74 1.69 0.999 Upper limit of 95% CI 9.02 7.67 6.55 7.64 7.47 5.64 7.61 7.44 4.95 OR Quartile 4 3.13 3.43 2.61 4.53 5.52 2.37 4.95 6.03 1.82 p Value 0.022 0.014 0.024 0.0015 6.4E4 0.046 7.9E4 3.4E4 0.17 Lower limit of 95% CI 1.18 1.29 1.13 1.78 2.07 1.02 1.94 2.26 0.769 Upper limit of 95% CI 8.33 9.14 6.01 11.5 14.7 5.52 12.6 16.1 4.29

TABLE-US-00258 TABLE 37.5 Comparison of marker levels and the area under the ROC curve (AUC) in urine samples for the persistent and non-persistent cohorts where persistence starts within 168 hours after sample collection and renal status is assessed by serum creatinine (sCr) only, urine output (UO) only, or serum creatinine or urine output RIFLE criteria. Persistence Period Duration (hr) 24 48 72 Non-persistent Persistent Non-persistent Persistent Non-persistent Persistent Cohort Cohort Cohort Cohort Cohort Cohort sCr or UO Median 534 1220 621 1290 621 1310 Average 810 2440 850 2720 841 2790 Stdev 829 4200 792 4530 785 4590 p (t-test) 0.011 0.0024 0.0015 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 45 80 58 67 60 65 sCr only Median 561 1200 619 1290 619 1310 Average 846 2380 840 2640 831 2710 Stdev 826 4210 775 4500 769 4550 p (t-test) 0.014 0.0029 0.0019 Min 45.2 51.6 45.2 51.6 45.2 51.6 Max 3380 30700 3380 30700 3380 30700 n (Patient) 48 76 59 65 61 63 UO only Median 677 1330 711 1290 727 1280 Average 1410 2670 1460 2690 1560 2520 Stdev 3600 3170 3530 3310 3590 3220 p (t-test) 0.053 0.065 0.15 Min 45.2 127 45.2 127 45.2 127 Max 30700 14400 30700 14400 30700 14400 n (Patient) 79 45 83 41 85 39 Persistence Period Duration (hr) 24 48 72 sCr or UO sCr only UO only sCr or UO sCr only UO only sCr or UO sCr only UO only AUC 0.69 0.67 0.70 0.69 0.69 0.67 0.70 0.70 0.65 SE 0.047 0.048 0.050 0.047 0.047 0.053 0.046 0.047 0.055 p Value 4.4E5 3.5E4 5.1E5 6.4E5 6.2E5 0.0011 1.7E5 1.6E5 0.0071 nCohort Non-persistent 45 48 79 58 59 83 60 61 85 nCohort Persistent 80 76 45 67 65 41 65 63 39 Cutoff Quartile 2 376 375 375 376 375 375 376 375 375 Sensitivity 84% 83% 91% 85% 85% 90% 86% 86% 90% Specificity 40% 38% 34% 36% 36% 33% 37% 36% 32% Cutoff Quartile 3 835 835 852 835 835 852 835 835 852 Sensitivity 62% 62% 69% 64% 65% 66% 65% 65% 64% Specificity 71% 69% 61% 66% 66% 58% 65% 66% 56% Cutoff Quartile 4 1880 1880 1910 1880 1880 1910 1880 1880 1910 Sensitivity 32% 33% 38% 37% 38% 37% 38% 40% 33% Specificity 87% 88% 82% 88% 90% 81% 88% 90% 79% OR Quartile 2 3.44 2.91 5.32 3.24 3.04 4.46 3.60 3.38 4.07 p Value 0.0041 0.012 0.0036 0.0074 0.011 0.0095 0.0042 0.0065 0.015 Lower limit of 95% CI 1.48 1.26 1.72 1.37 1.29 1.44 1.50 1.41 1.31 Upper limit of 95% CI 7.97 6.70 16.4 7.64 7.18 13.8 8.67 8.14 12.6 OR Quartile 3 4.10 3.57 3.43 3.40 3.56 2.64 3.39 3.55 2.32 p Value 4.4E4 0.0011 0.0019 0.0011 7.8E4 0.014 0.0011 7.9E4 0.035 Lower limit of 95% CI 1.87 1.66 1.58 1.63 1.70 1.21 1.63 1.69 1.06 Upper limit of 95% CI 9.02 7.67 7.45 7.11 7.47 5.76 7.07 7.44 5.07 OR Quartile 4 3.13 3.43 2.82 4.34 5.52 2.42 4.73 6.03 1.86 p Value 0.022 0.014 0.015 0.0020 6.4E4 0.039 0.0011 3.4E4 0.15 Lower limit of 95% CI 1.18 1.29 1.22 1.71 2.07 1.05 1.86 2.26 0.799 Upper limit of 95% CI 8.33 9.14 6.49 11.0 14.7 5.58 12.0 16.1 4.33

[0237] While the invention has been described and exemplified in sufficient detail for those skilled in this art to make and use it, various alternatives, modifications, and improvements should be apparent without departing from the spirit and scope of the invention. The examples provided herein are representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Modifications therein and other uses will occur to those skilled in the art. These modifications are encompassed within the spirit of the invention and are defined by the scope of the claims.

[0238] It will be readily apparent to a person skilled in the art that varying substitutions and modifications may be made to the invention disclosed herein without departing from the scope and spirit of the invention.

[0239] All patents and publications mentioned in the specification are indicative of the levels of those of ordinary skill in the art to which the invention pertains. All patents and publications are herein incorporated by reference to the same extent as if each individual publication was specifically and individually indicated to be incorporated by reference.

[0240] The invention illustratively described herein suitably may be practiced in the absence of any element or elements, limitation or limitations which is not specifically disclosed herein. Thus, for example, in each instance herein any of the terms comprising, consisting essentially of and consisting of may be replaced with either of the other two terms. The terms and expressions which have been employed are used as terms of description and not of limitation, and there is no intention that in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the invention claimed. Thus, it should be understood that although the present invention has been specifically disclosed by preferred embodiments and optional features, modification and variation of the concepts herein disclosed may be resorted to by those skilled in the art, and that such modifications and variations are considered to be within the scope of this invention as defined by the appended claims.

[0241] Other embodiments are set forth within the following claims.