MODULATION OF A PATHOGENIC PHENOTYPE IN TH1 CELLS

20240108689 ยท 2024-04-04

    Inventors

    Cpc classification

    International classification

    Abstract

    The subject matter disclosed herein is generally directed to pathogenic Th1 cells whose phenotype is dependent on IL-23R signaling. Th1 cell specific therapeutic targets and gene programs are disclosed herein. In particular, inhibition of CD160 reduces Th1 cell pathogenicity.

    Claims

    1. A method of treating an autoimmune disease caused by pathogenic Th1 cells comprising administering one or more agents capable of inhibiting the expression, activity and/or function of one or more genes selected from the group consisting of CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW.

    2. The method of claim 1, wherein the one or more agents inhibit the expression, activity and/or function of CD160.

    3. The method of claim 1, wherein the one or more agents inhibit the expression, activity and/or function of GPR18.

    4. The method of any one of claims 1 to 3, wherein the one or more agents comprises an antibody, antibody fragment, intrabody, small molecule, small molecule degrader, antibody-like protein scaffold, aptamer, polypeptide, genetic modifying agent, or any combination thereof.

    5. The method of claim 4, wherein the genetic modifying agent comprises an RNA-guided nuclease system, RNAi system, a zinc finger nuclease, a TALE, or a meganuclease.

    6. The method of claim 5, wherein the RNA-guided nuclease system is a CRISPR system or IscB system.

    7. The method of claim 6, wherein the CRISPR system comprises a CRISPR-Cas base editing system, a prime editor system, or a CAST system.

    8. A method of treating an autoimmune disease caused by pathogenic Th1 cells comprising administering Th1 cells modified to have decreased expression of IL-23R.

    9. A method of detecting a Th1 inflammatory response for diagnosis or monitoring of a treatment of a subject suffering from an autoimmune disease caused by colitogenic Th1 cells comprising detecting in a sample obtained from the subject Th1 cells expressing one or more genes selected from the group consisting of: a. IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW, wherein the expression of one or more genes are increased in an inflammatory response; or b. clusters 2, 9 and 7 in Table 3, wherein the expression of one or more genes or program from cluster 2 and/or 9 are increased in an inflammatory response and the expression of one or more genes or program in cluster 7 are decreased in an inflammatory response.

    10. The method of claim 9, wherein the treatment comprises one or more agents capable of inhibiting the expression, activity and/or function of CD160, GPR18, IL-23, or IL-12 and IL-23.

    11. The method of claim 9 or 10, wherein the Th1 cells are detected by immunohistochemistry (IHC), fluorescence activated cell sorting (FACS), fluorescently bar-coded oligonucleotide probes, RNA FISH (fluorescent in situ hybridization), RNA-seq, or any combination thereof.

    12. The method of claim 11, wherein the Th1 cell expression is inferred from bulk RNA-seq.

    13. The method of claim 11, wherein the Th1 cell expression is determined by single cell RNA-seq.

    14. The method of any of claims 9 to 13, wherein the sample is obtained by biopsy.

    15. The method of any of claims 1 to 14, wherein the autoimmune disease is inflammatory bowel disease (IBD) or type 1 diabetes.

    16. A method of obtaining IL-23R.sup.+ Th1 cells comprising differentiating na?ve CD4+ T cells in vitro with IL-12 and IL-21.

    17. The method of claim 16, further comprising differentiating with IL-23.

    18. A method of treating cancer comprising administering to a subject in need thereof Th1 cells differentiated according to claim 16 or 17.

    19. The method of claim 18, wherein the na?ve CD4+ T cells are obtained from the subject.

    20. A method of screening for drugs capable of shifting pathogenic Th1 cells to non-pathogenic Th1 cells comprising: a. treating Th1 cells obtained according to claim 16 or 17 with a drug candidate; b. detecting expression of one or more genes or program selected from cluster 2, 9 or 7 in Table 3; and c. identifying the drug, wherein the expression of one or more genes or program from cluster 2 or 9 decrease, and/or the expression of one or more genes or program in cluster 7 increase as compared to cells not contacted with the drug candidate.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0016] An understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention may be utilized, and the accompanying drawings of which:

    [0017] FIGS. 1A-1GIL-12+IL-21 strongly induce IL-23R in Th1 cells in vitro. FIG. 1a, Na?ve CD44.sup.lowCD62L.sup.hi CD4.sup.+ T cells were cultured under four different conditions in vitro for 5 days on anti-CD3/CD28 antibody-coated plates with the following conditions: TGF-?+IL-6 (non-pathogenic Th17 cells), IL-1?+IL-6+IL-23 (pathogenic Th17 cells), IL-12+IL-21 and IL-12+IL-21+IL-23. Flow cytometry was used to measure the extent of IL-23R expression taking advantage of an eGFP reporter allele. FIG. 1b, qPCR analysis shows the expression of Il23r in wildtype (Il23r.sup.eGFP/wt) cells. Important signature Th1 and Th17 genes such as Ifng, Il17a, Tbx21, Rorc and Stat3 were measured in both wildtype (Il23r.sup.eGFP/wt) and KO cells (Il23r.sup.eGFP/eGFP) FIG. 1c, Schematic of sorting by FACS of IL-23R.sup.+ (eGFP.sup.+) and IL-23R.sup.? (eGFP.sup.?) cells differentiated with IL-12+IL-21+IL-23 in preparation of scRNAseq (Smart-seq2). FIG. 1d, t-SNE plots showing the expression of Th1 and Th17 signature genes. FIG. 1e, Selected genes are shown that are expressed in eGFP.sup.+ and eGFP.sup.? cells in wildtype (Il23r.sup.eGFP/wt) cells. Green violin plots represent eGFP.sup.+-sorted cells. FIG. 1f, 528 genes were found to be differentially expressed between eGFP.sup.+ and eGFP.sup.? cells from wildtype cells (Il23r.sup.eGFP/wt) In knockout cells for IL-23R (Il23r.sup.eGFP/eGFP) only 129 genes were found to be differentially expressed between eGFP.sup.+ and eGFP.sup.? cells. FIG. 1g, Volcano plot showing genes differentially expressed in an IL-23R dependent manner. An interaction coefficient was computed to identify differences between the eGFP.sup.+ and eGFP.sup.? populations which varied according to genotype (wildtype Il23r.sup.eGFP/wt vs. knockout Il23r.sup.eGFP/eGFP) Panel a is representative of several experiments and mean+s.e.m are shown. In Panel b mean+s.e.m are shown.

    [0018] FIGS. 2A-2FscRNAseq of tissue-infiltrating Th1 cells in a pre-clinical model of adoptive transfer colitis. FIG. 2a, Schematic of adoptive transfer colitis by in vitro differentiated Th1 cells followed by histopathology and 10? scRNAseq. Viable CD45.sup.+CD4.sup.+ T lymphocytes from RAG1.sup.?/? recipients of either wildtype cells (Il23r.sup.wt/eGFP) or knockout cells (Il23r.sup.eGFP/eGFP) respectively, were isolated from the intestinal mucosa through FACS in preparation of scRNAseq. FIG. 2b, Deficiency of IL-23R protects from Th1 cell mediated adoptive transfer colitis as evaluated by histopathology. H&E staining and clinical score are shown. Mean+s.e.m. FIG. 2c, UMAP of 30,260 single cells sequenced from spleen, colonic and small intestinal (SI) lamina propria (LPL) and colonic epithelium (IEL=intraepithelial lymphocytes). FIG. 2d, Heatmap of differentially expressed genes among the tissues analyzed with selected genes highlighted as dot plots. FIG. 2e, Identification of wildtype (teal) and knockout cells (magenta), respectively. FIG. 2f, Selected genes are shown that are expressed in an IL-23R dependent manner. Red representing higher expression in wildtype cells and blue representing higher expression in knockout cells.

    [0019] FIGS. 3A-3EIL-23R drives the expansion of highly inflammatory and colitogenic T cells in the lamina propria as identified by scRNAseq. FIG. 3a, UMAP of T cells isolated from the lamina propria of small intestine and colon. Wildtype cells (teal) and knockout cells (magenta) are highlighted. FIG. 3b, Cluster analysis identifies 12 clusters with particular transcriptional signatures. FIG. 3c, The size of each cluster is shown as a percentage of the total number of cells. For each cluster, its relative abundance among wild type vs. knockout cells is visualized. FIG. 3d, Two clusters with a highly inflammatory and colitogenic signature are shown (clusters 2 and 9) which are dominated by wildtype cells. The top 20 differentially expressed genes in comparison to all other clusters are shown. Cluster 7 consists in the majority of knockout cells and exhibits a signature reminiscent of Tr-like cells FIG. 3e, Applicants assembled a list of genes (597 genes) found within IBD GWAS risk loci for which De Lange et al. (2017) provided the main basis. Applicants then asked which of these genes are expressed in clusters 2, 7 and 9 in an IL-23R-dependent manner comparing expression levels between wildtype and knockout cells. Positive values indicate higher expression in wildtype cells (Il23r.sup.eGFP/wt) Asterisks indicate statistically significant differences (FDR<0.1).

    [0020] FIGS. 4A-4ERanking algorithm and validation identify novel drivers of T cell-mediated intestinal inflammation in an IL-23R dependent manner. FIG. 4a, Identification and ranking of potential novel drivers of intestinal inflammation taking several critical considerations into account. 4 tracks are shown. Track 1: Genes are evaluated based on their expression in vivo in a cluster and genotype specific manner emphasizing clusters 2 and 9. Track 2: Genes are ranked based on their tissue specific expression comparing intestinal and peripheral (splenic) expression. Track 3: Genes are ranked based on their IL-23R dependent expression in vitro following differentiation with IL-12+IL-21+IL-23 (Smart-seq2 data from FIG. 1). Track 4: Genes that are found within an IBD GWAS risk locus are identified contributing to an increased ranking score. See methods for details of ranking. FIG. 4b, Deficiency for CD160 in Th1 cells adoptively transferred into RAG1.sup.?/? recipients protects from colitis. Representative H&E histopathological stainings are shown. FIG. 4c, Intestinal inflammation and colitis are scored in the following way: 0 (healthy)-4 (most severe colitis). Pooled data from three independent experiments are shown for small intestine and proximal colon. Mean+s.e.m. are indicated. FIG. 4d, Colon length in RAG1.sup.?/? recipients of either wildtype or CD160.sup.?/? cells. Pooled data are shown from two independent experiments. FIG. 4e, Gzmb expression is measured by flow cytometry in both Cd160.sup.+/+ and Cd160.sup.?/? Th1 cells prior to adoptive transfer. One experiment. Technical replicates. A t-test was used to determine statistical significance in panels c, d and e.

    [0021] FIG. 5Cytokine screen identifies IL-21 as a cytokine that together with IL-12 induces strong expression of IL-23R in Th1 cells in vitro. Applicants isolated na?ve T cells from Il23r.sup.wt/eGFP reporter mice and tested 19 different conditions. IL-23R expression was measured by flow cytometry identifying eGFP.sup.+ cells. Several conditions strongly induced IL-23R expression including the pathogenic Th17 cell condition IL-1?+IL-6+IL-23. The strongest expression of IL-17 was observed with the condition TGF-?+IL-6. Even though IL-21 and IL-6 alone induced IL-23R expression they resulted in the complete lack of IFN-? expression and showed slight induction of IL-17A. Importantly, both IL-12+IL-21 and IL-12+IL-21+IL-23 induced strong expression of the Th1 cell signature cytokine IFN-? and complete lack of IL-17A expression.

    [0022] FIG. 6Dot plot showing expression of 12 key genes in Th1 and Th17 cell biology across the 4 populations profiled by Smart-seq2. Tbx21, Il12rb2 and Il21r expression appeared largely unaltered by deficiency for Il23r which was consistent with unaltered expression between eGFP.sup.+ and eGFP.sup.? populations. Of note, the expression level of Il23r in knockout cells (Il23r.sup.eGFP/eGFP) is merely reminiscent of the fact that these cells produce mRNA truncated of the essential C-terminal region of IL-23R which was replaced by an IRES-eGFP sequence which results in a functional KO but is detected by Smart-seq2.

    [0023] FIGS. 7A-7DIL-23R.sup.+ Th1 and IL-23R.sup.+ Th17 cells show both common and unique transcriptional signatures. Pathogenic Th17 cells were differentiated with IL-1?+IL-6+IL-23 and IL-23R.sup.+ (i.e., eGFP.sup.+) and IL-23R.sup.? (i.e., eGFP.sup.?) were sorted and then single-cell Smart-seq2 was performed and the transcriptional signatures were compared to Th1 cells differentiated with IL-12+IL-21+IL-23 reported in FIG. 1. FIG. 7a, Th1 cells and Th17 cells show a set of genes that is similarly regulated in both IL-23R.sup.+ cells from either population. FIG. 7b, Some genes are differentially regulated between IL-23R.sup.+ and IL-23R.sup.? cells in Th1 cells only. FIG. 7c, Some genes show the exact opposite behavior in Th1 and Th17 cells. FIG. 7d, A fourth set of genes was differentially regulated between IL-23R.sup.+ and IL-23R.sup.? cells in Th17 cells only.

    [0024] FIGS. 8A-8GTissue infiltrating CD45.sup.+CD4.sup.+ T cells show strong expression of IFN-?. Flow cytometric analyses of tissue infiltrating T cells isolated from the intestine of recipients of either wildtype or IL-23R KO cells and cultured ON with the cytokines IL-7+IL-23. ICC was performed after restimulation with PMA/ionomycin. FIG. 8a, Colonic LPL cells. Two recipients of wildtype cells (Il23r.sup.eGFP/wt) and one recipient of KO cells (Il23r.sup.eGFP/eGFP) are shown. Gated on viable CD45.sup.+ cells. FIG. 8b, FIG. 8c ICC for IFN-?, IL-17A and GMCSF of the two recipients of wildtype cells is shown. FIG. 8d, Colonic IEL cells. One recipient of wildtype cells and one recipient of KO cells are shown. Gated on viable CD45.sup.+ cells. FIG. 8e, ICC for IFN-? and IL-17A of the IEL samples. FIG. 8f, FIG. 8g Pooled values of LPL and IEL samples. LPL and IEL samples were isolated and analyzed in independent experiments. Data in panels f and g are mean?SD. Unpaired t-test, p value **<0.01 in panel f.

    [0025] FIG. 9Cluster 8 represents highly proliferating cells. UMAPs show that cells of cluster 8 highly express genes critical to cell cycle progression such as Cdc20, Ccnb1 (cyclin B), Cdc6, Cdk1 and the proliferative marker Mki67.

    [0026] FIGS. 10A-10DIL-23R negatively impacts the development of regulatory Tr1 cells in the intestinal lamina propria as identified by scRNAseq. FIG. 10a, UMAPs and correlated expression profiles of signature genes of regulatory Tr cells exposing cluster 7. FIG. 10b, Dot plot showing the expression of signature genes in comparison to all other clusters. FIG. 10c, Transcriptional signature of Tr regulatory cells identified by Gruarin et al. (2019) highlights cluster 7. FIG. 10d, Volcano plot highlighting differentially expressed genes between wildtype (Il23r.sup.eGFP/wt) and knockout (II23r.sup.eGFP/eGFP) cells within cluster 7.

    [0027] FIGS. 11A-11BIn vitro differentiated Th1 cells from either Cd160.sup.+/+ or Cd160.sup.?/? cells do not show a difference in IFN-? expression prior to adoptive transfer. FIG. 11a, In vitro differentiated Th1 cells do not show a difference in IFN-? production under culture with IL-12+IL-21+IL-23 between wildtype and CD160 knockout cells. One representative experiment of three independent experiments is shown. FIG. 11b, Pooled data from in vitro differentiated Th1 cells are shown prior to adoptive transfer into RAG1.sup.?/? mice. 3 independent experiments. Mean is shown with SD error bars. All differences are non-significant.

    [0028] FIG. 12Overview of T cell and NK cell markers in cells isolated from the intestinal mucosa (LPL) and sequenced by 10? technology. UMAPs of cells sequenced that show uniform expression of CD45, CD3, CD4 and lack expression of NK cell markers such as NK1.1, CD56 and CD16 in addition to the lack of CD8a.

    [0029] The figures herein are for illustrative purposes only and are not necessarily drawn to scale.

    DETAILED DESCRIPTION OF THE EXAMPLE EMBODIMENTS

    General Definitions

    [0030] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Definitions of common terms and techniques in molecular biology may be found in Molecular Cloning: A Laboratory Manual, 2.sup.nd edition (1989) (Sambrook, Fritsch, and Maniatis); Molecular Cloning: A Laboratory Manual, 4.sup.th edition (2012) (Green and Sambrook); Current Protocols in Molecular Biology (1987) (F. M. Ausubel et al. eds.); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (1995) (M. J. MacPherson, B. D. Hames, and G. R. Taylor eds.): Antibodies, A Laboratory Manual (1988) (Harlow and Lane, eds.): Antibodies A Laboratory Manual, 2.sup.nd edition 2013 (E. A. Greenfield ed.); Animal Cell Culture (1987) (R. I. Freshney, ed.); Benjamin Lewin, Genes IX, published by Jones and Bartlet, 2008 (ISBN 0763752223); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0632021829); Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 9780471185710); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992); and Marten H. Hofker and Jan van Deursen, Transgenic Mouse Methods and Protocols, 2.sup.nd edition (2011).

    [0031] As used herein, the singular forms a an, and the include both singular and plural referents unless the context clearly dictates otherwise.

    [0032] The term optional or optionally means that the subsequent described event, circumstance or substituent may or may not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.

    [0033] The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints.

    [0034] The terms about or approximately as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +/?10% or less, +/?5% or less, +/?1% or less, and +/?0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier about or approximately refers is itself also specifically, and preferably, disclosed.

    [0035] As used herein, a biological sample may contain whole cells and/or live cells and/or cell debris. The biological sample may contain (or be derived from) a bodily fluid. The present invention encompasses embodiments wherein the bodily fluid is selected from amniotic fluid, aqueous humour, vitreous humour, bile, blood serum, breast milk, cerebrospinal fluid, cerumen (earwax), chyle, chyme, endolymph, perilymph, exudates, feces, female ejaculate, gastric acid, gastric juice, lymph, mucus (including nasal drainage and phlegm), pericardial fluid, peritoneal fluid, pleural fluid, pus, rheum, saliva, sebum (skin oil), semen, sputum, synovial fluid, sweat, tears, urine, vaginal secretion, vomit and mixtures of one or more thereof. Biological samples include cell cultures, bodily fluids, cell cultures from bodily fluids. Bodily fluids may be obtained from a mammal organism, for example by puncture, or other collecting or sampling procedures.

    [0036] The terms subject, individual, and patient are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.

    [0037] Various embodiments are described hereinafter. It should be noted that the specific embodiments are not intended as an exhaustive description or as a limitation to the broader aspects discussed herein. One aspect described in conjunction with a particular embodiment is not necessarily limited to that embodiment and can be practiced with any other embodiment(s). Reference throughout this specification to one embodiment, an embodiment, an example embodiment, means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases in one embodiment, in an embodiment, or an example embodiment in various places throughout this specification are not necessarily all referring to the same embodiment, but may. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention. For example, in the appended claims, any of the claimed embodiments can be used in any combination.

    [0038] All publications, published patent documents, and patent applications cited herein are hereby incorporated by reference to the same extent as though each individual publication, published patent document, or patent application was specifically and individually indicated as being incorporated by reference.

    Overview

    [0039] Embodiments disclosed herein provide methods of treating Th1 cell-mediated autoimmune diseases, generating IL-23R.sup.+ Th1 cells, and detection and modulation of pathogenic and regulatory cell programs. The cytokine receptor IL-23R plays a fundamental role in inflammation and autoimmunity.sup.1-5. However, several observations have been difficult to reconcile under the assumption that only Th17 cells critically depend on IL-23 to acquire a pathogenic phenotype.sup.6,7. To this end, Applicants performed a cytokine screen and discovered that the cytokine combination IL-12+IL-21 strongly induces IL-23R on Th1 cells in vitro. Th1 cells differentiated in vitro with IL-12+IL-21 show similar levels of IL-23R expression as in pathogenic Th17 cells.sup.8,9. Applicants demonstrate that IL-23R is required for Th1 cells to acquire a highly pathogenic/colitogenic phenotype in an adoptive transfer colitis model.sup.3,7. Thus, the Th1 cells were pathogenic. Loss of IL-23R expression on Th1 cells almost completely abrogated the ability of Th1 cells to transfer colitis. Thus, the Th1 cells were non-pathogenic. Using massively parallel single-cell RNA-sequencing (scRNAseq) of intestinal tissue-infiltrating colitogenic Th1 cells, Applicants demonstrated a striking expression of genes that promote inflammation and linked these genes with multiple pathways implicated in the induction of IBD in humans as identified by GWAS analysis. scRNAseq analysis of intestinal T cells enabled identification of novel regulators induced by IL-23R-signaling in Th1 cells which differed from those expressed in Th17 cells.sup.9-11. Applicants identified a number of novel regulators induced by IL-23R-dependent signaling in Th1 cells and demonstrated a critical role for the IL-23R-dependent gene Cd160 in colitis. The perturbation of CD160 in Th1 cells inhibited induction of colitis, validating the role of IL-23R signaling in Th1 cells.

    [0040] Applicants were able to uncouple IL-23R as a purely Th17 cell-specific factor and implicate IL-23R signaling as a pathogenic driver of Th1 cell-mediated tissue inflammation and disease. Thus, Applicants identified a pathogenic function for IL-23R signaling in Th1 cells that promotes colitis, expanding the importance of this pathway beyond Th17 cells in autoimmune disease and enabling identification of novel targets linked with human IBD for further investigation. The findings provide a reason to target the pathogenic function of IL-23R in autoimmune diseases in which Th1 or other T cell subsets are the main drivers of the disease.

    Pathogenic Th1 Cells

    [0041] The present invention identified pathogenic Th1 cells. As used herein, pathogenic Th1 cells refer to Th1 cells capable of inducing inflammation or an autoimmune response in vivo. In regard to the digestive track, pathogenic Th1 cells are also referred to herein as colitogenic Th1 cells. In certain embodiments, pathogenic Th1 cells are IFN-?-producing Th1 cells. In certain embodiments, pathogenic Th1 cells are characterized by high expression of IL-23R or are IL-23R+Th1 cells. In certain embodiments, pathogenic Th1 cells express a gene program comprising one or more of IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW.

    [0042] In certain embodiments, pathogenic Th1 cells express a gene program described herein as cluster 2 or LPL-2 (see, Table 3). For example, the top 50 genes differentially expressed for cluster 2 compared to all other Th1 clusters includes Lgals1, Crip1, S100a6, S100a10, Lgals3, S100a4, Itgb1, Emp3, Actg1, Vim, Ifitm1, Rps27, Rps29, Itgb7, Ms4a4b, Junb, Pglyrp1, Lsp1, Cd52, Klrd1, Got1, Odc1, Nkg7, Cd48, Glipr2, Anxa1, Klf2, Pycard, Rps28, AA467197, Ramp3, Rps27rt, Fxyd5, S1pr4, Rgs1, Bin2, Zyx, Anxa2, Tnfrsf4, Ifitm2, Ctla4, Malat1, Crem, Ifitm3, Myl6, Gnal5, Reep5, Rpl12, S1pr1 and Arhgdib (Positive log FC values are associated with genes with higher expression in cluster 2 and negative log FC values are associated with genes with lower expression in cluster 2). As used herein an increase in cluster 2 means an increase in the gene program that includes both upregulated and downregulated genes.

    [0043] In certain embodiments, pathogenic Th1 cells express a gene program described herein as cluster 9 or LPL-9 (see, Table 3). For example, the top 50 genes differentially expressed for cluster 9 compared to all other Th1 clusters includes Vps37b, Ubald2, Junb, H3f3b, Ifngr1, Bhlhe40, AW112010, Cd52, Tnfrsf4, Eif1, Odc1, Btg1, Tmsb4x, Gramd3, Hspa5, Ctla4, Jund, Dusp5, Pnrc1, Ifrd1, Prr7, Nfkbia, Pim1, Tnfaip3, Bcl2a1b, Tgif1, Icos, Orail, Il21r, Crem, Cd160, Cytip, Btg2, Rgs2, Gna13, Ramp3, Gpr132, Rsrp1, Hspa8, Kdm6b, Dnaja1, Tbc1d10c, Traf1, Got1, Serpinb9, Tnfsf8, Arf4, Dgat1, Fos12 and Sub1 (Positive log FC values are associated with genes with higher expression in cluster 9 and negative log FC values are associated with genes with lower expression in cluster 9). As used herein an increase in cluster 9 means an increase in the gene program that includes both upregulated and downregulated genes.

    [0044] In certain embodiments, regulatory Th1 cells express a gene signature or gene program described herein as cluster 7 (see, Table 3). In certain embodiments, regulatory Th1 cells are also referred to as non-pathogenic Th1 cells or Tr1-like cells. For example, the top 50 genes differentially expressed for cluster 7 compared to all other Th1 clusters includes Eomes, Gzmk, Cd27, Furin, Ifitm2, Cxcr6, Cc15, Plac8, Esm1, Gm43291, Sh3bgr13, Tnfsf8, Sh2d1a, Bend4, Rgs16, Tmsb4x, Ly6e, Tmsb10, Rpa2, Ifitm3, Nkg7, Tox, Cd52, Emb, Chchd10, Pim1, Lgals1, Vim, Cldnd1, Rgs10, Actn2, Cxcr5, Lgals3, Capg, Rpl41, AA467197, Tapbpl, Ly6a, Il18r1, Saraf, Asb2, Itgb7, Rasgef1a, Klrg1, Tmem176b, Tnfsf11, Dcp1b, Rps27, Fxyd5 and H2afy (Positive log FC values are associated with genes with higher expression in cluster 7 and negative log FC values are associated with genes with lower expression in cluster 7). As used herein an increase in cluster 7 means an increase in the gene program that includes both upregulated and downregulated genes.

    [0045] As used herein an increase in a cluster means an increase in the gene program that includes both upregulated and downregulated genes (i.e., there is an increase in Th1 cells expressing the program or the expression of genes in a cell is shifted closer to the gene program than in a control or to any other programs). Clusters as described herein can also be described as a metagene. As used herein a metagene refers to a pattern or aggregate of gene expression and not an actual gene. Each metagene may represent a collection or aggregate of genes behaving in a functionally correlated fashion within the genome. The metagene can be increased if the pattern is increased. As used herein the term gene program or program can be used interchangeably with biological program, expression program, transcriptional program, expression profile, signature, gene signature or expression program and may refer to a set of genes that share a role in a biological function (e.g., an activation program, cell differentiation program, proliferation program). Biological programs can include a pattern of gene expression that result in a corresponding physiological event or phenotypic trait (e.g., inflammation). Biological programs can include up to several hundred genes that are expressed in a spatially and temporally controlled fashion. Expression of individual genes can be shared between biological programs. Expression of individual genes can be shared among different single cell types; however, expression of a biological program may be cell type specific or temporally specific (e.g., the biological program is expressed in a cell type at a specific time). Multiple biological programs may include the same gene, reflecting the gene's roles in different processes. Expression of a biological program may be regulated by a master switch, such as a nuclear receptor or transcription factor.

    [0046] As used herein a signature or gene program may encompass any gene or genes, protein or proteins, or epigenetic element(s) whose expression profile or whose occurrence is associated with a specific cell type, subtype, or cell state of a specific cell type or subtype within a population of cells. For ease of discussion, when discussing gene expression, any of gene or genes, protein or proteins, or epigenetic element(s) may be substituted. Levels of expression or activity or prevalence may be compared between different cells in order to characterize or identify for instance signatures specific for cell (sub)populations. Increased or decreased expression or activity or prevalence of signature genes may be compared between different cells in order to characterize or identify for instance specific cell (sub)populations. The detection of a signature in single cells may be used to identify and quantitate for instance specific cell (sub)populations. A signature may include a gene or genes, protein or proteins, or epigenetic element(s) whose expression or occurrence is specific to a cell (sub)population, such that expression or occurrence is exclusive to the cell (sub)population. A gene signature as used herein, may thus refer to any set of up- and down-regulated genes that are representative of a cell type or subtype. A gene signature as used herein, may also refer to any set of up- and down-regulated genes between different cells or cell (sub)populations derived from a gene-expression profile. For example, a gene signature may comprise a list of genes differentially expressed in a distinction of interest.

    [0047] The signature as defined herein (being it a gene signature, protein signature or other genetic or epigenetic signature) can be used to indicate the presence of a cell type, a subtype of the cell type, the state of the microenvironment of a population of cells, a particular cell type population or subpopulation, and/or the overall status of the entire cell (sub)population. Furthermore, the signature may be indicative of cells within a population of cells in vivo. The signature may also be used to suggest for instance particular therapies, or to follow up treatment, or to suggest ways to modulate immune systems. The presence of subtypes or cell states may be determined by subtype specific or cell state specific signatures. The presence of these specific cell (sub)types or cell states may be determined by applying the signature genes to bulk sequencing data in a sample. Not being bound by a theory the signatures of the present invention may be microenvironment specific, such as their expression in a particular spatio-temporal context. Not being bound by a theory, signatures as discussed herein are specific to a particular pathological context. Not being bound by a theory, a combination of cell subtypes having a particular signature may indicate an outcome. Not being bound by a theory, the signatures can be used to deconvolute the network of cells present in a particular pathological condition. Not being bound by a theory the presence of specific cells and cell subtypes are indicative of a particular response to treatment, such as including increased or decreased susceptibility to treatment. The signature may indicate the presence of one particular cell type. In one embodiment, the novel signatures are used to detect multiple cell states or hierarchies that occur in subpopulations of immune cells that are linked to particular pathological condition (e.g., inflammation), or linked to a particular outcome or progression of the disease (e.g., autoimmunity), or linked to a particular response to treatment of the disease.

    [0048] The signature according to certain embodiments of the present invention may comprise or consist of one or more genes, proteins and/or epigenetic elements, such as for instance 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of two or more genes, proteins and/or epigenetic elements, such as for instance 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of three or more genes, proteins and/or epigenetic elements, such as for instance 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of four or more genes, proteins and/or epigenetic elements, such as for instance 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of five or more genes, proteins and/or epigenetic elements, such as for instance 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of six or more genes, proteins and/or epigenetic elements, such as for instance 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of seven or more genes, proteins and/or epigenetic elements, such as for instance 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of eight or more genes, proteins and/or epigenetic elements, such as for instance 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of nine or more genes, proteins and/or epigenetic elements, such as for instance 9, 10 or more. In certain embodiments, the signature may comprise or consist of ten or more genes, proteins and/or epigenetic elements, such as for instance 10, 11, 12, 13, 14, 15, or more. It is to be understood that a signature according to the invention may for instance also include genes or proteins as well as epigenetic elements combined.

    [0049] It is to be understood that differentially expressed genes/proteins include genes/proteins which are up- or down-regulated as well as genes/proteins which are turned on or off. When referring to up-or down-regulation, in certain embodiments, such up- or down-regulation is preferably at least two-fold, such as two-fold, three-fold, four-fold, five-fold, or more, such as for instance at least ten-fold, at least 20-fold, at least 30-fold, at least 40-fold, at least 50-fold, or more. Alternatively, or in addition, differential expression may be determined based on common statistical tests, as is known in the art.

    [0050] As discussed herein, differentially expressed genes/proteins, or differential epigenetic elements may be differentially expressed on a single cell level, or may be differentially expressed on a cell population level. Preferably, the differentially expressed genes/proteins or epigenetic elements as discussed herein, such as constituting the gene signatures as discussed herein, when as to the cell population level, refer to genes that are differentially expressed in all or substantially all cells of the population (such as at least 80%, preferably at least 90%, such as at least 95% of the individual cells). This allows one to define a particular subpopulation of tumor cells. As referred to herein, a subpopulation of cells preferably refers to a particular subset of cells of a particular cell type which can be distinguished or are uniquely identifiable and set apart from other cells of this cell type. The cell subpopulation may be phenotypically characterized, and is preferably characterized by the signature as discussed herein. A cell (sub)population as referred to herein may constitute of a (sub)population of cells of a particular cell type characterized by a specific cell state.

    [0051] When referring to induction, or alternatively suppression of a particular signature, preferable is meant induction or alternatively suppression (or upregulation or downregulation) of at least one gene/protein and/or epigenetic element of the signature, such as for instance at least two, at least three, at least four, at least five, at least six, or all genes/proteins and/or epigenetic elements of the signature.

    [0052] As used herein, all gene name symbols refer to the gene as commonly known in the art. The examples described herein that refer to the mouse gene names are to be understood to also encompasses human genes, as well as genes in any other organism (e.g., homologous, orthologous genes). Mouse gene symbols are generally italicized, with only the first letter in upper-case (e.g., 1123). Mouse protein symbols are generally not italicized, and all letters are in upper-case (e.g., IL-23). As used herein mouse gene symbols may be shown with only the first letter in upper-case and not italicized (e.g., 11123). Any reference to the gene symbol is a reference made to the entire gene or variants of the gene. Any reference to the gene symbol is also a reference made to the gene product (e.g., protein). The term, homolog, may apply to the relationship between genes separated by the event of speciation (e.g., ortholog). Orthologs are genes in different species that evolved from a common ancestral gene by speciation. Normally, orthologs retain the same function in the course of evolution. Gene symbols may be those referred to by the HUGO Gene Nomenclature Committee (HGNC) or National Center for Biotechnology Information (NCBI). The signature as described herein may encompass any of the genes described herein.

    Functional T Cell Immune States

    [0053] The present invention relates to immune cell balance and function, in particular Th1 cell pathogenicity or non-pathogenicty. In general, aberrant immune balance can lead to autoimmunity when the immune response is too strong and cancer when the immune response is suppressed. An immune response can include the interaction of several immune cell types and different immune responses can be mediated by specific immune cells. In certain embodiments, T cells can affect the overall immune state, such as other immune cells in proximity.

    [0054] The term immune cell as used throughout this specification generally encompasses any cell derived from a hematopoietic stem cell that plays a role in the immune response. The term is intended to encompass immune cells both of the innate or adaptive immune system. The immune cell as referred to herein may be a leukocyte, at any stage of differentiation (e.g., a stem cell, a progenitor cell, a mature cell) or any activation stage. Immune cells include lymphocytes (such as natural killer cells, T-cells (including, e.g., thymocytes, Th or Tc; Th1, Th2, Th17, Th??, CD4+, CD8+, effector Th, memory Th, regulatory Th, CD4+/CD8+ thymocytes, CD4?/CD8? thymocytes, ?? T cells, etc.) or B-cells (including, e.g., pro-B cells, early pro-B cells, late pro-B cells, pre-B cells, large pre-B cells, small pre-B cells, immature or mature B-cells, producing antibodies of any isotype, T1 B-cells, T2, B-cells, na?ve B-cells, GC B-cells, plasmablasts, memory B-cells, plasma cells, follicular B-cells, marginal zone B-cells, B-1 cells, B-2 cells, regulatory B cells, etc.), such as for instance, monocytes (including, e.g., classical, non-classical, or intermediate monocytes), (segmented or banded) neutrophils, eosinophils, basophils, mast cells, histiocytes, microglia, including various subtypes, maturation, differentiation, or activation stages, such as for instance hematopoietic stem cells, myeloid progenitors, lymphoid progenitors, myeloblasts, promyelocytes, myelocytes, metamyelocytes, monoblasts, promonocytes, lymphoblasts, prolymphocytes, small lymphocytes, macrophages (including, e.g., Kupffer cells, stellate macrophages, M1 or M2 macrophages), (myeloid or lymphoid) dendritic cells (including, e.g., Langerhans cells, conventional or myeloid dendritic cells, plasmacytoid dendritic cells, mDC-1, mDC-2, Mo-DC, HP-DC, veiled cells), granulocytes, polymorphonuclear cells, antigen-presenting cells (APC), etc.

    [0055] As used throughout this specification, immune response refers to a response by a cell of the immune system, such as a B cell, T cell (CD4+ or CD8+), regulatory T cell, antigen-presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil, to a stimulus. In some embodiments, the response is specific for a particular antigen (an antigen-specific response), and refers to a response by a CD4 T cell, CD8 T cell, or B cell via their antigen-specific receptor. In some embodiments, an immune response is a T cell response, such as a CD4+ response or a CD8+ response. Such responses by these cells can include, for example, cytotoxicity, proliferation, cytokine or chemokine production, trafficking, or phagocytosis, and can be dependent on the nature of the immune cell undergoing the response.

    [0056] T cell response refers more specifically to an immune response in which T cells directly or indirectly mediate or otherwise contribute to an immune response in a subject. T cell-mediated response may be associated with cell mediated effects, cytokine mediated effects, and even effects associated with B cells if the B cells are stimulated, for example, by cytokines secreted by T cells. By means of an example but without limitation, effector functions of NMC class I restricted Cytotoxic T lymphocytes (CTLs), may include cytokine and/or cytolytic capabilities, such as lysis of target cells presenting an antigen peptide recognized by the T cell receptor (naturally-occurring TCR or genetically engineered TCR, e.g., chimeric antigen receptor, CAR), secretion of cytokines, preferably IFN gamma, TNF alpha and/or or more immunostimulatory cytokines, such as IL-2, and/or antigen peptide-induced secretion of cytotoxic effector molecules, such as granzymes, perforins or granulysin. By means of example but without limitation, for NMC class II restricted T helper (Th) cells, effector functions may be antigen peptide-induced secretion of cytokines, preferably, IFN gamma, TNF alpha, IL-4, IL5, IL-10, and/or IL-2. By means of example but without limitation, for T regulatory (Treg) cells, effector functions may be antigen peptide-induced secretion of cytokines, preferably, IL-10, IL-35, and/or TGF-beta. B cell response refers more specifically to an immune response in which B cells directly or indirectly mediate or otherwise contribute to an immune response in a subject. Effector functions of B cells may include in particular production and secretion of antigen-specific antibodies by B cells (e.g., polyclonal B cell response to a plurality of the epitopes of an antigen (antigen-specific antibody response)), antigen presentation, and/or cytokine secretion.

    [0057] During persistent immune activation, such as during uncontrolled tumor growth or chronic infections, subpopulations of immune cells, particularly of CD8+ or CD4+ T cells, become compromised to different extents with respect to their cytokine and/or cytolytic capabilities. Such immune cells, particularly CD8+ or CD4+ T cells, are commonly referred to as dysfunctional or as functionally exhausted or exhausted. As used herein, the term dysfunctional or functional exhaustion refer to a state of a cell where the cell does not perform its usual function or activity in response to normal input signals, and includes refractivity of immune cells to stimulation, such as stimulation via an activating receptor or a cytokine. Such a function or activity includes, but is not limited to, proliferation (e.g., in response to a cytokine, such as IFN-gamma) or cell division, entrance into the cell cycle, cytokine production, cytotoxicity, migration and trafficking, phagocytotic activity, or any combination thereof. Normal input signals can include, but are not limited to, stimulation via a receptor (e.g., T cell receptor, B cell receptor, co-stimulatory receptor). Unresponsive immune cells can have a reduction of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or even 100% in cytotoxic activity, cytokine production, proliferation, trafficking, phagocytotic activity, or any combination thereof, relative to a corresponding control immune cell of the same type. In some particular embodiments of the aspects described herein, a cell that is dysfunctional is a CD8+ T cell that expresses the CD8+ cell surface marker. Such CD8+ cells normally proliferate and produce cell killing enzymes, e.g., they can release the cytotoxins perforin, granzymes, and granulysin. However, exhausted/dysfunctional T cells do not respond adequately to TCR stimulation, and display poor effector function, sustained expression of inhibitory receptors and a transcriptional state distinct from that of functional effector or memory T cells. Dysfunction/exhaustion of T cells thus prevents optimal control of infection and tumors. Exhausted/dysfunctional immune cells, such as T cells, such as CD8+ T cells, may produce reduced amounts of IFN-gamma, TNF-alpha and/or one or more immunostimulatory cytokines, such as IL-2, compared to functional immune cells. Exhausted/dysfunctional immune cells, such as T cells, such as CD8+ T cells, may further produce (increased amounts of) one or more immunosuppressive transcription factors or cytokines, such as IL-10 and/or Foxp3, compared to functional immune cells, thereby contributing to local immunosuppression. Dysfunctional CD8+ T cells can be both protective and detrimental against disease control. As used herein, a dysfunctional immune state refers to an overall suppressive immune state in a subject or microenvironment of the subject (e.g., tumor microenvironment). For example, increased IL-10 production leads to suppression of other immune cells in a population of immune cells.

    [0058] CD8+ T cell function is associated with their cytokine profiles. It has been reported that effector CD8+ T cells with the ability to simultaneously produce multiple cytokines (polyfunctional CD8+ T cells) are associated with protective immunity in patients with controlled chronic viral infections as well as cancer patients responsive to immune therapy (Spranger et al., 2014, J. Immunother. Cancer, vol. 2, 3). In the presence of persistent antigen CD8+ T cells were found to have lost cytolytic activity completely over time (Moskophidis et al., 1993, Nature, vol. 362, 758-761). It was subsequently found that dysfunctional T cells can differentially produce IL-2, TNFa and IFNg in a hierarchical order (Wherry et al., 2003, J. Virol., vol. 77, 4911-4927). Decoupled dysfunctional and activated CD8+ cell states have also been described (see, e.g., Singer, et al. (2016). A Distinct Gene Module for Dysfunction Uncoupled from Activation in Tumor-Infiltrating T Cells. Cell 166, 1500-1511 e1509; WO/2017/075478; and WO/2018/049025).

    [0059] The invention provides compositions and methods for modulating T cell balance, in particular Th1 cell pathogenicity (i.e., balance between pathogenic and non-pathogenic Th1 cells). The invention provides T cell modulating agents that modulate T cell balance. For example, in some embodiments, the invention provides T cell modulating agents and methods of using these T cell modulating agents to regulate, influence or otherwise impact the level of and/or balance of Th1 cells. For example, in some embodiments, the invention provides T cell modulating agents and methods of using these T cell modulating agents to regulate, influence or otherwise impact the level of and/or balance between Th1 activity and inflammatory potential. As used herein, terms such as Th1 cell and/or Th1 phenotype and all grammatical variations thereof refer to a differentiated T helper cell that expresses interferon gamma (IFN?). Further, Th1 cells are characterized as expressing IFN-?, IL-2, lymphotoxin (LT) and the master transcription factor T-bet but do not produce IL-17A, the signature cytokine of Th17 cells.

    [0060] In certain embodiments, Th17 balance is modified in combination with Th1 cells. As used herein, terms such as Th17 cell and/or Th17 phenotype and all grammatical variations thereof refer to a differentiated T helper cell that expresses one or more cytokines selected from the group the consisting of interleukin 17A (IL-17A), interleukin 17F (IL-17F), and interleukin 17A/F heterodimer (IL17-AF). As used herein, terms such as Th2 cell and/or Th2 phenotype and all grammatical variations thereof refer to a differentiated T helper cell that expresses one or more cytokines selected from the group the consisting of interleukin 4 (IL-4), interleukin 5 (IL-5) and interleukin 13 (IL-13). As used herein, terms such as Treg cell and/or Treg phenotype and all grammatical variations thereof refer to a differentiated T cell that expresses Foxp3.

    [0061] Depending on the cytokines used for differentiation, in vitro polarized Th17 cells can either cause severe autoimmune responses upon adoptive transfer (pathogenic Th17 cells) or have little or no effect in inducing autoimmune disease (non-pathogenic cells) (Ghoreschi et al., 2010; and Lee et al., 2012 Induction and molecular signature of pathogenic Th17 cells, Nature Immunology, vol. 13(10): 991-999). In vitro differentiation of na?ve CD4 T cells in the presence of TGF-?1+IL-6 induces an IL-17A and IL-10 producing population of Th17 cells, that are generally nonpathogenic, whereas activation of na?ve T cells in the presence of IL-1?+IL-6+IL-23 or TGF-?3+IL-6 induces a T cell population that produces IL-17A and IFN-?, and are potent inducers of autoimmune disease induction (Ghoreschi et al., 2010, Lee et al., 2012).

    [0062] As used herein, terms such as pathogenic Th17 cell and/or pathogenic Th17 phenotype and all grammatical variations thereof refer to Th17 cells that, exhibit a distinct pathogenic signature where one or more of the following genes or products of these genes is upregulated in Th17 cells: Cxcl3, Il22, Il3, Ccl4, Gzmb, Lrmp, Cc15, Casp1, Csf2, Ccl3, Tbx21, Icos, Il7r, Stat4, Lgals3 or Lag3. In certain embodiments, the pathogenic signature is elevated in TGF-?3-induced Th17 cells as compared to TGF-?1-induced Th17 cells. As used herein, terms such as non-pathogenic Th17 cell and/or non-pathogenic Th17 phenotype and all grammatical variations thereof refer to Th17 cells that exhibit a distinct non-pathogenic signature where one or more of the following genes or products of these genes is up-regulated in Th17 cells: Il6st, Il1rn, lkzf3, Maf, Ahr, Il9 or Il10. In certain embodiments, the non-pathogenic signature is elevated in TGF-?1-induced Th17 cells as compared to TGF-?3-induced Th17 cells. In certain embodiments, when induced in the presence of TGF-?3, Th17 cells express a decreased level of one or more genes selected from IL6st, IL1rn, Ikzf3, Maf, Ahr, IL9 and IL10, as compared to the level of expression in TGF-?3-induced Th17 cells.

    [0063] A dynamic regulatory network controls Th17 differentiation (See e.g., Yosef et al., Dynamic regulatory network controlling Th17 cell differentiation, Nature, vol. 496: 461-468 (2013); Wang et al., CD5L/AIM Regulates Lipid Biosynthesis and Restrains Th17 Cell Pathogenicity, Cell Volume 163, Issue 6, p 1413-1427, 3 Dec. 2015; Gaublomme et al., Single-Cell Genomics Unveils Critical Regulators of Th17 Cell Pathogenicity, Cell Volume 163, Issue 6, p 1400-1412, 3 Dec. 2015; and International publication numbers WO2016138488A2, WO2015130968, WO/2012/048265, WO/2014/145631 and WO/2014/134351, the contents of which are hereby incorporated by reference in their entirety).

    Diseases

    [0064] In certain embodiments, diseases or conditions are treated, monitored or detected. In certain embodiments, diseases relevant to the present invention are caused by pathogenic Th1 cells or are capable of being controlled by pathogenic Th1 cells. In certain embodiments, the diseases are associated with IL-23 or IL-23R.

    [0065] In certain embodiments, the diseases are associated with IL-23R by genome wide association studies (GWAS) (e.g., Duerr R H, Taylor K D, Brant S R, et al. A genome-wide association study identifies TL23R as an inflammatory bowel disease gene. Science. 2006; 314(5804):1461-1463; Zhu W, Deng Y, Zhou X. Multiple Membrane Transporters and Some Immune Regulatory Genes are Major Genetic Factors to Gout. Open Rheumatol J. 2018; 12:94-113; Peng L L, Wang Y, Zhu F L, Xu W D, Ji X L, Ni J. IL-23R mutation is associated with ulcerative colitis: A systemic review and meta-analysis. Oncotarget. 2017; 8(3):4849-4863; Zhang F, Liu H, Chen S, et al. Identification of two new loci at IL23R and RAB32 that influence susceptibility to leprosy. Nat Genet. 2011; 43(12):1247-1251; Mizuki N, Meguro A, Ota M, et al. Genome-wide association studies identify IL23R-IL12RB2 and IL10 as Beh?et's disease susceptibility loci. Nat Genet. 2010; 42(8):703-706; and Remmers E F, Cosan F, Kirino Y, et al. Genome-wide association study identifies variants in the MHC class I, IL10, and IL23R-IL12RB2 regions associated with Beh?et's disease. Nat Genet. 2010; 42(8):698-702). For example, shifting Th1 cell pathogenicity may be used to treat ankylosing spondylitis, psoriasis, ulcerative colitis, Crohn's disease, sclerosing cholangitis, inflammatory bowel disease (IBD), adolescent idiopathic scoliosis, autoimmune thyroid disease, type I diabetes mellitus, Common variable immunodeficiency, celiac disease, juvenile idiopathic arthritis, systemic lupus erythematosus, malaria, psoriatic arthritis, anterior uveitis, type II diabetes mellitus, psoriasis vulgaris or tuberculosis (see, e.g., Buniello, et al. The NHGRI-EBI GWAS Catalog of published genome-wide association studies, targeted arrays and summary statistics 2019. Nucleic Acids Research, 2019, Vol. 47 (Database issue): D1005-D1012).

    [0066] In certain embodiments, autoimmune or inflammatory diseases are treated, monitored or detected. As used throughout the present specification, the terms autoimmune disease or autoimmune disorder used interchangeably refer to a diseases or disorders caused by an immune response against a self-tissue or tissue component (self-antigen) and include a self-antibody response and/or cell-mediated response. The terms encompass organ-specific autoimmune diseases, in which an autoimmune response is directed against a single tissue, as well as non-organ specific autoimmune diseases, in which an autoimmune response is directed against a component present in two or more, several or many organs throughout the body. Examples of autoimmune diseases include but are not limited to acute disseminated encephalomyelitis (ADEM); Addison's disease; ankylosing spondylitis; antiphospholipid antibody syndrome (APS); aplastic anemia; autoimmune gastritis; autoimmune hepatitis; autoimmune thrombocytopenia; Beh?et's disease; coeliac disease; dermatomyositis; diabetes mellitus type I; Goodpasture's syndrome; Graves' disease; Guillain-Barre syndrome (GBS); Hashimoto's disease; idiopathic thrombocytopenic purpura; inflammatory bowel disease (IBD) including Crohn's disease and ulcerative colitis; mixed connective tissue disease; multiple sclerosis (MS); myasthenia gravis; opsoclonus myoclonus syndrome (OMS); optic neuritis; Ord's thyroiditis; pemphigus; pernicious anaemia; polyarteritis nodosa; polymyositis; primary biliary cirrhosis; primary myoxedema; psoriasis; rheumatic fever; rheumatoid arthritis; Reiter's syndrome; scleroderma; Sj?gren's syndrome; systemic lupus erythematosus; Takayasu's arteritis; temporal arteritis; vitiligo; warm autoimmune hemolytic anemia; or Wegener's granulomatosis.

    [0067] Examples of inflammatory diseases or disorders include, but are not limited to, asthma, allergy, allergic rhinitis, allergic airway inflammation, atopic dermatitis (AD), chronic obstructive pulmonary disease (COPD), inflammatory bowel disease (IBD), Irritable bowel syndrome (IBS), multiple sclerosis, arthritis, psoriasis, eosinophilic esophagitis, eosinophilic pneumonia, eosinophilic psoriasis, hypereosinophilic syndrome, graft-versus-host disease, uveitis, cardiovascular disease, pain, multiple sclerosis, lupus, vasculitis, chronic idiopathic urticaria and Eosinophilic Granulomatosis with Polyangiitis (Churg-Strauss Syndrome).

    [0068] In certain embodiments, cancer is treated by increasing Th1 pathogenicity or a cancer treatment is monitored by detecting Th1 pathogenicity. The cancer may include, without limitation, liquid tumors such as leukemia (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (e.g., Hodgkin's disease, non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy chain disease, or multiple myeloma.

    [0069] The cancer may include, without limitation, solid tumors such as sarcomas and carcinomas. Examples of solid tumors include, but are not limited to fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, epithelial carcinoma, bronchogenic carcinoma, hepatoma, colorectal cancer (e.g., colon cancer, rectal cancer), anal cancer, pancreatic cancer (e.g., pancreatic adenocarcinoma, islet cell carcinoma, neuroendocrine tumors), breast cancer (e.g., ductal carcinoma, lobular carcinoma, inflammatory breast cancer, clear cell carcinoma, mucinous carcinoma), ovarian carcinoma (e.g., ovarian epithelial carcinoma or surface epithelial-stromal tumour including serous tumour, endometrioid tumor and mucinous cystadenocarcinoma, sex-cord-stromal tumor), prostate cancer, liver and bile duct carcinoma (e.g., hepatocelluar carcinoma, cholangiocarcinoma, hemangioma), choriocarcinoma, seminoma, embryonal carcinoma, kidney cancer (e.g., renal cell carcinoma, clear cell carcinoma, Wilm's tumor, nephroblastoma), cervical cancer, uterine cancer (e.g., endometrial adenocarcinoma, uterine papillary serous carcinoma, uterine clear-cell carcinoma, uterine sarcomas and leiomyosarcomas, mixed mullerian tumors), testicular cancer, germ cell tumor, lung cancer (e.g., lung adenocarcinoma, squamous cell carcinoma, large cell carcinoma, bronchioloalveolar carcinoma, non-small-cell carcinoma, small cell carcinoma, mesothelioma), bladder carcinoma, signet ring cell carcinoma, cancer of the head and neck (e.g., squamous cell carcinomas), esophageal carcinoma (e.g., esophageal adenocarcinoma), tumors of the brain (e.g., glioma, glioblastoma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodenroglioma, schwannoma, meningioma), neuroblastoma, retinoblastoma, neuroendocrine tumor, melanoma, cancer of the stomach (e.g., stomach adenocarcinoma, gastrointestinal stromal tumor), or carcinoids. Lymphoproliferative disorders are also considered to be proliferative diseases.

    In Vitro Differentiated Pathogenic Th1 Cells

    [0070] In certain embodiments, pathogenic Th1 cells can be obtained by differentiating na?ve CD4+ T cells in vitro. The na?ve T cells may be obtained from a healthy donor subject. The na?ve T cells may be obtained from a subject suffering from an aberrant immune response. The na?ve T cells may be obtained from a subject suffering from cancer. The na?ve T cells may be obtained from an animal model, such as a mouse model. In certain embodiments, the mouse model is a model of any disease described herein. T cells may be obtained from the spleen or lymph nodes. The T cells may be obtained from a blood sample. CD4.sup.+ T cells can be enriched using any method commonly used in the art, such as microbeads. Na?ve CD4.sup.+ T cells can be isolated using any method known in the art, such as cell sorting. In certain embodiments, na?ve CD4+ T cells (CD4.sup.+CD44.sup.lowCD62L.sup.highCD25.sup.?) can be isolated by fluorescence-activated cell sorting (FACS). In certain embodiments, na?ve CD4+ T cells are activated (e.g., with anti-CD3 and anti-CD28 antibodies). In certain embodiments, na?ve CD4+ T cells are differentiated with cytokines. In certain embodiments, pathogenic Th1 cells are obtained by differentiating with IL-12 and IL-21. In certain embodiments, pathogenic Th1 cells are obtained by differentiating with IL-12, IL-21 and IL-23. Recombinant cytokines are commercially available.

    [0071] The differentiated pathogenic Th1 cells may be used for various applications described further herein. For example, in methods of screening for agents capable of shifting Th1 pathogenicity or for adoptive transfer. In certain embodiments, adoptively transferred pathogenic Th1 cells can be used to enhance anti-tumor immunity. In certain embodiments, the Th1 cells are specific for a tumor antigen as described herein.

    Therapeutic Methods

    [0072] In certain embodiments, shifting Th1 pathogenicity can be used in a therapeutic method (i.e., treatment) to decrease or increase an immune response. In certain embodiments, autoimmune diseases are treated by specifically targeting pathogenic Th1 cells or decreasing pathogenic Th1 cells. In certain embodiments, cancer is treated by specifically targeting Th1 cells or increasing pathogenic Th1 cells. Targeting Th1 cells can be performed by targeting specific pathogenic Th1 cell programs or markers, as described herein. In certain embodiments, surface markers are targeted. In certain embodiments, CD160 expression or activity is inhibited to decrease Th1 pathogenicity. In certain embodiments, CD160 expression or activity is enhanced or activated to increase Th1 pathogenicity. In certain embodiments, one or markers selected from CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW is targeted by one or more therapeutic agents. In certain embodiments, Th1 cells are targeted with one or more therapeutic agents. In certain embodiments, small molecules may be used to inhibit a target that has enzymatic activity. In certain embodiments, binding molecules, such as antibodies, are used to target surface proteins.

    [0073] As used herein, treatment or treating, or palliating or ameliorating are used interchangeably. These terms refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment. For prophylactic benefit, the compositions may be administered to a subject at risk of developing a particular disease, condition, or symptom, or to a subject reporting one or more of the physiological symptoms of a disease, even though the disease, condition, or symptom may not have yet been manifested. As used herein treating includes ameliorating, curing, preventing it from becoming worse, slowing the rate of progression, or preventing the disorder from re-occurring (i.e., to prevent a relapse).

    [0074] In certain embodiments, diabetes is treated. Type 1 diabetes is an autoimmune disease where the insulin-producing beta cells in the pancreas are wrongly detected as foreign and destroyed by the immune system (e.g., pathogenic Th1 cells). In certain embodiments, Type I diabetes can be treated at two main stages of the disease processprior to clinical onset but after the appearance of islet autoantibodies (secondary prevention) and immediately after diagnosis (intervention) (see, e.g., Staeva-Vieira T, Peakman M, von Herrath M. Translational mini-review series on type 1 diabetes: Immune-based therapeutic approaches for type 1 diabetes [published correction appears in Clin Exp Immunol. 2007 July; 149(1):203]. Clin Exp Immunol. 2007; 148(1):17-31). At the intervention stage there is still residual beta cell mass (about 15-20%). Id.

    [0075] In certain embodiments, IBD is treated by targeting pathogenic Th1 cells. Inflammatory bowel disease (IBD) is a chronic disabling inflammatory process that affects mainly the gastrointestinal tract and may present associated extraintestinal manifestations (see, e.g., Catalan-Serra I, Brenna ?. Immunotherapy in inflammatory bowel disease: Novel and emerging treatments. Hum Vaccin Immunother. 2018; 14(11):2597-2611). IBD includes both ulcerative colitis (UC) and Crohn's disease (CD). Id. The IL-23 pathway is altered in both conditions. Id Current pharmacological treatments used in clinical practice like thiopurines or anti-TNF are effective but can produce significant side effects and their efficacy may diminish over time. Id. The current treatment of IBD includes mesalazine (oral and rectal formulations), glucocorticoids (conventional and other forms like budesonide or beclomethasone), antibiotics (typically ciprofloxacine and metronidazole), immunosuppressants (mostly azathioprine/6-mercaptopurine or methotrexate) and anti-TNF agents (infliximab, adalimumab, certolizumab pegol and golimumab). Recently, the anti-integrin antibody vedolizumab and the antibody against IL-12/23 ustekinumab have been approved for IBD. Id. In certain embodiments, targeting pathogenic Th1 cells can be used to control inflammation in IBD without producing significant side effects. In certain embodiments, the treatment as described herein is administered in combination with the current treatments, such that side effects are diminished. In certain embodiments, the standard doses can be decreased in such combination treatments.

    [0076] In certain embodiments, the present invention provides for one or more therapeutic agents against one or more of the targets identified. In certain embodiments, the one or more agents comprises a small molecule inhibitor, small molecule degrader (e.g., ATTEC, AUTAC, LYTAC, or PROTAC), genetic modifying agent, antibody, antibody fragment, antibody-like protein scaffold, aptamer, protein, or any combination thereof.

    [0077] The terms therapeutic agent, therapeutic capable agent or treatment agent are used interchangeably and refer to a molecule or compound that confers some beneficial effect upon administration to a subject. The beneficial effect includes enablement of diagnostic determinations; amelioration of a disease, symptom, disorder, or pathological condition; reducing or preventing the onset of a disease, symptom, disorder or condition; and generally counteracting a disease, symptom, disorder or pathological condition.

    [0078] In certain embodiments, the therapeutic agents are administered in an effective amount or therapeutically effective amount. The term effective amount or therapeutically effective amount refers to the amount of an agent that is sufficient to effect beneficial or desired results. The therapeutically effective amount may vary depending upon one or more of: the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art. The term also applies to a dose that will provide an image for detection by any one of the imaging methods described herein. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.

    [0079] In certain embodiments, an agent against one of the targets is used in combination with a treatment already be known or used clinically. In certain embodiments, targeting the combination may require less of the agent as compared to the current standard of care and provide for less toxicity and improved treatment. The term standard of care as used herein refers to the current treatment that is accepted by medical experts as a proper treatment for a certain type of disease and that is widely used by healthcare professionals. Standard of care is also called best practice, standard medical care, and standard therapy.

    [0080] In certain embodiments, the agents are used to modulate cell types in vivo. In certain embodiments, the agents are used to modulate cell types in vitro. For example, the agents may be used to modulate cells for adoptive cell transfer.

    CD160

    [0081] In certain embodiments, CD160 is targeted for shifting Th1 cell pathogenicity. In certain embodiments, inhibiting CD160 reduces Th1 pathogenicity and enhancing CD160 increases Th1 pathogenicity. As used herein CD160 (also known as, BY55, NK1, NK28) refers to the CD160 molecule. Exemplary sequences include NCBI accession numbers NM_007053.4 and NP_008984.1. CD160 is a glycoprotein and ligand for Herpesvirus entry mediator (HVEM), also known as tumor necrosis factor receptor superfamily member 14 (TNFRSF14), and considered a proposed immune checkpoint inhibitor with anti-cancer activity along with anti-PD-1 antibodies (Stecher C, Battin C, Leitner J, et al. PD-1 Blockade Promotes Emerging Checkpoint Inhibitors in Enhancing T Cell Responses to Allogeneic Dendritic Cells. Front Immunol. 2017; 8:572). Blocking checkpoint inhibitors enhances an immune response. The present invention shows for the first time that CD160 is necessary for Th1 cell pathogenicity and inhibiting CD160 decreases an immune response. Stecher et al. discloses monoclonal-blocking antibodies for CD160 that can be used as a therapeutic to decrease inflammation or autoimmunity caused by pathogenic Th1 cells. Other non-limiting CD160 antibodies applicable to the present invention have been described (Menguy T, Briaux A, Jeunesse E, et al. Anti-CD160, Alone or in Combination With Bevacizumab, Is a Potent Inhibitor of Ocular Neovascularization in Rabbit and Monkey Models. Invest Ophthalmol Vis Sci. 2018; 59(7):2687-2698; El-Far M, Pellerin C, Pilote L, et al. CD160 isoforms and regulation of CD4 and CD8 T-cell responses. J Transl Med. 2014; 12:217; U.S. Ser. No. 10/208,124B2; US20200109211A1; US20190256595A1; WO2010084158A1; and US20150004170A1).

    GPR18

    [0082] In certain embodiments, GPR18 is targeted for shifting Th1 cell pathogenicity. In certain embodiments, inhibiting GPR18 reduces Th1 pathogenicity and enhancing GPR18 increases Th1 pathogenicity. As used herein GPR18 refers to the G protein-coupled receptor 18 (also known as, N-Arachidonyl glycine receptor, NAGly receptor). Exemplary sequences include NCBI accession numbers NM_001098200.2, NM_005292.4, NP 001091670.1 and NP_005283.1. Non-limiting GPR18 agonists include PSB-KK-1415, PSB-KD107, PSB-KD477, N-Arachidonoylglycine (NAGly), Abnormal cannabidiol (Abn-CBD), AM-251, Cannabidiol, O-1602, ?.sup.9-Tetrahydrocannabinol (?.sup.9-THC), Anandamide (N-arachidonoyl ethanolamine, AEA), Arachidonylcyclopropylamide (ACPA), and Resolvin D2 (RvD2). Non-limiting GPR18 antagonists include PSB-CB5, Amauromine, O-1918, and CID-85469571. See, also, Fabisiak A, Fabisiak N, Mokrowiecka A, et al. Novel selective agonist of GPR18, PSB-KK-1415 exerts potent anti-inflammatory and anti-nociceptive activities in animal models of intestinal inflammation and inflammatory pain [published online ahead of print, 2020 Oct. 14]. Neurogastroenterol Motil. 2020; e14003; and Schoeder C T, Mahardhika A B, Drabczynska A, Kied-Kononowicz K, M?ller CE. Discovery of Tricyclic Xanthines as Agonists of the Cannabinoid-Activated Orphan G-Protein-Coupled Receptor GPR18. ACS Med Chem Lett. 2020; 11(10):2024-2031.

    Antibodies

    [0083] In certain embodiments, the one or more agent is an antibody. In certain embodiments, an antibody targets one or more surface genes or polypeptides. The term antibody is used interchangeably with the term immunoglobulin herein, and includes intact antibodies, fragments of antibodies, e.g., Fab, F(ab)2 fragments, and intact antibodies and fragments that have been mutated either in their constant and/or variable region (e.g., mutations to produce chimeric, partially humanized, or fully humanized antibodies, as well as to produce antibodies with a desired trait, e.g., enhanced binding and/or reduced FcR binding). The term fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain. Fragments can be obtained via chemical or enzymatic treatment of an intact or complete antibody or antibody chain. Fragments can also be obtained by recombinant means. Exemplary fragments include Fab, Fab, F(ab)2, Fabc, Fd, dAb, V.sub.HH and scFv and/or Fv fragments.

    [0084] As used herein, a preparation of antibody protein having less than about 50% of non-antibody protein (also referred to herein as a contaminating protein), or of chemical precursors, is considered to be substantially free. 40%, 30%, 20%, 10% and more preferably 5% (by dry weight), of non-antibody protein, or of chemical precursors is considered to be substantially free. When the antibody protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 30%, preferably less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume or mass of the protein preparation.

    [0085] The term antigen-binding fragment refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding). As such these antibodies or fragments thereof are included in the scope of the invention, provided that the antibody or fragment binds specifically to a target molecule.

    [0086] It is intended that the term antibody encompass any Ig class or any Ig subclass (e.g., the IgG1, IgG2, IgG3, and IgG4 subclassess of IgG) obtained from any source (e.g., humans and non-human primates, and in rodents, lagomorphs, caprines, bovines, equines, ovines, etc.).

    [0087] The term Ig class or immunoglobulin class, as used herein, refers to the five classes of immunoglobulin that have been identified in humans and higher mammals, IgG, IgM, IgA, IgD, and IgE. The term Ig subclass refers to the two subclasses of IgM (H and L), three subclasses of IgA (IgA1, IgA2, and secretory IgA), and four subclasses of IgG (IgG1, IgG2, IgG3, and IgG4) that have been identified in humans and higher mammals. The antibodies can exist in monomeric or polymeric form; for example, lgM antibodies exist in pentameric form, and IgA antibodies exist in monomeric, dimeric or multimeric form.

    [0088] The term IgG subclass refers to the four subclasses of immunoglobulin class IgG-IgG1, IgG2, IgG3, and IgG4 that have been identified in humans and higher mammals by the heavy chains of the immunoglobulins, VI7.sup.4, respectively. The term single-chain immunoglobulin or single-chain antibody (used interchangeably herein) refers to a protein having a two-polypeptide chain structure consisting of a heavy and a light chain, said chains being stabilized, for example, by interchain peptide linkers, which has the ability to specifically bind antigen. The term domain refers to a globular region of a heavy or light chain polypeptide comprising peptide loops (e.g., comprising 3 to 4 peptide loops) stabilized, for example, by p pleated sheet and/or intrachain disulfide bond. Domains are further referred to herein as constant or variable, based on the relative lack of sequence variation within the domains of various class members in the case of a constant domain, or the significant variation within the domains of various class members in the case of a variable domain. Antibody or polypeptide domains are often referred to interchangeably in the art as antibody or polypeptide regions. The constant domains of an antibody light chain are referred to interchangeably as light chain constant regions, light chain constant domains, CL regions or CL domains. The constant domains of an antibody heavy chain are referred to interchangeably as heavy chain constant regions, heavy chain constant domains, CH regions or CH domains). The variable domains of an antibody light chain are referred to interchangeably as light chain variable regions, light chain variable domains, VL regions or VL domains). The variable domains of an antibody heavy chain are referred to interchangeably as heavy chain constant regions, heavy chain constant domains, VH regions or VH domains).

    [0089] The term region can also refer to a part or portion of an antibody chain or antibody chain domain (e.g., a part or portion of a heavy or light chain or a part or portion of a constant or variable domain, as defined herein), as well as more discrete parts or portions of said chains or domains. For example, light and heavy chains or light and heavy chain variable domains include complementarity determining regions or CDRs interspersed among framework regions or FRs, as defined herein.

    [0090] The term conformation refers to the tertiary structure of a protein or polypeptide (e.g., an antibody, antibody chain, domain or region thereof). For example, the phrase light (or heavy) chain conformation refers to the tertiary structure of a light (or heavy) chain variable region, and the phrase antibody conformation or antibody fragment conformation refers to the tertiary structure of an antibody or fragment thereof.

    [0091] The term antibody-like protein scaffolds or engineered protein scaffolds broadly encompasses proteinaceous non-immunoglobulin specific-binding agents, typically obtained by combinatorial engineering (such as site-directed random mutagenesis in combination with phage display or other molecular selection techniques). Usually, such scaffolds are derived from robust and small soluble monomeric proteins (such as Kunitz inhibitors or lipocalins) or from a stably folded extra-membrane domain of a cell surface receptor (such as protein A, fibronectin or the ankyrin repeat).

    [0092] Such scaffolds have been extensively reviewed in Binz et al. (Engineering novel binding proteins from nonimmunoglobulin domains. Nat Biotechnol 2005, 23:1257-1268), Gebauer and Skerra (Engineered protein scaffolds as next-generation antibody therapeutics. Curr Opin Chem Biol. 2009, 13:245-55), Gill and Damle (Biopharmaceutical drug discovery using novel protein scaffolds. Curr Opin Biotechnol 2006, 17:653-658), Skerra (Engineered protein scaffolds for molecular recognition. J Mol Recognit 2000, 13:167-187), and Skerra (Alternative non-antibody scaffolds for molecular recognition. Curr Opin Biotechnol 2007, 18:295-304), and include without limitation affibodies, based on the Z-domain of staphylococcal protein A, a three-helix bundle of 58 residues providing an interface on two of its alpha-helices (Nygren, Alternative binding proteins: Affibody binding proteins developed from a small three-helix bundle scaffold. FEBS J 2008, 275:2668-2676); engineered Kunitz domains based on a small (ca. 58 residues) and robust, disulphide-crosslinked serine protease inhibitor, typically of human origin (e.g., LACI-D1), which can be engineered for different protease specificities (Nixon and Wood, Engineered protein inhibitors of proteases. Curr Opin Drug Discov Dev 2006, 9:261-268); monobodies or adnectins based on the 10th extracellular domain of human fibronectin III (1? F.n3), which adopts an Ig-like beta-sandwich fold (94 residues) with 2-3 exposed loops, but lacks the central disulphide bridge (Koide and Koide, Monobodies: antibody mimics based on the scaffold of the fibronectin type III domain. Methods Mol Biol 2007, 352:95-109); anticalins derived from the lipocalins, a diverse family of eight-stranded beta-barrel proteins (ca. 180 residues) that naturally form binding sites for small ligands by means of four structurally variable loops at the open end, which are abundant in humans, insects, and many other organisms (Skerra, Alternative binding proteins: Anticalins-harnessing the structural plasticity of the lipocalin ligand pocket to engineer novel binding activities. FEBS J 2008, 275:2677-2683); DARPins, designed ankyrin repeat domains (166 residues), which provide a rigid interface arising from typically three repeated beta-turns (Stumpp et al., DARPins: a new generation of protein therapeutics. Drug Discov Today 2008, 13:695-701); avimers (multimerized LDLR-A module) (Silverman et al., Multivalent avimer proteins evolved by exon shuffling of a family of human receptor domains. Nat Biotechnol 2005, 23:1556-1561); and cysteine-rich knottin peptides (Kolmar, Alternative binding proteins: biological activity and therapeutic potential of cystine-knot miniproteins. FEBS J 2008, 275:2684-2690).

    [0093] Specific binding of an antibody means that the antibody exhibits appreciable affinity for a particular antigen or epitope and, generally, does not exhibit significant cross reactivity. Appreciable binding includes binding with an affinity of at least 25 ?M. Antibodies with affinities greater than 1?10.sup.7 M.sup.?1 (or a dissociation coefficient of 1 ?M or less or a dissociation coefficient of 1 nm or less) typically bind with correspondingly greater specificity. Values intermediate of those set forth herein are also intended to be within the scope of the present invention and antibodies of the invention bind with a range of affinities, for example, 100 nM or less, 75 nM or less, 50 nM or less, 25 nM or less, for example 10 nM or less, SnM or less, lnM or less, or in embodiments 500 pM or less, 100 pM or less, 50 pM or less or 25 pM or less. An antibody that does not exhibit significant crossreactivity is one that will not appreciably bind to an entity other than its target (e.g., a different epitope or a different molecule). For example, an antibody that specifically binds to a target molecule will appreciably bind the target molecule but will not significantly react with non-target molecules or peptides. An antibody specific for a particular epitope will, for example, not significantly crossreact with remote epitopes on the same protein or peptide. Specific binding can be determined according to any art-recognized means for determining such binding. Preferably, specific binding is determined according to Scatchard analysis and/or competitive binding assays.

    [0094] As used herein, the term affinity refers to the strength of the binding of a single antigen-combining site with an antigenic determinant. Affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, on the distribution of charged and hydrophobic groups, etc. Antibody affinity can be measured by equilibrium dialysis or by the kinetic BIACORE? method. The dissociation constant, Kd, and the association constant, Ka, are quantitative measures of affinity.

    [0095] As used herein, the term monoclonal antibody refers to an antibody derived from a clonal population of antibody-producing cells (e.g., B lymphocytes or B cells) which is homogeneous in structure and antigen specificity. The term polyclonal antibody refers to a plurality of antibodies originating from different clonal populations of antibody-producing cells which are heterogeneous in their structure and epitope specificity but which recognize a common antigen. Monoclonal and polyclonal antibodies may exist within bodily fluids, as crude preparations, or may be purified, as described herein.

    [0096] The term binding portion of an antibody (or antibody portion) includes one or more complete domains, e.g., a pair of complete domains, as well as fragments of an antibody that retain the ability to specifically bind to a target molecule. It has been shown that the binding function of an antibody can be performed by fragments of a full-length antibody. Binding fragments are produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins. Binding fragments include Fab, Fab, F(ab)2, Fabc, Fd, dAb, Fv, single chains, single-chain antibodies, e.g., scFv, and single domain antibodies.

    [0097] Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, FR residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.

    [0098] Examples of portions of antibodies or epitope-binding proteins encompassed by the present definition include: (i) the Fab fragment, having V.sub.L, C.sub.L, V.sub.H and C.sub.H1 domains; (ii) the Fab fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the C.sub.H1 domain; (iii) the Fd fragment having V.sub.H and C.sub.H1 domains; (iv) the Fd fragment having V.sub.H and C.sub.H1 domains and one or more cysteine residues at the C-terminus of the CHI domain; (v) the Fv fragment having the V.sub.L and V.sub.H domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al., 341 Nature 544 (1989)) which consists of a V.sub.H domain or a V.sub.L domain that binds antigen; (vii) isolated CDR regions or isolated CDR regions presented in a functional framework; (viii) F(ab).sub.2 fragments which are bivalent fragments including two Fab fragments linked by a disulphide bridge at the hinge region; (ix) single chain antibody molecules (e.g., single chain Fv; scFv) (Bird et al., 242 Science 423 (1988); and Huston et al., 85 PNAS 5879 (1988)); (x) diabodies with two antigen binding sites, comprising a heavy chain variable domain (V.sub.H) connected to a light chain variable domain (V.sub.L) in the same polypeptide chain (see, e.g., EP 404,097; WO 93/11161; Hollinger et al., 90 PNAS 6444 (1993)); (xi) linear antibodies comprising a pair of tandem Fd segments (V.sub.H-C.sub.h1-V.sub.H-C.sub.h1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. 8(10):1057-62 (1995); and U.S. Pat. No. 5,641,870).

    [0099] As used herein, a blocking antibody or an antibody antagonist is one which inhibits or reduces biological activity of the antigen(s) it binds (e.g., CD160). In certain embodiments, the blocking antibodies or antagonist antibodies or portions thereof described herein completely inhibit the biological activity of the antigen(s).

    [0100] Antibodies may act as agonists or antagonists of the recognized polypeptides. For example, the present invention includes antibodies which disrupt receptor/ligand interactions either partially or fully. The invention features both receptor-specific antibodies and ligand-specific antibodies. The invention also features receptor-specific antibodies which do not prevent ligand binding but prevent receptor activation. Receptor activation (i.e., signaling) may be determined by techniques described herein or otherwise known in the art. For example, receptor activation can be determined by detecting the phosphorylation (e.g., tyrosine or serine/threonine) of the receptor or of one of its down-stream substrates by immunoprecipitation followed by western blot analysis. In specific embodiments, antibodies are provided that inhibit ligand activity or receptor activity by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50% of the activity in absence of the antibody.

    [0101] The invention also features receptor-specific antibodies which both prevent ligand binding and receptor activation as well as antibodies that recognize the receptor-ligand complex. Likewise, encompassed by the invention are neutralizing antibodies which bind the ligand and prevent binding of the ligand to the receptor, as well as antibodies which bind the ligand, thereby preventing receptor activation, but do not prevent the ligand from binding the receptor. Further included in the invention are antibodies which activate the receptor. These antibodies may act as receptor agonists, i.e., potentiate or activate either all or a subset of the biological activities of the ligand-mediated receptor activation, for example, by inducing dimerization of the receptor. The antibodies may be specified as agonists, antagonists or inverse agonists for biological activities comprising the specific biological activities of the peptides disclosed herein. The antibody agonists and antagonists can be made using methods known in the art. See, e.g., PCT publication WO 96/40281; U.S. Pat. No. 5,811,097; Deng et al., Blood 92(6):1981-1988 (1998); Chen et al., Cancer Res. 58(16):3668-3678 (1998); Harrop et al., J. Immunol. 161(4):1786-1794 (1998); Zhu et al., Cancer Res. 58(15):3209-3214 (1998); Yoon et al., J. Immunol. 160(7):3170-3179 (1998); Prat et al., J. Cell. Sci. III (Pt2):237-247 (1998); Pitard et al., J. Immunol. Methods 205(2):177-190 (1997); Liautard et al., Cytokine 9(4):233-241 (1997); Carlson et al., J. Biol. Chem. 272(17):11295-11301 (1997); Taryman et al., Neuron 14(4):755-762 (1995); Muller et al., Structure 6(9):1153-1167 (1998); Bartunek et al., Cytokine 8(1):14-20 (1996).

    [0102] The antibodies as defined for the present invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.

    [0103] Simple binding assays can be used to screen for or detect agents that bind to a target protein, or disrupt the interaction between proteins (e.g., a receptor and a ligand). Because certain targets of the present invention are transmembrane proteins, assays that use the soluble forms of these proteins rather than full-length protein can be used, in some embodiments. Soluble forms include, for example, those lacking the transmembrane domain and/or those comprising the IgV domain or fragments thereof which retain their ability to bind their cognate binding partners. Further, agents that inhibit or enhance protein interactions for use in the compositions and methods described herein, can include recombinant peptido-mimetics.

    [0104] Detection methods useful in screening assays include antibody-based methods, detection of a reporter moiety, detection of cytokines as described herein, and detection of a gene signature as described herein.

    [0105] Another variation of assays to determine binding of a receptor protein to a ligand protein is through the use of affinity biosensor methods. Such methods may be based on the piezoelectric effect, electrochemistry, or optical methods, such as ellipsometry, optical wave guidance, and surface plasmon resonance (SPR).

    Bispecific Antibodies

    [0106] In certain embodiments, bispecific antibodies are used to target pathogenic Th1 cells. Bi-specific antigen-binding constructs, e.g., bi-specific antibodies (bsAb) or BiTEs, bind two antigens (see, e.g., Suurs et al., A review of bispecific antibodies and antibody constructs in oncology and clinical challenges. Pharmacol Ther. 2019 September; 201:103-119; and Huehls, et al., Bispecific T cell engagers for cancer immunotherapy. Immunol Cell Biol. 2015 March; 93(3): 290-296). The bi-specific antigen-binding construct includes two antigen-binding polypeptide constructs, e.g., antigen binding domains. In some embodiments, the antigen-binding construct is derived from known antibodies or antigen-binding constructs. In some embodiments, the antigen-binding polypeptide constructs comprise two antigen binding domains that comprise antibody fragments. In some embodiments, the first antigen binding domain and second antigen binding domain each independently comprises an antibody fragment selected from the group of: an scFv, a Fab, and an Fc domain. The antibody fragments may be the same format or different formats from each other. For example, in some embodiments, the antigen-binding polypeptide constructs comprise a first antigen binding domain comprising an scFv and a second antigen binding domain comprising a Fab. In some embodiments, the antigen-binding polypeptide constructs comprise a first antigen binding domain and a second antigen binding domain, wherein both antigen binding domains comprise an scFv. In some embodiments, the first and second antigen binding domains each comprise a Fab. In some embodiments, the first and second antigen binding domains each comprise an Fc domain. Any combination of antibody formats is suitable for the bi-specific antibody constructs disclosed herein.

    [0107] In certain embodiments, Th1 cells can be engaged to tumor cells. In certain embodiments, two targets are disrupted on a Th1 cell by the bsAb. By means of an example, an agent, such as a bi-specific antibody, capable of specifically binding to a gene product expressed on the cell surface of the Th1 cells and a tumor cell may be used for targeting Th1 cells to tumor cells.

    Aptamers

    [0108] In certain embodiments, the one or more agent is an aptamer. Nucleic acid aptamers are nucleic acid species that have been engineered through repeated rounds of in vitro selection or equivalently, SELEX (systematic evolution of ligands by exponential enrichment) to bind to various molecular targets such as small molecules, proteins, nucleic acids, cells, tissues and organisms. Nucleic acid aptamers have specific binding affinity to molecules through interactions other than classic Watson-Crick base pairing. Aptamers are useful in biotechnological and therapeutic applications as they offer molecular recognition properties similar to antibodies. In addition to their discriminate recognition, aptamers offer advantages over antibodies as they can be engineered completely in a test tube, are readily produced by chemical synthesis, possess desirable storage properties, and elicit little or no immunogenicity in therapeutic applications. In certain embodiments, RNA aptamers may be expressed from a DNA construct. In other embodiments, a nucleic acid aptamer may be linked to another polynucleotide sequence. The polynucleotide sequence may be a double stranded DNA polynucleotide sequence. The aptamer may be covalently linked to one strand of the polynucleotide sequence. The aptamer may be ligated to the polynucleotide sequence. The polynucleotide sequence may be configured, such that the polynucleotide sequence may be linked to a solid support or ligated to another polynucleotide sequence.

    [0109] Aptamers, like peptides generated by phage display or monoclonal antibodies (mAbs), are capable of specifically binding to selected targets and modulating the targets activity, e.g., through binding, aptamers may block their target's ability to function. A typical aptamer is 10-15 kDa in size (30-45 nucleotides), binds its target with sub-nanomolar affinity, and discriminates against closely related targets (e.g., aptamers will typically not bind other proteins from the same gene family). Structural studies have shown that aptamers are capable of using the same types of binding interactions (e.g., hydrogen bonding, electrostatic complementarity, hydrophobic contacts, steric exclusion) that drives affinity and specificity in antibody-antigen complexes.

    [0110] Aptamers have a number of desirable characteristics for use in research and as therapeutics and diagnostics including high specificity and affinity, biological efficacy, and excellent pharmacokinetic properties. In addition, they offer specific competitive advantages over antibodies and other protein biologics. Aptamers are chemically synthesized and are readily scaled as needed to meet production demand for research, diagnostic or therapeutic applications. Aptamers are chemically robust. They are intrinsically adapted to regain activity following exposure to factors such as heat and denaturants and can be stored for extended periods (>1 yr) at room temperature as lyophilized powders. Not being bound by a theory, aptamers bound to a solid support or beads may be stored for extended periods.

    [0111] Oligonucleotides in their phosphodiester form may be quickly degraded by intracellular and extracellular enzymes such as endonucleases and exonucleases. Aptamers can include modified nucleotides conferring improved characteristics on the ligand, such as improved in vivo stability or improved delivery characteristics. Examples of such modifications include chemical substitutions at the ribose and/or phosphate and/or base positions. SELEX identified nucleic acid ligands containing modified nucleotides are described, e.g., in U.S. Pat. No. 5,660,985, which describes oligonucleotides containing nucleotide derivatives chemically modified at the 2 position of ribose, 5 position of pyrimidines, and 8 position of purines, U.S. Pat. No. 5,756,703 which describes oligonucleotides containing various 2-modified pyrimidines, and U.S. Pat. No. 5,580,737 which describes highly specific nucleic acid ligands containing one or more nucleotides modified with 2-amino (2NH), 2-fluoro (2-F), and/or 2-0-methyl (2-OMe) substituents. Modifications of aptamers may also include, modifications at exocyclic amines, substitution of 4-thiouridine, substitution of 5-bromo or 5-iodo-uracil; backbone modifications, phosphorothioate or allyl phosphate modifications, methylations, and unusual base-pairing combinations such as the isobases isocytidine and isoguanosine. Modifications can also include 3 and 5 modifications such as capping. As used herein, the term phosphorothioate encompasses one or more non-bridging oxygen atoms in a phosphodiester bond replaced by one or more sulfur atoms. In further embodiments, the oligonucleotides comprise modified sugar groups, for example, one or more of the hydroxyl groups is replaced with halogen, aliphatic groups, or functionalized as ethers or amines. In one embodiment, the 2-position of the furanose residue is substituted by any of an O-methyl, O-alkyl, O-allyl, S-alkyl, S-allyl, or halo group. Methods of synthesis of 2-modified sugars are described, e.g., in Sproat, et al., Nucl Acid Res. 19:733-738 (1991); Cotten, et al, Nucl. Acid Res. 19:2629-2635 (1991); and Hobbs, et al, Biochemistry 12:5138-5145 (1973). Other modifications are known to one of ordinary skill in the art. In certain embodiments, aptamers include aptamers with improved off-rates as described in international Patent Publication No. WO 2009012418, Method for generating aptamers with improved off-rates, incorporated herein by reference in its entirety. In certain embodiments aptamers are chosen from a library of aptamers. Such libraries include, but are not limited to, those described in Rohloff et al., Nucleic Acid Ligands With Protein-like Side Chains: Modified Aptamers and Their Use as Diagnostic and Therapeutic Agents, Molecular Therapy Nucleic Acids (2014) 3, e201. Aptamers are also commercially available (see, e.g., SomaLogic, Inc., Boulder, Colorado). In certain embodiments, the present invention may utilize any aptamer containing any modification as described herein.

    Small Molecules

    [0112] In certain embodiments, the one or more agents is a small molecule. The term small molecule refers to compounds, preferably organic compounds, with a size comparable to those organic molecules generally used in pharmaceuticals. The term excludes biological macromolecules (e.g., proteins, peptides, nucleic acids, etc.). Preferred small organic molecules range in size up to about 5000 Da, e.g., up to about 4000, preferably up to 3000 Da, more preferably up to 2000 Da, even more preferably up to about 1000 Da, e.g., up to about 900, 800, 700, 600 or up to about 500 Da. In certain embodiments, the small molecule may act as an antagonist or agonist (e.g., blocking an enzyme active site or activating a receptor by binding to a ligand binding site).

    [0113] One type of small molecule applicable to the present invention is a degrader molecule (see, e.g., Ding, et al., Emerging New Concepts of Degrader Technologies, Trends Pharmacol Sci. 2020 July; 41(7):464-474). The terms degrader and degrader molecule refer to all compounds capable of specifically targeting a protein for degradation (e.g., ATTEC, AUTAC, LYTAC, or PROTAC, reviewed in Ding, et al. 2020). Proteolysis Targeting Chimera (PROTAC) technology is a rapidly emerging alternative therapeutic strategy with the potential to address many of the challenges currently faced in modern drug development programs. PROTAC technology employs small molecules that recruit target proteins for ubiquitination and removal by the proteasome (see, e.g., Zhou et al., Discovery of a Small-Molecule Degrader of Bromodomain and Extra-Terminal (BET) Proteins with Picomolar Cellular Potencies and Capable of Achieving Tumor Regression. J. Med. Chem. 2018, 61, 462-481; Bondeson and Crews, Targeted Protein Degradation by Small Molecules, Annu Rev Pharmacol Toxicol. 2017 Jan. 6; 57: 107-123; and Lai et al., Modular PROTAC Design for the Degradation of Oncogenic BCR-ABL Angew Chem Int Ed Engl. 2016 Jan. 11; 55(2): 807-810). In certain embodiments, LYTACs are particularly advantageous for cell surface proteins as described herein (e.g., CD160).

    Genetic Modifying Agents

    [0114] In certain embodiments, the one or more modulating agents may be a genetic modifying agent. The genetic modifying agents may manipulate nucleic acids (e.g., genomic DNA or mRNA). The genetic modulating agent can be used to up- or downregulate expression of a gene either by targeting a nuclease or functional domain to a DNA or RNA sequence. The genetic modifying agent may comprise an RNA-guided nuclease system (e.g., CRISPR system or IscB system), RNAi system, a zinc finger nuclease, a TALE, or a meganuclease.

    CRISPR-Cas Modification

    [0115] In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a CRISPR-Cas and/or Cas-based system (e.g., genomic DNA or mRNA, preferably, for a disease gene). The nucleotide sequence may be or encode one or more components of a CRISPR-Cas system. For example, the nucleotide sequences may be or encode guide RNAs. The nucleotide sequences may also encode CRISPR proteins, variants thereof, or fragments thereof.

    [0116] In general, a CRISPR-Cas or CRISPR system as used herein and in other documents, such as WO 2014/093622 (PCT/US2013/074667), refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (Cas) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g., tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a direct repeat and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a spacer in the context of an endogenous CRISPR system), or RNA(s) as that term is herein used (e.g., RNA(s) to guide Cas, such as Cas9, e.g., CRISPR RNA and transactivating (tracr) RNA or a single guide RNA (sgRNA) (chimeric RNA)) or other sequences and transcripts from a CRISPR locus. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). See, e.g., Shmakov et al. (2015) Discovery and Functional Characterization of Diverse Class 2 CRISPR-Cas Systems, Molecular Cell, DOI: dx.doi.org/10.1016/j.molcel. 2015.10.008.

    [0117] CRISPR-Cas systems can generally fall into two classes based on their architectures of their effector molecules, which are each further subdivided by type and subtype. The two classes are Class 1 and Class 2. Class 1 CRISPR-Cas systems have effector modules composed of multiple Cas proteins, some of which form crRNA-binding complexes, while Class 2 CRISPR-Cas systems include a single, multi-domain crRNA-binding protein.

    [0118] In some embodiments, the CRISPR-Cas system that can be used to modify a polynucleotide of the present invention described herein can be a Class 1 CRISPR-Cas system. In some embodiments, the CRISPR-Cas system that can be used to modify a polynucleotide of the present invention described herein can be a Class 2 CRISPR-Cas system.

    Class 1 CRISPR-Cas Systems

    [0119] In some embodiments, the CRISPR-Cas system that can be used to modify a polynucleotide of the present invention described herein can be a Class 1 CRISPR-Cas system. Class 1 CRISPR-Cas systems are divided into Types I, II, and IV. Makarova et al. 2020. Nat. Rev. 18: 67-83, particularly as described in FIG. 1. Type I CRISPR-Cas systems are divided into 9 subtypes (I-A, I-B, I-C, I-D, I-E, I-F1, I-F2, I-F3, and IG). Makarova et al., 2020. Class 1, Type I CRISPR-Cas systems can contain a Cas3 protein that can have helicase activity. Type III CRISPR-Cas systems are divided into 6 subtypes (III-A, III-B, III-C, III-D, III-E, and III-F). Type III CRISPR-Cas systems can contain a Cas10 that can include an RNA recognition motif called Palm and a cyclase domain that can cleave polynucleotides. Makarova et al., 2020. Type IV CRISPR-Cas systems are divided into 3 subtypes. (IV-A, IV-B, and IV-C). Makarova et al., 2020. Class 1 systems also include CRISPR-Cas variants, including Type I-A, I-B, I-E, I-F and I-U variants, which can include variants carried by transposons and plasmids, including versions of subtype I-F encoded by a large family of Tn7-like transposon and smaller groups of Tn7-like transposons that encode similarly degraded subtype I-B systems. Peters et al., PNAS 114 (35) (2017); DOI: 10.1073/pnas.1709035114; see also, Makarova et al. 2018. The CRISPR Journal, v. 1, n5, FIG. 5.

    [0120] The Class 1 systems typically use a multi-protein effector complex, which can, in some embodiments, include ancillary proteins, such as one or more proteins in a complex referred to as a CRISPR-associated complex for antiviral defense (Cascade), one or more adaptation proteins (e.g., Cas1, Cas2, RNA nuclease), and/or one or more accessory proteins (e.g., Cas 4, DNA nuclease), CRISPR associated Rossman fold (CARF) domain containing proteins, and/or RNA transcriptase.

    [0121] The backbone of the Class 1 CRISPR-Cas system effector complexes can be formed by RNA recognition motif domain-containing protein(s) of the repeat-associated mysterious proteins (RAMPs) family subunits (e.g., Cas 5, Cas6, and/or Cas7). RAMP proteins are characterized by having one or more RNA recognition motif domains. In some embodiments, multiple copies of RAMPs can be present. In some embodiments, the Class I CRISPR-Cas system can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more Cas5, Cas6, and/or Cas 7 proteins. In some embodiments, the Cas6 protein is an RNAse, which can be responsible for pre-crRNA processing. When present in a Class 1 CRISPR-Cas system, Cas6 can be optionally physically associated with the effector complex.

    [0122] Class 1 CRISPR-Cas system effector complexes can, in some embodiments, also include a large subunit. The large subunit can be composed of or include a Cas8 and/or Cas10 protein. See, e.g., FIGS. 1 and 2. Koonin E V, Makarova K S. 2019. Phil. Trans. R. Soc. B 374: 20180087, DOI: 10.1098/rstb.2018.0087 and Makarova et al. 2020.

    [0123] Class 1 CRISPR-Cas system effector complexes can, in some embodiments, include a small subunit (for example, Cas11). See, e.g., FIGS. 1 and 2. Koonin E V, Makarova K S. 2019 Origins and Evolution of CRISPR-Cas systems. Phil. Trans. R. Soc. B 374: 20180087, DOI: 10.1098/rstb.2018.0087.

    [0124] In some embodiments, the Class 1 CRISPR-Cas system can be a Type I CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-A CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-B CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-C CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-D CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-E CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-F1 CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-F2 CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-F3 CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-G CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a CRISPR Cas variant, such as a Type I-A, I-B, I-E, I-F and I-U variants, which can include variants carried by transposons and plasmids, including versions of subtype I-F encoded by a large family of Tn7-like transposon and smaller groups of Tn7-like transposons that encode similarly degraded subtype I-B systems as previously described.

    [0125] In some embodiments, the Class 1 CRISPR-Cas system can be a Type III CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-A CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-B CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-C CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-D CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-E CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-F CRISPR-Cas system.

    [0126] In some embodiments, the Class 1 CRISPR-Cas system can be a Type IV CRISPR-Cas-system. In some embodiments, the Type IV CRISPR-Cas system can be a subtype IV-A CRISPR-Cas system. In some embodiments, the Type IV CRISPR-Cas system can be a subtype IV-B CRISPR-Cas system. In some embodiments, the Type IV CRISPR-Cas system can be a subtype IV-C CRISPR-Cas system.

    [0127] The effector complex of a Class 1 CRISPR-Cas system can, in some embodiments, include a Cas3 protein that is optionally fused to a Cas2 protein, a Cas4, a Cas5, a Cas6, a Cas7, a Cas8, a Cas10, a Cas11, or a combination thereof. In some embodiments, the effector complex of a Class 1 CRISPR-Cas system can have multiple copies, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14, of any one or more Cas proteins.

    Class 2 CRISPR-Cas Systems

    [0128] The compositions, systems, and methods described in greater detail elsewhere herein can be designed and adapted for use with Class 2 CRISPR-Cas systems. Thus, in some embodiments, the CRISPR-Cas system is a Class 2 CRISPR-Cas system. Class 2 systems are distinguished from Class 1 systems in that they have a single, large, multi-domain effector protein. In certain example embodiments, the Class 2 system can be a Type II, Type V, or Type VI system, which are described in Makarova et al. Evolutionary classification of CRISPR-Cas systems: a burst of class 2 and derived variants Nature Reviews Microbiology, 18:67-81 (February 2020), incorporated herein by reference. Each type of Class 2 system is further divided into subtypes. See Markova et al. 2020, particularly at Figure. 2. Class 2, Type II systems can be divided into 4 subtypes: II-A, II-B, II-C1, and II-C2. Class 2, Type V systems can be divided into 17 subtypes: V-A, V-B1, V-B2, V-C, V-D, V-E, V-F1, V-F1(V-U3), V-F2, V-F3, V-G, V-H, V-I, V-K (V-U5), V-U1, V-U2, and V-U4. Class 2, Type IV systems can be divided into 5 subtypes: VI-A, VI-B1, VI-B2, VI-C, and VI-D.

    [0129] The distinguishing feature of these types is that their effector complexes consist of a single, large, multi-domain protein. Type V systems differ from Type II effectors (e.g., Cas9), which contain two nuclear domains that are each responsible for the cleavage of one strand of the target DNA, with the HNH nuclease inserted inside the Ruv-C like nuclease domain sequence. The Type V systems (e.g., Cas12) only contain a RuvC-like nuclease domain that cleaves both strands. Type VI (Cas13) are unrelated to the effectors of Type II and V systems and contain two HEPN domains and target RNA. Cas13 proteins also display collateral activity that is triggered by target recognition. Some Type V systems have also been found to possess this collateral activity with two single-stranded DNA in in vitro contexts.

    [0130] In some embodiments, the Class 2 system is a Type II system. In some embodiments, the Type II CRISPR-Cas system is a II-A CRISPR-Cas system. In some embodiments, the Type II CRISPR-Cas system is a II-B CRISPR-Cas system. In some embodiments, the Type II CRISPR-Cas system is a II-C1 CRISPR-Cas system. In some embodiments, the Type II CRISPR-Cas system is a II-C2 CRISPR-Cas system. In some embodiments, the Type II system is a Cas9 system. In some embodiments, the Type II system includes a Cas9.

    [0131] In some embodiments, the Class 2 system is a Type V system. In some embodiments, the Type V CRISPR-Cas system is a V-A CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-B1 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-B2 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-C CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-D CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-E CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F1 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F1 (V-U3) CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F2 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F3 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-G CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-H CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-I CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-K (V-U5) CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-U1 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-U2 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-U4 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system includes a Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), CasX, and/or Cas14.

    [0132] In some embodiments the Class 2 system is a Type VI system. In some embodiments, the Type VI CRISPR-Cas system is a VI-A CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-B1 CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-B2 CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-C CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-D CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system includes a Cas13a (C2c2), Cas13b (Group 29/30), Cas13c, and/or Cas13d.

    Specialized Cas-Based Systems

    [0133] In some embodiments, the system is a Cas-based system that is capable of performing a specialized function or activity. For example, the Cas protein may be fused, operably coupled to, or otherwise associated with one or more functionals domains. In certain example embodiments, the Cas protein may be a catalytically dead Cas protein (dCas) and/or have nickase activity. A nickase is a Cas protein that cuts only one strand of a double stranded target. In such embodiments, the dCas or nickase provide a sequence specific targeting functionality that delivers the functional domain to or proximate a target sequence. Example functional domains that may be fused to, operably coupled to, or otherwise associated with a Cas protein can be or include, but are not limited to a nuclear localization signal (NLS) domain, a nuclear export signal (NES) domain, a translational activation domain, a transcriptional activation domain (e.g. VP64, p65, MyoD1, HSF1, RTA, and SET7/9), a translation initiation domain, a transcriptional repression domain (e.g., a KRAB domain, NuE domain, NcoR domain, and a SID domain such as a SID4X domain), a nuclease domain (e.g., FokI), a histone modification domain (e.g., a histone acetyltransferase), a light inducible/controllable domain, a chemically inducible/controllable domain, a transposase domain, a homologous recombination machinery domain, a recombinase domain, an integrase domain, and combinations thereof. Methods for generating catalytically dead Cas9 or a nickase Cas9 (WO 2014/204725, Ran et al. Cell. 2013 Sep. 12; 154(6):1380-1389), Cas12 (Liu et al. Nature Communications, 8, 2095 (2017), and Cas13 (WO 2019/005884, WO2019/060746) are known in the art and incorporated herein by reference.

    [0134] In some embodiments, the functional domains can have one or more of the following activities: methylase activity, demethylase activity, translation activation activity, translation initiation activity, translation repression activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, single-strand RNA cleavage activity, double-strand RNA cleavage activity, single-strand DNA cleavage activity, double-strand DNA cleavage activity, molecular switch activity, chemical inducibility, light inducibility, and nucleic acid binding activity. In some embodiments, the one or more functional domains may comprise epitope tags or reporters. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporters include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and auto-fluorescent proteins including blue fluorescent protein (BFP).

    [0135] The one or more functional domain(s) may be positioned at, near, and/or in proximity to a terminus of the effector protein (e.g., a Cas protein). In embodiments having two or more functional domains, each of the two can be positioned at or near or in proximity to a terminus of the effector protein (e.g., a Cas protein). In some embodiments, such as those where the functional domain is operably coupled to the effector protein, the one or more functional domains can be tethered or linked via a suitable linker (including, but not limited to, GlySer linkers) to the effector protein (e.g., a Cas protein). When there is more than one functional domain, the functional domains can be same or different. In some embodiments, all the functional domains are the same. In some embodiments, all of the functional domains are different from each other. In some embodiments, at least two of the functional domains are different from each other. In some embodiments, at least two of the functional domains are the same as each other.

    [0136] Other suitable functional domains can be found, for example, in International Patent Publication No. WO 2019/018423.

    Split CRISPR-Cas Systems

    [0137] In some embodiments, the CRISPR-Cas system is a split CRISPR-Cas system. See e.g., Zetche et al., 2015. Nat. Biotechnol. 33(2): 139-142 and WO 2019/018423, the compositions and techniques of which can be used in and/or adapted for use with the present invention. Split CRISPR-Cas proteins are set forth herein and in documents incorporated herein by reference in further detail herein. In certain embodiments, each part of a split CRISPR protein are attached to a member of a specific binding pair, and when bound with each other, the members of the specific binding pair maintain the parts of the CRISPR protein in proximity. In certain embodiments, each part of a split CRISPR protein is associated with an inducible binding pair. An inducible binding pair is one which is capable of being switched on or off by a protein or small molecule that binds to both members of the inducible binding pair. In some embodiments, CRISPR proteins may preferably split between domains, leaving domains intact. In particular embodiments, said Cas split domains (e.g., RuvC and HNH domains in the case of Cas9) can be simultaneously or sequentially introduced into the cell such that said split Cas domain(s) process the target nucleic acid sequence in the algae cell. The reduced size of the split Cas compared to the wild type Cas allows other methods of delivery of the systems to the cells, such as the use of cell penetrating peptides as described herein.

    DNA and RNA Base Editing

    [0138] In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a base editing system. In some embodiments, a Cas protein is connected or fused to a nucleotide deaminase. Thus, in some embodiments the Cas-based system can be a base editing system. As used herein base editing refers generally to the process of polynucleotide modification via a CRISPR-Cas-based or Cas-based system that does not include excising nucleotides to make the modification. Base editing can convert base pairs at precise locations without generating excess undesired editing byproducts that can be made using traditional CRISPR-Cas systems.

    [0139] In certain example embodiments, the nucleotide deaminase may be a DNA base editor used in combination with a DNA binding Cas protein such as, but not limited to, Class 2 Type II and Type V systems. Two classes of DNA base editors are generally known: cytosine base editors (CBEs) and adenine base editors (ABEs). CBEs convert a C.Math.G base pair into a T.Math.A base pair (Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Li et al. Nat. Biotech. 36:324-327) and ABEs convert an A.Math.T base pair to a G.Math.C base pair. Collectively, CBEs and ABEs can mediate all four possible transition mutations (C to T, A to G, T to C, and G to A). Rees and Liu. 2018. Nat. Rev. Genet. 19(12): 770-788, particularly at FIGS. 1b, 2a-2c, 3a-3f, and Table 1. In some embodiments, the base editing system includes a CBE and/or an ABE. In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a base editing system. Rees and Liu. 2018. Nat. Rev. Gent. 19(12):770-788. Base editors also generally do not need a DNA donor template and/or rely on homology-directed repair. Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Gaudeli et al. 2017. Nature. 551:464-471. Upon binding to a target locus in the DNA, base pairing between the guide RNA of the system and the target DNA strand leads to displacement of a small segment of ssDNA in an R-loop. Nishimasu et al. Cell. 156:935-949. DNA bases within the ssDNA bubble are modified by the enzyme component, such as a deaminase. In some systems, the catalytically disabled Cas protein can be a variant or modified Cas can have nickase functionality and can generate a nick in the non-edited DNA strand to induce cells to repair the non-edited strand using the edited strand as a template. Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Gaudeli et al. 2017. Nature. 551:464-471. Base editors may be further engineered to optimize conversion of nucleotides (e.g. A:T to G:C). Richter et al. 2020. Nature Biotechnology. doi.org/10.1038/s41587-020-0453-z.

    [0140] Other Example Type V base editing systems are described in WO 2018/213708, WO 2018/213726, PCT/US2018/067207, PCT/US2018/067225, and PCT/US2018/067307 which are incorporated by referenced herein.

    [0141] In certain example embodiments, the base editing system may be a RNA base editing system. As with DNA base editors, a nucleotide deaminase capable of converting nucleotide bases may be fused to a Cas protein. However, in these embodiments, the Cas protein will need to be capable of binding RNA. Example RNA binding Cas proteins include, but are not limited to, RNA-binding Cas9s such as Francisella novicida Cas9 (FnCas9), and Class 2 Type VI Cas systems. The nucleotide deaminase may be a cytidine deaminase or an adenosine deaminase, or an adenosine deaminase engineered to have cytidine deaminase activity. In certain example embodiments, the RNA based editor may be used to delete or introduce a post-translation modification site in the expressed mRNA. In contrast to DNA base editors, whose edits are permanent in the modified cell, RNA base editors can provide edits where finer temporal control may be needed, for example in modulating a particular immune response. Example Type VI RNA-base editing systems are described in Cox et al. 2017. Science 358: 1019-1027, WO 2019/005884, WO 2019/005886, WO 2019/071048, PCT/US20018/05179, PCT/US2018/067207, which are incorporated herein by reference. An example FnCas9 system that may be adapted for RNA base editing purposes is described in WO 2016/106236, which is incorporated herein by reference.

    [0142] An example method for delivery of base-editing systems, including use of a split-intein approach to divide CBE and ABE into reconstitutable halves, is described in Levy et al. Nature Biomedical Engineering doi.org/10.1038/s41441-019-0505-5 (2019), which is incorporated herein by reference.

    Prime Editors

    [0143] In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a prime editing system (See e.g., Anzalone et al. 2019. Nature. 576: 149-157). Like base editing systems, prime editing systems can be capable of targeted modification of a polynucleotide without generating double stranded breaks and does not require donor templates. Further prime editing systems can be capable of all 12 possible combination swaps. Prime editing can operate via a search-and-replace methodology and can mediate targeted insertions, deletions, all 12 possible base-to-base conversion, and combinations thereof. Generally, a prime editing system, as exemplified by PE1, PE2, and PE3 (Id.), can include a reverse transcriptase fused or otherwise coupled or associated with an RNA-programmable nickase, and a prime-editing extended guide RNA (pegRNA) to facility direct copying of genetic information from the extension on the pegRNA into the target polynucleotide. Embodiments that can be used with the present invention include these and variants thereof. Prime editing can have the advantage of lower off-target activity than traditional CRIPSR-Cas systems along with few byproducts and greater or similar efficiency as compared to traditional CRISPR-Cas systems.

    [0144] In some embodiments, the prime editing guide molecule can specify both the target polynucleotide information (e.g., sequence) and contain a new polynucleotide cargo that replaces target polynucleotides. To initiate transfer from the guide molecule to the target polynucleotide, the PE system can nick the target polynucleotide at a target side to expose a 3hydroxyl group, which can prime reverse transcription of an edit-encoding extension region of the guide molecule (e.g., a prime editing guide molecule or peg guide molecule) directly into the target site in the target polynucleotide. See e.g., Anzalone et al. 2019. Nature. 576: 149-157, particularly at FIGS. 1b, 1c, related discussion, and Supplementary discussion.

    [0145] In some embodiments, a prime editing system can be composed of a Cas polypeptide having nickase activity, a reverse transcriptase, and a guide molecule. The Cas polypeptide can lack nuclease activity. The guide molecule can include a target binding sequence as well as a primer binding sequence and a template containing the edited polynucleotide sequence. The guide molecule, Cas polypeptide, and/or reverse transcriptase can be coupled together or otherwise associate with each other to form an effector complex and edit a target sequence. In some embodiments, the Cas polypeptide is a Class 2, Type V Cas polypeptide. In some embodiments, the Cas polypeptide is a Cas9 polypeptide (e.g. is a Cas9 nickase). In some embodiments, the Cas polypeptide is fused to the reverse transcriptase. In some embodiments, the Cas polypeptide is linked to the reverse transcriptase.

    [0146] In some embodiments, the prime editing system can be a PE1 system or variant thereof, a PE2 system or variant thereof, or a PE3 (e.g., PE3, PE3b) system. See e.g., Anzalone et al. 2019. Nature. 576: 149-157, particularly at pgs. 2-3, FIGS. 2a, 3a-3f, 4a-4b, Extended data FIGS. 3a-3b, 4,

    [0147] The peg guide molecule can be about 10 to about 200 or more nucleotides in length, such as 10 to/or 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, or 200 or more nucleotides in length. Optimization of the peg guide molecule can be accomplished as described in Anzalone et al. 2019. Nature. 576: 149-157, particularly at pg. 3, FIG. 2a-2b, and Extended Data FIGS. 5a-c.

    CRISPR Associated Transposase (CAST) Systems

    [0148] In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a CRISPR Associated Transposase (CAST) system. CAST system can include a Cas protein that is catalytically inactive, or engineered to be catalytically active, and further comprises a transposase (or subunits thereof) that catalyze RNA-guided DNA transposition. Such systems are able to insert DNA sequences at a target site in a DNA molecule without relying on host cell repair machinery. CAST systems can be Class1 or Class 2 CAST systems. An example Class 1 system is described in Klompe et al. Nature, doi:10.1038/s41586-019-1323, which is in incorporated herein by reference. An example Class 2 system is described in Strecker et al. Science. 10/1126/science. aax9181 (2019), and PCT/US2019/066835 which are incorporated herein by reference.

    Guide Molecules

    [0149] The CRISPR-Cas or Cas-Based system described herein can, in some embodiments, include one or more guide molecules. The terms guide molecule, guide sequence and guide polynucleotide, refer to polynucleotides capable of guiding Cas to a target genomic locus and are used interchangeably as in foregoing cited documents such as WO 2014/093622 (PCT/US2013/074667). In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. The guide molecule can be a polynucleotide.

    [0150] The ability of a guide sequence (within a nucleic acid-targeting guide RNA) to direct sequence-specific binding of a nucleic acid-targeting complex to a target nucleic acid sequence may be assessed by any suitable assay. For example, the components of a nucleic acid-targeting CRISPR system sufficient to form a nucleic acid-targeting complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target nucleic acid sequence, such as by transfection with vectors encoding the components of the nucleic acid-targeting complex, followed by an assessment of preferential targeting (e.g., cleavage) within the target nucleic acid sequence, such as by Surveyor assay (Qui et al. 2004. BioTechniques. 36(4)702-707). Similarly, cleavage of a target nucleic acid sequence may be evaluated in a test tube by providing the target nucleic acid sequence, components of a nucleic acid-targeting complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible and will occur to those skilled in the art.

    [0151] In some embodiments, the guide molecule is an RNA. The guide molecule(s) (also referred to interchangeably herein as guide polynucleotide and guide sequence) that are included in the CRISPR-Cas or Cas based system can be any polynucleotide sequence having sufficient complementarity with a target nucleic acid sequence to hybridize with the target nucleic acid sequence and direct sequence-specific binding of a nucleic acid-targeting complex to the target nucleic acid sequence. In some embodiments, the degree of complementarity, when optimally aligned using a suitable alignment algorithm, can be about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting examples of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).

    [0152] A guide sequence, and hence a nucleic acid-targeting guide, may be selected to target any target nucleic acid sequence. The target sequence may be DNA. The target sequence may be any RNA sequence. In some embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of messenger RNA (mRNA), pre-mRNA, ribosomal RNA (rRNA), transfer RNA (tRNA), micro-RNA (miRNA), small interfering RNA (siRNA), small nuclear RNA (snRNA), small nucleolar RNA (snoRNA), double stranded RNA (dsRNA), non-coding RNA (ncRNA), long non-coding RNA (lncRNA), and small cytoplasmatic RNA (scRNA). In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of mRNA, pre-mRNA, and rRNA. In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of ncRNA, and lncRNA. In some more preferred embodiments, the target sequence may be a sequence within an mRNA molecule or a pre-mRNA molecule.

    [0153] In some embodiments, a nucleic acid-targeting guide is selected to reduce the degree secondary structure within the nucleic acid-targeting guide. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the nucleic acid-targeting guide participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g., A. R. Gruber et al., 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62).

    [0154] In certain embodiments, a guide RNA or crRNA may comprise, consist essentially of, or consist of a direct repeat (DR) sequence and a guide sequence or spacer sequence. In certain embodiments, the guide RNA or crRNA may comprise, consist essentially of, or consist of a direct repeat sequence fused or linked to a guide sequence or spacer sequence. In certain embodiments, the direct repeat sequence may be located upstream (i.e., 5) from the guide sequence or spacer sequence. In other embodiments, the direct repeat sequence may be located downstream (i.e., 3) from the guide sequence or spacer sequence.

    [0155] In certain embodiments, the crRNA comprises a stem loop, preferably a single stem loop. In certain embodiments, the direct repeat sequence forms a stem loop, preferably a single stem loop.

    [0156] In certain embodiments, the spacer length of the guide RNA is from 15 to 35 nt. In certain embodiments, the spacer length of the guide RNA is at least 15 nucleotides. In certain embodiments, the spacer length is from 15 to 17 nt, e.g., 15, 16, or 17 nt, from 17 to 20 nt, e.g., 17, 18, 19, or 20 nt, from 20 to 24 nt, e.g., 20, 21, 22, 23, or 24 nt, from 23 to 25 nt, e.g., 23, 24, or 25 nt, from 24 to 27 nt, e.g., 24, 25, 26, or 27 nt, from 27 to 30 nt, e.g., 27, 28, 29, or 30 nt, from 30 to 35 nt, e.g., 30, 31, 32, 33, 34, or 35 nt, or 35 nt or longer.

    [0157] The tracrRNA sequence or analogous terms includes any polynucleotide sequence that has sufficient complementarity with a crRNA sequence to hybridize. In some embodiments, the degree of complementarity between the tracrRNA sequence and crRNA sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and crRNA sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.

    [0158] In general, degree of complementarity is with reference to the optimal alignment of the sca sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm and may further account for secondary structures, such as self-complementarity within either the sca sequence or tracr sequence. In some embodiments, the degree of complementarity between the tracr sequence and sca sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher.

    [0159] In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence can be about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or 100%; a guide or RNA or sgRNA can be about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length; or guide or RNA or sgRNA can be less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length; and tracr RNA can be 30 or 50 nucleotides in length. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence is greater than 94.5% or 95% or 95.5% or 96% or 96.5% or 97% or 97.5% or 98% or 98.5% or 99% or 99.5% or 99.9%, or 100%. Off target is less than 100% or 99.9% or 99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95% or 94.5% or 94% or 93% or 92% or 91% or 90% or 89% or 88% or 87% or 86% or 85% or 84% or 83% or 82% or 81% or 80% complementarity between the sequence and the guide, with it advantageous that off target is 100% or 99.9% or 99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95% or 94.5% complementarity between the sequence and the guide.

    [0160] In some embodiments according to the invention, the guide RNA (capable of guiding Cas to a target locus) may comprise (1) a guide sequence capable of hybridizing to a genomic target locus in the eukaryotic cell; (2) a tracr sequence; and (3) a tracr mate sequence. All (1) to (3) may reside in a single RNA, i.e., an sgRNA (arranged in a 5 to 3 orientation), or the tracr RNA may be a different RNA than the RNA containing the guide and tracr sequence. The tracr hybridizes to the tracr mate sequence and directs the CRISPR/Cas complex to the target sequence. Where the tracr RNA is on a different RNA than the RNA containing the guide and tracr sequence, the length of each RNA may be optimized to be shortened from their respective native lengths, and each may be independently chemically modified to protect from degradation by cellular RNase or otherwise increase stability.

    [0161] Many modifications to guide sequences are known in the art and are further contemplated within the context of this invention. Various modifications may be used to increase the specificity of binding to the target sequence and/or increase the activity of the Cas protein and/or reduce off-target effects. Example guide sequence modifications are described in PCT US2019/045582, specifically paragraphs [0178]-[0333]. which is incorporated herein by reference.

    Target Sequences, PAMs, and PFSs

    Target Sequences

    [0162] In the context of formation of a CRISPR complex, target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise RNA polynucleotides. The term target RNA refers to an RNA polynucleotide being or comprising the target sequence. In other words, the target polynucleotide can be a polynucleotide or a part of a polynucleotide to which a part of the guide sequence is designed to have complementarity with and to which the effector function mediated by the complex comprising the CRISPR effector protein and a guide molecule is to be directed. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.

    [0163] The guide sequence can specifically bind a target sequence in a target polynucleotide. The target polynucleotide may be DNA. The target polynucleotide may be RNA. The target polynucleotide can have one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc. or more) target sequences. The target polynucleotide can be on a vector. The target polynucleotide can be genomic DNA. The target polynucleotide can be episomal. Other forms of the target polynucleotide are described elsewhere herein.

    [0164] The target sequence may be DNA. The target sequence may be any RNA sequence. In some embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of messenger RNA (mRNA), pre-mRNA, ribosomal RNA (rRNA), transfer RNA (tRNA), micro-RNA (miRNA), small interfering RNA (siRNA), small nuclear RNA (snRNA), small nucleolar RNA (snoRNA), double stranded RNA (dsRNA), non-coding RNA (ncRNA), long non-coding RNA (lncRNA), and small cytoplasmatic RNA (scRNA). In some preferred embodiments, the target sequence (also referred to herein as a target polynucleotide) may be a sequence within an RNA molecule selected from the group consisting of mRNA, pre-mRNA, and rRNA. In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of ncRNA, and lncRNA. In some more preferred embodiments, the target sequence may be a sequence within an mRNA molecule or a pre-mRNA molecule.

    PAM and PFS Elements

    [0165] PAM elements are sequences that can be recognized and bound by Cas proteins. Cas proteins/effector complexes can then unwind the dsDNA at a position adjacent to the PAM element. It will be appreciated that Cas proteins and systems that include them that target RNA do not require PAM sequences (Marraffini et al. 2010. Nature. 463:568-571). Instead, many rely on PFSs, which are discussed elsewhere herein. In certain embodiments, the target sequence should be associated with a PAM (protospacer adjacent motif) or PFS (protospacer flanking sequence or site), that is, a short sequence recognized by the CRISPR complex. Depending on the nature of the CRISPR-Cas protein, the target sequence should be selected, such that its complementary sequence in the DNA duplex (also referred to herein as the non-target sequence) is upstream or downstream of the PAM. In the embodiments, the complementary sequence of the target sequence is downstream or 3 of the PAM or upstream or 5 of the PAM. The precise sequence and length requirements for the PAM differ depending on the Cas protein used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence). Examples of the natural PAM sequences for different Cas proteins are provided herein below and the skilled person will be able to identify further PAM sequences for use with a given Cas protein.

    [0166] The ability to recognize different PAM sequences depends on the Cas polypeptide(s) included in the system. See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517. Table A below shows several Cas polypeptides and the PAM sequence they recognize.

    TABLE-US-00001 TABLEA ExamplePAMSequences CasProtein PAMSequence SpCas9 NGG/NRG SaCas9 NGRRTorNGRRN NmeCas9 NNNNGATT CjCas9 NNNNRYAC StCas9 NNAGAAW Cas12a(Cpf1)(including TTTV LbCpf1andAsCpf1) Cas12b(C2c1) TTT,TTA,andTTC Cas12c(C2c3) TA Cas12d(CasY) TA Cas12e(CasX) 5-TTCN-3

    [0167] In a preferred embodiment, the CRISPR effector protein may recognize a 3 PAM. In certain embodiments, the CRISPR effector protein may recognize a 3 PAM which is 5H, wherein H is A, C or U.

    [0168] Further, engineering of the PAM Interacting (PI) domain on the Cas protein may allow programing of PAM specificity, improve target site recognition fidelity, and increase the versatility of the CRISPR-Cas protein, for example as described for Cas9 in Kleinstiver B P et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. 2015 Jul. 23; 523(7561):481-5. doi: 10.1038/nature14592. As further detailed herein, the skilled person will understand that Cas13 proteins may be modified analogously. Gao et al, Engineered Cpf1 Enzymes with Altered PAM Specificities, bioRxiv 091611; doi: dx.doi.org/10.1101/091611 (Dec. 4, 2016). Doench et al. created a pool of sgRNAs, tiling across all possible target sites of a panel of six endogenous mouse and three endogenous human genes and quantitatively assessed their ability to produce null alleles of their target gene by antibody staining and flow cytometry. The authors showed that optimization of the PAM improved activity and also provided an on-line tool for designing sgRNAs.

    [0169] PAM sequences can be identified in a polynucleotide using an appropriate design tool, which are commercially available as well as online. Such freely available tools include, but are not limited to, CRISPRFinder and CRISPRTarget. Mojica et al. 2009. Microbiol. 155(Pt. 3):733-740; Atschul et al. 1990. J. Mol. Biol. 215:403-410; Biswass et al. 2013 RNA Biol. 10:817-827; and Grissa et al. 2007. Nucleic Acid Res. 35:W52-57. Experimental approaches to PAM identification can include, but are not limited to, plasmid depletion assays (Jiang et al. 2013. Nat. Biotechnol. 31:233-239; Esvelt et al. 2013. Nat. Methods. 10:1116-1121; Kleinstiver et al. 2015. Nature. 523:481-485), screened by a high-throughput in vivo model called PAM-SCNAR (Pattanayak et al. 2013. Nat. Biotechnol. 31:839-843 and Leenay et al. 2016. Mol. Cell. 16:253), and negative screening (Zetsche et al. 2015. Cell. 163:759-771).

    [0170] As previously mentioned, CRISPR-Cas systems that target RNA do not typically rely on PAM sequences. Instead, such systems typically recognize protospacer flanking sites (PFSs) instead of PAMs Thus, Type VI CRISPR-Cas systems typically recognize protospacer flanking sites (PFSs) instead of PAMs. PFSs represents an analogue to PAMs for RNA targets. Type VI CRISPR-Cas systems employ a Cas13. Some Cas13 proteins analyzed to date, such as Cas13a (C2c2) identified from Leptotrichia shahii (LShCAsl3a) have a specific discrimination against G at the 3end of the target RNA. The presence of a C at the corresponding crRNA repeat site can indicate that nucleotide pairing at this position is rejected. However, some Cas13 proteins (e.g., LwaCAsl3a and PspCas13b) do not seem to have a PFS preference. See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517.

    [0171] Some Type VI proteins, such as subtype B, have 5-recognition of D (G, T, A) and a 3-motif requirement of NAN or NNA. One example is the Cas13b protein identified in Bergeyella zoohelcum (BzCas13b). See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517.

    [0172] Overall Type VI CRISPR-Cas systems appear to have less restrictive rules for substrate (e.g., target sequence) recognition than those that target DNA (e.g., Type V and type II).

    IscBs

    [0173] In some embodiments, the nucleic acid-guided nucleases herein may be an IscB protein. An IscB protein may comprise an X domain and a Y domain as described herein. In some examples, the IscB proteins may form a complex with one or more guide molecules. In some cases, the IscB proteins may form a complex with one or more hRNA molecules which serve as a scaffold molecule and comprise guide sequences. In some examples, the IscB proteins are CRISPR-associated proteins, e.g., the loci of the nucleases are associated with an CRISPR array. In some examples, the IscB proteins are not CRISPR-associated.

    [0174] In some examples, the IscB protein may be homolog or ortholog of IscB proteins described in Kapitonov V V et al., ISC, a Novel Group of Bacterial and Archaeal DNA Transposons That Encode Cas9 Homologs, J Bacteriol. 2015 Dec. 28; 198(5):797-807. doi: 10.1128/JB.00783-15, which is incorporated by reference herein in its entirety.

    [0175] In some embodiments, the IscBs may comprise one or more domains, e.g., one or more of a X domain (e.g., at N-terminus), a RuvC domain, a Bridge Helix domain, and a Y domain (e.g., at C-terminus). In some examples, the nucleic-acid guided nuclease comprises an N-terminal X domain, a RuvC domain (e.g., including a RuvC-I, RuvC-II, and RuvC-III subdomains), a Bridge Helix domain, and a C-terminal Y domain. In some examples, the nucleic-acid guided nuclease comprises In some examples, the nucleic-acid guided nuclease comprises an N-terminal X domain, a RuvC domain (e.g., including a RuvC-I, RuvC-II, and RuvC-III subdomains), a Bridge Helix domain, an HNH domain, and a C-terminal Y domain.

    [0176] In some embodiments, the nucleic acid-guided nucleases may have a small size. For example, the nucleic acid-guided nucleases may be no more than 50, no more than 100, no more than 150, no more than 200, no more than 250, no more than 300, no more than 350, no more than 400, no more than 450, no more than 500, no more than 550, no more than 600, no more than 650, no more than 700, no more than 750, no more than 800, no more than 850, no more than 900, no more than 950, or no more than 1000 amino acids in length.

    [0177] In some examples, the IscB protein shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with a IscB protein selected from Table 1.

    TABLE-US-00002 TABLE1 No. Proteins Sequences 1 IscB(?HNH) 1 mstdatlirttpshaeadatdtlvatplmpprrvispwpgpgegqslmripvvdirgmal EFH81386 61 mpctpakarhllksgnarpkrnklglfyvqlsyeqepdnqslvagvdpgskfeglsvvgt 121 kdtvlnlmveapdhvkgavqtrrtmrrarrqrkwrrpkrfhnrlnrmqrippstrsrwea 181 karivahlrtilpftdvvvedvqavtrkgkggtwngsfspvqvgkehlyrllramgltlh 241 lregwqtkelreqhglkktkskskqsfeshavdswvlaasisgaehptctrlwymvpail 301 hrrqlhrlqaskggvrkpyggtrslgvkrgtlvehkkygrctvggvdrkrntislheyrt 361 ntrltqaakvetcrvltwlswrswllrgkrtsskgkgshss(SEQIDNO:1) 2 IscB(+HNH) 1 mqpakqqnwvfqingdkqpldminpgrcrelqnrgklasfrrfpyvviqqqtienpqtke TAE54104.1 61 yilkidpgsqwtgfaiqcgndilfraelnhrgeaikfdlvkrawfrrgrrsrnlryrkkr 121 lnrakpegwlapsirhrvltvetwikrfmrycpiawieieqvrfdtqklanpeidgveyq 181 qgelqgyevreyllqkwgrkcaycgtenvplevehiqskskggssrignltlachvcnvk 241 kgnldvrdflakspdilngvlenstkplkdaaavnstryaivkmaksicenvkcssgart 301 kmnrvrqglekthsldaacvgesgasirvltdrpllitckghgsrqsirvnasgfpavkn 361 aktvfthiaagdvvrftigkdrkkaqagtytarvktptpkgfevlidgarislstmsnvv 421 fvhrsdgygyel(SEQIDNO:2) 3 IscB(+HNH) 1 mavfvidkhkrplmpcsekrarlllergravvhrqvpfvirlkdrtvqhsavqplrvald WP_038093640.1 61 pgsratgmalvrekntvdtgtgevyrerialnlfelvhrghrireqldqrrnfrrrrrga 121 nlryraprfdnrrrppgwlapslqhrvdttmawvrrlerwapasaigietvrfdtqrlqn 181 peisgveyqqgalagcevreyllekwgrkcaycgaenvpleiehivpksrggsdrvsnla 241 lacracnqakgnrdvrafladqperlarilaqakaplkdaaavnatrwalyralvdtglp 301 veagtggrtkwnrtrlglpkthaldalcvgqvdqvrhwrvpvlgircagrgsyrrtrltr 361 hgfprgyltrnksafgfqtgdliravvtkgkkagtylgriairasgsfniqtpmgvvqgi 421 hhrfctllqradgygyfvqpkpteaalssprlkagvssagn(SEQIDNO:3) 4 IscB(+HNH) 1 mttnvvfvidtnqkplqpcsaavarklllrgkaamfrrypaviilkkevdsvgkpkielr WP_052490348.1 61 idpgskytgfalvdskdnadfiiwgtelehrgaaickeltkrsairrsrrnrktryrkkr 121 ferrkpegwlapslqhrvdttltwvkrickfvpimsisveqvkfdlqklensdiqgieyq 181 qgtlagytlreallehwgrkcaycdvenvfleiehiypkskggsdkfsnltlachkcnin 241 kgnksidefllsdhkrleqiklhqkktlkdaaavnatrkklvttlqektflnvlvsdgas 301 tkmtrlssslakrhwidagcvnttlivilktlqplqvkcnghgnkqfvtmdaygfprksy 361 epkkvrkdwkagdiirvtkkdgtmlmgrvkkaakklvyipfggkeasfssenakaihrsd 421 gyrysfaaidsellqkmat(SEQIDNO:4) 5 IscB(+HNH) 1 mpnkyafvldskgklldptkskkawylirkgkaslveeypliiklkrevpkdqvnsdkli WP_015325818.1 61 lgiddgtkkvgfalvqkcqtknkvlfkavmeqrqdvskkmeerrgyrryrrshkryrpar 121 fdnrssskrkgrippsilqkkqailrvvnklkkyiridkivledvsidirkltegrelyn 181 weyqesnrldenlrkatlyrddctcqlegttetmlhahhimprrdggadsiynlitlcka 241 chkdkvdnneyqykdqflaiidskelsdlksashvmqgktwlrdklskiaqleitsggnt 301 ankridyeiekshsndaicttgllpvdniddikeyyikplrkkskakikelkcfrqrdlv 361 kytkrngetytgyitslriknnkynskvenfstlkgkifrgygfrnltllnrpkglmiv (SEQIDNO:5) 6 sp|G3ECR1|CAS9_ 1 mlfnkciiisinldfsnkekcmtkpysigldigtnsvgwavitdnykvpskkmkvlgnts STRTR 61 kkyikknllgvllfdsgitaegrrlkrtarrrytrrrnrilylqeifstematlddaffq 121 rlddsflvpddkrdskypifgnlveekvyhdefptiyhlrkyladstkkadlrlvylala 181 hmikyrghfliegefnsknndiqknfqdfldtynaifesdlslenskqleeivkdkiskl 241 ekkdrilklfpgeknsgifseflklivgnqadfrkcfnldekaslhfskesydedletll 301 gyigddysdvflkakklydaillsgfltvtdneteaplssamikrynehkedlallkeyi 361 rnislktynevfkddtkngyagyidgktnqedfyvylknllaefegadyflekidredfl 421 rkqrtfdngsipyqihlqemraildkqakfypflaknkeriekiltfripyyvgplargn 481 sdfawsirkrnekitpwnfedvidkessaeafinrmtsfdlylpeekvlpkhsllyetfn 541 vyneltkvrfiaesmrdyqfldskqkkdivrlyfkdkrkvtdkdiieylhaiygydgiel 601 kgiekqfnsslstyhdllniindkeflddssneaiieeiihtltifedremikqrlskfe 661 nifdksvlkklsrrhytgwgklsaklingirdeksgntildyliddgisnrnfmqlihdd 721 alsfkkkiqkaqiigdedkgnikevvkslpgspaikkgilqsikivdelvkvmggrkpes 781 ivvemarenqytnqgksnsqqrlkrlekslkelgskilkenipaklskidnnalqndrly 841 lyylqngkdmytgddldidrlsnydidhiipqaflkdnsidnkvlvssasnrgksddfps 901 levvkkrktfwyqllksklisqrkfdnltkaerggllpedkagfiqrqlvetrqitkhva 961 rlldekfnnkkdennravrtvkiitlkstlvsqfrkdfelykvreindfhhahdaylnav 1021 iasallkkypklepefvygdypkynsfrerksatekvyfysnimnifkksisladgrvie 1081 rplievneetgesvwnkesdlatvrrvlsypqvnvvkkveeqnhgldrgkpkglfnanls 1141 skpkpnsnenlvgakeyldpkkyggyagisnsfavlvkgtiekgakkkitnvlefqgisi 1201 ldrinyrkdklnfllekgykdieliielpkyslfelsdgsrrmlasilstnnkrgeihkg 1261 nqiflsqkfvkllyhakrisntinenhrkyvenhkkefeelfyyilefnenyvgakkngk 1321 llnsafqswqnhsidelcssfigptgserkglfeltsrgsaadfeflgvkipryrdytps 1381 slikdatlihqsvtglyetridlaklgeg(SEQIDNO:6) 7 sp|J7RUA5|CAS9_ 1 mkrnyilgldigitsvgygiidyetrdvidagvrlfkeanvennegrrskrgarrlkrrr STAAU 61 rhriqrvkkllfdynlltdhselsginpyearvkglsqklseeefsaallhlakrrgvhn 121 vneveedtgnelstkeqisrnskaleekyvaelqlerlkkdgevrgsinrfktsdyvkea 181 kqllkvqkayhqldqsfidtyidlletrrtyyegpgegspfgwkdikewyemlmghctyf 241 peelrsvkyaynadlynalndlnnlvitrdenekleyyekfqiienvfkqkkkptlkqia 301 keilvneedikgyrvtstgkpeftnlkvyhdikditarkeiienaelldqiakiltiyqs 361 sediqeeltnlnseltqeeieqisnlkgytgthnlslkainlildelwhtndnqiaifnr 421 lklvpkkvdlsqqkeipttlvddfilspvvkrsfiqsikvinaiikkyglpndiiielar 481 eknskdagkminemqkrnrqtnerieeiirttgkenakyliekiklhdmqegkclyslea 541 ipledllnnpfnyevdhiiprsvsfdnsfnnkvlvkqeenskkgnrtpfqylsssdskis 601 yetfkkhilnlakgkgrisktkkeylleerdinrfsvqkdfinrnlvdtryatrglmnll 661 rsyfrvnnldvkvksinggftsflrrkwkfkkernkgykhhaedaliianadfifkewkk 721 ldkakkvmenqmfeekqaesmpeieteqeykeifitphqikhikdfkdykyshrvdkkpn 781 relindtlystrkddkgntlivnninglydkdndklkklinkspekllmyhhdpqtyqkl 841 klimeqygdeknplykyyeetgnyltkyskkdngpvikkikyygnklnahlditddypns 901 rnkvvklslkpyrfdvyldngvykfvtvknldvikkenyyevnskcyeeakklkkisnqa 961 efiasfynndlikingelyrvigvnndllnrievnmidityreylenmndkrppriikti 1021 asktqsikkystdilgnlyevkskkhpgiikkg(SEQIDNO:7) 8 Streptococcus_ 1 kysigldigtnsvgwavitdeykvpskkfkvlgntdrhsikknligallfdsgetaeatr pyogenes_SF370 61 lkrtarrrytrrknricylqeifsnemakvddsffhrleesflveedkkherhpifgniv 121 devayhekyptiyhlrkklvdstdkadlrliylalahmikfrghfliegdlnpdnsdvdk 181 lfiqlvqtynqlfeenpinasgvdakailsarlsksrrlenliaqlpgekknglfgnlia 241 lslgltpnfksnfdlaedaklqlskdtydddldnllaqigdqyadlflaaknlsdaills 301 dilrvnteitkaplsasmikrydehhqdltllkalvrqqlpekykeiffdqskngyagyi 361 dggasqeefykfikpilekmdgteellvklnredllrkqrtfdngsiphqihlgelhail 421 rrqedfypflkdnrekiekiltfripyyvgplargnsrfawmtrkseetitpwnfeevvd 481 kgasaqsfiermtnfdknlpnekvlpkhsllyeyftvyneltkvkyvtegmrkpaflsge 541 qkkaivdllfktnrkvtvkqlkedyfkkiecfdsveisgvedrfnaslgtyhdllkiikd 601 kdfldneenediledivltltlfedremieerlktyahlfddkvmkqlkrrrytgwgrls 661 rklingirdkqsgktildflksdgfanrnfmqlihddsltfkediqkaqvsgqgdslheh 721 ianlagspaikkgilqtvkvvdelvkvmgrhkpeniviemarenqttqkgqknsrermkr 781 ieegikelgsqilkehpventqlqneklylyylqngrdmyvdqeldinrlsdydvdhivp 841 qsflkddsidnkvltrsdknrgksdnvpseevvkkmknywrqllnaklitqrkfdnltka 901 ergglseldkagfikrqlvetrqitkhvaqildsrmntkydendklirevkvitlksklv 961 sdfrkdfqfykvreinnyhhahdaylnavvgtalikkypklesefvygdykvydvrkmia 1021 kseqeigkatakyffysnimnffkteitlangeirkrplietngetgeivwdkgrdfatv 1081 rkvlsmpqvnivkktevqtggfskesilpkrnsdkliarkkdwdpkkyggfdsptvaysv 1141 lvvakvekgkskklksvkellgitimerssfeknpidfleakgykevkkdliiklpkysl 1201 felengrkrmlasagelqkgnelalpskyvnflylashyeklkgspedneqkqlfveqhk 1261 hyldeiieqisefskrviladanldkvlsaynkhrdkpireqaeniihlftltnlgapaa 1321 fkyfdttidrkrytstkevldatlihqsitglyetridlsglggd(SEQIDNO:8) No. Proteins Domainsandaminoacidpositions 1 IscB(?HNH) Xdomain:51-97 EFH81386 RuvC-I:104-118 BridgeHelix:140-160 RuvC-II:169-212 RuvC-III:226-278 2 IscB(+HNH) Xdomain:11-56 TAE54104.1 RuvC-I:63-77 BridgeHelix:100-121 RuvC-II:129-172 HNH:211-243 RuvC-III:279-321 3 IscB(+HNH) Xdomain:4-50 WP_038093640.1 RuvC-I:57-71 BridgeHelix:108-129 RuvC-II:138-181 HNH:220-252 RuvC-III:288-330 4 IscB(+HNH) Xdomain:7-52 WP_052490348.1 RuvC-I:59-73 BridgeHelix:100-121 RuvC-II:129-172 HNH:211-243 RuvC-III:279-322 5 IscB(+HNH) Xdomain:7-52 WP_015325818.1 RuvC-I:61-75 BridgeHelix:101-121 RuvC-II:132-175 HNH:215-247 RuvC-III:284-327 6 sp|G3ECR1|CAS9_ RuvC-I:28-42 STRTR BridgeHelix:85-108 Rec:118-736 RuvC-II:750-799 HNH:864-896 RuvC-III:957-1019 PAMInteraction(PI):1119-1409 7 sp|J7RUA5|CAS9_ RuvC-I:7-21 STAAU BridgeHelix:49-72 Rec:80-433 RuvC-II:445-493 HNH:553-585 RuvC-III:654-709 PAMInteraction(PI):789-1053 8 Streptococcus_ RuvC-I:4-18 pyogenes_SF370 BridgeHelix:61-84 Rec:94-718 RuvC-II:725-774 HNH:833-865 RuvC-III:926-988 PAMInteraction(PI):1099-1365

    X Domains

    [0178] In some embodiments, the IscB proteins comprise an X domain, e.g., at its N-terminal.

    [0179] In certain embodiments, the X domain include the X domains in Table 1. Examples of the X domains also include any polypeptides a structural similarity and/or sequence similarity to a X domain described in the art. In some examples, the X domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 50%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with X domains in Table 1.

    [0180] In some examples, the X domain may be no more than 10, no more than 20, no more than 30, no more than 40, no more than 50, no more than 60, no more than 70, no more than 80, no more than 90, or no more than 100 amino acids in length. For example, the X domain may be no more than 50 amino acids in length, such as comprising 2 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids in length.

    Y Domain

    [0181] In some embodiments, the IscB proteins comprise a Y domain, e.g., at its C-terminal.

    [0182] In certain embodiments, the X domain include Y domains in Table 1. Examples of the Y domain also include any polypeptides a structural similarity and/or sequence similarity to a Y domain described in the art. In some examples, the Y domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with Y domains in Table 1.

    RuvC Domain

    [0183] In some embodiments, the IscB proteins comprises at least one nuclease domain. In certain embodiments, the IscB proteins comprise at least two nuclease domains. In certain embodiments, the one or more nuclease domains are only active upon presence of a cofactor. In certain embodiments, the cofactor is Magnesium (Mg). In embodiments where more than one nuclease domain is present and the substrate is a double-strand polynucleotide, the nuclease domains each cleave a different strand of the double-strand polynucleotide. In certain embodiments, the nuclease domain is a RuvC domain.

    [0184] The IscB proteins may comprise a RuvC domain. The RuvC domain may comprise multiple subdomains, e.g., RuvC-I, RuvC-II and RuvC-III. The subdomains may be separated by interval sequences on the amino acid sequence of the protein.

    [0185] In certain embodiments, examples of the RuvC domain include those in Table 1. Examples of the RuvC domain also include any polypeptides a structural similarity and/or sequence similarity to a RuvC domain described in the art. For example, the RuvC domain may share a structural similarity and/or sequence similarity to a RuvC of Cas9. In some examples, the RuvC domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with RuvC domains in Table 1.

    Bridge Helix

    [0186] The IscB proteins comprise abridge helix (BH) domain. The bridge helix domain refers to a helix and arginine rich polypeptide. The bridge helix domain may be located next to anyone of the amino acid domains in the nucleic-acid guided nuclease. In some embodiments, the bridge helix domain is next to a RuvC domain, e.g., next to RuvC-I, RuvC-II, or RuvC-III subdomain. In one example, the bridge helix domain is between a RuvC-1 and RuvC2 subdomains.

    [0187] The bridge helix domain may be from 10 to 100, from 20 to 60, from 30 to 50, e.g., 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46 or 47, 48, 49, or 50 amino acids in length. Examples of bridge helix includes the polypeptide of amino acids 60-93 of the sequence of S. pyogenes Cas9.

    [0188] In certain embodiments, examples of the BH domain include those in Table 1. Examples of the BH domain also include any polypeptides a structural similarity and/or sequence similarity to a BH domain described in the art. For example, the BH domain may share a structural similarity and/or sequence similarity to a BH domain of Cas9. In some examples, the BH domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with BH domains in Table 1.

    HNH Domain

    [0189] The IscB proteins comprise an HNH domain. In certain embodiments, at least one nuclease domain shares a substantial structural similarity or sequence similarity to a HNH domain described in the art.

    [0190] In some examples, the nucleic acid-guided nuclease comprises a HNH domain and a RuvC domain. In the cases where the RuvC domain comprises RuvC-I, RuvC-II, and RuvC-III domain, the HNH domain may be located between the Ruv C II and RuvC III subdomains of the RuvC domain.

    [0191] In certain embodiments, examples of the HNH domain include those in Table 1. Examples of the HNH domain also include any polypeptides a structural similarity and/or sequence similarity to a HNH domain described in the art. For example, the HNH domain may share a structural similarity and/or sequence similarity to a HNH domain of Cas9. In some examples, the HNH domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with HNH domains in Table 1.

    hRNA

    [0192] In some examples, the IscB proteins capable of forming a complex with one or more hRNA molecules. The hRNA complex can comprise a guide sequence and a scaffold that interacts with the IscB polypeptide. An hRNA molecules may form a complex with an IscB polypeptide nuclease or IscB polypeptide and direct the complex to bind with a target sequence. In certain example embodiments, the hRNA molecule is a single molecule comprising a scaffold sequence and a spacer sequence. In certain example embodiments, the spacer is 5 of the scaffold sequence. In certain example embodiments, the hRNA molecule may further comprise a conserved nucleic acid sequence between the scaffold and spacer portions.

    [0193] As used herein, a heterologous hRNA molecule is an hRNA molecule that is not derived from the same species as the IscB polypeptide nuclease, or comprises a portion of the molecule, e.g., spacer, that is not derived from the same species as the IscB polypeptide nuclease, e.g., IscB protein. For example, a heterologous hRNA molecule of a IscB polypeptide nuclease derived from species A comprises a polynucleotide derived from a species different from species A, or an artificial polynucleotide.

    Zinc Finger Nucleases

    [0194] In some embodiments, the polynucleotide is modified using a Zinc Finger nuclease or system thereof. One type of programmable DNA-binding domain is provided by artificial zinc-finger (ZF) technology, which involves arrays of ZF modules to target new DNA-binding sites in the genome. Each finger module in a ZF array targets three DNA bases. A customized array of individual zinc finger domains is assembled into a ZF protein (ZFP).

    [0195] ZFPs can comprise a functional domain. The first synthetic zinc finger nucleases (ZFNs) were developed by fusing a ZF protein to the catalytic domain of the Type IIS restriction enzyme FokI. (Kim, Y. G. et al., 1994, Chimeric restriction endonuclease, Proc. Natl. Acad. Sci. U.S.A. 91, 883-887; Kim, Y. G. et al., 1996, Hybrid restriction enzymes: zinc finger fusions to Fok I cleavage domain. Proc. Natl. Acad. Sci. U.S.A. 93, 1156-1160). Increased cleavage specificity can be attained with decreased off target activity by use of paired ZFN heterodimers, each targeting different nucleotide sequences separated by a short spacer. (Doyon, Y. et al., 2011, Enhancing zinc-finger-nuclease activity with improved obligate heterodimeric architectures. Nat. Methods 8, 74-79). ZFPs can also be designed as transcription activators and repressors and have been used to target many genes in a wide variety of organisms. Exemplary methods of genome editing using ZFNs can be found for example in U.S. Pat. Nos. 6,534,261, 6,607,882, 6,746,838, 6,794,136, 6,824,978, 6,866,997, 6,933,113, 6,979,539, 7,013,219, 7,030,215, 7,220,719, 7,241,573, 7,241,574, 7,585,849, 7,595,376, 6,903,185, and 6,479,626, all of which are specifically incorporated by reference.

    TALE Nucleases

    [0196] In some embodiments, a TALE nuclease or TALE nuclease system can be used to modify a polynucleotide. In some embodiments, the methods provided herein use isolated, non-naturally occurring, recombinant or engineered DNA binding proteins that comprise TALE monomers or TALE monomers or half monomers as a part of their organizational structure that enable the targeting of nucleic acid sequences with improved efficiency and expanded specificity.

    [0197] Naturally occurring TALEs or wild type TALEs are nucleic acid binding proteins secreted by numerous species of proteobacteria. TALE polypeptides contain a nucleic acid binding domain composed of tandem repeats of highly conserved monomer polypeptides that are predominantly 33, 34 or 35 amino acids in length and that differ from each other mainly in amino acid positions 12 and 13. In advantageous embodiments the nucleic acid is DNA. As used herein, the term polypeptide monomers, TALE monomers or monomers will be used to refer to the highly conserved repetitive polypeptide sequences within the TALE nucleic acid binding domain and the term repeat variable di-residues or RVD will be used to refer to the highly variable amino acids at positions 12 and 13 of the polypeptide monomers. As provided throughout the disclosure, the amino acid residues of the RVD are depicted using the IUPAC single letter code for amino acids. A general representation of a TALE monomer which is comprised within the DNA binding domain is X.sub.1-11-(X.sub.12X.sub.13)-X.sub.1-33 or 34 or 35, where the subscript indicates the amino acid position and X represents any amino acid. X.sub.12X.sub.13 indicate the RVDs. In some polypeptide monomers, the variable amino acid at position 13 is missing or absent and in such monomers, the RVD consists of a single amino acid. In such cases the RVD may be alternatively represented as X*, where X represents X.sub.12 and (*) indicates that X.sub.13 is absent. The DNA binding domain comprises several repeats of TALE monomers and this may be represented as (X.sub.1-11-(X.sub.12X.sub.13)-X.sub.14-33 or 34 or 35).sub.z, where in an advantageous embodiment, z is at least 5 to 40. In a further advantageous embodiment, z is at least 10 to 26.

    [0198] The TALE monomers can have a nucleotide binding affinity that is determined by the identity of the amino acids in its RVD. For example, polypeptide monomers with an RVD of NI can preferentially bind to adenine (A), monomers with an RVD of NG can preferentially bind to thymine (T), monomers with an RVD of HD can preferentially bind to cytosine (C) and monomers with an RVD of NN can preferentially bind to both adenine (A) and guanine (G). In some embodiments, monomers with an RVD of IG can preferentially bind to T. Thus, the number and order of the polypeptide monomer repeats in the nucleic acid binding domain of a TALE determines its nucleic acid target specificity. In some embodiments, monomers with an RVD of NS can recognize all four base pairs and can bind to A, T, G or C. The structure and function of TALEs is further described in, for example, Moscou et al., Science 326:1501 (2009); Boch et al., Science 326:1509-1512 (2009); and Zhang et al., Nature Biotechnology 29:149-153 (2011).

    [0199] The polypeptides used in methods of the invention can be isolated, non-naturally occurring, recombinant or engineered nucleic acid-binding proteins that have nucleic acid or DNA binding regions containing polypeptide monomer repeats that are designed to target specific nucleic acid sequences.

    [0200] As described herein, polypeptide monomers having an RVD of HN or NH preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In some embodiments, polypeptide monomers having RVDs RN, NN, NK, SN, NH, KN, HN, NQ, HH, RG, KH, RH and SS can preferentially bind to guanine. In some embodiments, polypeptide monomers having RVDs RN, NK, NQ, HH, KH, RH, SS and SN can preferentially bind to guanine and can thus allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In some embodiments, polypeptide monomers having RVDs HH, KH, NH, NK, NQ, RH, RN and SS can preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In some embodiments, the RVDs that have high binding specificity for guanine are RN, NH RH and KH. Furthermore, polypeptide monomers having an RVD of NV can preferentially bind to adenine and guanine. In some embodiments, monomers having RVDs of H*, HA, KA, N*, NA, NC, NS, RA, and S* bind to adenine, guanine, cytosine and thymine with comparable affinity.

    [0201] The predetermined N-terminal to C-terminal order of the one or more polypeptide monomers of the nucleic acid or DNA binding domain determines the corresponding predetermined target nucleic acid sequence to which the polypeptides of the invention will bind. As used herein the monomers and at least one or more half monomers are specifically ordered to target the genomic locus or gene of interest. In plant genomes, the natural TALE-binding sites always begin with a thymine (T), which may be specified by a cryptic signal within the non-repetitive N-terminus of the TALE polypeptide; in some cases, this region may be referred to as repeat 0. In animal genomes, TALE binding sites do not necessarily have to begin with a thymine (T) and polypeptides of the invention may target DNA sequences that begin with T, A, G or C. The tandem repeat of TALE monomers always ends with a half-length repeat or a stretch of sequence that may share identity with only the first 20 amino acids of a repetitive full-length TALE monomer and this half repeat may be referred to as a half-monomer. Therefore, it follows that the length of the nucleic acid or DNA being targeted is equal to the number of full monomers plus two.

    [0202] As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), TALE polypeptide binding efficiency may be increased by including amino acid sequences from the capping regions that are directly N-terminal or C-terminal of the DNA binding region of naturally occurring TALEs into the engineered TALEs at positions N-terminal or C-terminal of the engineered TALE DNA binding region. Thus, in certain embodiments, the TALE polypeptides described herein further comprise an N-terminal capping region and/or a C-terminal capping region.

    [0203] An exemplary amino acid sequence of a N-terminal capping region is:

    TABLE-US-00003 (SEQIDNO:9) MDPIRSRTPSPARELLSGPQPDGVQPTADRGVSPPAGGP LDGLPARRTMSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLENTS LFDSLPPFGAHHTEAATGEWDEVQSGLRAADAPPPTMRVAVTA ARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKP KVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTVAVKYQD MIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQL DTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLN

    [0204] An exemplary amino acid sequence of a C-terminal capping region is:

    TABLE-US-00004 (SEQIDNO:10) RPALESIVAQLSRPDPALAALTNDHLVALACLGGRPAL DAVKKGLPHAPALIKRTNRRIPERTSHRVADHAQVVRVLGFFQ CHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLP PASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERD LDAPSPMHEGDQTRAS

    [0205] As used herein the predetermined N-terminus to C terminus orientation of the N-terminal capping region, the DNA binding domain comprising the repeat TALE monomers and the C-terminal capping region provide structural basis for the organization of different domains in the d-TALEs or polypeptides of the invention.

    [0206] The entire N-terminal and/or C-terminal capping regions are not necessary to enhance the binding activity of the DNA binding region. Therefore, in certain embodiments, fragments of the N-terminal and/or C-terminal capping regions are included in the TALE polypeptides described herein.

    [0207] In certain embodiments, the TALE polypeptides described herein contain a N-terminal capping region fragment that included at least 10, 20, 30, 40, 50, 54, 60, 70, 80, 87, 90, 94, 100, 102, 110, 117, 120, 130, 140, 147, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260 or 270 amino acids of an N-terminal capping region. In certain embodiments, the N-terminal capping region fragment amino acids are of the C-terminus (the DNA-binding region proximal end) of an N-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), N-terminal capping region fragments that include the C-terminal 240 amino acids enhance binding activity equal to the full length capping region, while fragments that include the C-terminal 147 amino acids retain greater than 80% of the efficacy of the full length capping region, and fragments that include the C-terminal 117 amino acids retain greater than 50% of the activity of the full-length capping region.

    [0208] In some embodiments, the TALE polypeptides described herein contain a C-terminal capping region fragment that included at least 6, 10, 20, 30, 37, 40, 50, 60, 68, 70, 80, 90, 100, 110, 120, 127, 130, 140, 150, 155, 160, 170, 180 amino acids of a C-terminal capping region. In certain embodiments, the C-terminal capping region fragment amino acids are of the N-terminus (the DNA-binding region proximal end) of a C-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), C-terminal capping region fragments that include the C-terminal 68 amino acids enhance binding activity equal to the full-length capping region, while fragments that include the C-terminal 20 amino acids retain greater than 50% of the efficacy of the full-length capping region.

    [0209] In certain embodiments, the capping regions of the TALE polypeptides described herein do not need to have identical sequences to the capping region sequences provided herein. Thus, in some embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical or share identity to the capping region amino acid sequences provided herein. Sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. In some preferred embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.

    [0210] Sequence homologies can be generated by any of a number of computer programs known in the art, which include but are not limited to BLAST or FASTA. Suitable computer programs for carrying out alignments like the GCG Wisconsin Bestfit package may also be used. Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.

    [0211] In some embodiments described herein, the TALE polypeptides of the invention include a nucleic acid binding domain linked to the one or more effector domains. The terms effector domain or regulatory and functional domain refer to a polypeptide sequence that has an activity other than binding to the nucleic acid sequence recognized by the nucleic acid binding domain. By combining a nucleic acid binding domain with one or more effector domains, the polypeptides of the invention may be used to target the one or more functions or activities mediated by the effector domain to a particular target DNA sequence to which the nucleic acid binding domain specifically binds.

    [0212] In some embodiments of the TALE polypeptides described herein, the activity mediated by the effector domain is a biological activity. For example, in some embodiments the effector domain is a transcriptional inhibitor (i.e., a repressor domain), such as an mSin interaction domain (SID). SID4X domain or a Kruppel-associated box (KRAB) or fragments of the KRAB domain. In some embodiments the effector domain is an enhancer of transcription (i.e., an activation domain), such as the VP16, VP64 or p65 activation domain. In some embodiments, the nucleic acid binding is linked, for example, with an effector domain that includes but is not limited to a transposase, integrase, recombinase, resolvase, invertase, protease, DNA methyltransferase, DNA demethylase, histone acetylase, histone deacetylase, nuclease, transcriptional repressor, transcriptional activator, transcription factor recruiting, protein nuclear-localization signal or cellular uptake signal.

    [0213] In some embodiments, the effector domain is a protein domain which exhibits activities which include but are not limited to transposase activity, integrase activity, recombinase activity, resolvase activity, invertase activity, protease activity, DNA methyltransferase activity, DNA demethylase activity, histone acetylase activity, histone deacetylase activity, nuclease activity, nuclear-localization signaling activity, transcriptional repressor activity, transcriptional activator activity, transcription factor recruiting activity, or cellular uptake signaling activity. Other preferred embodiments of the invention may include any combination of the activities described herein.

    Meganucleases

    [0214] In some embodiments, a meganuclease or system thereof can be used to modify a polynucleotide. Meganucleases, which are endodeoxyribonucleases characterized by a large recognition site (double-stranded DNA sequences of 12 to 40 base pairs). Exemplary methods for using meganucleases can be found in U.S. Pat. Nos. 8,163,514, 8,133,697, 8,021,867, 8,119,361, 8,119,381, 8,124,369, and 8,129,134, which are specifically incorporated by reference.

    Sequences Related to Nucleus Targeting and Transportation

    [0215] In some embodiments, one or more components (e.g., the Cas protein and/or deaminase, Zn Finger protein, TALE, or meganuclease) in the composition for engineering cells may comprise one or more sequences related to nucleus targeting and transportation. Such sequence may facilitate the one or more components in the composition for targeting a sequence within a cell. In order to improve targeting of the CRISPR-Cas protein and/or the nucleotide deaminase protein or catalytic domain thereof used in the methods of the present disclosure to the nucleus, it may be advantageous to provide one or both of these components with one or more nuclear localization sequences (NLSs).

    [0216] In some embodiments, the NLSs used in the context of the present disclosure are heterologous to the proteins. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 11) or PKKKRKVEAS (SEQ ID NO: 12); the NLS from nucleoplasmin (e.g., the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 13)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 14) or RQRRNELKRSP (SEQ ID NO: 15); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 16); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 17) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 18) and PPKKARED (SEQ ID NO: 19) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 20) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 21) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 22) and PKQKKRK (SEQ ID NO: 23) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 24) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 25) of the mouse Mxl protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 26) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 27) of the steroid hormone receptors (human) glucocorticoid. In general, the one or more NLSs are of sufficient strength to drive accumulation of the DNA-targeting Cas protein in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR-Cas protein, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the nucleic acid-targeting protein, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g., a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of nucleic acid-targeting complex formation (e.g., assay for deaminase activity) at the target sequence, or assay for altered gene expression activity affected by DNA-targeting complex formation and/or DNA-targeting), as compared to a control not exposed to the CRISPR-Cas protein and deaminase protein, or exposed to a CRISPR-Cas and/or deaminase protein lacking the one or more NLSs.

    [0217] The CRISPR-Cas and/or nucleotide deaminase proteins may be provided with 1 or more, such as with, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more heterologous NLSs. In some embodiments, the proteins comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g., zero or at least one or more NLS at the amino-terminus and zero or at one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. In preferred embodiments of the CRISPR-Cas proteins, an NLS attached to the C-terminal of the protein.

    [0218] In certain embodiments, the CRISPR-Cas protein and the deaminase protein are delivered to the cell or expressed within the cell as separate proteins. In these embodiments, each of the CRISPR-Cas and deaminase protein can be provided with one or more NLSs as described herein. In certain embodiments, the CRISPR-Cas and deaminase proteins are delivered to the cell or expressed with the cell as a fusion protein. In these embodiments one or both of the CRISPR-Cas and deaminase protein is provided with one or more NLSs. Where the nucleotide deaminase is fused to an adaptor protein (such as MS2) as described above, the one or more NLS can be provided on the adaptor protein, provided that this does not interfere with aptamer binding. In particular embodiments, the one or more NLS sequences may also function as linker sequences between the nucleotide deaminase and the CRISPR-Cas protein.

    [0219] In certain embodiments, guides of the disclosure comprise specific binding sites (e.g. aptamers) for adapter proteins, which may be linked to or fused to an nucleotide deaminase or catalytic domain thereof. When such a guide forms a CRISPR complex (e.g., CRISPR-Cas protein binding to guide and target) the adapter proteins bind and, the nucleotide deaminase or catalytic domain thereof associated with the adapter protein is positioned in a spatial orientation which is advantageous for the attributed function to be effective.

    [0220] The skilled person will understand that modifications to the guide which allow for binding of the adapter+nucleotide deaminase, but not proper positioning of the adapter+nucleotide deaminase (e.g., due to steric hindrance within the three dimensional structure of the CRISPR complex) are modifications which are not intended. The one or more modified guide may be modified at the tetra loop, the stem loop 1, stem loop 2, or stem loop 3, as described herein, preferably at either the tetra loop or stem loop 2, and in some cases at both the tetra loop and stem loop 2.

    [0221] In some embodiments, a component (e.g., the dead Cas protein, the nucleotide deaminase protein or catalytic domain thereof, or a combination thereof) in the systems may comprise one or more nuclear export signals (NES), one or more nuclear localization signals (NLS), or any combinations thereof. In some cases, the NES may be an HIV Rev NES. In certain cases, the NES may be MAPK NES. When the component is a protein, the NES or NLS may be at the C terminus of component. Alternatively, or additionally, the NES or NLS may be at the N terminus of component. In some examples, the Cas protein and optionally said nucleotide deaminase protein or catalytic domain thereof comprise one or more heterologous nuclear export signal(s) (NES(s)) or nuclear localization signal(s) (NLS(s)), preferably an HIV Rev NES or MAPK NES, preferably C-terminal.

    Templates

    [0222] In some embodiments, the composition for engineering cells comprises a template, e.g., a recombination template. A template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide. In some embodiments, a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a nucleic acid-targeting effector protein as a part of a nucleic acid-targeting complex.

    [0223] In an embodiment, the template nucleic acid alters the sequence of the target position. In an embodiment, the template nucleic acid results in the incorporation of a modified, or non-naturally occurring base into the target nucleic acid.

    [0224] The template sequence may undergo a breakage mediated or catalyzed recombination with the target sequence. In an embodiment, the template nucleic acid may include sequence that corresponds to a site on the target sequence that is cleaved by a Cas protein mediated cleavage event. In an embodiment, the template nucleic acid may include sequence that corresponds to both, a first site on the target sequence that is cleaved in a first Cas protein mediated event, and a second site on the target sequence that is cleaved in a second Cas protein mediated event.

    [0225] In certain embodiments, the template nucleic acid can include sequence which results in an alteration in the coding sequence of a translated sequence, e.g., one which results in the substitution of one amino acid for another in a protein product, e.g., transforming a mutant allele into a wild type allele, transforming a wild type allele into a mutant allele, and/or introducing a stop codon, insertion of an amino acid residue, deletion of an amino acid residue, or a nonsense mutation. In certain embodiments, the template nucleic acid can include sequence which results in an alteration in a non-coding sequence, e.g., an alteration in an exon or in a 5 or 3 non-translated or non-transcribed region. Such alterations include an alteration in a control element, e.g., a promoter, enhancer, and an alteration in a cis-acting or trans-acting control element.

    [0226] A template nucleic acid having homology with a target position in a target gene may be used to alter the structure of a target sequence. The template sequence may be used to alter an unwanted structure, e.g., an unwanted or mutant nucleotide. The template nucleic acid may include sequence which, when integrated, results in: decreasing the activity of a positive control element; increasing the activity of a positive control element; decreasing the activity of a negative control element; increasing the activity of a negative control element; decreasing the expression of a gene; increasing the expression of a gene; increasing resistance to a disorder or disease; increasing resistance to viral entry; correcting a mutation or altering an unwanted amino acid residue conferring, increasing, abolishing or decreasing a biological property of a gene product, e.g., increasing the enzymatic activity of an enzyme, or increasing the ability of a gene product to interact with another molecule.

    [0227] The template nucleic acid may include sequence which results in: a change in sequence of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more nucleotides of the target sequence.

    [0228] A template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In an embodiment, the template nucleic acid may be 20+/?10, 30+/?10, 40+/?10, 50+/?10, 60+/?10, 70+/?10, 80+/?10, 90+/?10, 100+/?10, 1 10+/?10, 120+/?10, 130+/?10, 140+/?10, 150+/?10, 160+/?10, 170+/?10, 1 80+/?10, 190+/?10, 200+/?10, 210+/?10, of 220+/?10 nucleotides in length. In an embodiment, the template nucleic acid may be 30+/?20, 40+/?20, 50+/?20, 60+/?20, 70+/?20, 80+/?20, 90+/?20, 100+/?20, 1 10+/?20, 120+/?20, 130+/?20, 140+/?20, 150+/?20, 160+/?20, 170+/?20, 180+/?20, 190+/?20, 200+/?20, 210+/?20, of 220+/?20 nucleotides in length. In an embodiment, the template nucleic acid is 10 to 1,000, 20 to 900, 30 to 800, 40 to 700, 50 to 600, 50 to 500, 50 to 400, 50 to300, 50 to 200, or 50 to 100 nucleotides in length.

    [0229] In some embodiments, the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence. When optimally aligned, a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g., about or more than about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more nucleotides). In some embodiments, when a template sequence and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the template polynucleotide is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.

    [0230] The exogenous polynucleotide template comprises a sequence to be integrated (e.g., a mutated gene). The sequence for integration may be a sequence endogenous or exogenous to the cell. Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a microRNA). Thus, the sequence for integration may be operably linked to an appropriate control sequence or sequences. Alternatively, the sequence to be integrated may provide a regulatory function.

    [0231] An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000.

    [0232] An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000

    [0233] In certain embodiments, one or both homology arms may be shortened to avoid including certain sequence repeat elements. For example, a 5 homology arm may be shortened to avoid a sequence repeat element. In other embodiments, a 3 homology arm may be shortened to avoid a sequence repeat element. In some embodiments, both the 5 and the 3 homology arms may be shortened to avoid including certain sequence repeat elements.

    [0234] In some methods, the exogenous polynucleotide template may further comprise a marker. Such a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers. The exogenous polynucleotide template of the disclosure can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996).

    [0235] In certain embodiments, a template nucleic acid for correcting a mutation may be designed for use as a single-stranded oligonucleotide. When using a single-stranded oligonucleotide, 5 and 3 homology arms may range up to about 200 base pairs (bp) in length, e.g., at least 25, 50, 75, 100, 125, 150, 175, or 200 bp in length.

    [0236] In certain embodiments, a template nucleic acid for correcting a mutation may be designed for use with a homology-independent targeted integration system. Suzuki et al. describe in vivo genome editing via CRISPR/Cas9 mediated homology-independent targeted integration (2016, Nature 540:144-149). Schmid-Burgk, et al. describe use of the CRISPR-Cas9 system to introduce a double-strand break (DSB) at a user-defined genomic location and insertion of a universal donor DNA (Nat Commun. 2016 Jul. 28; 7:12338). Gao, et al. describe Plug-and-Play Protein Modification Using Homology-Independent Universal Genome Engineering (Neuron. 2019 Aug. 21; 103(4):583-597).

    RNAi

    [0237] In some embodiments, the genetic modulating agents may be interfering RNAs. In certain embodiments, diseases caused by a dominant mutation in a gene is targeted by silencing the mutated gene using RNAi. In some cases, the nucleotide sequence may comprise coding sequence for one or more interfering RNAs. In certain examples, the nucleotide sequence may be interfering RNA (RNAi). As used herein, the term RNAi refers to any type of interfering RNA, including but not limited to, siRNAi, shRNAi, endogenous microRNA and artificial microRNA. For instance, it includes sequences previously identified as siRNA, regardless of the mechanism of down-stream processing of the RNA (i.e., although siRNAs are believed to have a specific method of in vivo processing resulting in the cleavage of mRNA, such sequences can be incorporated into the vectors in the context of the flanking sequences described herein). The term RNAi can include both gene silencing RNAi molecules, and also RNAi effector molecules which activate the expression of a gene.

    [0238] In certain embodiments, a modulating agent may comprise silencing one or more endogenous genes. As used herein, gene silencing or gene silenced in reference to an activity of an RNAi molecule, for example a siRNA or miRNA refers to a decrease in the mRNA level in a cell for a target gene by at least about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 99%, about 100% of the mRNA level found in the cell without the presence of the miRNA or RNA interference molecule. In one preferred embodiment, the mRNA levels are decreased by at least about 70%, about 80%, about 90%, about 95%, about 99%, about 100%.

    [0239] As used herein, a siRNA refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to reduce or inhibit expression of a gene or target gene when the siRNA is present or expressed in the same cell as the target gene. The double stranded RNA siRNA can be formed by the complementary strands. In one embodiment, a siRNA refers to a nucleic acid that can form a double stranded siRNA. The sequence of the siRNA can correspond to the full-length target gene, or a subsequence thereof. Typically, the siRNA is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded siRNA is about 15-50 nucleotides in length, and the double stranded siRNA is about 15-50 base pairs in length, preferably about 19-30 base nucleotides, preferably about 20-25 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length).

    [0240] As used herein shRNA or small hairpin RNA (also called stem loop) is a type of siRNA. In one embodiment, these shRNAs are composed of a short, e.g., about 19 to about 25 nucleotide, antisense strand, followed by a nucleotide loop of about 5 to about 9 nucleotides, and the analogous sense strand. Alternatively, the sense strand can precede the nucleotide loop structure and the antisense strand can follow.

    [0241] The terms microRNA or miRNA, used interchangeably herein, are endogenous RNAs, some of which are known to regulate the expression of protein-coding genes at the posttranscriptional level. Endogenous microRNAs are small RNAs naturally present in the genome that are capable of modulating the productive utilization of mRNA. The term artificial microRNA includes any type of RNA sequence, other than endogenous microRNA, which is capable of modulating the productive utilization of mRNA. MicroRNA sequences have been described in publications such as Lim, et al., Genes & Development, 17, p. 991-1008 (2003), Lim et al Science 299, 1540 (2003), Lee and Ambros Science, 294, 862 (2001), Lau et al., Science 294, 858-861 (2001), Lagos-Quintana et al, Current Biology, 12, 735-739 (2002), Lagos Quintana et al, Science 294, 853-857 (2001), and Lagos-Quintana et al, RNA, 9, 175-179 (2003), which are incorporated by reference. Multiple microRNAs can also be incorporated into a precursor molecule. Furthermore, miRNA-like stem-loops can be expressed in cells as a vehicle to deliver artificial miRNAs and short interfering RNAs (siRNAs) for the purpose of modulating the expression of endogenous genes through the miRNA and or RNAi pathways.

    [0242] As used herein, double stranded RNA or dsRNA refers to RNA molecules that are comprised of two strands. Double-stranded molecules include those comprised of a single RNA molecule that doubles back on itself to form a two-stranded structure. For example, the stem loop structure of the progenitor molecules from which the single-stranded miRNA is derived, called the pre-miRNA (Bartel et al. 2004. Cell 1 16:281-297), comprises a dsRNA molecule.

    Adoptive Cell Transfer

    [0243] In certain embodiments, non-pathogenic Th1 cells are used to treat autoimmunity by adoptively transferring the cells to a subject in need thereof. In certain embodiments, non-pathogenic Th1 cells are generated by treating Th1 cells or naive CD4 T cells with an agent capable of decreasing expression of IL-23R. In certain embodiments, non-pathogenic Th1 cells are generated by treating Th1 cells or naive CD4 T cells with an agent capable of decreasing expression of one or more of CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW. For example, Th1 cells can be modified ex vivo using a genetic modifying agent (e.g., CRISPR, RNAi). In certain embodiments, pathogenic Th1 cells are used in adoptive cell transfer to treat cancer (e.g., in vitro differentiated Th1 cells, as described herein). In certain embodiments, the Th1 cells are modified ex vivo to express a tumor antigen specific T cell receptor (TCR).

    [0244] As used herein, ACT, adoptive cell therapy and adoptive cell transfer may be used interchangeably. In certain embodiments, Adoptive cell therapy (ACT) can refer to the transfer of cells, most commonly immune-derived cells, back into the same patient or into a new recipient host with the goal of transferring the immunologic functionality and characteristics into the new host. If possible, use of autologous cells helps the recipient by minimizing GVHD issues. The adoptive transfer of autologous tumor infiltrating lymphocytes (TIL) (Zacharakis et al., (2018) Nat Med. 2018 June; 24(6):724-730; Besser et al., (2010) Clin. Cancer Res 16 (9) 2646-55; Dudley et al., (2002) Science 298 (5594): 850-4; and Dudley et al., (2005) Journal of Clinical Oncology 23 (10): 2346-57.) or genetically re-directed peripheral blood mononuclear cells (Johnson et al., (2009) Blood 114 (3): 535-46; and Morgan et al., (2006) Science 314(5796) 126-9) has been used to successfully treat patients with advanced solid tumors, including melanoma, metastatic breast cancer and colorectal carcinoma, as well as patients with CD19-expressing hematologic malignancies (Kalos et al., (2011) Science Translational Medicine 3 (95): 95ra73). In certain embodiments, allogenic cells immune cells are transferred (see, e.g., Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266). As described further herein, allogenic cells can be edited to reduce alloreactivity and prevent graft-versus-host disease. Thus, use of allogenic cells allows for cells to be obtained from healthy donors and prepared for use in patients as opposed to preparing autologous cells from a patient after diagnosis.

    [0245] Aspects of the invention involve the adoptive transfer of immune system cells, such as T cells, specific for selected antigens, such as tumor associated antigens or tumor specific neoantigens (see, e.g., Maus et al., 2014, Adoptive Immunotherapy for Cancer or Viruses, Annual Review of Immunology, Vol. 32: 189-225; Rosenberg and Restifo, 2015, Adoptive cell transfer as personalized immunotherapy for human cancer, Science Vol. 348 no. 6230 pp. 62-68; Restifo et al., 2015, Adoptive immunotherapy for cancer: harnessing the T cell response. Nat. Rev. Immunol. 12(4): 269-281; and Jenson and Riddell, 2014, Design and implementation of adoptive therapy with chimeric antigen receptor-modified T cells. Immunol Rev. 257(1): 127-144; and Rajasagi et al., 2014, Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia. Blood. 2014 Jul. 17; 124(3):453-62).

    [0246] In certain embodiments, an antigen (such as a tumor antigen) to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) may be selected from a group consisting of: MR1 (see, e.g., Crowther, et al., 2020, Genome-wide CRISPR-Cas9 screening reveals ubiquitous T cell cancer targeting via the monomorphic MHC class I-related protein MR1, Nature Immunology volume 21, pages178-185), B cell maturation antigen (BCMA) (see, e.g., Friedman et al., Effective Targeting of Multiple BCMA-Expressing Hematological Malignancies by Anti-BCMA CAR T Cells, Hum Gene Ther. 2018 Mar. 8; Berdeja J G, et al. Durable clinical responses in heavily pretreated patients with relapsed/refractory multiple myeloma: updated results from a multicenter study of bb2121 anti-Bcma CAR T cell therapy. Blood. 2017; 130:740; and Mouhieddine and Ghobrial, Immunotherapy in Multiple Myeloma: The Era of CAR T Cell Therapy, Hematologist, May-June 2018, Volume 15, issue 3); PSA (prostate-specific antigen); prostate-specific membrane antigen (PSMA); PSCA (Prostate stem cell antigen); Tyrosine-protein kinase transmembrane receptor ROR1; fibroblast activation protein (FAP); Tumor-associated glycoprotein 72 (TAG72); Carcinoembryonic antigen (CEA); Epithelial cell adhesion molecule (EPCAM); Mesothelin; Human Epidermal growth factor Receptor 2 (ERBB2 (Her2/neu)); Prostase; Prostatic acid phosphatase (PAP); elongation factor 2 mutant (ELF2M); Insulin-like growth factor 1 receptor (IGF-1R); gplOO; BCR-ABL (breakpoint cluster region-Abelson); tyrosinase; New York esophageal squamous cell carcinoma 1 (NY-ESO-1); ?-light chain, LAGE (L antigen); MAGE (melanoma antigen); Melanoma-associated antigen 1 (MAGE-A1); MAGE A3; MAGE A6; legumain; Human papillomavirus (HPV) E6; HPV E7; prostein; survivin; PCTA1 (Galectin 8); Melan-A/MART-1; Ras mutant; TRP-1 (tyrosinase related protein 1, or gp75); Tyrosinase-related Protein 2 (TRP2); TRP-2/INT2 (TRP-2/intron 2); RAGE (renal antigen); receptor for advanced glycation end products 1 (RAGE1); Renal ubiquitous 1, 2 (RU1, RU2); intestinal carboxyl esterase (iCE); Heat shock protein 70-2 (HSP70-2) mutant; thyroid stimulating hormone receptor (TSHR); CD123; CD171; CD19; CD20; CD22; CD26; CD30; CD33; CD44v7/8 (cluster of differentiation 44, exons 7/8); CD53; CD92; CD100; CD148; CD150; CD200; CD261; CD262; CD362; CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); Tn antigen (Tn Ag); Fms-Like Tyrosine Kinase 3 (FLT3); CD38; CD138; CD44v6; B7H3 (CD276); KIT (CD117); Interleukin-13 receptor subunit alpha-2 (IL-13Ra2); Interleukin 11 receptor alpha (IL-11Ra); prostate stem cell antigen (PSCA); Protease Serine 21 (PRSS21); vascular endothelial growth factor receptor 2 (VEGFR2); Lewis(Y) antigen; CD24; Platelet-derived growth factor receptor beta (PDGFR-beta); stage-specific embryonic antigen-4 (SSEA-4); Mucin 1, cell surface associated (MUC1); mucin 16 (MUC16); epidermal growth factor receptor (EGFR); epidermal growth factor receptor variant III (EGFRvIII); neural cell adhesion molecule (NCAM); carbonic anhydrase IX (CAIX); Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2); ephrin type-A receptor 2 (EphA2); Ephrin B2; Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); TGS5; high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor alpha; Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysialic acid; placenta-specific 1 (PLAC1); hexasaccharide portion of globoH glycoceramide (GloboH); mammary gland differentiation antigen (NY-BR-1); uroplakin 2 (UPK2); Hepatitis A virus cellular receptor 1 (HAVCR1); adrenoceptor beta 3 (ADRB3); pannexin 3 (PANX3); G protein-coupled receptor 20 (GPR20); lymphocyte antigen 6 complex, locus K 9 (LY6K); Olfactory receptor 51E2 (OR51E2); TCR Gamma Alternate Reading Frame Protein (TARP); Wilms tumor protein (WTi); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGEl); angiopoietin-binding cell surface receptor 2 (Tie 2); CT (cancer/testis (antigen)); melanoma cancer testis antigen-1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; p53; p.sup.53 mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA17); paired box protein Pax-3 (PAX3); Androgen receptor; Cyclin B1; Cyclin D1; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Ras Homolog Family Member C (RhoC); Cytochrome P450 1B1 (CYP1B1); CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS); Squamous Cell Carcinoma Antigen Recognized By T Cells-1 or 3 (SART1, SART3); Paired box protein Pax-5 (PAX5); proacrosin binding protein sp32 (OY-TES1); lymphocyte-specific protein tyrosine kinase (LCK); A kinase anchor protein 4 (AKAP-4); synovial sarcoma, X breakpoint-1, -2, -3 or -4 (SSX1, SSX2, SSX3, SSX4); CD79a; CD79b; CD72; Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Fc fragment of IgA receptor (FCAR); Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); CD300 molecule-like family member f (CD300LF); C-type lectin domain family 12 member A (CLECi2A); bone marrow stromal cell antigen 2 (BST2); EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); lymphocyte antigen 75 (LY75); Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); mouse double minute 2 homolog (MDM2); livin; alphafetoprotein (AFP); transmembrane activator and CAML Interactor (TACI); B-cell activating factor receptor (BAFF-R); V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS); immunoglobulin lambda-like polypeptide 1 (IGLL1); 707-AP (707 alanine proline); ART-4 (adenocarcinoma antigen recognized by T4 cells); BAGE (B antigen; b-catenin/m, b-catenin/mutated); CAMEL (CTL-recognized antigen on melanoma); CAP1 (carcinoembryonic antigen peptide 1); CASP-8 (caspase-8); CDC27m (cell-division cycle 27 mutated); CDK4/m (cycline-dependent kinase 4 mutated); Cyp-B (cyclophilin B); DAM (differentiation antigen melanoma); EGP-2 (epithelial glycoprotein 2); EGP-40 (epithelial glycoprotein 40); Erbb2, 3, 4 (erythroblastic leukemia viral oncogene homolog-2, -3, 4); FBP (folate binding protein); fAchR (Fetal acetylcholine receptor); G250 (glycoprotein 250); GAGE (G antigen); GnT-V (N-acetylglucosaminyltransferase V); HAGE (helicose antigen); ULA-A (human leukocyte antigen-A); HST2 (human signet ring tumor 2); KIAA0205; KDR (kinase insert domain receptor); LDLR/FUT (low density lipid receptor/GDP L-fucose: b-D-galactosidase 2-a-L fucosyltransferase); L1CAM (L1 cell adhesion molecule); MC1R (melanocortin 1 receptor); Myosin/m (myosin mutated); MUM-1, -2, -3 (melanoma ubiquitous mutated 1, 2, 3); NA88-A (NA cDNA clone of patient M88); KG2D (Natural killer group 2, member D) ligands; oncofetal antigen (h5T4); p190 minor bcr-abl (protein of 190KD bcr-abl); Pml/RARa (promyelocytic leukaemia/retinoic acid receptor a); PRAME (preferentially expressed antigen of melanoma); SAGE (sarcoma antigen); TEL/AML1 (translocation Ets-family leukemia/acute myeloid leukemia 1); TPI/m (triosephosphate isomerase mutated); CD70; and any combination thereof.

    [0247] In certain embodiments, ACT includes co-transferring CD4+Th1 cells and CD8+CTLs to induce a synergistic antitumour response (see, e.g., Li et al., Adoptive cell therapy with CD4+T helper 1 cells and CD8+ cytotoxic T cells enhances complete rejection of an established tumour, leading to generation of endogenous memory responses to non-targeted tumour epitopes. Clin Transl Immunology. 2017 October; 6(10): e160).

    [0248] To guard against possible adverse reactions, engineered immunoresponsive cells may be equipped with a transgenic safety switch, in the form of a transgene that renders the cells vulnerable to exposure to a specific signal. For example, the herpes simplex viral thymidine kinase (TK) gene may be used in this way, for example by introduction into allogeneic T lymphocytes used as donor lymphocyte infusions following stem cell transplantation (Greco, et al., Improving the safety of cell therapy with the TK-suicide gene. Front. Pharmacol. 2015; 6: 95). In such cells, administration of a nucleoside prodrug such as ganciclovir or acyclovir causes cell death. Alternative safety switch constructs include inducible caspase 9, for example triggered by administration of a small-molecule dimerizer that brings together two nonfunctional icasp9 molecules to form the active enzyme. A wide variety of alternative approaches to implementing cellular proliferation controls have been described (see U.S. Patent Publication No. 20130071414; PCT Patent Publication WO2011146862; PCT Patent Publication WO2014011987; PCT Patent Publication WO2013040371; Zhou et al. BLOOD, 2014, 123/25:3895-3905; Di Stasi et al., The New England Journal of Medicine 2011; 365:1673-1683; Sadelain M, The New England Journal of Medicine 2011; 365:1735-173; Ramos et al., Stem Cells 28(6):1107-15 (2010)).

    [0249] In a further refinement of adoptive therapies, genome editing may be used to tailor immunoresponsive cells to alternative implementations, for example providing edited CAR T cells (see Poirot et al., 2015, Multiplex genome edited T-cell manufacturing platform for off-the-shelf adoptive T-cell immunotherapies, Cancer Res 75 (18): 3853; Ren et al., 2017, Multiplex genome editing to generate universal CAR T cells resistant to PD1 inhibition, Clin Cancer Res. 2017 May 1; 23(9):2255-2266. doi: 10.1158/1078-0432.CCR-16-1300. Epub 2016 Nov. 4; Qasim et al., 2017, Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells, Sci Transl Med. 2017 Jan. 25; 9(374); Legut, et al., 2018, CRISPR-mediated TCR replacement generates superior anticancer transgenic T cells. Blood, 131(3), 311-322; Georgiadis et al., Long Terminal Repeat CRISPR-CAR-Coupled Universal T Cells Mediate Potent Anti-leukemic Effects, Molecular Therapy, In Press, Corrected Proof, Available online 6 Mar. 2018; and Roth, T. L. Editing of Endogenous Genes in Cellular Immunotherapies. Curr Hematol Malig Rep 15, 235-240 (2020)). Cells may be edited using any CRISPR system and method of use thereof as described herein. CRISPR systems may be delivered to an immune cell by any method described herein. In preferred embodiments, cells are edited ex vivo and transferred to a subject in need thereof.

    [0250] T cells can be obtained from a number of sources, including peripheral blood mononuclear cells (PBMC), bone marrow, lymph node tissue, spleen tissue, and tumors. In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis or leukapheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.

    [0251] In one embodiment of the invention, the method further comprises expanding the numbers of T cells in the enriched cell population. The numbers of T cells may be increased at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold), more preferably at least about 10-fold (or 20-, 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold), more preferably at least about 100-fold, more preferably at least about 1,000-fold, or most preferably at least about 100,000-fold. The numbers of T cells may be expanded using any suitable method known in the art.

    [0252] The administration of cells or population of cells, such as immune system cells or cell populations, such as more particularly immunoresponsive cells or cell populations, as disclosed herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The cells or population of cells may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, intrathecally, by intravenous or intralymphatic injection, or intraperitoneally. In some embodiments, the disclosed immune cells may be delivered or administered into a cavity formed by the resection of tumor tissue (i.e., intracavity delivery) or directly into a tumor prior to resection (i.e., intratumoral delivery). In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.

    [0253] The administration of the cells or population of cells can consist of the administration of 10.sup.4-10.sup.9 cells per kg body weight, preferably 10.sup.5 to 10.sup.6 cells/kg body weight including all integer values of cell numbers within those ranges. The cells or population of cells can be administrated in one or more doses. In another embodiment, the effective amount of cells are administrated as a single dose. In another embodiment, the effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions are within the skill of one in the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.

    Administration

    [0254] In certain embodiments, the one or more agents are administered to a subject in a pharmaceutical composition. A pharmaceutical composition refers to a composition that usually contains an excipient, such as a pharmaceutically acceptable carrier that is conventional in the art and that is suitable for administration to cells or to a subject.

    [0255] The pharmaceutical composition according to the present invention can, in one alternative, include a prodrug. When a pharmaceutical composition according to the present invention includes a prodrug, prodrugs and active metabolites of a compound may be identified using routine techniques known in the art. (See, e.g., Bertolini et al., J. Med. Chem., 40, 2011-2016 (1997); Shan et al., J. Pharm. Sci., 86 (7), 765-767; Bagshawe, Drug Dev. Res., 34, 220-230 (1995); Bodor, Advances in Drug Res., 13, 224-331 (1984); Bundgaard, Design of Prodrugs (Elsevier Press 1985); Larsen, Design and Application of Prodrugs, Drug Design and Development (Krogsgaard-Larsen et al., eds., Harwood Academic Publishers, 1991); Dear et al., J. Chromatogr. B, 748, 281-293 (2000); Spraul et al., J. Pharmaceutical & Biomedical Analysis, 10, 601-605 (1992); and Prox et al., Xenobiol., 3, 103-112 (1992)).

    [0256] The term pharmaceutically acceptable as used throughout this specification is consistent with the art and means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof.

    [0257] As used herein, carrier or excipient includes any and all solvents, diluents, buffers (such as, e.g., neutral buffered saline or phosphate buffered saline), solubilizers, colloids, dispersion media, vehicles, fillers, chelating agents (such as, e.g., EDTA or glutathione), amino acids (such as, e.g., glycine), proteins, disintegrants, binders, lubricants, wetting agents, emulsifiers, sweeteners, colorants, flavorings, aromatizers, thickeners, agents for achieving a depot effect, coatings, antifungal agents, preservatives, stabilizers, antioxidants, tonicity controlling agents, absorption delaying agents, and the like. The use of such media and agents for pharmaceutical active components is well known in the art. Such materials should be non-toxic and should not interfere with the activity of the cells or active components.

    [0258] The precise nature of the carrier or excipient or other material will depend on the route of administration. For example, the composition may be in the form of a parenterally acceptable aqueous solution, which is pyrogen-free and has suitable pH, isotonicity and stability. For general principles in medicinal formulation, the reader is referred to Cell Therapy: Stem Cell Transplantation, Gene Therapy, and Cellular Immunotherapy, by G. Morstyn & W. Sheridan eds., Cambridge University Press, 1996; and Hematopoietic Stem Cell Therapy, E. D. Ball, J. Lister & P. Law, Churchill Livingstone, 2000.

    [0259] The pharmaceutical composition can be applied parenterally, rectally, orally or topically. Preferably, the pharmaceutical composition may be used for intravenous, intramuscular, subcutaneous, peritoneal, peridural, rectal, nasal, pulmonary, mucosal, or oral application. In a preferred embodiment, the pharmaceutical composition according to the invention is intended to be used as an infusion. The skilled person will understand that compositions which are to be administered orally or topically will usually not comprise cells, although it may be envisioned for oral compositions to also comprise cells, for example when gastro-intestinal tract indications are treated. Each of the cells or active components (e.g., immunomodulants) as discussed herein may be administered by the same route or may be administered by a different route. By means of example, and without limitation, cells may be administered parenterally and other active components may be administered orally.

    [0260] Liquid pharmaceutical compositions may generally include a liquid carrier such as water or a pharmaceutically acceptable aqueous solution. For example, physiological saline solution, tissue or cell culture media, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.

    [0261] The composition may include one or more cell protective molecules, cell regenerative molecules, growth factors, anti-apoptotic factors or factors that regulate gene expression in the cells. Such substances may render the cells independent of their environment.

    [0262] Such pharmaceutical compositions may contain further components ensuring the viability of the cells therein. For example, the compositions may comprise a suitable buffer system (e.g., phosphate or carbonate buffer system) to achieve desirable pH, more usually near neutral pH, and may comprise sufficient salt to ensure isoosmotic conditions for the cells to prevent osmotic stress. For example, suitable solution for these purposes may be phosphate-buffered saline (PBS), sodium chloride solution, Ringer's Injection or Lactated Ringer's Injection, as known in the art. Further, the composition may comprise a carrier protein, e.g., albumin (e.g., bovine or human albumin), which may increase the viability of the cells.

    [0263] Further suitably pharmaceutically acceptable carriers or additives are well known to those skilled in the art and for instance may be selected from proteins such as collagen or gelatine, carbohydrates such as starch, polysaccharides, sugars (dextrose, glucose and sucrose), cellulose derivatives like sodium or calcium carboxymethylcellulose, hydroxypropyl cellulose or hydroxypropylmethyl cellulose, pregeletanized starches, pectin agar, carrageenan, clays, hydrophilic gums (acacia gum, guar gum, arabic gum and xanthan gum), alginic acid, alginates, hyaluronic acid, polyglycolic and polylactic acid, dextran, pectins, synthetic polymers such as water-soluble acrylic polymer or polyvinylpyrrolidone, proteoglycans, calcium phosphate and the like.

    [0264] In certain embodiments, a pharmaceutical cell preparation as taught herein may be administered in a form of liquid composition. In embodiments, the cells or pharmaceutical composition comprising such can be administered systemically, topically, within an organ or at a site of organ dysfunction or lesion.

    [0265] Preferably, the pharmaceutical compositions may comprise a therapeutically effective amount of the specified immune cells and/or other active components (e.g., immunomodulants). The term therapeutically effective amount refers to an amount which can elicit a biological or medicinal response in a tissue, system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, and in particular can prevent or alleviate one or more of the local or systemic symptoms or features of a disease or condition being treated.

    [0266] It will be appreciated that administration of therapeutic entities in accordance with the invention will be administered with suitable carriers, excipients, and other agents that are incorporated into formulations to provide improved transfer, delivery, tolerance, and the like. A multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences (15th ed, Mack Publishing Company, Easton, PA (1975)), particularly Chapter 87 by Blaug, Seymour, therein. These formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as Lipofectin?), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. Any of the foregoing mixtures may be appropriate in treatments and therapies in accordance with the present invention, provided that the active ingredient in the formulation is not inactivated by the formulation and the formulation is physiologically compatible and tolerable with the route of administration. See also Baldrick P. Pharmaceutical excipient development: the need for preclinical guidance. Regul. Toxicol Pharmacol. 32(2):210-8 (2000), Wang W. Lyophilization and development of solid protein pharmaceuticals. Int. J. Pharm. 203(1-2):1-60 (2000), Charman W N Lipids, lipophilic drugs, and oral drug delivery-some emerging concepts. J Pharm Sci. 89(8):967-78 (2000), Powell et al. Compendium of excipients for parenteral formulations PDA J Pharm Sci Technol. 52:238-311 (1998) and the citations therein for additional information related to formulations, excipients and carriers well known to pharmaceutical chemists.

    [0267] The medicaments of the invention are prepared in a manner known to those skilled in the art, for example, by means of conventional dissolving, lyophilizing, mixing, granulating or confectioning processes. Methods well known in the art for making formulations are found, for example, in Remington: The Science and Practice of Pharmacy, 20th ed., ed. A. R. Gennaro, 2000, Lippincott Williams & Wilkins, Philadelphia, and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York.

    [0268] Administration of medicaments of the invention may be by any suitable means that results in a compound concentration that is effective for treating or inhibiting (e.g., by delaying) the development of a disease. The compound is admixed with a suitable carrier substance, e.g., a pharmaceutically acceptable excipient that preserves the therapeutic properties of the compound with which it is administered. One exemplary pharmaceutically acceptable excipient is physiological saline. The suitable carrier substance is generally present in an amount of 1-95% by weight of the total weight of the medicament. The medicament may be provided in a dosage form that is suitable for administration. Thus, the medicament may be in form of, e.g., tablets, capsules, pills, powders, granulates, suspensions, emulsions, solutions, gels including hydrogels, pastes, ointments, creams, plasters, drenches, delivery devices, injectables, implants, sprays, or aerosols.

    [0269] Administration can be systemic or local. In addition, it may be advantageous to administer the composition into the central nervous system by any suitable route, including intraventricular and intrathecal injection. Pulmonary administration may also be employed by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. It may also be desirable to administer the agent locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, by injection, by means of a catheter, by means of a suppository, or by means of an implant.

    [0270] Various delivery systems are known and can be used to administer the pharmacological compositions including, but not limited to, encapsulation in liposomes, microparticles, microcapsules; minicells; polymers; capsules; tablets; and the like. In one embodiment, the agent may be delivered in a vesicle, in particular a liposome. In a liposome, the agent is combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers in aqueous solution. Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Pat. Nos. 4,837,028 and 4,737,323. In yet another embodiment, the pharmacological compositions can be delivered in a controlled release system including, but not limited to: a delivery pump (See, for example, Saudek, et al., New Engl. J. Med. 321: 574 (1989) and a semi-permeable polymeric material (See, for example, Howard, et al., J. Neurosurg. 71: 105 (1989)). Additionally, the controlled release system can be placed in proximity of the therapeutic target (e.g., a tumor), thus requiring only a fraction of the systemic dose. See, for example, Goodson, In: Medical Applications of Controlled Release, 1984. (CRC Press, Boca Raton, Fla.).

    [0271] The amount of the agents which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and may be determined by standard clinical techniques by those of skill within the art. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the overall seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Ultimately, the attending physician will decide the amount of the agent with which to treat each individual patient. In certain embodiments, the attending physician will administer low doses of the agent and observe the patient's response. Larger doses of the agent may be administered until the optimal therapeutic effect is obtained for the patient, and at that point the dosage is not increased further. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. Ultimately the attending physician will decide on the appropriate duration of therapy using compositions of the present invention. Dosage will also vary according to the age, weight and response of the individual patient.

    [0272] There are a variety of techniques available for introducing nucleic acids into viable cells. The techniques vary depending upon whether the nucleic acid is transferred into cultured cells in vitro, or in vivo in the cells of the intended host. Techniques suitable for the transfer of nucleic acid into mammalian cells in vitro include the use of liposomes, electroporation, microinjection, cell fusion, DEAE-dextran, the calcium phosphate precipitation method, etc. The currently preferred in vivo gene transfer techniques include transfection with viral (typically retroviral) vectors and viral coat protein-liposome mediated transfection.

    Diagnostic Methods

    [0273] In certain embodiments, detecting pathogenic Th1 cells or a pathogenic Th1 cell immune response can be used to detect Th1 mediated autoimmune diseases. In certain embodiments, detecting pathogenic Th1 cells or a pathogenic Th1 cell immune response can be used to determine whether a treatment is effective in a subject suffering from a disease. In certain embodiments, the disease is an autoimmune and the treatment is any treatment described herein or currently used for treatment. In certain embodiments, a treatment is effective in a subject suffering from an autoimmune disease if the treatment decreases pathogenic Th1 cells or a pathogenic signature described herein. In certain embodiments, the treatment is any treatment as described herein (e.g., a CD160, GPR18 inhibitors). In certain embodiments, the treatment is an IL-23 antagonist. In certain embodiments, the treatment is an IL-12 and IL-23 antagonist. Non-limiting IL-23 antagonists that are approved for use and whose effectiveness can be monitored include the monoclonal antibodies ustekinumab, guselkumab, risankizumab, and tildrakizumab. Ustekinumab targets IL-23 and IL-12 through their shared p40 subunit (see, e.g., Cingoz O. Ustekinumab. MAbs. 2009; 1(3):216-221. doi:10.4161/mabs.1.3.8593). Guselkumab, risankizumab, and tildrakizumab are selective IL-23 inhibitors, which are inhibitors of p19 of IL-23 (see, e.g., Gottlieb A B, Saure D, Wilhelm S, et al. Indirect comparisons of ixekizumab versus three interleukin-23 p19 inhibitors in patients with moderate-to-severe plaque psoriasisefficacy findings up to week 12. J Dermatolog Treat. 2020; 1-8).

    [0274] In certain embodiments, an autoimmune response can be detected by detecting pathogenic Th1 cells or non-pathogenic Th1 cells. In certain embodiments, pathogenic Th1 cells can be detected by detecting Th1 cells that express one or markers described herein. For example, Th1 cells that express IL-23R or one or more of IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW or a gene program selected from cluster 2 or cluster 9. In certain embodiments, pathogenic Th1 cells are increased. In certain embodiments, non-pathogenic Th1 cells can be detected by detecting Th1 cells expressing a program characterized by cluster 7 genes. In certain embodiments, non-pathogenic Th1 cells are decreased.

    [0275] The invention provides biomarkers (e.g., phenotype specific or cell type) for the identification, diagnosis, prognosis and manipulation of cell properties, for use in a variety of diagnostic and/or therapeutic indications. Biomarkers in the context of the present invention encompasses, without limitation nucleic acids, proteins, reaction products, and metabolites, together with their polymorphisms, mutations, variants, modifications, subunits, fragments, and other analytes or sample-derived measures. In certain embodiments, biomarkers include the signature genes or signature gene products, and/or cells as described herein.

    [0276] Biomarkers are useful in methods of diagnosing, prognosing and/or staging an immune response in a subject by detecting a first level of expression, activity and/or function of one or more biomarker and comparing the detected level to a control of level wherein a difference in the detected level and the control level indicates that the presence of an immune response in the subject.

    [0277] The terms diagnosis and monitoring are commonplace and well-understood in medical practice. By means of further explanation and without limitation the term diagnosis generally refers to the process or act of recognising, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition).

    [0278] The terms prognosing or prognosis generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prognosis of the diseases or conditions taught herein may generally encompass anticipation of a satisfactory partial or complete recovery from the diseases or conditions, preferably within an acceptable time period. A good prognosis of such may more commonly encompass anticipation of not further worsening or aggravating of such, preferably within a given time period. A poor prognosis of the diseases or conditions as taught herein may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of such.

    [0279] The biomarkers of the present invention are useful in methods of identifying patient populations at risk or suffering from an immune response based on a detected level of expression, activity and/or function of one or more biomarkers. These biomarkers are also useful in monitoring subjects undergoing treatments and therapies for suitable or aberrant response(s) to determine efficaciousness of the treatment or therapy and for selecting or modifying therapies and treatments that would be efficacious in treating, delaying the progression of or otherwise ameliorating a symptom. The biomarkers provided herein are useful for selecting a group of patients at a specific state of a disease with accuracy that facilitates selection of treatments.

    [0280] The term monitoring generally refers to the follow-up of a disease or a condition in a subject for any changes which may occur over time.

    [0281] The terms also encompass prediction of a disease. The terms predicting or prediction generally refer to an advance declaration, indication or foretelling of a disease or condition in a subject not (yet) having said disease or condition. For example, a prediction of a disease or condition in a subject may indicate a probability, chance or risk that the subject will develop said disease or condition, for example within a certain time period or by a certain age. Said probability, chance or risk may be indicated inter alia as an absolute value, range or statistics, or may be indicated relative to a suitable control subject or subject population (such as, e.g., relative to a general, normal or healthy subject or subject population). Hence, the probability, chance or risk that a subject will develop a disease or condition may be advantageously indicated as increased or decreased, or as fold-increased or fold-decreased relative to a suitable control subject or subject population. As used herein, the term prediction of the conditions or diseases as taught herein in a subject may also particularly mean that the subject has a positive prediction of such, i.e., that the subject is at risk of having such (e.g., the risk is significantly increased vis-?-vis a control subject or subject population). The term prediction of no diseases or conditions as taught herein as described herein in a subject may particularly mean that the subject has a negative prediction of such, i.e., that the subject's risk of having such is not significantly increased vis-?-vis a control subject or subject population.

    [0282] Suitably, an altered quantity or phenotype of the immune cells in the subject compared to a control subject having normal immune status or not having a disease comprising an immune component indicates that the subject has an impaired immune status or has a disease comprising an immune component or would benefit from an immune therapy.

    [0283] Hence, the methods may rely on comparing the quantity of immune cell populations, biomarkers, or gene or gene product signatures measured in samples from patients with reference values, wherein said reference values represent known predictions, diagnoses and/or prognoses of diseases or conditions as taught herein.

    [0284] For example, distinct reference values may represent the prediction of a risk (e.g., an abnormally elevated risk) of having a given disease or condition as taught herein vs. the prediction of no or normal risk of having said disease or condition. In another example, distinct reference values may represent predictions of differing degrees of risk of having such disease or condition.

    [0285] In a further example, distinct reference values can represent the diagnosis of a given disease or condition as taught herein vs. the diagnosis of no such disease or condition (such as, e.g., the diagnosis of healthy, or recovered from said disease or condition, etc.). In another example, distinct reference values may represent the diagnosis of such disease or condition of varying severity.

    [0286] In yet another example, distinct reference values may represent a good prognosis for a given disease or condition as taught herein vs. a poor prognosis for said disease or condition. In a further example, distinct reference values may represent varyingly favourable or unfavourable prognoses for such disease or condition.

    [0287] Such comparison may generally include any means to determine the presence or absence of at least one difference and optionally of the size of such difference between values being compared. A comparison may include a visual inspection, an arithmetical or statistical comparison of measurements. Such statistical comparisons include, but are not limited to, applying a rule.

    [0288] Reference values may be established according to known procedures previously employed for other cell populations, biomarkers and gene or gene product signatures. For example, a reference value may be established in an individual or a population of individuals characterised by a particular diagnosis, prediction and/or prognosis of said disease or condition (i.e., for whom said diagnosis, prediction and/or prognosis of the disease or condition holds true). Such population may comprise without limitation 2 or more, 10 or more, 100 or more, or even several hundred or more individuals.

    [0289] A deviation of a first value from a second value may generally encompass any direction (e.g., increase: first value>second value; or decrease: first value<second value) and any extent of alteration.

    [0290] For example, a deviation may encompass a decrease in a first value by, without limitation, at least about 10% (about 0.9-fold or less), or by at least about 20% (about 0.8-fold or less), or by at least about 30% (about 0.7-fold or less), or by at least about 40% (about 0.6-fold or less), or by at least about 50% (about 0.5-fold or less), or by at least about 60% (about 0.4-fold or less), or by at least about 70% (about 0.3-fold or less), or by at least about 80% (about 0.2-fold or less), or by at least about 90% (about 0.1-fold or less), relative to a second value with which a comparison is being made.

    [0291] For example, a deviation may encompass an increase of a first value by, without limitation, at least about 10% (about 1.1-fold or more), or by at least about 20% (about 1.2-fold or more), or by at least about 30% (about 1.3-fold or more), or by at least about 40% (about 1.4-fold or more), or by at least about 50% (about 1.5-fold or more), or by at least about 60% (about 1.6-fold or more), or by at least about 70% (about 1.7-fold or more), or by at least about 80% (about 1.8-fold or more), or by at least about 90% (about 1.9-fold or more), or by at least about 100% (about 2-fold or more), or by at least about 150% (about 2.5-fold or more), or by at least about 200% (about 3-fold or more), or by at least about 500% (about 6-fold or more), or by at least about 700% (about 8-fold or more), or like, relative to a second value with which a comparison is being made.

    [0292] Preferably, a deviation may refer to a statistically significant observed alteration. For example, a deviation may refer to an observed alteration which falls outside of error margins of reference values in a given population (as expressed, for example, by standard deviation or standard error, or by a predetermined multiple thereof, e.g., ?1?SD or ?2?SD or ?3?SD, or 1?SE or ?2?SE or ?3?SE). Deviation may also refer to a value falling outside of a reference range defined by values in a given population (for example, outside of a range which comprises ?40%, ?50%, ?60%, ?70%, ?75% or ?80% or ?85% or ?90% or ?95% or even ?100% of values in said population).

    [0293] In a further embodiment, a deviation may be concluded if an observed alteration is beyond a given threshold or cut-off. Such threshold or cut-off may be selected as generally known in the art to provide for a chosen sensitivity and/or specificity of the prediction methods, e.g., sensitivity and/or specificity of at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 85%, or at least 90%, or at least 95%.

    [0294] For example, receiver-operating characteristic (ROC) curve analysis can be used to select an optimal cut-off value of the quantity of a given immune cell population, biomarker or gene or gene product signatures, for clinical use of the present diagnostic tests, based on acceptable sensitivity and specificity, or related performance measures which are well-knownper se, such as positive predictive value (PPV), negative predictive value (NPV), positive likelihood ratio (LR+), negative likelihood ratio (LR?), Youden index, or similar.

    [0295] In one embodiment, the signature genes, biomarkers, and/or cells may be detected or isolated by immunofluorescence, immunohistochemistry (IHC), fluorescence activated cell sorting (FACS), mass spectrometry (MS), mass cytometry (CyTOF), RNA-seq, single cell RNA-seq (described further herein), quantitative RT-PCR, single cell qPCR, FISH, RNA-FISH, MERFISH (multiplex (in situ) RNA FISH) and/or by in situ hybridization. Other methods including absorbance assays and colorimetric assays are known in the art and may be used herein. detection may comprise primers and/or probes or fluorescently bar-coded oligonucleotide probes for hybridization to RNA (see e.g., Geiss G K, et al., Direct multiplexed measurement of gene expression with color-coded probe pairs. Nat Biotechnol. 2008 March; 26(3):317-25).

    [0296] In certain embodiments, a tissue sample may be obtained and analyzed for specific cell markers (IHC) or specific transcripts (e.g., RNA-FISH). Tissue samples for diagnosis, prognosis or detecting may be obtained by endoscopy. In one embodiment, a sample may be obtained by endoscopy and analyzed by FACS. As used herein, endoscopy refers to a procedure that uses an endoscope to examine the interior of a hollow organ or cavity of the body. The endoscope may include a camera and a light source. The endoscope may include tools for dissection or for obtaining a biological sample.

    [0297] The present invention also may comprise a kit with a detection reagent that binds to one or more biomarkers or can be used to detect one or more biomarkers.

    MS methods

    [0298] Biomarker detection may also be evaluated using mass spectrometry methods. A variety of configurations of mass spectrometers can be used to detect biomarker values. Several types of mass spectrometers are available or can be produced with various configurations. In general, a mass spectrometer has the following major components: a sample inlet, an ion source, a mass analyzer, a detector, a vacuum system, and instrument-control system, and a data system. Difference in the sample inlet, ion source, and mass analyzer generally define the type of instrument and its capabilities. For example, an inlet can be a capillary-column liquid chromatography source or can be a direct probe or stage such as used in matrix-assisted laser desorption. Common ion sources are, for example, electrospray, including nanospray and microspray or matrix-assisted laser desorption. Common mass analyzers include a quadrupole mass filter, ion trap mass analyzer and time-of-flight mass analyzer. Additional mass spectrometry methods are well known in the art (see Burlingame et al., Anal. Chem. 70:647 R-716R (1998); Kinter and Sherman, New York (2000)).

    [0299] Protein biomarkers and biomarker values can be detected and measured by any of the following: electrospray ionization mass spectrometry (ESI-MS), ESI-MS/MS, ESI-MS/(MS)n, matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS), desorption/ionization on silicon (DIOS), secondary ion mass spectrometry (SIMS), quadrupole time-of-flight (Q-TOF), tandem time-of-flight (TOF/TOF) technology, called ultraflex III TOF/TOF, atmospheric pressure chemical ionization mass spectrometry (APCI-MS), APCI-MS/MS, APCI-(MS).sup.N, atmospheric pressure photoionization mass spectrometry (APPI-MS), APPI-MS/MS, and APPI-(MS).sup.N, quadrupole mass spectrometry, Fourier transform mass spectrometry (FTMS), quantitative mass spectrometry, and ion trap mass spectrometry.

    [0300] Sample preparation strategies are used to label and enrich samples before mass spectroscopic characterization of protein biomarkers and determination biomarker values. Labeling methods include but are not limited to isobaric tag for relative and absolute quantitation (iTRAQ) and stable isotope labeling with amino acids in cell culture (SILAC). Capture reagents used to selectively enrich samples for candidate biomarker proteins prior to mass spectroscopic analysis include but are not limited to aptamers, antibodies, nucleic acid probes, chimeras, small molecules, an F(ab).sub.2 fragment, a single chain antibody fragment, an Fv fragment, a single chain Fv fragment, a nucleic acid, a lectin, a ligand-binding receptor, affybodies, nanobodies, ankyrins, domain antibodies, alternative antibody scaffolds (e.g. diabodies etc) imprinted polymers, avimers, peptidomimetics, peptoids, peptide nucleic acids, threose nucleic acid, a hormone receptor, a cytokine receptor, and synthetic receptors, and modifications and fragments of these.

    Immunoassays

    [0301] Immunoassay methods are based on the reaction of an antibody to its corresponding target or analyte and can detect the analyte in a sample depending on the specific assay format. To improve specificity and sensitivity of an assay method based on immunoreactivity, monoclonal antibodies are often used because of their specific epitope recognition. Polyclonal antibodies have also been successfully used in various immunoassays because of their increased affinity for the target as compared to monoclonal antibodies Immunoassays have been designed for use with a wide range of biological sample matrices Immunoassay formats have been designed to provide qualitative, semi-quantitative, and quantitative results.

    [0302] Quantitative results may be generated through the use of a standard curve created with known concentrations of the specific analyte to be detected. The response or signal from an unknown sample is plotted onto the standard curve, and a quantity or value corresponding to the target in the unknown sample is established.

    [0303] Numerous immunoassay formats have been designed. ELISA or EIA can be quantitative for the detection of an analyte/biomarker. This method relies on attachment of a label to either the analyte or the antibody and the label component includes, either directly or indirectly, an enzyme. ELISA tests may be formatted for direct, indirect, competitive, or sandwich detection of the analyte. Other methods rely on labels such as, for example, radioisotopes (I.sup.125) or fluorescence. Additional techniques include, for example, agglutination, nephelometry, turbidimetry, Western blot, immunoprecipitation, immunocytochemistry, immunohistochemistry, flow cytometry, Luminex assay, and others (see ImmunoAssay: A Practical Guide, edited by Brian Law, published by Taylor & Francis, Ltd., 2005 edition).

    [0304] Exemplary assay formats include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay, fluorescent, chemiluminescence, and fluorescence resonance energy transfer (FRET) or time resolved-FRET (TR-FRET) immunoassays. Examples of procedures for detecting biomarkers include biomarker immunoprecipitation followed by quantitative methods that allow size and peptide level discrimination, such as gel electrophoresis, capillary electrophoresis, planar electrochromatography, and the like.

    [0305] Methods of detecting and/or quantifying a detectable label or signal generating material depend on the nature of the label. The products of reactions catalyzed by appropriate enzymes (where the detectable label is an enzyme; see above) can be, without limitation, fluorescent, luminescent, or radioactive or they may absorb visible or ultraviolet light. Examples of detectors suitable for detecting such detectable labels include, without limitation, x-ray film, radioactivity counters, scintillation counters, spectrophotometers, colorimeters, fluorometers, luminometers, and densitometers.

    [0306] Any of the methods for detection can be performed in any format that allows for any suitable preparation, processing, and analysis of the reactions. This can be, for example, in multi-well assay plates (e.g., 96 wells or 384 wells) or using any suitable array or microarray. Stock solutions for various agents can be made manually or robotically, and all subsequent pipetting, diluting, mixing, distribution, washing, incubating, sample readout, data collection and analysis can be done robotically using commercially available analysis software, robotics, and detection instrumentation capable of detecting a detectable label.

    Hybridization Assays

    [0307] Such applications are hybridization assays in which a nucleic acid that displays probe nucleic acids for each of the genes to be assayed/profiled in the profile to be generated is employed. In these assays, a sample of target nucleic acids is first prepared from the initial nucleic acid sample being assayed, where preparation may include labeling of the target nucleic acids with a label, e.g., a member of a signal producing system. Following target nucleic acid sample preparation, the sample is contacted with the array under hybridization conditions, whereby complexes are formed between target nucleic acids that are complementary to probe sequences attached to the array surface. The presence of hybridized complexes is then detected, either qualitatively or quantitatively. Specific hybridization technology which may be practiced to generate the expression profiles employed in the subject methods includes the technology described in U.S. Pat. Nos. 5,143,854; 5,288,644; 5,324,633; 5,432,049; 5,470,710; 5,492,806; 5,503,980; 5,510,270; 5,525,464; 5,547,839; 5,580,732; 5,661,028; 5,800,992; the disclosures of which are herein incorporated by reference; as well as WO 95/21265; WO 96/31622; WO 97/10365; WO 97/27317; EP 373 203; and EP 785 280. In these methods, an array of probe nucleic acids that includes a probe for each of the biomarkers whose expression is being assayed is contacted with target nucleic acids as described above. Contact is carried out under hybridization conditions, e.g., stringent hybridization conditions as described above, and unbound nucleic acid is then removed. The resultant pattern of hybridized nucleic acids provides information regarding expression for each of the biomarkers that have been probed, where the expression information is in terms of whether or not the gene is expressed and, typically, at what level, where the expression data, i.e., expression profile, may be both qualitative and quantitative.

    [0308] Optimal hybridization conditions will depend on the length (e.g., oligomer vs. polynucleotide greater than 200 bases) and type (e.g., RNA, DNA, PNA) of labeled probe and immobilized polynucleotide or oligonucleotide. General parameters for specific (i.e., stringent) hybridization conditions for nucleic acids are described in Sambrook et al., supra, and in Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing and Wiley-interscience, NY (1987), which is incorporated in its entirety for all purposes. When the cDNA microarrays are used, typical hybridization conditions are hybridization in 5?SSC plus 0.2% SDS at 65 C for 4 hours followed by washes at 25? C. in low stringency wash buffer (1?SSC plus 0.2% SDS) followed by 10 minutes at 25? C. in high stringency wash buffer (0.1SSC plus 0.2% SDS) (see Shena et al., Proc. Natl. Acad. Sci. USA, Vol. 93, p. 10614 (1996)). Useful hybridization conditions are also provided in, e.g., Tijessen, Hybridization With Nucleic Acid Probes, Elsevier Science Publishers B.V. (1993) and Kricka, Nonisotopic DNA Probe Techniques, Academic Press, San Diego, Calif. (1992).

    Single Cell Sequencing

    [0309] In certain embodiments, the invention involves single cell RNA sequencing (see, e.g., Kalisky, T., Blainey, P. & Quake, S. R. Genomic Analysis at the Single-Cell Level. Annual review of genetics 45, 431-445, (2011); Kalisky, T. & Quake, S. R. Single-cell genomics. Nature Methods 8, 311-314 (2011); Islam, S. et al. Characterization of the single-cell transcriptional landscape by highly multiplex RNA-seq. Genome Research, (2011); Tang, F. et al. RNA-Seq analysis to capture the transcriptome landscape of a single cell. Nature Protocols 5, 516-535, (2010); Tang, F. et al. mRNA-Seq whole-transcriptome analysis of a single cell. Nature Methods 6, 377-382, (2009); Ramskold, D. et al. Full-length mRNA-Seq from single-cell levels of RNA and individual circulating tumor cells. Nature Biotechnology 30, 777-782, (2012); and Hashimshony, T., Wagner, F., Sher, N. & Yanai, I. CEL-Seq: Single-Cell RNA-Seq by Multiplexed Linear Amplification. Cell Reports, Cell Reports, Volume 2, Issue 3, p 666-673, 2012).

    [0310] In certain embodiments, the invention involves plate based single cell RNA sequencing (see, e.g., Picelli, S. et al., 2014, Full-length RNA-seq from single cells using Smart-seq2 Nature protocols 9, 171-181, doi:10.1038/nprot.2014.006).

    [0311] In certain embodiments, the invention involves high-throughput single-cell RNA-seq. In this regard reference is made to Macosko et al., 2015, Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets Cell 161, 1202-1214; International patent application number PCT/US2015/049178, published as WO2016/040476 on Mar. 17, 2016; Klein et al., 2015, Droplet Barcoding for Single-Cell Transcriptomics Applied to Embryonic Stem Cells Cell 161, 1187-1201; International patent application number PCT/US2016/027734, published as WO2016168584A1 on Oct. 20, 2016; Zheng, et al., 2016, Haplotyping germline and cancer genomes with high-throughput linked-read sequencing Nature Biotechnology 34, 303-311; Zheng, et al., 2017, Massively parallel digital transcriptional profiling of single cells Nat. Commun. 8, 14049 doi: 10.1038/ncomms14049; International patent publication number WO2014210353A2; Zilionis, et al., 2017, Single-cell barcoding and sequencing using droplet microfluidics Nat Protoc. Jan; 12(1):44-73; Cao et al., 2017, Comprehensive single cell transcriptional profiling of a multicellular organism by combinatorial indexing bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/104844; Rosenberg et al., 2017, Scaling single cell transcriptomics through split pool barcoding bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/105163; Rosenberg et al., Single-cell profiling of the developing mouse brain and spinal cord with split-pool barcoding Science 15 Mar. 2018; Vitak, et al., Sequencing thousands of single-cell genomes with combinatorial indexing Nature Methods, 14(3):302-308, 2017; Cao, et al., Comprehensive single-cell transcriptional profiling of a multicellular organism. Science, 357(6352):661-667, 2017; Gierahn et al., Seq-Well: portable, low-cost RNA sequencing of single cells at high throughput Nature Methods 14, 395-398 (2017); and Hughes, et al., Highly Efficient, Massively-Parallel Single-Cell RNA-Seq Reveals Cellular States and Molecular Features of Human Skin Pathology bioRxiv 689273; doi: doi.org/10.1101/689273, all the contents and disclosure of each of which are herein incorporated by reference in their entirety.

    [0312] In certain embodiments, the invention involves single nucleus RNA sequencing. In this regard reference is made to Swiech et al., 2014, In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9 Nature Biotechnology Vol. 33, pp. 102-106; Habib et al., 2016, Div-Seq: Single-nucleus RNA-Seq reveals dynamics of rare adult newborn neurons Science, Vol. 353, Issue 6302, pp. 925-928; Habib et al., 2017, Massively parallel single-nucleus RNA-seq with DroNc-seq Nat Methods. 2017 October; 14(10):955-958; International Patent Application No. PCT/US2016/059239, published as WO2017164936 on Sep. 28, 2017; International Patent Application No. PCT/US2018/060860, published as WO/2019/094984 on May 16, 2019; International Patent Application No. PCT/US2019/055894, published as WO/2020/077236 on Apr. 16, 2020; and Drokhlyansky, et al., The enteric nervous system of the human and mouse colon at a single-cell resolution, bioRxiv 746743; doi: doi.org/10.1101/746743, which are herein incorporated by reference in their entirety.

    Screening

    [0313] A further aspect of the invention relates to a method for identifying an agent capable of modulating one or more phenotypic aspects of a pathogenic Th1 cell or cell population comprising Th1 cells. The Th1 cell or population comprising Th1 cells can be Th1 cells differentiated in vitro as described herein. In certain embodiments, the method comprises a) applying a candidate agent to the cell or cell population; b) detecting modulation of one or more phenotypic aspects of the cell or cell population by the candidate agent (e.g., expression of one or more genes or program selected from cluster 2, 9 or 7 in Table 3), thereby identifying the agent. The phenotypic aspects of the cell or cell population that is modulated may be one or more genes or biological program specific to a Th1 cell phenotype (e.g., an inflammatory phenotype or suppressive immune phenotype). In certain embodiments, steps can include administering candidate modulating agents to cells, detecting identified cell (sub)populations for changes in signatures, or identifying relative changes in cell (sub) populations which may comprise detecting relative abundance of particular gene signatures.

    [0314] The term modulate broadly denotes a qualitative and/or quantitative alteration, change or variation in that which is being modulated. Where modulation can be assessed quantitativelyfor example, where modulation comprises or consists of a change in a quantifiable variable such as a quantifiable property of a cell or where a quantifiable variable provides a suitable surrogate for the modulationmodulation specifically encompasses both increase (e.g., activation) or decrease (e.g., inhibition) in the measured variable. The term encompasses any extent of such modulation, e.g., any extent of such increase or decrease, and may more particularly refer to statistically significant increase or decrease in the measured variable. By means of example, modulation may encompass an increase in the value of the measured variable by at least about 10%, e.g., by at least about 20%, preferably by at least about 30%, e.g., by at least about 40%, more preferably by at least about 50%, e.g., by at least about 75%, even more preferably by at least about 100%, e.g., by at least about 150%, 200%, 250%, 300%, 400% or by at least about 500%, compared to a reference situation without said modulation; or modulation may encompass a decrease or reduction in the value of the measured variable by at least about 10%, e.g., by at least about 20%, by at least about 30%, e.g., by at least about 40%, by at least about 50%, e.g., by at least about 60%, by at least about 70%, e.g., by at least about 80%, by at least about 90%, e.g., by at least about 95%, such as by at least about 96%, 97%, 98%, 99% or even by 100%, compared to a reference situation without said modulation. Preferably, modulation may be specific or selective, hence, one or more desired phenotypic aspects of an immune cell or immune cell population may be modulated without substantially altering other (unintended, undesired) phenotypic aspect(s).

    [0315] The term agent broadly encompasses any condition, substance or agent capable of modulating one or more phenotypic aspects of a cell or cell population as disclosed herein. Such conditions, substances or agents may be of physical, chemical, biochemical and/or biological nature. The term candidate agent refers to any condition, substance or agent that is being examined for the ability to modulate one or more phenotypic aspects of a cell or cell population as disclosed herein in a method comprising applying the candidate agent to the cell or cell population (e.g., exposing the cell or cell population to the candidate agent or contacting the cell or cell population with the candidate agent) and observing whether the desired modulation takes place.

    [0316] Agents may include any potential class of biologically active conditions, substances or agents, such as for instance antibodies, proteins, peptides, nucleic acids, oligonucleotides, small molecules, or combinations thereof, as described herein.

    [0317] The methods of phenotypic analysis can be utilized for evaluating environmental stress and/or state, for screening of chemical libraries, and to screen or identify structural, syntenic, genomic, and/or organism and species variations. For example, a culture of cells, can be exposed to an environmental stress, such as but not limited to heat shock, osmolarity, hypoxia, cold, oxidative stress, radiation, starvation, a chemical (for example a therapeutic agent or potential therapeutic agent) and the like. After the stress is applied, a representative sample can be subjected to analysis, for example at various time points, and compared to a control, such as a sample from an organism or cell, for example a cell from an organism, or a standard value. By exposing cells, or fractions thereof, tissues, or even whole animals, to different members of the chemical libraries, and performing the methods described herein, different members of a chemical library can be screened for their effect on immune phenotypes thereof simultaneously in a relatively short amount of time, for example using a high throughput method.

    [0318] In some embodiments, screening of test agents involves testing a combinatorial library containing a large number of potential modulator compounds. A combinatorial chemical library may be a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical building blocks such as reagents. For example, a linear combinatorial chemical library, such as a polypeptide library, is formed by combining a set of chemical building blocks (amino acids) in every possible way for a given compound length (for example the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.

    [0319] In certain embodiments, the present invention provides for gene signature screening. The concept of signature screening was introduced by Stegmaier et al. (Gene expression-based high-throughput screening (GE-HTS) and application to leukemia differentiation. Nature Genet. 36, 257-263 (2004)), who realized that if a gene-expression signature was the proxy for a phenotype of interest, it could be used to find small molecules that effect that phenotype without knowledge of a validated drug target. The signatures or biological programs of the present invention may be used to screen for drugs that reduce the signature or biological program in cells as described herein. The signature or biological program may be used for GE-HTS. In certain embodiments, pharmacological screens may be used to identify drugs that are selectively toxic to cells having a signature.

    [0320] The Connectivity Map (cmap) is a collection of genome-wide transcriptional expression data from cultured human cells treated with bioactive small molecules and simple pattern-matching algorithms that together enable the discovery of functional connections between drugs, genes and diseases through the transitory feature of common gene-expression changes (see, Lamb et al., The Connectivity Map: Using Gene-Expression Signatures to Connect Small Molecules, Genes, and Disease. Science 29 Sep. 2006: Vol. 313, Issue 5795, pp. 1929-1935, DOI: 10.1126/science.1132939; and Lamb, J., The Connectivity Map: a new tool for biomedical research. Nature Reviews Cancer January 2007: Vol. 7, pp. 54-60). In certain embodiments, Cmap can be used to screen for small molecules capable of modulating a signature or biological program of the present invention in silico.

    [0321] Further embodiments are illustrated in the following Examples which are given for illustrative purposes only and are not intended to limit the scope of the invention.

    EXAMPLES

    Example 1In Vitro Differentiation of Na?ve T Cells with IL-12 and IL-21 Induces IL-23R.SUP.+ Th1 Cells

    [0322] Although it has been shown in vivo that IFN-?.sup.+ T cells can express IL-23R, these IFN-?-producing cells were identified as transdifferentiated Th17 cells using a fate-mapping approach.sup.19. In fact, chronic stimulation of Th17 cells with IL-23 was shown to increase IFN-? production from Th17 cells and to inhibit IL-17 production.sup.19. However, whether there are bona fide Th1 cells that express IL-23R and thus may be impacted by IL-23 signaling has not been addressed. It has been long established that na?ve T cells differentiated in vitro with IL-12 to become Th1 cells express IL-12R but are not known to express IL-23R.sup.20. Therefore, Applicants sought to identify whether there are bonafide Th1 cells that express IL-23R and undertook a screen to identify a cytokine that in conjunction with IL-12 would efficiently induce IL-23R in Th1 cells in vitro. Th1 cells express IFN-?, IL-2, lymphotoxin (LT) and the master transcription factor T-bet but do not produce IL-17A, the signature cytokine of Th17 cells.sup.20,21. Screening different cytokine conditions (FIG. 5), Applicants discovered that culturing na?ve CD4+ T cells with IL-12+IL-21 for 5 days induces strong expression of IL-23R, together with IFN-? expression, the signature cytokine of Th1 cells (FIG. 1a and FIG. 5). The expression of IL-23R in Th1 cells reached similar levels as in pathogenic Th17 cells that were differentiated with the cytokine combination IL-1?+IL-6+IL-23 (FIG. 1a).sup.8. When Applicants further added IL-23 to the differentiation condition (IL-12+IL-21+IL-23), it slightly increased the expression of Il23r compared to IL-12+IL-21, and it is known that IL-23 can increase the expression of its own receptor (FIG. 1a and FIG. 5). Differentiation of na?ve T cells with IL-12 or IL-18 alone induced minimal expression of IL-23R (FIG. 5). Addition of IL-23 together with IL-12 did also induce Il23r expression, however, the induction of IL-23R and IFN-? expression was more pronounced with IL-12+IL-21. Applicants also measured the expression of Il23r, Ifng, III7a, Tbx21, Rorc and Stat3 in these in vitro differentiated T cells and could confirm the induction of Il23r together with a Th1 cell transcriptional program (FIG. 1b). In summary, Applicants demonstrate that IL-12+IL-21 strongly induces IL-23R expression in Th1 cells in vitro.

    Example 2Single-Cell RNA-Sequencing Identifies Genes in Th1 Cells that are Expressed in an IL-23R Dependent Manner

    [0323] It is known that IL-23R signaling induces a set of genes in Th17 cells that makes them pathogenic, therefore, Applicants studied the impact of IL-23R signaling on Th1 cells. Applicants took advantage of a previously described reporter allele for Il23r expression and chose a two-pronged approach: (1) Applicants differentiated na?ve T cells from reporter mice that carry an eGFP reporter in their endogenous IL-23R locus (Il23r.sup.eGFP/wt) with IL-12+IL-21+IL-23 for 96 hours. Applicants then isolated IL-23R.sup.+ (i.e., eGFP.sup.+) and IL-23R.sup.? (i.e., eGFP.sup.?) cells and conducted scRNAseq of the two populations using Smart-seq2 protocol.sup.22,23. Notably, Applicants added IL-23 to the cytokine combination in this experiment in order to enhance signaling through IL-23R and thus better identify its role in Th1 cells. (2) Secondly, Applicants differentiated na?ve T cells from IL-23R-deficient mice (Il23r.sup.eGFP/eGFP) with the same set of cytokines and sorted eGFP.sup.+ vs. eGFP.sup.? cells for the expression analysis by scRNAseq (FIG. 1c).

    [0324] Applicants analyzed the expression of signature Th1 and Th17 cell genes in these in vitro differentiated cells and confirmed at the single-cell level that IFN-?-expressing Th1 cells co-express IL-23R but do not express Th17 cell signature genes such as Il17a, Il17f and Ccr6. In addition to Ifng, the cells prominently expressed Th1 cell signature genes including Tbx21 and Cxcr3 (FIG. 1d and FIG. 6). A low frequency of cells expressed Rorc, encoding the transcription factor ROR?t associated with Th17 cell differentiation, but the expression of Rorc was minimal when compared to the Th1 cell master transcription factor Tbx21 (FIG. 1d and FIG. 6).

    [0325] Comparing the IL-23R.sup.+ vs. the IL-23R.sup.? subsets from the wildtype cells (Il23r.sup.eGFP/wt) provided a way to identify genes that may be co-expressed with IL-23R (FIGS. 1e and f). Here, Applicants identified a set of 528 differentially expressed (DE) genes whose expression in Th1 cells is positively or negatively associated with the presence of IL-23R and may be involved in pathogenicity of Th1 cells similar to how IL-23R signaling promotes pathogenicity of Th17 cells.sup.13,24. Indeed, the set of genes that were co-expressed with IL-23R included critical effector molecules and transcription factors including Il18r1 and Stat5a (FIG. 1e and Table 1).

    [0326] Strikingly, Applicants found that the number of differentially expressed genes between the eGFP.sup.+ and eGFP.sup.? populations in knockout cells (Il23r.sup.eGFP/eGFP) was substantially lower than the IL-23R.sup.+ vs. IL-23R.sup.? comparison in wildtype cells (129 vs 528 at FDR<0.1 with only 33 genes overlapping). These eGFP.sup.+ knockout cells would reflect differentiation in response to IL-12 plus IL-21 in the absence of IL-23R signaling. This finding suggests that the majority of genes Applicants identified in the wildtype cells as being differentially expressed between the IL-23R.sup.+ and IL-23R.sup.? populations are more likely to be directly affected by IL-23R signaling.

    [0327] Applicants then undertook a combined analysis of the expression profiles from both wildtype and IL23R-deficient cells to better distinguish genes directly regulated by IL-23R signaling in Th1 cells (FIG. 1g). To this end, Applicants combined the datasets and incorporated model terms for the presence of eGFP, the genotype (wildtype or IL-23R-deficient), and the interaction of eGFP and genotype (see methods for full details). By testing the interaction term, Applicants sought genes whose expression difference between eGFP.sup.+ and eGFP.sup.? cells was dependent on the genotype. In this manner Applicants identified altogether 219 genes where the presence of wildtype IL-23R was associated with an increase in expression in eGFP.sup.+ cells compared to eGFP.sup.? cells. Of those, Dusp2, Gpr18, Trim27, Itgb1, Gzmb, Pde4b, Plek, Thap11, Panx1, Peli1, Rac1 and Lamp1(CD107a) appeared of particular interest as novel candidate genes dependent on IL-23R signaling and potentially important for pathogenicity of Th1 cells (FIG. 1g and Table 1). Some of these genes have been implicated previously in autoimmune inflammation, such as Panx1.sup.25 and Rac1.sup.26. The finding that these genes are regulated in an IL-23R-dependent manner suggests an important function in Th1 cells.

    [0328] In summary, in addition to pathogenic Th17 cells, Applicants find that Th1 cells can be induced to express IL-23 receptor in vitro through culture with IL-12+IL-21 and that the single-cell transcriptomic profile corresponds to that of Th1 cells. Through this process, Applicants have further identified a unique gene set associated with IL-23R signaling in Th1 cells.

    Example 3IL-23R.SUP.+ Th1 and IL-23R+Th17 Cells Share Common Gene Signatures but Also Display Subset-Specific Features

    [0329] To investigate whether IL-23R.sup.+ Th1 and IL-23R.sup.+ Th17 cells share common features, Applicants differentiated pathogenic Th17 cells with IL-1?+IL-6+IL-23 and sorted IL-23R.sup.+ (i.e., eGFP.sup.+) and IL-23R.sup.? (i.e. eGFP.sup.?) cells for single-cell analysis comparing their transcriptional profiles with those of Th1 cells described above. Interestingly, Applicants find a set of 147 genes whose expression in IL-23R.sup.+ and IL-23R.sup.? cells is shared by Th1 and Th17 cells (FIG. 7a and Table 1). Among the genes highly expressed in both IL-23R.sup.+ Th1 and Th17 cells, Applicants find Il22, which has been identified previously as a core component of the pathogenicity signature of Th17 cells.sup.9,11. Some genes (179) were expressed only in Th1 cells differentially between IL-23R.sup.+ and IL-23R.sup.? cells such as Il18r1 and Ifng (FIG. 7b and Table 1). Interestingly, 93 genes showed the exact opposite profile in Th1 and Th17 cells, one of which was Il27ra which was highly expressed in IL-23R.sup.? Th1 cells (FIG. 7c and Table 1). Finally, Il17a and Il17f were prominently expressed in IL-23R.sup.+ cells in Th17 cells only and were among 158 genes that were differentially expressed between IL-23R.sup.+ cells and IL-23R.sup.? cells only in Th17 cells (FIG. 7d and Table 1). These results suggest that IL-23R induces a common Th1/Th17 pathogenicity expression profile but also induces a distinct set of genes in Th1 and Th17 cells that likely contribute to their pathogenicity to exert lineage-specific phenotype and function.

    Example 4IL-23R Deficiency Protects from Th1 Cell Adoptive Transfer Colitis

    [0330] GWAS analysis has implicated IL-23R as a major risk gene for IBD.sup.5, but the actual mechanism by which IL-23R signaling promotes the disease has not been fully elucidated. It has been known that na?ve T cells that lack IL-23R lose the ability to induce adoptive transfer colitis, presumably by not developing Th17 cells and promoting differentiation of FoxP3+Tregs.sup.3,14,18. However, as bonafide Th1 cells elicit adoptive transfer colitis.sup.7, Applicants assessed the issue of whether IL-23R has a role in these pathogenic Th1 cells to induce colitis. To test the contribution of IL-23R to the pathogenicity of Th1 cells in vivo, Applicants differentiated wildtype (I123.sup.eGFP/wt) and IL-23R-knockout (Il23r.sup.eGFP/eGFP) Th1 cells in vitro with IL-12+IL-21+IL-23 (see methods for details) and then adoptively transferred them to RAG1.sup.?/? recipients (FIG. 2a). Strikingly, Applicants found that Th1 cells that lack IL-23R do not efficiently induce severe colitis, as determined by the histopathological exam of the colon (FIG. 2b). The results therefore establish an important function of IL-23R in the pathogenicity of Th1 cells and their ability to induce colitis.

    [0331] To test whether the transferred Th1 cells produced IFN-? or had transdifferentiated into IL-17A-producing Th17 cells, Applicants isolated colonic intraepithelial lymphocytes (IEL) as well as lamina propria lymphocytes (LPL) and tested these cells for the production of IFN-?, IL-17A and GM-CSF. Animals that received wildtype (Il23r.sup.eGFP/wt) Th1 cells had a dramatically increased frequency of CD4.sup.+ intraepithelial lymphocytes and lamina propria lymphocytes, up to 60-70% of the entire CD45.sup.+ population vs. 4%-9% in recipients of knockout (Il23r.sup.eGFP/eGFP) Th1 cells, pointing to the ongoing inflammatory process (FIGS. 8a, d and f). Interestingly, Applicants found that in the animals studied here, the CD4.sup.+ T cells had largely maintained their production of IFN-? and had not significantly deviated into IL-17A-producing cells (FIGS. 8b, e and g). Furthermore, a sizable frequency of IFN-?-producing cells in the colon also produced GM-CSF (FIG. 8c). It is known that both in the EAE model and the colitis model Applicants used here, Th17 cells show extensive plasticity and become IL-17A.sup.+/IFN-?.sup.+ double positive.sup.7,19. The results suggest that at least in these settings, Th1 cells were not plastic and retained a Th1 cell phenotype. Taken together, these data suggest that colitogenic Th1 cells require IL-23R expression in order to induce disease in vivo similar to Th17 cells and that these cells do not transdifferentiate towards a Th17 phenotype. Therefore, pathogenicity mediated by IL-23R signaling is separable and not limited to Th17 cells in vivo.

    Example 5Single-Cell RNA-Sequencing Reveals Transcriptional Signatures of Colitogenic Intestinal Lymphocytes and their Dependence on IL-23R Signaling

    [0332] To gain a better understanding of the transcriptional programs that may be driven by IL-23R in transferred Th1 cells and therefore associated with pathogenicity, Applicants isolated CD45.sup.+CD4.sup.+ infiltrating T cells from the intestinal mucosa (both the intraepithelial lymphocytes, IEL, and the lamina propria lymphocytes, LPL) from animals that received either wildtype or IL-23R KO cells by fluorescence-activated cell sorting (FACS). Applicants then performed massively parallel single-cell transcriptional profiling by 10?technology of 32,763 cells (FIG. 2a).

    [0333] The cells primarily cluster depending on which tissue they were isolated from, with splenic CD4.sup.+ T cells segregating from cells of intestinal origin (FIG. 2c). These results confirm previous findings that T cells acquire distinct transcriptional profiles depending on whether they are isolated from secondary lymphoid organs such as the spleen or reside in tissues such as the intestine.sup.27. Applicants find the expression of 1224 genes was strongly associated with the tissue of origin (FDR<0.1, |log FC|>0.5), whereas other genes showed a broader expression in cells of all tissue origins (FIG. 2d and Table 2). For instance, CD69 has been proposed as a marker of tissue residency in T cells including in T.sub.RM (tissue resident memory) cells and the precise tissue specific expression of Rgs1 suggests that it could be involved in trafficking and tissue residency as well, in particular in the intestinal mucosa.sup.28. Klf2, a transcription factor that is important for the expression of CD62L and S1pr1, and which was shown to direct lymphocyte trafficking was highly upregulated in splenic cells suggesting an antagonistic function to CD69 and potentially Rgs1 as well.sup.29. Interestingly, the chemokine Cxcl10 was particularly highly expressed in T cells within the LPL but not IEL (FIG. 2d), suggesting a very specific autocrine/paracrine regulation, in particular since the contribution of Cxc110 to the trafficking and retention of pro-inflammatory Th1 cells expressing the corresponding receptor Cxcr3 has been previously identified.sup.30,31. Overall, multiple chemokine-related transcripts were expressed in a compartment-specific fashion and therefore likely contribute to the trafficking of Th1 cells to the intestine (FIG. 2d).

    [0334] In terms of their splenic transcriptional profiles, it appeared that the wildtype Th1 cells (Il23r.sup.eGFP/wt) and the knockout cells (Il23r.sup.eGFP/eGFP) isolated from recipient mice were rather uniformly distributed (FIG. 2e). Strikingly, the wildtype and KO cells appeared to instead segregate within the intestinal tissues, suggesting that Th1 cells from the wildtype vs. IL-23R KO mice may attain transcriptionally different expression profiles when they infiltrate the intestine (FIG. 2e). Applicants then asked which genes would be differentially expressed between wildtype and KO cells across the four analyzed tissues (spleen, LPL small intestine (SI), LPL colon and IEL colon) and identified between 84 and 190 genes per tissue (FDR<0.1 and |log FC|>0.5) (Table 2). Applicants identified genes such as Gpr18, Cd160 and Zfp36l2 being differentially expressed dependent on IL-23R signaling in all or most tissues in vivo (FIG. 2f). Interestingly, the chemokine Ccl5 (RANTES), a ligand of Ccr5, exhibited a clear IL-23R dependent expression within the intestine only, suggesting that the regulation of Ccl5 is particularly relevant within the tissue and that IL-23R might contribute to pathogenicity by enabling inflammatory cells to migrate to tissues. Cxcl10 did not show such IL-23R dependent regulation (FIG. 2f). Taken together, the observations support the notion that IL-23R signaling affects the tissue-specific transcriptional expression of novel genes relevant to intestinal inflammation.

    Example 6IL-23R Drives the Expansion of Highly Inflammatory and Colitogenic Th1 Cells in the Lamina Propria as Uncovered by scRNAseq

    [0335] Lymphocytes residing within the lamina propria exert a critical contribution to elicit intestinal inflammation.sup.32. Therefore, Applicants decided to focus on these samples (both from the colon and small intestine) in wildtype (Il23r.sup.eGFP/wt) and IL-23R KO (Il23r.sup.eGFPeGFP) cells (FIG. 3a). Applicants partitioned all cells into clusters and identified a total of 12 distinct clusters with characteristic transcriptional profiles within the LPL (FIG. 3b). Applicants then sought to identify clusters consisting of cells with a highly pro-inflammatory and colitogenic gene signature that may be responsible for mediating colitis. Importantly, Applicants noted differential contribution of wildtype or KO cells to some clusters, especially clusters 2, 8, 9 and 10 were dominated by cells from wildtype animals (Il23r.sup.eGFP/wt) whereas clusters 5 and 7 were dominated by KO cells (Il23r.sup.eGPF/eGFP) (FIG. 3c). Based on their transcriptional profiles, Applicants found that clusters 2 and 9 consisted of cells that exhibited a highly colitogenic gene signature and may have the ability to drive intestinal inflammation which will be highlighted in detail below (FIG. 3d).

    [0336] Applicants found that the characterizing genes of cluster 9 (one vs. all comparison, FDR<0.1, |log FC|>0.5 and Table 3) encode a wide range of molecules essential for inflammation and colitis. For example, among the most highly expressed genes was Itgae (CD103) which has been shown to enable pathogenic T cells to migrate to their target tissue and is characteristic of pro-inflammatory colonic T cells in ulcerative colitis.sup.33,34. Another highly expressed gene, Ccr9, encodes a gut homing receptor and has been shown to play a crucial role in colitis.sup.35. Previously, it was shown that the transmembrane glycoprotein CD38 is important for intestinal inflammation.sup.36. Likewise, CD48, a SLAM (signaling lymphocyte activation molecule) family member, is crucial for T cell function in colitis and it has been suggested that CD48 may represent a useful target in human IBD.sup.37. Strikingly, an ORF (open reading frame) within the gene AW112010 (encoding a long-noncoding RNA) which was among the top 20 differentially regulated genes within cluster 9 in the data set has been recently shown to be essential in mucosal immunity including colitis.sup.38. The expression of this ORF is fairly broad across clusters and the locus appears to be transcribed in the vast majority of cells. However, the expression of AW112010 shows a dramatic increase in expression within the inflammatory cluster 9 (FIG. 3d).

    [0337] Importantly, in addition to the genes in cluster 9 that have been implicated in the development of colitis, the cluster also contained novel genes not previously associated with the development of colitis. For example, Cd160, the most upregulated gene in cluster 9 encodes an Ig superfamily member.sup.39 and has not been assigned a function in colitogenic T cells yet. The gene encoding the nectin receptor family member Cd226 (DNAM-1), was also part of the signature of highly expressed genes in cluster 9. Co-stimulatory receptors such as CD226 play a critical role in T cell activation, autoimmunity and cancer.sup.40. Previously, CD226 was shown to be crucial for the activation of cytotoxic lymphocytes and Th1 cells and its expression within cluster 9 suggests that it may play an important role in intestinal inflammation.sup.41,42. In summary, the transcriptional analysis of cluster 9 exhibits an entire array of genes critical for intestinal inflammation and identifies novel potential genes important for intestinal inflammation such as Cd160.

    [0338] Many genes highly expressed in cluster 2 are implicated in IFN-? signaling (FIG. 3d and Table 3). In fact, IFN-? signaling has early been identified as being critical for intestinal inflammation in various pre-clinical models of colitis.sup.31,43. For example, top differentially genes in this cluster were Ifitm1 (interferon-inducible transmembrane protein), Ifitm2 and Ifitm3. Members of this family are interferon response genes that have been shown to be entry sites in viral infection.sup.44. A study in human IBD patients identified IFITM1 as a potential prognostic marker in ulcerative colitis.sup.45. Interestingly, Applicants identified many integrins as being part of the list of genes highly expressed within cluster 2, with Itgb1 as the second highest differentially expressed gene and which has previously been implicated in colorectal cancer.sup.46. Two additional integrins highly upregulated in cluster 2 (albeit not among the top 20 differentially expressed genes) were Itga4 (position 101) and Itgb7 (position 32). Strikingly, a recent study demonstrated that targeting the leukocyte integrin a4p.sub.7 with vedolizumab was more effective in moderately to severely active ulcerative colitis than adalimumab (a humanized monoclonal antibody neutralizing TNF).sup.47.

    [0339] The observation, that many genes implicated in IFN-? signaling and lymphocyte trafficking (integrins) were highly upregulated in cluster 2 suggests that this cluster consisted of inflammatory cells that could potentially represent the cellular phenotype of early potential drivers of the intestinal inflammatory response.

    [0340] The other two clusters that were enriched in wildtype cells (Il23r.sup.eGFP/wt) were clusters 8 and 10.

    [0341] Cluster 8 represented a cluster of highly proliferating cells exemplified by the expression of Ki-67 and genes important for cell cycle progression such as Cdc (cell division cycle) genes, including Cdc6 (critical for the initiation of DNA synthesis.sup.48) and Cdc20, which is known to activate the anaphase promoting complex/cyclosome APC/C.sup.49 (FIG. 9). The observation that cluster 8 was highly enriched with wildtype cells suggests that these cells were actively proliferating within the tissue to contribute to the inflammatory process.

    [0342] Cluster 10 on the other hand showed high expression of Ccr7 which is commonly correlated with an ability of T cell trafficking and homing to lymph nodes and Peyer's patches.sup.50. In addition, cluster 10 cells expressed higher levels of the anti-apoptotic gene bcl2 which is known to be driven by STAT5 signaling and may be an interesting target in IBD as suggested in pre-clinical studies.sup.51.

    [0343] In summary, using single-cell RNA-sequencing, Applicants identify distinct clusters of T cells within the intestinal mucosa that exhibit a highly inflammatory profile, in particular clusters 2 and 9. Furthermore, the observation that these clusters are dominated by wildtype cells suggests that IL-23R signaling critically contributes to the observed expression of inflammatory genes. Importantly, Applicants succeed in identifying novel genes such as Cd160 that may play an important role for intestinal inflammation and IBD.

    Example 7IL-23R is Implicated in the Reciprocal Regulation of Tr-1 Like Cells and Limits their Expansion

    [0344] Cluster 7 was particularly interesting as it is strongly enriched with IL-23R KO cells which would suggest that this cluster contains predominantly non-pathogenic T cells (FIG. 3c). The 117 genes that characterize this cluster (one vs. all comparison, FDR<0.1, log FC>0.5) include Eomes, Cd27, Gzmk, Lag3 and Il10 (FIG. 3d and FIGS. 10a and b). This finding was of particular significance as these genes have been recently identified to define a novel human IFN-?.sup.+IL-1?+Tr1-like cell type that may be reduced in IBD patients.sup.52. In fact, Eomesodermin (Eomes) has been shown to be a key transcription factor of a Tr1-like lineage.sup.51. The finding that cluster 7 is predominantly composed of IL-23R KO cells suggests that IL-23R may function as an important gatekeeper and negative regulator for the development of Tr1-like cells in the colonic mucosa. Previously, it was shown that IL-23R is indeed expressed on these IFN-?.sup.+IL-1?+Tn-like cells and therefore IL-23 signaling could potentially regulate development and function of this population.sup.54. To Applicants knowledge, this study is the first to provide functional evidence that IL-23R may act as a negative regulator of such Tr1-like cells. In addition, PD1 was shown to be expressed on human Tn-like cells which is highly consistent with the data presented here.sup.54 (FIG. 3d). In fact, it was shown that PD1 is implicated in the conversion of human T-BET.sup.+ Th1 cells to FOXP3.sup.+ Tregs.sup.55. Other co-inhibitory molecules such as Lag-3 were also more highly expressed in cluster 7 (FIG. 3d and FIG. 10b). Applicants used a published transcriptional signature that characterizes human Tr-1 like cells and were able to show that it identifies cluster 7 (upregulated compared to other clusters, Wilcoxon rank-sum test p<10.sup.?200) providing strong evidence that the cells of cluster 7 are the equivalent of these human cells in this study (FIG. 10c).sup.52. In summary, the results suggest that IL-23R signaling balances the differentiation of colitogenic Th1 vs. Tr cells and therefore effector vs regulatory arms of the immune response.

    [0345] Interestingly, comparing WT to KO cells within cluster 7 revealed a set of heat shock protein family members, in particular Hspa1a and Hspa1b (FIG. 10d). Heat shock proteins are implicated in the regulation of T cell responses and specific single nucleotide polymorphisms have recently been identified in HSPA1L that distinguish IBD patients from healthy controls.sup.56,57. The finding suggests that heat shock proteins of the Hsp70 family, in particular Hspa1a and Hspa1b, may be protective in IBD and regulated in an IL-23R dependent manner.

    Example 8Comparative Analysis of Human IBD GWAS with the scRNAseq Study Nominates Genes of Particular Interest for the Function of Colitogenic Th1 Cells in an IL-23R Dependent Manner

    [0346] It has become clear from genome-wide association studies (GWAS) that IL-23R plays an important role in IBD.sup.5. To investigate if IL-23R signaling is particularly relevant to the expression of other genes found within human IBD GWAS loci in T cells, Applicants conducted a survey of the roughly 240 IBD risk loci that have been identified so far.sup.58-61 and tallied their associated genes (about 700 genes in total).sup.58. Within loci that contain multiple genes, Applicants focused on genes that were found to be implicated, for example, by fine-mapping or by expressed quantitative trait loci (eQTL) analysis which reduced the list of genes that Applicants further investigated to 597. Since Applicants established that clusters 2 and 9 were dominated by wildtype cells with a highly inflammatory transcriptional signature Applicants focused the analysis on these two clusters in addition to cluster 7 which was dominated by KO cells to investigate the potential contribution of genes found in GWAS loci to IL-23R mediated pathogenicity. Applicants used within-cluster comparison of WT vs. KO cells and identified genes found within IBD GWAS loci that were expressed in an IL-23R dependent manner (FIG. 3e and Table 3). This finding suggests that IL-23R signaling in Th1 cells may be relevant to induction of genes implicated through GWAS in the development of IBD.

    [0347] Among the genes in the set implicated through GWAS were Gpr18, Traf3ip2, Ncf4 and Ets1.

    [0348] Gpr18 was particularly highly expressed in clusters 2 and 9 in an IL-23R dependent manner. Recently, it was shown that certain mutations are increased in ulcerative colitis including in the gene Traf3ip2 (encoding Act1) which is part of the NFKBIZ pathway.sup.62. Ncf4 plays an important role in cellular reactive oxygen species (ROS) pathways as part of the NOX2 (NADPH oxidase 2) complex. Ets1 is a transcription factor and essential co-factor of Tbet in Th1 cell-mediated inflammatory responses.sup.63

    [0349] Adhesion and migration regulate major biological outcomes of T cell-mediated autoimmunity. Interestingly, a number of genes implicated in these processes were part of the identified gene signatures of cluster 2, in particular Lsp1, Lpxn (Leupaxin) and Fermt3. Applicants hypothesize that IL-23R signaling may exert pathogenicity also through downstream effects on migration and adhesion.

    [0350] Notably, some genes were not limited to clusters 2 and 9 in their IL-23R-dependent expression such as Zfp36l2 but exhibited this pattern also across other clusters including cluster 7 suggesting that their genotype-dependent expression may be too dominant than to be confined to a particular cluster (FIG. 3e). Zfp36l2 belongs to a family of RNA binding proteins that have been implicated in Th17 cell biology but their contribution to Th1 cell-mediated autoimmunity remains unknown.sup.11,64.

    [0351] The findings illuminate genes implicated in cellular pathways ranging from trafficking, cellular adhesion (integrins), metabolic regulators and immune cell interaction identified in GWAS IBD risk loci that may prove critical in their contribution to intestinal inflammation driven by IL-23R in colitogenic T cells. The observation that these genes found in GWAS IBD risk loci are driven by IL-23R in colitogenic Th1 cells may suggest that IL-23R and these genes converge mechanistically in a disease relevant manner.

    Example 9Ranking Identifies Novel Genes as Drivers of Intestinal Inflammation in an IL-23R Dependent Manner

    [0352] In many cases, the combinatorial analysis of several data sets yields a comprehensive insight into useful targets for further analysis as critical genes may not only emerge as being the top differentially expressed genes in a singular data set. Therefore, Applicants combined both in vitro and in vivo single-cell RNA-sequencing data sets Applicants reported above and included data from human IBD GWAS to rank the genes that may have an impact on the development of colitis.

    [0353] Applicants postulated the following criteria that were important and queried the data set for genes that would match as many criteria as possible: (1) As Applicants were particularly interested in genes potentially conferring pathogenicity, Applicants focused on genes that were most highly expressed in clusters 2 and 9 in comparison to all other clusters and that were differentially expressed between wildtype and KO cells within either cluster 2 or 9; (2) Genes of particular importance to intestinal inflammation may exhibit a highly tissue specific expression and therefore Applicants evaluated their expression comparing splenic and intestinal samples; (3) Applicants asked which genes showed an TL-23R dependent expression in Th1 cells differentiated under IL-12+IL21+TL-23 in vitro; (4) Applicants incorporated as one criterion whether a given gene was previously identified in human GWAS to confer risk and/or is located within a GWAS risk locus for IBD (FIG. 4a and Table 4, see methods for details of ranking).

    [0354] Gpr18 scored very highly in all criteria including being located within a GWAS risk locus.sup.61. Interestingly, it was shown that Gpr18 plays a crucial role for CD8aa.sup.+ intraepithelial T lymphocytes within the intestinal mucosa.sup.65. The studies suggest it may be a critical mediator of pathogenicity by IL-23R in colitogenic Th1 cells.

    [0355] The transcription factor NF-fB is critical to T cell function and in particular mutations within the NFKBIZ pathway were recently found to be relevant in ulcerative colitis.sup.62. Nfkbiz itself scored highly in the ranking data as a target in colitogenic T cells (FIG. 4a).

    Example 10CD160 Plays an Important Role in Colitogenic Th1 Cells

    [0356] Finally, Applicants sought to provide conclusive evidence of the critical contribution of candidate genes identified in the studies to T cell-driven intestinal inflammation. To this end, Applicants acquired knockout mice for Cd160, the top differentially expressed signature gene of inflammatory cluster 9 and which ranked prominently in the ranking scheme (FIG. 4a).sup.66. CD160 is an Ig superfamily member and its function in inducing colitogenic T cells and IBD has not been investigated. It has been shown to be important for IFN-? production in NK cells and being expressed on intraepithelial CD8.sup.+ T cells.sup.66,67. Applicants differentiated na?ve T cells from these CD160 KO mice to Th1 cells in vitro as described above and tested their ability to elicit adoptive transfer colitis. Applicants did not observe a difference between wildtype and CD160 KO Th1 cells to produce IFN-? or GM-CSF prior to adoptive transfer in vitro (FIGS. 11a and b). The cells did not express any IL-17A prior to adoptive transfer. Strikingly, the recipient animals that received CD160 deficient Th1 cells showed a strong protection from colonic inflammation as assessed by histopathological examination (FIG. 4b). The decrease of inflammation showed a clear trend in the small intestine and was statistically significant in the colon (FIGS. 4b and c) The histopathological analysis was consistent with the shortening of the colon in recipients of wildtype cells (FIG. 4d). When Applicants isolated T cells from mesenteric lymph nodes from recipients of either wildtype or CD160 knockout cells Applicants did not observe a significant difference in IFN-? expression which was consistent with the observations in vitro suggesting that it was likely not any lack in the ability to produce IFN-? that protected recipients of CD160 KO cells from developing severe colitis (data not shown). Previously, it was shown that CD160 is important for Gzmb expression in intestinal CD8+ T cells which helps to clear Listeria monocytogenes infection.sup.66. Interestingly, this was highly consistent with the observation that CD160 KO cells differentiated in vitro with IL-12+IL+21+IL23 produced less Gzmb compared to wildtype cells which could contribute mechanistically to their diminished colitogenicity in vivo (FIG. 4e). Taken together, the results demonstrate an important function of CD160 to the colitogenicity of Th1 cells in an IL-23R dependent manner.

    Example 11Discussion

    [0357] IL-23R function has been considered a critical driver of pathogenicity in Th17 cells and important for the regulation of FoxP3.sup.+ Tregs but not for other T helper cell subsets. However, several experimental and clinical observations have been difficult to reconcile under this assumption. Applicants provide compelling evidence that IL-23R plays an important role in other pathogenic T cell subsets, in particular a subset of IL-23R.sup.+ Th1 cells.

    [0358] First, Applicants report that bonafide Th1 cells can be differentiated in vitro with IL-12+IL-21 and express similar levels of IL-23R as pathogenic Th17 cells polarized with IL-1?+IL-6+IL-23. This illustrates how the combinatorial action of cytokines crucially determines the functional outcome since IL-21 has been shown to participate with TGF-? to induce pro-inflammatory Th17 cells, not Th1 cells.sup.68. In Th17 cells, IL-6 has been shown to induce IL-21 that promoted IL-23R expression in an autocrine manner, and this induction was STAT3 dependent.sup.69. Which transcription factor mediates the induction of IL-23R in Th1 cells differentiated with IL-12+IL-21 remains to be determined. However, one such transcription factor could be c-MAF that has been shown to bind to the IL-23R promoter and to work in conjunction with IL-21 in some non-Th17 cells, in particular in the setting of autoimmune diabetes which is known to be Th1 cell-driven.sup.70-72.

    [0359] Applicants continue to show that IL-23R is required in Th1 cells in vivo to acquire full pathogenicity to elicit adoptive transfer colitis. Applicants take advantage of scRNAseq to profile 32,763 cells in a pre-clinical model of colitis including roughly 20000 intestinal T cells and uncover transcriptional signatures that are governed by IL-23R and that are critical to the emergence of pathogenic and colitogenic Th1 cells. The inflammatory signatures of the pre-clinical model were highly reminiscent of human studies in IBD as outlined above. Applicants identify novel candidate genes for T cell-mediated IL-23R dependent pathology and provide a framework of genes identified in previous IBD GWAS as potential drivers in colitogenic Th1 cells. The study therefore contributes to the important effort of identifying and validating genes found within GWAS risk loci having an important function in colonic inflammation and their implication in colitogenic T cells.

    [0360] Previously, it was shown that Th17 cells show extensive plasticity during an inflammatory response and that Th17 cells eventually may develop features of Th1 cells by upregulating Tbx21 and expressing IFN-? both in mouse and human.sup.1973,7.sup.4. IL-23R was shown to play an important role in this lineage plasticity.sup.19 and it was assumed that IL-23R bearing Th cells that express IFN-? are solely transdifferentiated Th17 cells. Interestingly, it was shown in the adoptive transfer model of colitis that Th17 cells convert to Th1 cells and that this appears to be essential to Th17 cell mediated disease in this model.sup.7. Importantly, Applicants show that bonafide Th1 cells can be differentiated to express Il23r in vitro and that IL-23R deficient Th1 cells lose their ability to elicit intestinal inflammation. Interestingly, Applicants did not observe extended plasticity in the Th1 cells adoptively transferred in the study towards a Th17 cell phenotype. With the exception of cluster 3 in the LPL that contained cells showing a transcriptional signature of Th17 cells including expression of Ccr6, Il17a, Il22, Il17re and Il17f, however, Applicants did not identify IL-17A.sup.+ cells by intracellular cytokine when retrieved from the intestinal mucosa in RAG1 KO recipients. Thus, the vast majority of LPL cells showed a strong transcriptional signature of bona fide Th1 cells including expression of Il12rb1, Il12rb2, Cxcr3, Stat1, Stat4, Tbx21 and Ifng.

    [0361] Applicants speculate that Th1 cells represent a further advanced state of inflammatory trajectory that may be reached with or without transitioning through a Th17 cell state. Strikingly, it has been demonstrated that both Th17 and Th1 cells may ultimately give rise to T cells with regulatory function at the resolution of inflammation.sup.55,75.

    [0362] Importantly, Applicants describe here a dichotomous function of IL-23R in promoting inflammatory cells on one hand and on the other hand limiting the expansion of Tr cells with a regulatory function, identified by expression of signature genes such as Eomes, Cd27, Il10ra, Il10, Gmzk and co-inhibitory receptors Lag-3 and Pdcd1. A concept is evolving in which IL-23R serves not only as a critical driver of inflammatory T cells but a central integrator of immune responses within the local immunological milieu. In fact, in addition to the emergence of Tr1-like cells in IL-23R deficient cells in the study, it has been shown previously that IL-23R is also expressed on colonic FoxP3.sup.+ Tregs, making these cells receptive to sudden inflammatory changes that limit their suppressive effector functions in the presence of the pro-inflammatory cytokine IL-23.sup.14,15.

    [0363] In the setting of Th17 cells, it was shown that the salt-sensing kinase Sgkl is important in regulating their plasticity toward FoxP3.sup.+ T cells.sup.76. Which mediators downstream of IL-23R signaling suppress a Tr1 cell fate in Th1 cells remains to be determined.

    [0364] A ranking scheme combining both in vitro and in vivo transcriptional signatures and their dependence on IL-23R signaling enabled us to identify novel drivers of T cell pathogenicity and Applicants succeeded in validating one of these candidates, CD160. Indeed, CD160 emerged in a recent study profiling the cellular composition and transcriptional signatures of ileal biopsies from Crohn's patients although the functional significance remained unclear.sup.77. Interestingly, CD160 was shown to be very important for intraepithelial type I ILCs which are amplified in Crohn's disease and was important for the pathogenicity of ILCis in the anti-CD40 colitis model in addition to control of L. monocytogenes infection. These data suggest that CD160 is not only important for CD4.sup.+ T cells as demonstrated in the study but for other immune cells such as ILC1s and CD8.sup.+ T cells as well.sup.66,78. To validate that Applicants had not inadvertently included immune cells other than CD3.sup.+CD4.sup.+ T cells in the analysis that have been shown to express CD160, Applicants confirmed that the cells sequenced lacked expression of NK cell markers and expression of CD8 (FIG. 12).

    [0365] Another important candidate that emerged and which scored highly in all categories in the ranking (FIG. 4a) was Gpr18. Interestingly it was identified as a central part of a transcriptional signature in myeloid cells driving a Th1 cell intestinal inflammation triggered by the colonization of germ-free mice with Klebsilla isolated from a Crohn's patient.sup.79

    [0366] In summary, Applicants uncouple IL-23R as a purely Th17 cell-specific pathogenicity factor and implicate it in being critical for evoking a pathogenic phenotype in Th1 cells. Furthermore, through the powerful combination of a highly relevant pre-clinical model of colitis with massively parallel single-cell RNA-sequencing and integration of GWAS data from IBD patients, Applicants identify novel potential drivers of IL-23R-mediated T cell pathogenicity and validate one of these candidates. Applicants hope that the discovery of the role of IL-23 in the induction of pathogenic Th1 cells and their contribution to autoimmune disease on one hand and the inhibition of IL-10 producing Tr cells on the other hand may identify novel targets and prove useful for the development of therapeutic intervention in multiple human autoimmune diseases.

    Example 12Materials and Methods

    [0367] Mice. IL-23R.sup.eGFP reporter mice were described previously (Awasthi et al., 2009). The following strain was purchased from The Jackson Laboratories: B6.129S7-Rag1.sup.tm1Mom/J (known as Rag1.sup.?/?; Stock No.: 002216). CD160.sup.?/? mice were a kind gift of Dr. Arlene Sharpe and previously described (Tan et al., 2018). All animals were bred and maintained under specific-pathogen-free (SPF) conditions. Genotyping was performed with DNA isolated from tail biopsies. All experiments were approved by and carried out in accordance with guidelines of the Institutional Animal Care and Use Committee (IACUC) at Harvard Medical School and Brigham and Women's Hospital.

    [0368] In vitro T cell differentiation. A single-cell suspension was prepared from spleen and lymph nodes and red blood cells were removed by lysis with ACK buffer (Lonza). CD4.sup.+ T cells were enriched using microbeads (Miltenyi Biotec, Cat. #.: 130-117-043). Na?ve CD4.sup.+ T cells (CD4.sup.+CD44.sup.low CD62L.sup.highCD25.sup.?) were isolated by fluorescence-activated cell sorting (FACS) using a custom-built BD FACSAria instrument. Sorted na?ve CD4+ T cells were activated with plate-bound anti-CD3 and anti-CD28 antibodies (1 ?g/ml; BioXCell; Clone 145-2C11 and clone PV-1, respectively) in 96-well flat-bottom plates (50-100?10.sup.3 cells/per well). Cells were cultured for 5 days (cytokine screen) with the following cytokine concentrations: IL-1? (20 ng/ml); IL-6 (25 ng/ml); IL-23 (20 ng/ml); IL-12 (20 ng/ml); IL-21 (20 ng/ml); TGF-? (2 ng/ml); IL-18 (20 ng/ml). All recombinant cytokines were purchased from Biolegend (IL-21), R&D (IL-12, IL-1?, IL-6, IL-23) and Miltenyi Biotec (hTGF-?).

    [0369] Flow cytometry and antibodies. Single-cell suspensions were stained with diluted antibodies (1:100) in ice-cold PBS+2% FBS. Dead cells were identified with either 7-AAD (BD Biosciences) or viability dye eFluor 506 (eBioscience). For intracellular cytokine staining (ICC), cells were stimulated for 4 hr at 37? C. with phorbol 12-myristate 13-acetate (PMA, Sigma), ionomycin (Sigma) and monensin (GolgiStop; 1:1000; BD Biosciences). Then, cells were stained for surface markers and viability. Cells were fixed and permabilized according to the manufacturer's instructions (BD Cytofix/Cytoperm kit). All flow cytometric data were acquired with either a BD LSRII or Fortessa instrument and analyzed with FlowJo (BD).

    [0370] The following antibodies labeled with different fluorophores were purchased from Biolegend unless otherwise indicated: anti-CD4 (RM4-5), anti-CD25 (PC61), anti-CD44 (IM7), anti-CD62L (Mel14), anti-IL-17A (TC11-18H10.1), anti-IFN-7 (XMG1.2), anti-GM-CSF (MP1-22E9, BD), anti-CD45 (30-F11).

    [0371] Adoptive transfer colitis. Na?ve T cells were isolated from donor mice by FACS and differentiated for 6 days prior to adoptive transfer with the following paradigm. Na?ve CD4.sup.+ T cells (in 6 well dishes, 1?10.sup.6 cells/ml) were cultured for 48 hrs on anti-CD3/anti-CD28 coated plates with the cytokines IL-12 (10 ng/ml)+IL-21 (20 ng/ml). After 48 hrs, the cells were passaged onto non-coated plates and IL-2 (20 ng/ml) was added to the culture. Cells were passaged if needed 1:2. On day 4, IL-23 (20 ng/ml) was added to the culture. During the entire culture, the medium was supplemented with anti-IL-4 antibody (BioXcell; clone 11B11). On day 5, a small sample was taken and used for ICC to determine IFN-?.sup.+ cells and cells to be adoptively transferred were re-stimulated by passage onto anti-CD3/anti-CD28-coated plates for at least 24 hrs. After 6 days, cells were harvested, washed in ice-cold PBS and viability was assessed with Typan Blue staining. Cells to be injected were normalized based on IFN-? expression determined by ICC and 400000 viable IFN-?.sup.+ cells were injected intraperitoneally per animal. As recipients, sex-matched RAG1.sup.?/? animals were used. The weight was measured pre-adoptive transfer and routinely over the course of the experiment.

    [0372] For histopathology, the colon and small intestine were fixed in 10% formalin and processed by the Harvard Medical School rodent histopathology core for H&E staining. The severity of disease was assessed in a blinded manner by an experienced histopathologist. The following scoring system was used: 0 (healthy)-4 (most severe disease).

    [0373] Isolation of intestinal lymphocytes. Intestinal lymphocytes were isolated from RAG1.sup.?/? recipients using a lamina propria dissociation kit according to the manufacturer's instructions (Miltenyi Biotec, Cat. No.: 130-097-410). Briefly, intestines were isolated and flushed with ice-cold buffer. The small intestine and colon were separated, opened longitudinally with scissors, turned inside-out and then cut into small pieces (<1 cm). Then, the intraepithelial lymphocytes (IEL) were shaken off with buffer containing 1 mM DTT with gentle rotation at 37? C. After the incubation period, the IEL were swiftly filtered (100 ?m), washed with complete medium and kept on ice. This step was repeated once followed by a washing step to remove DTT. Then, the procedure was continued to isolate the lamina propria lymphocytes (LPL). For digestion of the intestinal mucosa, the samples were gently incubated with a proprietary enzymatic solution in C-tubes (Miltenyi Biotec, Cat. No.: 130-096-334) at 37? C. for at least 30 minutes using a rotator. After the enzymatic incubation, the samples were homogenized using a gentleMACS (Miltenyi Biotec) and the program m_intestine_01.

    [0374] For overnight culture, to assess the cytokine profile of intestinal T cells, the cells were further isolated using a Percoll (GE Life Sciences/Cytiva) gradient centrifugation to remove cell debris and fat tissue.

    [0375] Analysis of ex vivo cytokine production by intestinal lymphocytes. IEL and LPL were cultured overnight in complete medium with IL-7 (20 ng/ml, Biolegend)+IL-23 (20 ng/ml, R&D). The next day, the cells were stimulated with PMA/ionomycin+GolgiStop for 4 hrs as described above. ICC was performed and the cells stained for IL-17A, IFN-? and GM-CSF.

    [0376] Single-cell RNA-sequencing (scRNAseq). For full-length scRNAseq, single, viable in vitro differentiated CD4+ T cells were sorted into 96-well plates containing 5 ?l TCL Buffer (QIAGEN) with 1% 2-mercaptoethanol, centrifuged and frozen at ?80? C. SMART-Seq2 protocol was carried out mainly as previously described (Singer et al., 2016). For droplet-based 3 end massively parallel single-cell RNA-sequencing, sorted (FACS) CD45+CD4+ intestinal T cells were encapsulated into droplets, and libraries were prepared using Chromium Single Cell 3 Reagent Kits v2 according to the manufacturer's protocol (10?Genomics). Generated libraries were sequenced on a HiSeq X (Illumina).

    [0377] RNA isolation and quantitative PCR. Total RNA was isolated with the RNeasy kit according to the manufacturer's instructions (Qiagen). In brief, cells were homogenized with 200?l RLT buffer supplemented with 2-mercaptoethanol by gentle pipetting and then an equal amount of 70% ethanol was added, the samples were mixed by inversion and RNA was captured through a centrifugation step with silica-based columns. Purified RNA was reverse-transcribed using Superscript II enzyme and random hexamer primers (Invitrogen). Taqman probes for genes of interest were purchased from Applied Biosystems. A ViiA7 Real-time PCR system (Applied Biosystems) was used for amplification and data acquisition.

    TABLE-US-00005 Taqman probes Taqman assay Gene Mm00519943_m1 Il23r Mm01168134_m1 Ifng Mm00439618_m1 Il17a Mm00450960_m1 Tbx21 Mm01261022_m1 Rorc Mm01219775_m1 Stat3

    [0378] Statistical analysis. Details regarding the statistical analyses can be found in the figure legends. Statistical analysis was performed using GraphPad Prism 8.0. A p-value p<0.05 was considered significant.

    [0379] Analysis of in-vitro SmartSeq2 single-cell transcriptional profiles. Sequencing reads were initially filtered with Trimmomatic 0.32.sup.80 to remove low quality ends and adapter sequences. A combination of Bowtie2 v2.2.9.sup.81 was used to align reads to a reference transcriptome derived from the GRCm38 Mus musculus genome (NCBI Refseq). RSEM 1.2.31.sup.82 was used to compile the transcriptome and estimate transcript abundance following read alignment. Prior to alignment, the GRCm38 reference was augmented to include the modified eGFP+IL23R functional knockout transcript.

    [0380] Prior to downstream analysis, cell libraries were excluded if they contained less than 800,000 reads or more than 3 million reads. Additionally, libraries with less than a 40% alignment rate were withheld. Finally, genes detected in less than 5 cell libraries were discarded prior to differential expression.

    [0381] Initial inspection of the RNA-seq libraries showed that the dominant source of variation between cells could be attributed to differences in cell cycle progression. To reduce the effect of cell cycle on differential expression testing, two cell-cycle scores per cell were computed and input as covariates into the differential expression model. To compute these scores, Applicants first subset the expression matrix, retaining only 97 genes identified as G1/S or G2/M enriched genes in a previous study.sup.83. Then, PCA was run on the log(TPM+1) expression values and the first two component scores per cell were extracted.

    [0382] To identify differentially expressed genes, the MAST.sup.84 R package was used. When fitting the hurdle model, in addition to the covariates of interest both cell cycle components (described above) as well as the number of detected genes per cell were used to reduce false positives due to cycling state or mRNA capture rates. P-values were corrected with the Benjamini Hochberg FDR procedure and genes were accepted at an FDR<0.1 threshold. To identify genes whose expression differed between the GFP.sup.+ and GFP.sup.? subsets in a genotype-dependent manner (and therefore may be perturbed as a consequence of Il-23 receptor signaling), data from all four subsets (Il23R.sup.WT/eGFP and Il23R.sup.eGFP/eGFP, GFP.sup.+/? both) were combined and modeled with categorical covariates for GFP, Genotype, and a GFP:Genotype interaction term (in addition to the cell cycle and detection rate terms). Genes whose expression differed between the FACS sorted GFP subsets were first identified by comparing this full model to a reduced model without the GFP and GFP:Genotype terms, retaining those with FDR<0.1. Then, in this subset, Applicants tested the GFP:Genotype interaction term specifically and retained genes with FDR<0.1.

    [0383] For visualization, the dataset was reduced using principal components analysis (PCA) followed by tSNE.sup.85. Prior to running PCA, the log(x+1) transformed TPM expression values were normalized by regressing out three cell-level covariates: the number of detected genes, and both cell-cycle components. The top 30 components from PCA were then used as input to the tSNE procedure (with perplexity=30) to further reduce the data to 2 dimensions.

    [0384] When comparing the GFP-associated expression between T cells stimulated under Th1 or Th17-producing conditions, an effect was considered common using the criteria FDR<0.05 in at least one comparison and (unadjusted) p-value <0.05 in the other with a log fold-change in the same direction. Opposite effects satisfied the same significance criteria but with a log fold-change of opposing signs, and Th1/Th17-specific effects satisfied FDR<0.05 in one group but p-value >0.05 in the other.

    [0385] Analysis of In-Vivo 10?-Sequenced Single-Cell Libraries

    [0386] Alignment and Preprocessing. To quantify gene expression, samples were individually aligned to the mm10 Mus musculus genome using CellRanger v2.0.2. In total, 14 samples were collected, however two samples of intraepithelial lymphocytes in the small intestine from batch 1 were discarded as the IL23R knockout sample did not pass quality checks (insufficient barcodes belonging to cells). The remaining 12 samples were used in downstream analysis.

    [0387] Merging and Filtering. An initial analysis was performed on the concatenation of all samples to identify and remove dying or contaminating cell types. All 12 samples were modeled with scVI.sup.86, selecting genes expressed in at least 100 cells, using 10 latent components, and encoding each sample ID as a batch variable so as to remove tissue and genotype specific effects.

    [0388] The resulting latent space was then clustered into 11 clusters using the Louvain algorithm as implemented in SCANPY.sup.87 with the following settings: n_neighbors=10 and resolution=0.5. Of these four clusters were marked for removal in all subsequent analysis (across all samples), in total consisting of 7.6% of all 32,763 cells.

    [0389] One cluster, c8, was characterized by low recovered UMI counts, a low proportion of ribosomal coding RNA, a high proportion of mitochondrial RNA, and very few other distinguishing genes. These were removed as being likely low-quality measurements from damaged cells.

    [0390] Another cluster, c9, was identified as a possible contaminant cell type due to marked lack of CD4 and CD52 expression. Similarly, cluster c10 lacked T cell markers and had high expression of hemoglobin-related genes.

    [0391] Finally, cluster c6, despite exhibiting Th17-related genes (Ccr6, Il-23r, Rorc, and IL-22), was removed as the lack of CD3 expression, lack of TCR expression, and distinct lack of any IL-23r-eGFP detection (despite significant Il-23r detection), indicated that these were likely LTi ILC3 cells from the recipient mouse and therefore not part of the genotype-perturbed donor cells of interest in this experiment. After this stage of filtering, a total of 30,259 cells remained for downstream analysis.

    [0392] Between Tissue Analyses. The combined UMAP plots of FIG. 2 were generated by first modeling all cells with scVI.sup.86, and then running the UMAP.sup.88 algorithm using SCANPY.sup.87 with n_neighbors=30. When running scVI, the two experimental batches were encoded as the batch variable and zero-inflation in the model was disabled. Additionally, genes were pre-filtered to retain A) genes expressed in at least 100 cells and B) genes with high fano factor: genes divided into 30 bins based on mean, fano factor computed for each geneusing the UMI-depth normalized countsand genes retained with a fano factor greater than 2 MAD (median absolute deviations above median) per bin.

    [0393] For the heatmap in FIG. 2E, edgeR.sup.89 was run to compute average expression per tissue and to determine the genes with the highest tissue specificity, the top 500 of which were plotted. The model was fit in the form Batch+Tissue and the Tissue coefficient was tested with the likelihood ratio test. When computing within-tissue differential expression based on Genotype, edgeR was used to compute differential expression (between control and eGFP/eGFP cells) using the likelihood ratio test.

    [0394] Within-Tissue Analysis: Lamina Propria Lymphocytes. Samples from the lamina propria (6 totalbatch 1: control and knockout in colon and batch: 2 control and knockout in colon and small intestine) were grouped together and modeled with scVI.sup.86 (8 components, zero-inflation enabled, genes retained that were expressed in 10 cells or more and the Fano filter as described in the previous section). As broad genotype-specific differences in expression (e.g., heat shock proteins), prevented cells from clustering together, Applicants regressed out individual sample differences as if they were batch (i.e., encoded sample ID as the batch variable) and instead assessed the resulting clusters in terms of proportional representation (control vs. knockout) and within-cluster differential expression (control vs knockout). UMAP and Louvain clustering were run on the resulting 8 components as implemented in SCANPY.sup.87 with the following parameters: n_neighbors=30 and (for Louvain) resolution=0.9.

    [0395] Changes in cluster composition were adjusted by the number of cells recovered using the following relation:

    [00001] Genotype Ratio = ( Control Cells in Cluster Total Control Cells ) / ( Knockout Cells in Cluster Total Knockout Cells )

    [0396] To identify marker genes per cluster, edgeR.sup.89 was used to compute log fold-change and significance when comparing cells in the cluster vs all other cells (1 vs. all differential expression). Similarly, edgeR was used to determine differential expression within cluster (control vs. knockout cells).

    [0397] The Tr1 signature from Gruarin et al., 2019.sup.52 is composed of the 51 genes differentiated Tr1 cells from other CD4 cells in FIG. 1A of that study. Per-cell signature scores were calculated using VISION.sup.90 and the expression matrix scaled to the median number of UMIs per cell.

    [0398] Target Prioritization (Ranking)

    [0399] For each gene, Applicants computed an overall score with four components. Genes were then ranked by a weighted sum of these components. The components are defined as:

    1. In-vivo, Cluster Specificthe maximum of: [0400] The log fold-change of genes significant (FDR<0.1) in the cluster 2 vs. all comparison [0401] The log fold-change*0.5 of genes significant (FDR<0.1) in the cluster 9 vs. all comparison [0402] The log fold-change of genes significant (FDR<0.1) in the within-cluster (cluster 2) control vs. knockout comparison [0403] The log fold-change*0.5 of genes significant (FDR<0.1) in the within-cluster (cluster 9) control vs. knockout comparison
    2. In-vivo, Tissue Specificthe maximum of: [0404] The log fold-change for genes significant (FDR<0.1) in the LPL vs. Spleen comparison [0405] The log fold-change for genes significant (FDR<0.1) in the within-LPL control vs. knockout comparison

    [0406] For both the above in-vivo categories, negative log fold-changes were truncated at 0 (to select specifically for genes upregulated in the cluster of interest or in control cells) and the overall score per gene was limited to 2.

    3. In-vitro, Summarythe maximum of: [0407] The log fold-change for genes with significant (FDR<0.1) genotype-independent differences in the in-vitro GFP+vs. GFP? comparison [0408] The log fold-change of the genotype-dependent effect (GFP+?Genotype Ctrl) in the in-vitro linear model

    [0409] For the above, in-vitro category, the overall score per gene was limited to 3.

    4. GWAS:

    [0410] Applicants assigned a GWAS score of 1 for genes within GWAS loci for Ulcerative Colitis or Crohn's Disease (as identified by Jostins et. al., 2012; Liu et. al., 2015; DeLange et. al., 2017.sup.58,60,61 and compiled by DeLange et al., 2017.sup.58). Alternate genes were discarded for loci in which a specific gene has been confidently implicated by fine-mapping, eQTL, or target sequencing studies (as compiled by DeLange et al. 2017.sup.58).

    [0411] The final ranking was determined by combining all four categories using the following weightings:


    Overall Score=(In-vivo,Cluster Specific)?2+(In-vivo,Tissue Specific)?1+(In-vitro,Summary)?1+(GWAS)?2

    REFERENCES

    [0412] 1 Cua, D. J. et al. Interleukin-23 rather than interleukin-12 is the critical cytokine for autoimmune inflammation of the brain. Nature 421, 744-748, doi:10.1038/nature01355 (2003). [0413] 2 Murphy, C. A. et al. Divergent pro- and antiinflammatory roles for IL-23 and IL-12 in joint autoimmune inflammation. J Exp Med 198, 1951-1957, doi:10.1084/jem.20030896 (2003). [0414] 3 Ahern, P. P. et al. Interleukin-23 drives intestinal inflammation through direct activity on T cells. Immunity 33, 279-288, doi:10.1016/j.immuni.2010.08.010 (2010). [0415] 4 Teng, M. W. et al. IL-12 and IL-23 cytokines: from discovery to targeted therapies for immune-mediated inflammatory diseases. Nat Med 21, 719-729, doi:10.1038/nm.3895 (2015). [0416] 5 Duerr, R. H. et al. A genome-wide association study identifies IL23R as an inflammatory bowel disease gene. Science 314, 1461-1463, doi:10.1126/science.1135245 (2006). [0417] 6 Hueber, W. et al. Secukinumab, a human anti-IL-17A monoclonal antibody, for moderate to severe Crohn's disease: unexpected results of a randomised, double-blind placebo-controlled trial. Gut 61, 1693-1700, doi:10.1136/gutjnl-2011-301668 (2012). [0418] 7 Harbour, S. N., Maynard, C. L., Zindl, C. L., Schoeb, T. R. & Weaver, C. T. Th17 cells give rise to Th1 cells that are required for the pathogenesis of colitis. Proc Natl Acad Sci USA 112, 7061-7066, doi:10.1073/pnas.1415675112 (2015). [0419] 8 Ghoreschi, K. et al. Generation of pathogenic T(H)17 cells in the absence of TGF-beta signalling. Nature 467, 967-971, doi:10.1038/nature09447 (2010). [0420] 9 Lee, Y. et al. Induction and molecular signature of pathogenic TH17 cells. Nature immunology 13, 991-999, doi:10.1038/ni.2416 (2012). [0421] 10 Yosef, N. et al. Dynamic regulatory network controlling TH17 cell differentiation. Nature 496, 461-468, doi:10.1038/nature11981 (2013). [0422] 11 Gaublomme, J. T. et al. Single-Cell Genomics Unveils Critical Regulators of Th17 Cell Pathogenicity. Cell 163, 1400-1412, doi:10.1016/j.cell.2015.11.009 (2015). [0423] 12 Patel, D. D. & Kuchroo, V. K. Th17 Cell Pathway in Human Immunity: Lessons from Genetics and Therapeutic Interventions. Immunity 43, 1040-1051, doi:10.1016/j.immuni.2015.12.003 (2015). [0424] 13 McGeachy, M. J. et al. The interleukin 23 receptor is essential for the terminal differentiation of interleukin 17-producing effector T helper cells in vivo. Nature immunology 10, 314-324, doi:10.1038/ni.1698 (2009). [0425] 14 Izcue, A. et al. Interleukin-23 restrains regulatory T cell activity to drive T cell-dependent colitis. Immunity 28, 559-570, doi:10.1016/j.immuni.2008.02.019 (2008). [0426] 15 Schiering, C. et al. The alarmin IL-33 promotes regulatory T-cell function in the intestine. Nature 513, 564-568, doi:10.1038/nature13577 (2014). [0427] 16 Sandborn, W. J. et al. Ustekinumab induction and maintenance therapy in refractory Crohn's disease. N Engl J Med 367, 1519-1528, doi:10.1056/NEJMoa1203572 (2012). [0428] 17 Sands, B. E. et al. Ustekinumab as Induction and Maintenance Therapy for Ulcerative Colitis. N Engl J Med 381, 1201-1214, doi:10.1056/NEJMoa1900750 (2019). [0429] 18 Powrie, F. et al. Inhibition of Th1 responses prevents inflammatory bowel disease in scid mice reconstituted with CD45RBhi CD4+ T cells. Immunity 1, 553-562 (1994). [0430] 19 Hirota, K. et al. Fate mapping of IL-17-producing T cells in inflammatory responses. Nat Immunol 12, 255-263, doi:10.1038/ni.1993 (2011). [0431] 20 Szabo, S. J. et al. A novel transcription factor, T-bet, directs Th1 lineage commitment. Cell 100, 655-669, doi:10.1016/s0092-8674(00)80702-3 (2000). [0432] 21 Mosmann, T. R., Cherwinski, H., Bond, M. W., Giedlin, M. A. & Coffman, R. L. Two types of murine helper T cell clone. I. Definition according to profiles of lymphokine activities and secreted proteins. J Immunol 136, 2348-2357 (1986). [0433] 22 Awasthi, A. et al. Cutting edge: IL-23 receptor gfp reporter mice reveal distinct populations of IL-17-producing cells. J Immunol 182, 5904-5908, doi:10.4049/jimmunol.0900732 (2009). [0434] 23 Picelli, S. et al. Smart-seq2 for sensitive full-length transcriptome profiling in single cells. Nat Methods 10, 1096-1098, doi:10.1038/nmeth.2639 (2013). [0435] 24 Lee, Y. et al. Induction and molecular signature of pathogenic TH17 cells. Nat Immunol 13, 991-999, doi:10.1038/ni.2416 (2012). [0436] Velasquez, S., Malik, S., Lutz, S. E., Scemes, E. & Eugenin, E. A. Pannexin1 Channels Are Required for Chemokine-Mediated Migration of CD4+T Lymphocytes: Role in Inflammation and Experimental Autoimmune Encephalomyelitis. J Immunol 196, 4338-4347, doi:10.4049/jimmunol.1502440 (2016). [0437] 26 Kurdi, A. T. et al. Tiaml/Rac1 complex controls Il17a transcription and autoimmunity. Nat Commun 7, 13048, doi:10.1038/ncomms13048 (2016). [0438] 27 DiSpirito, J. R. et al. Molecular diversification of regulatory T cells in nonlymphoid tissues. Sci Immunol 3, doi:10.1126/sciimmunol.aat5861 (2018). [0439] 28 Masopust, D. & Soerens, A. G. Tissue-Resident T Cells and Other Resident Leukocytes. Annu Rev Immunol 37, 521-546, doi:10.1146/annurev-immunol-042617-053214 (2019). [0440] 29 Carlson, C. M. et al. Kruppel-like factor 2 regulates thymocyte and T-cell migration. Nature 442, 299-302, doi:10.1038/nature04882 (2006). [0441] 30 Bonecchi, R. et al. Differential expression of chemokine receptors and chemotactic responsiveness of type 1 T helper cells (Th1s) and Th2s. J Exp Med 187, 129-134, doi:10.1084/jem.187.1.129 (1998). [0442] 31 Singh, U. P., Singh, S., Taub, D. D. & Lillard, J. W., Jr. Inhibition of IFN-gamma-inducible protein-10 abrogates colitis in IL-10?/? mice. J Immunol 171, 1401-1406, doi:10.4049/jimmunol.171.3.1401 (2003). [0443] 32 Khor, B., Gardet, A. & Xavier, R. J. Genetics and pathogenesis of inflammatory bowel disease. Nature 474, 307-317, doi:10.1038/nature10209 (2011). [0444] 33 Annacker, O. et al. Essential role for CD103 in the T cell-mediated regulation of experimental colitis. J Exp Med 202, 1051-1061, doi:10.1084/jem.20040662 (2005). [0445] 34 Lamb, C. A. et al. alphaEbeta7 Integrin Identifies Subsets of Pro-Inflammatory Colonic CD4+T Lymphocytes in Ulcerative Colitis. J Crohns Colitis 11, 610-620, doi:10.1093/ecco-jcc/jjw189 (2017). [0446] 35 Johansson-Lindbom, B. & Agace, W. W. Generation of gut-homing T cells and their localization to the small intestinal mucosa. Immunol Rev 215, 226-242, doi:10.1111/j.1600-065X.2006.00482.x (2007). [0447] 36 Schneider, M. et al. CD38 is expressed on inflammatory cells of the intestine and promotes intestinal inflammation. PLoS One 10, e0126007, doi:10.1371/journal.pone.0126007 (2015). [0448] 37 Abadia-Molina, A. C. et al. CD48 controls T-cell and antigen-presenting cell functions in experimental colitis. Gastroenterology 130, 424-434, doi:10.1053/j.gastro.2005.12.009 (2006). [0449] 38 Jackson, R. et al. The translation of non-canonical open reading frames controls mucosal immunity. Nature 564, 434-438, doi:10.1038/s41586-018-0794-7 (2018). [0450] 39 Anumanthan, A. et al. Cloning of BY55, a novel Ig superfamily member expressed on NK cells, CTL, and intestinal intraepithelial lymphocytes. J Immunol 161, 2780-2790 (1998). [0451] 40 Zhang, Q. & Vignali, D. A. Co-stimulatory and Co-inhibitory Pathways in Autoimmunity. Immunity 44, 1034-1051, doi:10.1016/j.immuni.2016.04.017 (2016). [0452] 41 Dardalhon, V. et al. CD226 is specifically expressed on the surface of Th1 cells and regulates their expansion and effector functions. J Immunol 175, 1558-1565, doi:10.4049/jimmunol.175.3.1558 (2005). [0453] 42 Gilfillan, S. et al. DNAM-1 promotes activation of cytotoxic lymphocytes by nonprofessional antigen-presenting cells and tumors. J Exp Med 205, 2965-2973, doi:10.1084/jem.20081752 (2008). [0454] 43 Ito, R. et al. Interferon-gamma is causatively involved in experimental inflammatory bowel disease in mice. Clin Exp Immunol 146, 330-338, doi:10.1111/j.1365-2249.2006.03214.x (2006). [0455] 44 Brass, A. L. et al. The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus. Cell 139, 1243-1254, doi:10.1016/j.cell.2009.12.017 (2009). [0456] 45 Roman, J. et al. Evaluation of responsive gene expression as a sensitive and specific biomarker in patients with ulcerative colitis. Inflamm Bowel Dis 19, 221-229, doi:10.1002/ibd.23020 (2013). [0457] 46 Laudato, S. et al. P53-induced miR-30e-5p inhibits colorectal cancer invasion and metastasis by targeting ITGA6 and ITGB1. Int J Cancer 141, 1879-1890, doi:10.1002/ijc.30854 (2017). [0458] 47 Sands, B. E. et al. Vedolizumab versus Adalimumab for Moderate-to-Severe Ulcerative Colitis. N Engl J Med 381, 1215-1226, doi:10.1056/NEJMoa1905725 (2019). [0459] 48 Mailand, N. & Diffley, J. F. CDKs promote DNA replication origin licensing in human cells by protecting Cdc6 from APC/C-dependent proteolysis. Cell 122, 915-926, doi:10.1016/j.cell.2005.08.013 (2005). [0460] 49 Yu, H. Cdc20: a WD40 activator for a cell cycle degradation machine. Mol Cell 27, 3-16, doi:10.1016/j.molcel.2007.06.009 (2007). [0461] 50 Forster, R., Davalos-Misslitz, A. C. & Rot, A. CCR7 and its ligands: balancing immunity and tolerance. Nat Rev Immunol 8, 362-371, doi:10.1038/nri2297 (2008). [0462] 51 Weder, B. et al. BCL-2 levels do not predict azathioprine treatment response in inflammatory bowel disease, but inhibition induces lymphocyte apoptosis and ameliorates colitis in mice. Clin Exp Immunol 193, 346-360, doi:10.1111/cei.13151 (2018). [0463] 52 Gruarin, P. et al. Eomesodermin controls a unique differentiation program in human IL-10 and IFN-gamma coproducing regulatory T cells. Eur J Immunol 49, 96-111, doi:10.1002/eji.201847722 (2019). [0464] 53 Zhang, P. et al. Eomesodermin promotes the development of type 1 regulatory T (TR1) cells. Sci Immunol 2, doi:10.1126/sciimmunol.aah7152 (2017). [0465] 54 Alfen, J. S. et al. Intestinal IFN-gamma-producing type 1 regulatory T cells coexpress CCR5 and programmed cell death protein 1 and downregulate IL-10 in the inflamed guts of patients with inflammatory bowel disease. J Allergy Clin Immunol 142, 1537-1547 e1538, doi:10.1016/j.jaci.2017.12.984 (2018). [0466] 55 Amarnath, S. et al. The PDL1-PD1 axis converts human TH1 cells into regulatory T cells. Sci Transl Med 3, 111ra120, doi:10.1 126/scitranslmed.3003130 (2011). [0467] 56 Takahashi, S. et al. De novo and rare mutations in the HSPA1L heat shock gene associated with inflammatory bowel disease. Genome Med 9, 8, doi:10.1186/si3073-016-0394-9 (2017). [0468] 57 van Eden, W., van der Zee, R. & Prakken, B. Heat-shock proteins induce T-cell regulation of chronic inflammation. Nat Rev Immunol 5, 318-330, doi:10.1038/nri1593 (2005). [0469] 58 de Lange, K. M. et al. Genome-wide association study implicates immune activation of multiple integrin genes in inflammatory bowel disease. Nat Genet 49, 256-261, doi:10.1038/ng.3760 (2017). [0470] 59 Huang, H. et al. Fine-mapping inflammatory bowel disease loci to single-variant resolution. Nature 547, 173-178, doi:10.1038/nature22969 (2017). [0471] 60 Liu, J. Z. et al. Association analyses identify 38 susceptibility loci for inflammatory bowel disease and highlight shared genetic risk across populations. Nat Genet 47, 979-986, doi:10.1038/ng.3359 (2015). [0472] 61 Jostins, L. et al. Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease. Nature 491, 119-124, doi:10.1038/nature11582 (2012). [0473] 62 Kakiuchi, N. et al. Frequent mutations that converge on the NFKBIZ pathway in ulcerative colitis. Nature 577, 260-265, doi:10.1038/s41586-019-1856-1 (2020). [0474] 63 Grenningloh, R., Kang, B. Y. & Ho, I. C. Ets-1, a functional cofactor of T-bet, is essential for Th1 inflammatory responses. J Exp Med 201, 615-626, doi:10.1084/jem.20041330 (2005). [0475] 64 Wells, M. L., Perera, L. & Blackshear, P. J. An Ancient Family of RNA-Binding Proteins: Still Important! Trends Biochem Sci 42, 285-296, doi:10.1016/j.tibs.2016.12.003 (2017). [0476] 65 Wang, X., Sumida, H. & Cyster, J. G. GPR18 is required for a normal CD8alphaalpha intestinal intraepithelial lymphocyte compartment. J Exp Med 211, 2351-2359, doi:10.1084/jem.20140646 (2014). [0477] 66 Tan, C. L. et al. CD160 Stimulates CD8(+) T Cell Responses and Is Required for Optimal Protective Immunity to Listeria monocytogenes. Immunohorizons 2, 238-250, doi:10.4049/immunohorizons.1800039 (2018). [0478] 67 Tu, T. C. et al. CD160 is essential for NK-mediated IFN-gamma production. J Exp Med 212, 415-429, doi:10.1084/jem.20131601 (2015). [0479] 68 Korn, T. et al. IL-21 initiates an alternative pathway to induce proinflammatory T(H)17 cells. Nature 448, 484-487, doi:10.1038/nature05970 (2007). [0480] 69 Zhou, L. et al. IL-6 programs T(H)-17 cell differentiation by promoting sequential engagement of the IL-21 and IL-23 pathways. Nature immunology 8, 967-974, doi:10.1038/ni1488 (2007). [0481] 70 Hsu, C. Y. et al. SUMO-defective c-Maf preferentially transactivates 1121 to exacerbate autoimmune diabetes. J Clin Invest 128, 3779-3793, doi:10.1172/JCI98786 (2018). [0482] 71 Sato, K. et al. Marked induction of c-Maf protein during Th17 cell differentiation and its implication in memory Th cell development. J Biol Chem 286, 14963-14971, doi:10.1074/jbc.M111.218867 (2011). [0483] 72 Iwamoto, T. et al. Interleukin-21-producing c-Maf-expressing CD4+ T cells induce effector CD8+ T cells and enhance autoimmune inflammation in scurfy mice. Arthritis Rheumatol 66, 2079-2090, doi:10.1002/art.38658 (2014). [0484] 73 Acosta-Rodriguez, E. V., Napolitani, G., Lanzavecchia, A. & Sallusto, F. Interleukins 1beta and 6 but not transforming growth factor-beta are essential for the differentiation of interleukin 17-producing human T helper cells. Nature immunology 8, 942-949, doi:10.1038/ni1496 (2007). [0485] 74 Becattini, S. et al. T cell immunity. Functional heterogeneity of human memory CD4(+) T cell clones primed by pathogens or vaccines. Science 347, 400-406, doi:10.1 126/science.1260668 (2015). [0486] 75 Gagliani, N. et al. Th17 cells transdifferentiate into regulatory T cells during resolution of inflammation. Nature 523, 221-225, doi:10.1038/nature14452 (2015). [0487] 76 Wu, C. et al. SGK1 Governs the Reciprocal Development of Th17 and Regulatory T Cells. Cell Rep 22, 653-665, doi:10.1016/j.celrep.2017.12.068 (2018). [0488] 77 Uniken Venema, W. T. et al. Single-Cell RNA Sequencing of Blood and Ileal T Cells From Patients With Crohn's Disease Reveals Tissue-Specific Characteristics and Drug Targets. Gastroenterology 156, 812-815 e822, doi:10.1053/j.gastro.2018.10.046 (2019). [0489] 78 Fuchs, A. et al. Intraepithelial type 1 innate lymphoid cells are a unique subset of IL-12- and IL-15-responsive IFN-gamma-producing cells. Immunity 38, 769-781, doi:10.1016/j.immuni.2013.02.010 (2013). [0490] 79 Atarashi, K. et al. Ectopic colonization of oral bacteria in the intestine drives TH1 cell induction and inflammation. Science 358, 359-365, doi:10.1126/science.aan4526 (2017). [0491] 80 Bolger, A. M., Lohse, M. & Usadel, B. Trimmomatic: a flexible trimmer for Illumina sequence data. Bioinformatics 30, 2114-2120, doi:10.1093/bioinformatics/btul70 (2014). [0492] 81 Langmead, B. & Salzberg, S. L. Fast gapped-read alignment with Bowtie 2. Nat Methods 9, 357-359, doi:10.1038/nmeth. 1923 (2012). [0493] 82 Li, B. & Dewey, C. N. RSEM: accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinformatics 12, 323, doi:10.1186/1471-2105-12-323 (2011). [0494] 83 Kowalczyk, M. S. et al. Single-cell RNA-seq reveals changes in cell cycle and differentiation programs upon aging of hematopoietic stem cells. Genome Res 25, 1860-1872, doi:10.1101/gr.192237.115 (2015). [0495] 84 Finak, G. et al. MAST: a flexible statistical framework for assessing transcriptional changes and characterizing heterogeneity in single-cell RNA sequencing data. Genome Biol 16, 278, doi:10.1186/s13059-015-0844-5 (2015). [0496] 85 van der Maaten, L. Accelerating t-SNE using Tree-Based Algorithms. Journal of Machine Learning Research 15, 3221-3245 (2014). [0497] 86 Lopez, R., Regier, J., Cole, M. B., Jordan, M. I. & Yosef, N. Deep generative modeling for single-cell transcriptomics. Nat Methods 15, 1053-1058, doi:10.1038/s41592-018-0229-2 (2018). [0498] 87 Wolf, F. A., Angerer, P. & Theis, F. J. SCANPY: large-scale single-cell gene expression data analysis. Genome Biol 19, 15, doi:10.1186/s13059-017-1382-0 (2018). [0499] 88 Becht, E. et al. Dimensionality reduction for visualizing single-cell data using UMAP. Nat Biotechnol, doi:10.1038/nbt.4314 (2018). [0500] 89 Robinson, M. D., McCarthy, D. J. & Smyth, G. K. edgeR: a Bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics 26, 139-140, doi:10.1093/bioinformatics/btp616 (2010). [0501] 90 DeTomaso, D. et al. Functional interpretation of single cell similarity maps. Nat Commun 10, 4376, doi:10.1038/s41467-019-12235-0 (2019).

    Tables

    [0502] Table 1A-1D. Tables related to the Smart-Seq2, in-vitro T cell cytokine stimulation experiments. Includes the results of differential expression comparisons (GFP+ vs GFP? comparisons along with the results of the combined, two-factor model.

    [0503] Table Heading Descriptions:

    [0504] Each section represents the output of MAST in computing a differential expression test (See Methods text for full details).

    [0505] Ctrl GFP+vs GFP?: GFP coefficient (GFP+vs GFP?), only Ctrl cells

    [0506] KO GFP+vs GFP?: GFP coefficient (GFP+vs GFP?), only KO cells

    [0507] Combined Model: Analysis of the interaction term (GFP:Genotype) in a combined model with both Ctrl and KO cells.

    [0508] Coefficient tested is for GFP+:GenotypeCtrl

    [0509] Th1: Cells stimulated in Th1-polarizing conditions (IL12+IL21+IL23)

    [0510] Th17: Cells stimulated in Th17-polarizing conditions (IL1+IL6+IL23)

    [0511] Descriptions for MAST (common) to all sections:

    [0512] Gene: Gene for which the test was computed

    [0513] coefC: continuous coefficient in the MAST hurdle model

    [0514] pvalC: p-value associated with the continuous coefficient

    [0515] coefD: discrete coefficient in the MAST hurdle model

    [0516] pvalD: p-value associated with the discrete coefficient

    [0517] pvalH: overall p-value associated with the MAST hurdle model

    [0518] log FC: log 2 effect size associated with the tested coefficient

    [0519] FDR. Benjamini-Hochberg False Discovery Rate

    TABLE-US-00006 TABLE 1A Th1 Ctrl GFP+ vs GFP? Gene coefC pvalC coefD pvalD pvalH logFC FDR IL23R 1.61 2.41E?05 4.54E+00 5.84E?27 1.06E?29 4.76 1.38E?25 EGFP_IRES_IL23R 2.40 3.81E?04 4.26E+00 1.69E?25 4.04E?27 3.81 2.62E?23 RPS2 1.00 2.35E?19 ?1.20E?16 1.00E+00 2.68E?18 1.00 1.16E?14 H2-T23 ?0.96 9.22E?19 ?1.20E?16 1.00E+00 1.03E?17 ?0.96 3.35E?14 CBX3 ?0.77 1.15E?14 ?1.20E?16 1.00E+00 1.13E?13 ?0.77 2.44E?10 VAPA 1.69 3.39E?14 1.84E+00 1.21E?01 9.86E?14 1.75 2.44E?10 IL4 ?3.47 2.74E?03 ?2.97E+00 5.21E?12 5.17E?13 ?3.13 9.58E?10 RPSA ?0.46 6.37E?14 ?1.20E?16 1.00E+00 6.09E?13 ?0.46 9.87E?10 RNF187 1.72 4.02E?11 2.07E+00 4.33E?04 6.96E?13 2.44 1.00E?09 ARGLU1 ?1.05 1.14E?13 ?1.20E?16 1.00E+00 1.08E?12 ?1.04 1.40E?09 CLASP2 1.86 1.02E?11 1.61E+00 1.25E?02 3.94E?12 2.05 4.65E?09 RPS12 ?0.49 7.22E?13 ?1.20E?16 1.00E+00 6.61E?12 ?0.49 7.14E?09 TPT1 ?0.43 1.48E?12 ?1.20E?16 1.00E+00 1.34E?11 ?0.43 1.34E?08 LARS2 0.60 7.74E?12 ?1.20E?16 1.00E+00 6.77E?11 0.60 6.27E?08 ANXA2 1.11 1.41E?11 7.73E?01 6.73E?01 1.12E?10 1.12 9.67E?08 SMOX 1.55 3.89E?11 9.62E?01 1.97E?01 1.43E?10 1.78 1.16E?07 RPL12 ?0.39 2.95E?11 ?1.20E?16 1.00E+00 2.51E?10 ?0.39 1.92E?07 MAP3K1 ?1.20 2.66E?10 ?1.66E+00 4.43E?02 2.85E?10 ?1.27 2.05E?07 RNH1 0.80 9.93E?11 1.20E+00 3.94E?01 5.73E?10 0.84 3.91E?07 RPS20 ?0.39 7.32E?11 ?1.20E?16 1.00E+00 6.11E?10 ?0.39 3.96E?07 RPL5 ?0.31 9.11E?11 ?1.20E?16 1.00E+00 7.57E?10 ?0.31 4.67E?07 EIF3F 0.76 1.14E?10 ?1.20E?16 1.00E+00 9.41E?10 0.76 5.54E?07 PDCD4 ?1.10 3.18E?08 ?2.96E+00 1.14E?03 1.14E?09 ?1.29 6.45E?07 NSUN2 1.15 2.83E?10 ?7.08E?01 2.65E?01 1.23E?09 0.88 6.64E?07 TIMP1 1.02 8.98E?02 2.06E+00 1.41E?09 2.60E?09 4.05 1.35E?06 1110008F13RIK 1.43 4.97E?07 1.18E+00 2.86E?04 4.50E?09 2.27 2.24E?06 PHLDA3 1.09 1.14E?03 1.69E+00 2.26E?07 7.61E?09 2.49 3.53E?06 ACTB ?0.45 9.71E?10 ?1.20E?16 1.00E+00 7.63E?09 ?0.45 3.53E?06 RNR1 0.90 1.61E?09 ?1.20E?16 1.00E+00 1.25E?08 0.90 5.48E?06 S1PR1 1.16 9.45E?07 1.74E+00 4.45E?04 1.27E?08 2.07 5.48E?06 ANP32B 1.20 5.36E?09 ?1.87E+00 1.36E?01 1.33E?08 1.13 5.56E?06 PSMB9 ?0.67 2.45E?09 ?1.20E?16 1.00E+00 1.88E?08 ?0.67 7.63E?06 SLC4A11 1.32 1.86E?08 8.08E?01 4.93E?02 1.95E?08 1.86 7.68E?06 PELI1 1.22 9.77E?07 2.00E+00 1.38E?03 3.75E?08 1.78 1.43E?05 HSH2D ?0.80 1.29E?01 ?2.16E+00 2.04E?08 4.66E?08 ?1.36 1.72E?05 LSM4 0.93 1.41E?08 1.48E+00 2.47E?01 5.29E?08 0.97 1.91E?05 RPL30 ?0.36 7.69E?09 ?1.20E?16 1.00E+00 5.72E?08 ?0.36 1.95E?05 H2-Q10 1.07 4.40E?05 1.60E+00 4.35E?05 5.58E?08 2.50 1.95E?05 UCK2 1.31 6.31E?08 1.63E+00 4.46E?02 5.88E?08 1.60 1.95E?05 RPS27A ?0.28 1.08E?08 ?1.20E?16 1.00E+00 7.97E?08 ?0.28 2.58E?05 KLF6 1.20 8.41E?08 1.07E+00 5.25E?02 8.90E?08 1.59 2.81E?05 CALM2 0.71 1.35E?08 5.59E?01 8.74E?01 9.78E?08 0.72 3.02E?05 SRM 1.24 1.51E?08 ?1.45E?02 9.37E?01 1.10E?07 1.12 3.31E?05 ENSA ?1.06 2.93E?05 ?1.63E+00 1.55E?04 1.26E?07 ?1.82 3.72E?05 CANX ?0.55 2.07E?08 ?1.20E?16 1.00E+00 1.50E?07 ?0.55 4.31E?05 PAXBP1 ?1.00 1.08E?05 ?1.57E+00 6.42E?04 1.84E?07 ?1.54 5.19E?05 CLPTM1 1.05 1.60E?05 1.36E+00 4.70E?04 2.01E?07 1.73 5.54E?05 DUSP2 1.18 7.41E?04 1.64E+00 1.14E?05 2.22E?07 2.64 5.99E?05 NPTN ?1.09 2.12E?05 ?1.43E+00 5.90E?04 3.24E?07 ?1.66 8.39E?05 OST4 ?0.93 7.14E?08 ?1.29E+00 3.51E?01 3.22E?07 ?0.96 8.39E?05 TMEM161B ?1.16 6.96E?05 ?1.21E+00 2.35E?04 4.23E?07 ?0.96 1.07E?04 CSF1 0.26 6.40E?01 1.96E+00 6.85E?08 4.29E?07 1.23 1.07E?04 RBMS1 0.89 4.12E?04 1.87E+00 4.78E?05 5.02E?07 1.90 1.23E?04 GM5111 1.00E+00 3.79E+00 5.48E?07 5.48E?07 1.32E?04 ACTR2 ?0.57 9.10E?08 ?1.20E?16 1.00E+00 6.30E?07 ?0.57 1.48E?04 S100A10 0.66 9.31E?08 ?1.20E?16 1.00E+00 6.43E?07 0.66 1.49E?04 CASP6 0.94 1.18E?07 ?4.16E?01 6.84E?01 7.43E?07 0.93 1.69E?04 ID2 ?1.20 8.17E?07 ?8.88E?01 5.25E?02 8.00E?07 ?1.69 1.76E?04 TMEM30A 0.86 7.60E?05 3.04E+00 4.20E?04 7.92E?07 1.38 1.76E?04 RALA 0.64 1.56E?04 1.97E+00 2.37E?04 9.11E?07 1.52 1.97E?04 RN7S1 0.55 1.10E?02 1.46E+00 4.22E?06 1.00E?06 1.68 2.03E?04 RN7S2 0.55 1.10E?02 1.46E+00 4.22E?06 1.00E?06 1.68 2.03E?04 RPL7A ?0.27 1.41E?07 ?1.20E?16 1.00E+00 9.63E?07 ?0.27 2.03E?04 EMB 0.78 1.49E?07 5.59E?01 8.74E?01 1.00E?06 0.79 2.03E?04 RORA 0.71 1.68E?02 .49E+00 3.80E?06 1.31E?06 1.35 2.62E?04 RPS21 ?0.33 2.03E?07 ?1.20E?16 1.00E+00 1.37E?06 ?0.33 2.69E?04 IZUMO1R ?1.27 8.34E?06 ?8.83E?01 8.08E?03 1.46E?06 ?2.15 2.82E?04 MAPK1 0.96 1.95E?05 1.46E+00 3.78E?03 1.65E?06 1.52 3.14E?04 RORC 0.35 5.10E?01 1.72E+00 3.40E?07 1.81E?06 1.54 3.39E?04 ZFP622 1.36 4.16E?07 2.86E?01 3.77E?01 1.85E?06 0.96 3.39E?04 RPS15 ?0.26 2.76E?07 ?1.20E?16 1.00E+00 1.84E?06 ?0.26 3.39E?04 OSTF1 1.03 9.09E?07 1.19E+00 1.81E?01 2.37E?06 1.24 4.27E?04 GATA3 ?0.93 7.00E?03 ?1.87E+00 2.01E?05 2.97E?06 ?2.13 5.28E?04 ERMN 0.94 7.85E?03 1.87E+00 2.09E?05 3.42E?06 2.39 5.99E?04 TPR 0.76 1.71E?06 1.26E+00 1.39E?01 3.57E?06 0.80 6.18E?04 PPP1R16B ?0.92 2.35E?05 ?1.80E+00 7.54E?03 3.68E?06 ?1.12 6.28E?04 PRRC2A 0.60 6.75E?06 2.27E+00 3.52E?02 4.34E?06 0.65 7.31E?04 PRKCH 0.97 1.17E?06 5.94E?01 3.08E?01 4.42E?06 1.17 7.35E?04 HSD17B10 0.72 1.00E?06 ?6.85E?01 5.01E?01 5.08E?06 0.64 8.34E?04 RPLP2 ?0.26 8.06E?07 ?1.20E?16 1.00E+00 5.18E?06 ?0.26 8.39E?04 WNT10B 0.21 8.48E?01 2.38E+00 8.43E?07 5.30E?06 0.87 8.49E?04 RPL28 ?0.26 8.74E?07 ?1.20E?16 1.00E+00 5.59E?06 ?0.26 8.84E?04 SLC29A2 1.16 1.12E?02 1.40E+00 2.58E?05 5.72E?06 1.54 8.93E?04 PDE4B 1.24 6.38E?05 1.17E+00 4.40E?03 5.85E?06 1.87 9.03E?04 INHBA 0.59 2.70E?01 1.60E+00 1.96E?06 6.63E?06 2.84 1.01E?03 ATP6V0D2 0.35 3.06E?01 1.57E+00 1.94E?06 7.14E?06 2.43 1.08E?03 PSME1 ?0.38 1.21E?06 ?1.20E?16 1.00E+00 7.63E?06 ?0.38 1.14E?03 RBM17 0.82 1.45E?06 1.04E+00 5.84E?01 7.81E?06 0.83 1.15E?03 TMEM160 0.80 3.46E?04 1.33E+00 1.09E?03 8.02E?06 1.76 1.17E?03 LAMA5 ?0.75 2.70E?04 ?1.48E+00 1.50E?03 8.51E?06 ?1.25 1.20E?03 ITSN2 1.33 1.34E?06 ?8.48E?03 9.63E?01 8.43E?06 0.96 1.20E?03 CALM1 0.51 1.65E?06 ?6.40E?01 5.31E?01 8.46E?06 0.48 1.20E?03 GGNBP2 1.13 1.46E?06 2.60E?01 7.22E?01 8.61E?06 1.14 1.20E?03 PPP4C 0.77 5.51E?06 1.87E+00 1.18E?01 9.66E?06 0.89 1.33E?03 IFI27L2A ?0.74 3.38E?06 ?1.60E+00 2.21E?01 9.72E?06 ?0.78 1.33E?03 YIPF4 0.76 1.23E?05 1.63E+00 4.93E?02 1.02E?05 1.07 1.38E?03 IIGP1 ?0.69 3.46E?02 ?1.38E+00 1.79E?05 1.08E?05 ?1.99 1.44E?03 UTP18 1.43 2.29E?06 1.96E?01 5.73E?01 1.21E?05 1.14 1.59E?03 D030056L22RIK 1.48 3.74E?03 1.46E+00 1.65E?04 1.24E?05 1.11 1.59E?03 CCDC71L 0.78 9.23E?03 1.30E+00 6.99E?05 1.24E?05 1.23 1.59E?03 USP39 0.78 6.80E?05 1.53E+00 9.48E?03 1.24E?05 1.37 1.59E?03 GTF2A1 ?1.08 2.05E?06 6.32E?02 8.89E?01 1.26E?05 ?0.77 1.60E?03 BHLHE41 ?0.10 2.24E?01 ?1.46E+00 4.50E?06 1.29E?05 ?0.25 1.62E?03 SUMF1 1.80 1.20E?04 9.46E?01 5.61E?03 1.32E?05 1.03 1.65E?03 LAMP1 0.97 5.72E?05 1.09E+00 1.31E?02 1.40E?05 1.52 1.73E?03 PMM1 0.58 4.63E?03 1.78E+00 1.60E?04 1.46E?05 2.07 1.78E?03 IL27RA ?1.08 1.27E?05 ?6.05E?01 7.93E?02 1.56E?05 ?1.29 1.90E?03 STOM 0.83 5.92E?02 1.43E+00 1.69E?05 1.61E?05 1.74 1.93E?03 TUSC2 ?0.02 9.49E?01 1.55E+00 2.68E?06 1.64E?05 1.83 1.95E?03 SOCS3 0.77 1.61E?03 2.35E+00 5.21E?04 1.68E?05 1.35 1.98E?03 SYNE2 0.46 3.44E?01 2.11E+00 4.47E?06 1.72E?05 0.35 2.01E?03 TSPO 0.48 2.87E?06 ?1.20E?16 1.00E+00 1.75E?05 0.48 2.03E?03 6430571L13RIK ?0.88 1.73E?02 ?1.31E+00 5.67E?05 1.77E?05 ?1.36 2.03E?03 CCDC85B 0.37 8.41E?02 1.72E+00 1.41E?05 1.80E?05 1.12 2.05E?03 RAD23A ?0.82 8.25E?06 ?1.07E+00 1.80E?01 1.97E?05 ?0.94 2.22E?03 PLBD2 0.57 2.00E?02 1.44E+00 5.74E?05 2.04E?05 1.74 2.26E?03 PTPN1 0.80 3.36E?06 ?1.20E?16 1.00E+00 2.04E?05 0.79 2.26E?03 PERP 0.69 8.58E?03 1.38E+00 1.36E?04 2.18E?05 2.20 2.39E?03 RPS13 ?0.21 3.68E?06 ?1.20E?16 1.00E+00 2.23E?05 ?0.21 2.42E?03 ODC1 1.03 5.80E?06 ?5.18E?01 4.48E?01 2.58E?05 0.89 2.78E?03 IL22 1.00E+00 3.31E+00 2.59E?05 2.59E?05 2.78E?03 RPS26 ?0.22 4.42E?06 ?1.20E?16 1.00E+00 2.66E?05 ?0.22 2.81E?03 TRP53I11 ?0.44 4.95E?02 ?1.51E+00 3.35E?05 2.67E?05 ?1.73 2.81E?03 BLOC1S4 0.60 1.32E?01 1.47E+00 1.50E?05 2.73E?05 1.51 2.86E?03 CFL1 0.26 4.65E?06 ?1.20E?16 1.00E+00 2.79E?05 0.26 2.89E?03 SERBP1 0.36 5.21E?06 ?1.20E?16 1.00E+00 3.11E?05 0.36 3.20E?03 MFHAS1 0.88 3.56E?05 9.40E?01 5.66E?02 3.16E?05 1.11 3.22E?03 NOP9 0.71 1.41E?03 1.34E+00 1.20E?03 3.22E?05 1.60 3.27E?03 IL18R1 0.90 2.67E?02 1.27E+00 7.26E?05 3.27E?05 2.03 3.29E?03 STX6 0.71 9.73E?03 1.62E+00 1.92E?04 3.37E?05 1.72 3.36E?03 CSGALNACT1 0.04 9.53E?01 1.99E+00 5.75E?06 3.41E?05 0.82 3.37E?03 TPD52L2 0.67 1.07E?05 1.42E+00 3.15E?01 3.73E?05 0.71 3.67E?03 PLAGL2 0.66 9.73E?06 1.23E+00 3.79E?01 3.84E?05 0.69 3.72E?03 RACK1 ?0.25 6.51E?06 ?1.20E?16 1.00E+00 3.84E?05 ?0.25 3.72E?03 KARS ?0.58 7.74E?06 ?1.20E?16 1.00E+00 4.54E?05 ?0.58 4.36E?03 RBM43 ?0.65 4.35E?03 ?1.10E+00 5.87E?04 4.66E?05 ?1.67 4.44E?03 RPS10 ?0.22 8.08E?06 ?1.20E?16 1.00E+00 4.73E?05 ?0.22 4.48E?03 SCAND1 0.44 8.89E?02 1.33E+00 3.73E?05 4.77E?05 1.70 4.48E?03 PGS1 0.94 1.10E?05 5.21E?01 4.56E?01 4.81E?05 1.06 4.48E?03 SERPINB5 0.73 1.04E?01 1.35E+00 3.32E?05 4.85E?05 2.06 4.49E?03 YWHAH 0.47 8.68E?06 5.59E?01 8.74E?01 5.00E?05 0.47 4.60E?03 H2?K1 ?0.43 9.07E?06 ?1.20E?16 1.00E+00 5.28E?05 ?0.43 4.79E?03 RBM42 0.78 5.28E?05 1.57E+00 6.67E?02 5.25E?05 1.01 4.79E?03 EIF4B ?0.43 9.16E?06 ?1.20E?16 1.00E+00 5.33E?05 ?0.43 4.80E?03 MTRF1L 0.69 3.64E?02 1.44E+00 9.34E?05 5.43E?05 1.05 4.86E?03 IFNG 3.15 2.89E?03 1.15E+00 1.12E?03 5.84E?05 2.17 5.19E?03 RBM3 ?0.38 1.02E?05 ?1.20E?16 1.00E+00 5.88E?05 ?0.38 5.19E?03 EEF1A1 ?0.27 1.05E?05 ?1.20E?16 1.00E+00 6.06E?05 ?0.27 5.27E?03 TRAPPC6B 1.14 3.41E?05 5.74E?01 1.33E?01 6.02E?05 1.40 5.27E?03 EIF4A2 ?0.51 4.59E?05 ?1.98E+00 9.62E?02 6.19E?05 ?0.62 5.35E?03 LIN7C ?0.84 7.57E?05 8.60E?01 5.73E?02 6.52E?05 ?0.23 5.60E?03 SDHD ?0.66 1.51E?05 5.81E?01 6.10E?01 7.55E?05 ?0.57 6.32E?03 TNP2 ?0.73 5.20E?03 ?1.14E+00 8.27E?04 7.53E?05 ?1.89 6.32E?03 POLR2M 0.75 1.30E?05 9.45E?02 9.63E?01 7.41E?05 0.74 6.32E?03 CCNB2 0.92 2.30E?04 ?8.67E?01 1.98E?02 7.48E?05 ?0.04 6.32E?03 RPGRIP1 ?0.38 1.38E?01 ?1.40E+00 4.40E?05 7.88E?05 ?1.12 6.55E?03 FAM49B 0.67 1.80E?05 4.80E?01 5.01E?01 8.09E?05 0.71 6.64E?03 GPR18 0.66 1.73E?02 1.68E+00 2.83E?04 8.09E?05 1.88 6.64E?03 FURIN 0.99 1.27E?04 ?1.88E+00 4.37E?02 8.50E?05 0.75 6.93E?03 ATG3 0.65 1.86E?04 9.67E?01 2.98E?02 8.76E?05 1.32 6.99E?03 HIST1H2AH 1.65 1.56E?02 ?2.18E+00 3.40E?04 8.79E?05 ?0.39 6.99E?03 SLC15A3 1.10 7.46E?04 1.01E+00 6.83E?03 8.75E?05 1.95 6.99E?03 DONSON 0.77 2.96E?02 1.19E+00 1.87E?04 8.75E?05 1.48 6.99E?03 CD72 ?3.12 4.55E?05 ?7.32E?01 1.59E?01 9.07E?05 ?0.39 7.17E?03 SLC30A9 0.80 7.38E?03 1.11E+00 7.38E?04 9.29E?05 1.42 7.29E?03 THAP11 0.71 6.99E?03 1.11E+00 7.82E?04 9.34E?05 1.79 7.29E?03 RGCC 0.87 3.67E?04 1.33E+00 1.62E?02 9.73E?05 1.62 7.46E?03 ISG20 ?0.65 2.10E?01 ?1.57E+00 3.89E?05 9.64E?05 ?1.69 7.46E?03 ETV6 ?0.75 1.73E?05 1.75E?01 9.31E?01 9.74E?05 ?0.70 7.46E?03 WIPI2 0.41 3.60E?02 1.92E+00 1.76E?04 9.78E?05 1.30 7.46E?03 ANP32A 0.71 6.21E?05 9.90E?01 1.21E?01 9.92E?05 0.93 7.52E?03 CD81 0.66 2.23E?05 9.84E?01 5.28E?01 1.02E?04 0.67 7.70E?03 RIPK2 0.78 1.51E?02 1.18E+00 4.29E?04 1.06E?04 1.86 7.88E?03 UNC119B 0.54 1.47E?02 2.06E+00 4.38E?04 1.05E?04 1.42 7.88E?03 ATP5G2 ?0.33 1.91E?05 ?1.20E?16 1.00E+00 1.08E?04 ?0.33 7.97E?03 LATS1 ?1.13 2.98E?05 2.83E?01 3.75E?01 1.11E?04 ?0.34 8.09E?03 RPL23 ?0.20 1.98E?05 ?1.20E?16 1.00E+00 1.11E?04 ?0.20 8.09E?03 RPS16 ?0.20 1.98E?05 ?1.20E?16 1.00E+00 1.11E?04 ?0.20 8.09E?03 RPS28 ?0.24 1.99E?05 ?1.20E?16 1.00E+00 1.12E?04 ?0.24 8.09E?03 KHNYN ?0.98 1.30E?03 ?9.04E?01 5.09E?03 1.13E?04 ?1.25 8.11E?03 PAIP1 ?0.64 7.65E?04 ?1.33E+00 8.98E?03 1.14E?04 ?0.91 8.19E?03 NMT1 ?0.88 3.44E?05 ?7.53E?01 3.43E?01 1.20E?04 ?0.97 8.54E?03 CDKN1A 0.83 2.20E?05 ?1.67E?01 8.66E?01 1.21E?04 0.81 8.58E?03 GAS2L1 0.94 3.38E?02 1.34E+00 2.46E?04 1.27E?04 0.87 8.93E?03 SHROOM3 1.26 3.40E?03 1.11E+00 2.23E?03 1.28E?04 0.75 8.94E?03 2310036022RIK 1.02 6.41E?05 4.41E?01 1.82E?01 1.39E?04 1.03 9.65E?03 CAPZA2 0.39 2.50E?05 ?1.20E?16 1.00E+00 1.39E?04 0.39 9.65E?03 IER2 0.81 9.37E?05 9.22E?01 1.17E?01 1.42E?04 1.20 9.81E?03 ATXN2L 0.78 3.23E?05 5.88E?01 5.49E?01 1.48E?04 0.80 1.02E?02 COX15 0.42 1.33E?01 ?1.26E+00 9.04E?05 1.52E?04 ?0.29 1.03E?02 PLEK ?0.05 8.72E?01 1.48E+00 2.81E?05 1.53E?04 1.74 1.04E?02 ZDHHC7 1.07 9.05E?04 8.42E?01 1.08E?02 1.57E?04 1.38 1.06E?02 TRIM27 0.82 7.52E?04 1.07E+00 1.36E?02 1.63E?04 1.27 1.10E?02 RAC1 0.92 3.66E?05 1.04E+00 5.84E?01 1.72E?04 0.93 1.15E?02 RAPH1 0.42 7.36E?02 1.31E+00 1.72E?04 1.74E?04 0.98 1.15E?02 FBXO2 1.25 6.97E?03 1.22E+00 1.53E?03 1.73E?04 1.02 1.15E?02 UBA5 1.56 4.10E?05 2.17E?01 4.94E?01 1.76E?04 0.83 1.16E?02 FLOT2 0.77 3.31E?03 1.26E+00 3.26E?03 1.77E?04 1.60 1.16E?02 ADIPOR1 0.88 3.72E?05 4.14E?01 6.30E?01 1.80E?04 0.92 1.17E?02 LRRFIP2 0.91 9.21E?04 8.00E?01 1.30E?02 1.88E?04 1.14 1.22E?02 DAXX ?0.07 7.11E?01 ?3.18E+00 3.79E?05 1.92E?04 ?0.63 1.24E?02 ASB2 ?0.30 4.51E?01 ?1.34E+00 5.49E?05 2.20E?04 ?1.57 1.41E?02 SOX5 0.70 1.75E?02 1.08E+00 8.53E?04 2.29E?04 1.02 1.46E?02 LGALS4 ?1.04 3.16E?04 ?6.23E?01 5.19E?02 2.30E?04 ?0.88 1.46E?02 ACBD6 0.83 8.58E?05 5.19E?01 2.62E?01 2.38E?04 1.09 1.51E?02 FBXL22 ?2.22 4.69E?05 1.21E?01 7.89E?01 2.44E?04 ?0.24 1.53E?02 ARPC1B 0.29 4.51E?05 ?1.20E?16 1.00E+00 2.43E?04 0.29 1.53E?02 MAPK6 0.75 4.44E?04 1.66E+00 3.90E?02 2.49E?04 0.96 1.55E?02 PKIB 1.03 1.04E?01 1.57E+00 1.98E?04 2.63E?04 0.56 1.63E?02 FZR1 0.61 1.38E?02 1.39E+00 1.32E?03 2.78E?04 1.61 1.72E?02 PRKCQ ?0.40 8.76E?02 ?1.95E+00 2.54E?04 2.89E?04 ?1.41 1.77E?02 SOD1 ?0.29 5.47E?05 ?1.20E?16 1.00E+00 2.92E?04 ?0.29 1.77E?02 ATP6V0B 0.62 3.02E?04 1.49E+00 7.22E?02 2.90E?04 0.88 1.77E?02 UBASH3A ?0.68 1.93E?02 ?1.06E+00 1.02E?03 2.93E?04 ?1.59 1.77E?02 IL2RA 0.40 5.60E?05 ?1.20E?16 1.00E+00 2.99E?04 0.40 1.79E?02 PGP 0.74 5.35E?04 9.02E?01 3.94E?02 2.99E?04 1.47 1.79E?02 NRAS 0.47 5.75E?05 4.70E?01 9.30E?01 3.05E?04 0.47 1.82E?02 SLAMF6 ?2.48 2.26E?04 ?6.96E?01 1.08E?01 3.06E?04 ?0.78 1.82E?02 RAB3GAP1 ?0.83 4.38E?04 ?7.37E?01 5.15E?02 3.11E?04 ?1.15 1.83E?02 BATF 0.71 1.25E?04 9.24E?01 2.29E?01 3.10E?04 1.00 1.83E?02 D17H6S53E ?0.39 6.58E?02 ?1.42E+00 3.54E?04 3.11E?04 ?0.96 1.83E?02 PITHD1 0.71 5.27E?03 1.07E+00 3.94E?03 3.19E?04 1.70 1.86E?02 CCR3 1.00E+00 3.06E+00 3.30E?04 3.30E?04 1.92E?02 STAT5A 0.74 8.97E?05 8.95E?01 4.22E?01 3.38E?04 0.84 1.95E?02 MLF2 0.54 7.43E?05 ?4.14E?01 6.27E?01 3.47E?04 0.49 2.00E?02 ATP5E ?0.31 6.66E?05 ?1.20E?16 1.00E+00 3.52E?04 ?0.31 2.02E?02 MIDN 0.82 8.04E?05 2.29E?01 5.75E?01 3.59E?04 0.74 2.05E?02 SLC39A8 0.17 5.62E?01 1.29E+00 8.26E?05 3.64E?04 1.44 2.07E?02 RFNG 0.42 1.14E?01 1.20E+00 2.73E?04 3.80E?04 1.53 2.15E?02 TMED2 0.40 7.41E?05 ?1.20E?16 1.00E+00 3.89E?04 0.40 2.18E?02 ARID3A 0.76 2.26E?03 7.98E?01 1.15E?02 3.89E?04 0.89 2.18E?02 GAK 0.56 7.57E?05 ?1.20E?16 1.00E+00 3.97E?04 0.56 2.20E?02 TTC39C 0.86 1.60E?02 1.02E+00 1.69E?03 3.96E?04 1.62 2.20E?02 VPS37A 0.74 3.73E?03 1.04E+00 7.06E?03 3.96E?04 1.19 2.20E?02 DSTN 0.71 6.43E?04 9.26E?01 4.52E?02 3.98E?04 1.34 2.20E?02 BEND4 0.56 2.03E?02 1.11E+00 1.38E?03 4.07E?04 1.08 2.23E?02 CD3E 0.57 7.91E?05 ?1.20E?16 1.00E+00 4.14E?04 0.57 2.26E?02 UPF3A 0.69 2.62E?02 1.05E+00 1.11E?03 4.13E?04 1.31 2.26E?02 MGAT2 0.72 5.77E?03 1.00E+00 4.87E?03 4.20E?04 1.46 2.28E?02 LGALS1 0.42 8.25E?05 ?1.20E?16 1.00E+00 4.31E?04 0.42 2.33E?02 GATM 0.39 1.48E?01 1.49E+00 2.53E?04 4.34E?04 1.80 2.34E?02 MDFIC 0.78 5.18E?04 6.89E?01 6.54E?02 4.43E?04 1.07 2.37E?02 RPL31?PS12 ?0.02 9.34E?01 ?1.30E+00 8.68E?05 4.50E?04 ?1.82 2.40E?02 H2?Q7 ?0.60 3.03E?03 ?2.58E+00 1.02E?02 4.54E?04 ?0.93 2.41E?02 RNF115 0.87 5.29E?03 9.11E?01 5.88E?03 4.61E?04 1.49 2.44E?02 FAM174A 0.17 4.67E?01 1.27E+00 1.20E?04 4.70E?04 1.39 2.48E?02 CTBP1 0.91 1.57E?04 3.53E?01 3.17E?01 4.80E?04 0.97 2.52E?02 ZBTB38 0.64 4.65E?02 1.10E+00 7.69E?04 4.81E?04 1.28 2.52E?02 ZFP973 0.41 6.58E?02 ?1.17E+00 5.67E?04 4.84E?04 ?0.38 2.52E?02 1810026J23RIK 0.02 9.45E?01 1.31E+00 9.47E?05 4.90E?04 1.26 2.54E?02 TDP2 0.72 1.50E?02 1.00E+00 2.31E?03 5.00E?04 1.46 2.58E?02 RPL39 ?0.20 9.89E?05 ?1.20E?16 1.00E+00 5.11E?04 ?0.20 2.63E?02 RAI14 ?0.43 3.50E?01 1.43E+00 1.60E?04 5.21E?04 0.60 2.67E?02 ADAMTSL4 ?0.60 1.52E?01 ?1.20E+00 3.06E?04 5.30E?04 ?0.91 2.71E?02 ZFAND6 0.66 1.07E?03 1.41E+00 3.66E?02 5.35E?04 1.05 2.71E?02 MCUR1 0.46 1.15E?01 1.15E+00 3.88E?04 5.35E?04 0.95 2.71E?02 MYLK 0.16 8.03E?01 1.92E+00 1.08E?04 5.39E?04 0.38 2.72E?02 ANKRD13C 1.07 1.97E?03 7.22E?01 1.98E?02 5.52E?04 1.05 2.75E?02 IARS ?0.79 1.11E?04 3.38E?01 7.91E?01 5.50E?04 ?0.70 2.75E?02 GBP10 ?0.45 2.53E?01 ?1.18E+00 2.15E?04 5.52E?04 ?1.49 2.75E?02 PSMD3 0.55 1.10E?04 ?6.33E?02 9.04E?01 5.59E?04 0.55 2.78E?02 MIR684?2 ?1.96 5.81E?02 ?1.59E+00 7.60E?04 5.73E?04 ?1.46 2.84E?02 ACLY ?0.55 1.12E?04 ?1.20E?16 1.00E+00 5.75E?04 ?0.55 2.84E?02 CRIP2 ?0.25 5.85E?01 1.46E+00 1.36E?04 5.96E?04 0.98 2.93E?02 FRMD6 ?0.61 3.62E?02 1.09E+00 1.23E?03 6.00E?04 0.62 2.93E?02 ST3GAL1 0.83 1.79E?03 8.24E?01 2.45E?02 6.09E?04 1.22 2.97E?02 LYSMD2 1.26 1.44E?04 1.87E?01 5.53E?01 6.12E?04 0.72 2.97E?02 PANK4 ?0.96 3.79E?04 ?4.76E?01 1.48E?01 6.35E?04 ?0.96 3.06E?02 CACNB2 1.46 6.17E?03 1.12E+00 7.16E?03 6.33E?04 0.41 3.06E?02 CDCA7 ?0.42 7.05E?02 ?1.81E+00 7.24E?04 6.43E?04 ?1.16 3.09E?02 CRISPLD2 0.34 6.24E?01 1.64E+00 1.45E?04 6.49E?04 0.69 3.10E?02 GM4951 ?1.08 1.21E?01 ?1.37E+00 4.67E?04 6.59E?04 ?0.95 3.14E?02 CHST10 2.47 5.56E?03 1.45E+00 8.48E?03 6.70E?04 0.52 3.18E?02 IFT57 0.71 1.37E?02 9.23E?01 3.52E?03 6.76E?04 1.23 3.19E?02 PCBP3 ?1.85 1.12E?03 ?1.09E+00 4.59E?02 6.74E?04 ?0.27 3.19E?02 GGA3 0.54 8.38E?02 ?1.18E+00 6.74E?04 6.93E?04 ?0.37 3.24E?02 TESC 0.79 1.22E?02 9.32E?01 4.02E?03 6.90E?04 1.54 3.24E?02 EBF1 0.47 5.34E?02 1.35E+00 1.01E?03 6.94E?04 1.37 3.24E?02 CTSD 0.63 5.01E?04 1.87E+00 1.22E?01 7.10E?04 0.73 3.30E?02 ETNK1 ?0.62 2.11E?03 ?8.95E?01 2.54E?02 7.28E?04 ?1.00 3.37E?02 CBLN3 0.43 5.60E?03 ?8.11E?01 9.30E?03 7.32E?04 0.04 3.38E?02 NHLRC2 0.32 3.47E?01 1.16E+00 2.34E?04 7.38E?04 1.14 3.39E?02 S100A11 0.76 1.44E?04 2.05E?01 1.00E+00 7.40E?04 0.78 3.39E?02 DHX57 ?1.00 2.05E?04 ?2.35E?01 4.44E?01 7.57E?04 ?0.59 3.46E?02 E030024N20RIK ?0.38 1.52E?04 ?1.20E?16 1.00E+00 7.67E?04 ?0.38 3.49E?02 NLRC5 ?0.32 1.75E?01 ?1.85E+00 4.08E?04 7.71E?04 ?0.87 3.49E?02 DTX3L ?0.74 1.74E?04 ?3.67E?01 6.39E?01 7.79E?04 ?0.76 3.52E?02 EIF4G2 ?0.55 1.55E?04 ?1.20E?16 1.00E+00 7.83E?04 ?0.55 3.52E?02 SLC25A39 0.53 1.74E?04 ?2.55E?01 6.76E?01 7.99E?04 0.45 3.53E?02 ISCU 0.57 4.38E?03 1.33E+00 1.31E?02 7.92E?04 1.37 3.53E?02 BACH2 0.73 6.50E?04 9.31E?01 1.04E?01 7.95E?04 0.90 3.53E?02 MGLL 0.44 6.29E?02 1.26E+00 1.01E?03 7.98E?04 1.48 3.53E?02 PTBP2 ?1.13 7.27E?04 ?5.25E?01 9.03E?02 7.90E?04 ?0.85 3.53E?02 APLF 0.37 1.63E?01 ?1.33E+00 4.54E?04 8.08E?04 ?0.27 3.56E?02 ANXA3 0.60 7.99E?02 ?1.14E+00 8.46E?04 8.23E?04 ?1.13 3.61E?02 TNFRSF4 ?0.45 1.63E?04 ?1.20E?16 1.00E+00 8.20E?04 ?0.45 3.61E?02 MXD4 3.36 9.34E?03 1.96E+00 6.44E?03 8.34E?04 0.29 3.64E?02 ARHGDIB ?0.32 1.68E?04 ?1.20E?16 1.00E+00 8.41E?04 ?0.32 3.66E?02 HIST1H1E 0.70 3.16E?03 8.23E?01 1.97E?02 8.46E?04 1.45 3.67E?02 DCTN4 0.65 5.94E?04 1.88E+00 1.26E?01 8.54E?04 0.73 3.68E?02 KIF3A ?0.48 3.43E?02 ?1.13E+00 1.90E?03 8.56E?04 ?1.23 3.68E?02 GPM6B ?0.78 3.29E?02 ?9.69E?01 1.97E?03 8.57E?04 ?1.67 3.68E?02 DUSP3 0.69 3.01E?02 1.02E+00 2.16E?03 8.64E?04 1.27 3.69E?02 RPL9 ?0.18 1.73E?04 ?1.20E?16 1.00E+00 8.67E?04 ?0.18 3.70E?02 SEMA7A 0.59 1.32E?01 1.12E+00 5.84E?04 8.71E?04 1.19 3.70E?02 INPP4B ?0.16 5.50E?01 ?1.67E+00 2.14E?04 8.86E?04 ?1.02 3.75E?02 GNAI2 0.56 2.24E?04 ?5.96E?01 5.22E?01 8.99E?04 0.53 3.79E?02 TRIM25 ?0.37 5.86E?02 ?2.23E+00 1.26E?03 9.21E?04 ?0.70 3.87E?02 PRG4 0.53 1.59E?01 ?1.44E+00 5.39E?04 9.31E?04 ?0.18 3.91E?02 H1F0 0.97 9.21E?04 5.78E?01 8.52E?02 9.38E?04 1.19 3.92E?02 PKNOX1 ?0.68 4.56E?02 9.93E?01 1.63E?03 9.50E?04 0.58 3.95E?02 TRIP10 ?0.86 2.25E?04 1.95E?01 5.78E?01 9.51E?04 ?0.37 3.95E?02 RNF10 0.82 2.43E?04 3.56E?01 5.38E?01 9.84E?04 0.88 3.99E?02 HMGB1 ?0.45 1.98E?04 ?1.20E?16 1.00E+00 9.85E?04 ?0.45 3.99E?02 LMNA 0.52 1.63E?01 1.13E+00 5.57E?04 9.80E?04 1.75 3.99E?02 SOAT2 ?0.63 2.91E?02 ?1.26E+00 2.56E?03 9.80E?04 ?0.94 3.99E?02 HMGN2 ?0.73 2.35E?03 ?1.27E+00 3.17E?02 9.72E?04 ?0.99 3.99E?02 GM20939 ?0.57 2.07E?02 ?1.52E+00 3.51E?03 9.70E?04 ?0.93 3.99E?02 MAX 0.69 2.32E?04 ?3.12E?01 5.79E?01 9.79E?04 0.56 3.99E?02 CEBPD 2.35 2.74E?02 1.87E+00 2.68E?03 9.68E?04 0.34 3.99E?02 ARHGAP18 ?0.33 1.43E?01 ?1.14E+00 6.32E?04 9.93E?04 ?1.36 4.01E?02 THY1 0.58 2.06E?04 ?1.20E?16 1.00E+00 1.02E?03 0.57 4.10E?02 CNN3 0.31 3.79E?02 2.85E+00 2.12E?03 1.03E?03 0.87 4.14E?02 CPNE8 ?0.36 4.91E?02 ?1.29E+00 1.68E?03 1.04E?03 ?0.96 4.16E?02 HMGCR ?0.83 2.38E?04 ?3.12E?01 6.48E?01 1.05E?03 ?0.86 4.18E?02 ETS1 ?0.74 2.13E?04 ?1.20E?16 1.00E+00 1.05E?03 ?0.74 4.18E?02 MRPL23 ?0.50 4.25E?04 1.07E+00 2.54E?01 1.05E?03 ?0.42 4.18E?02 TEFM ?1.01 5.57E?04 ?4.25E?01 1.83E?01 1.06E?03 ?0.79 4.21E?02 RPLP1 ?0.19 2.20E?04 ?1.20E?16 1.00E+00 1.08E?03 ?0.19 4.27E?02 WASF2 0.52 2.22E?04 ?1.20E?16 1.00E+00 1.09E?03 0.52 4.29E?02 NME2 0.34 2.70E?04 9.82E?01 5.46E?01 1.10E?03 0.36 4.30E?02 UBXN2A 1.06 2.55E?04 1.70E?01 6.21E?01 1.10E?03 0.87 4.30E?02 MYO10 0.62 7.30E?03 1.14E+00 1.19E?02 1.15E?03 0.93 4.49E?02 GNPDA2 0.68 4.91E?03 8.88E?01 1.79E?02 1.16E?03 1.50 4.49E?02 PHF2 0.35 7.46E?02 ?1.01E+00 1.30E?03 1.16E?03 ?0.22 4.49E?02 KDSR 1.07 2.77E?04 ?2.18E?01 5.99E?01 1.17E?03 0.77 4.50E?02 RFX3 1.39 2.26E?02 ?1.18E+00 3.96E?03 1.17E?03 ?0.10 4.50E?02 ILTIFB 1.00E+00 2.89E+00 1.17E?03 1.17E?03 4.50E?02 PNO1 0.60 3.60E?03 1.59E+00 2.54E?02 1.18E?03 1.13 4.53E?02 TIAL1 ?0.40 1.33E?01 ?1.10E+00 8.10E?04 1.19E?03 ?0.82 4.53E?02 MYC 0.79 3.07E?04 ?3.76E?01 5.24E?01 1.21E?03 0.61 4.61E?02 RNF214 ?0.85 2.53E?04 4.19E?02 9.24E?01 1.23E?03 ?0.53 4.66E?02 SLC25A33 1.62 7.18E?04 5.45E?01 1.66E?01 1.26E?03 0.55 4.75E?02 DCLK1 0.71 1.81E?02 9.19E?01 5.40E?03 1.28E?03 1.08 4.82E?02 FUNDC2 ?0.46 3.04E?02 ?1.03E+00 3.31E?03 1.29E?03 ?1.13 4.83E?02 FAU ?0.19 2.68E?04 ?1.20E?16 1.00E+00 1.31E?03 ?0.19 4.89E?02 RAB24 ?0.09 7.96E?01 1.21E+00 2.79E?04 1.31E?03 1.01 4.89E?02 DGAT2 0.90 4.85E?01 ?2.43E+00 3.50E?04 1.32E?03 ?0.41 4.90E?02 UBE2D3 0.36 5.33E?04 1.43E+00 2.68E?01 1.34E?03 0.40 4.99E?02 SRSF11 0.59 5.36E?04 1.43E+00 2.68E?01 1.35E?03 0.63 5.00E?02 SYVN1 0.62 5.18E?03 9.73E?01 2.04E?02 1.37E?03 0.98 5.04E?02 H2-T22 ?0.61 2.81E?04 ?1.20E?16 1.00E+00 1.36E?03 ?0.61 5.04E?02 IL18BP ?1.87 3.37E?04 ?2.30E?01 5.69E?01 1.38E?03 ?0.45 5.05E?02 IFT46 0.93 8.85E?04 5.26E?01 1.47E?01 1.39E?03 1.04 5.08E?02 ADAM10 ?0.64 1.99E?03 ?9.08E?01 5.96E?02 1.43E?03 ?0.97 5.21E?02 SLC43A1 1.42 2.36E?01 ?2.36E+00 6.39E?04 1.45E?03 ?0.32 5.30E?02 DDB2 ?1.01 4.65E?03 ?7.13E?01 2.48E?02 1.47E?03 ?1.26 5.34E?02 H2-Q9 ?0.71 2.65E?02 ?9.25E?01 4.49E?03 1.50E?03 ?1.68 5.44E?02 SSBP4 0.67 1.01E?02 8.65E?01 1.17E?02 1.52E?03 1.36 5.50E?02 ULBP1 0.16 7.02E?01 1.27E+00 3.48E?04 1.55E?03 1.14 5.56E?02 MICU2 0.83 7.01E?04 4.76E?01 2.27E?01 1.55E?03 1.10 5.56E?02 GFPT2 0.57 1.79E?01 1.23E+00 8.55E?04 1.56E?03 0.92 5.60E?02 ROGDI 0.19 6.48E?01 ?1.19E+00 3.65E?04 1.57E?03 ?1.12 5.62E?02 HIST2H3B 1.06 5.77E?04 3.80E?01 3.05E?01 1.58E?03 0.62 5.62E?02 IRGM1 ?0.48 7.39E?02 ?1.47E+00 1.86E?03 1.60E?03 ?1.20 5.64E?02 GLTSCR2 ?0.29 3.34E?04 ?1.20E?16 1.00E+00 1.61E?03 ?0.29 5.64E?02 CCR8 ?0.78 6.94E?03 ?8.18E?01 1.81E?02 1.60E?03 ?1.57 5.64E?02 IL16 ?0.60 2.13E?02 ?9.43E?01 5.94E?03 1.61E?03 ?1.27 5.64E?02 APOPT1 ?0.81 1.00E?03 ?6.98E?01 1.52E?01 1.60E?03 ?1.07 5.64E?02 FLOT1 0.58 4.20E?03 1.32E+00 3.10E?02 1.62E?03 1.13 5.65E?02 ESYT1 0.57 3.98E?03 1.47E+00 3.26E?02 1.61E?03 0.95 5.65E?02 ATP6V1H ?0.50 3.31E?02 ?9.79E?01 3.94E?03 1.62E?03 ?1.50 5.65E?02 SEMA4F 0.53 9.72E?02 1.05E+00 1.50E?03 1.64E?03 1.52 5.69E?02 TMEM50A 0.38 3.42E?04 ?1.20E?16 1.00E+00 1.64E?03 0.38 5.69E?02 AUP1 ?0.41 3.45E?04 ?1.20E?16 1.00E+00 1.65E?03 ?0.41 5.72E?02 ADAM28 0.41 4.34E?03 6.73E?01 3.13E?02 1.68E?03 0.34 5.80E?02

    TABLE-US-00007 TABLE 1B Th1 KO GFP+ vs GFP? Gene coefC pvalC coefD pvalD pvalH logFC FDR IL23R 1.17 1.84E?02 3.63E+00 3.38E?20 2.45E?20 3.97 3.17E?16 EGFP_IRES_IL23R 0.75 2.22E?01 2.77E+00 5.60E?13 2.44E?12 3.48 1.58E?08 GZMB ?1.78 1.06E?03 ?1.69E+00 1.27E?06 3.77E?08 ?3.93 1.50E?04 CHCHD10 ?1.17 1.68E?08 ?1.31E+00 1.64E?01 4.64E?08 ?1.33 1.50E?04 ARPC3 0.96 1.19E?07 1.73E+00 2.91E?02 7.56E?08 1.32 1.96E?04 TPT1 ?0.51 2.53E?08 ?3.03E?17 1.00E+00 1.82E?07 ?0.51 3.94E?04 TIMP1 0.80 1.14E?01 1.86E+00 1.08E?07 2.13E?07 3.64 3.94E?04 FAM162A 0.93 1.25E?07 1.04E+00 4.91E?01 6.77E?07 0.95 1.10E?03 SMOX 1.10 7.85E?06 2.52E+00 1.22E?02 1.99E?06 1.37 2.87E?03 GM8096 1.00E+00 ?3.73E+00 3.81E?06 3.81E?06 4.49E?03 ANP32B ?1.04 8.44E?06 ?1.55E+00 2.26E?02 3.67E?06 ?1.17 4.49E?03 S100A10 0.73 9.67E?07 ?3.03E?17 1.00E+00 6.17E?06 0.73 6.66E?03 PHF11C ?1.84 9.44E?05 ?1.16E+00 3.84E?03 7.49E?06 ?1.16 7.42E?03 IRF7 ?0.62 4.18E?02 ?1.51E+00 1.10E?05 8.01E?06 ?2.17 7.42E?03 SPHK1 ?1.19 2.91E?01 2.67E+00 2.71E?06 9.50E?06 1.22 8.06E?03 TNC ?0.49 5.40E?02 1.66E+00 1.10E?05 9.94E?06 0.29 8.06E?03 RPS6KC1 ?1.07 6.49E?02 1.69E+00 1.06E?05 1.12E?05 0.97 8.52E?03 PRDX2 0.65 2.69E?06 ?3.03E?17 1.00E+00 1.65E?05 0.65 9.37E?03 TNFRSF8 0.75 2.12E?02 1.60E+00 4.38E?05 1.66E?05 1.92 9.37E?03 EBF1 0.34 3.16E?01 1.66E+00 4.39E?06 1.60E?05 1.57 9.37E?03 BHLHE40 0.99 4.08E?06 1.45E+00 3.30E?01 1.53E?05 1.02 9.37E?03 ATP6V0D2 1.48 2.44E?03 1.24E+00 3.18E?04 1.55E?05 2.42 9.37E?03 H2?Q10 0.99 9.72E?03 1.53E+00 8.35E?05 1.54E?05 2.35 9.37E?03 INSL5 3.64 3.57E?03 2.52E+00 2.57E?04 1.80E?05 0.92 9.72E?03 IFITM2 0.84 2.15E?05 1.48E+00 7.92E?02 2.58E?05 1.12 1.34E?02 SERPINF1 1.36 3.38E?05 8.46E?01 7.16E?02 3.65E?05 1.79 1.82E?02 S1PR1 1.10 9.87E?05 1.25E+00 2.36E?02 3.93E?05 1.44 1.82E?02 P4HA2 1.14 3.09E?03 1.18E+00 7.20E?04 4.12E?05 1.96 1.82E?02 ASS1 ?0.95 1.11E?04 ?1.05E+00 2.02E?02 3.84E?05 ?1.61 1.82E?02 AP1B1 0.39 1.56E?01 2.70E+00 2.05E?05 4.21E?05 1.19 1.82E?02 PDCD1 0.63 6.70E?02 1.52E+00 4.38E?05 4.41E?05 2.17 1.82E?02 RPSA ?0.31 7.66E?06 ?3.03E?17 1.00E+00 4.49E?05 ?0.31 1.82E?02 AW554918 ?2.25 1.02E?05 8.16E?02 8.82E?01 5.86E?05 ?0.37 2.23E?02 KCTD11 0.08 9.12E?01 1.84E+00 1.01E?05 5.79E?05 1.24 2.23E?02 MGARP 0.44 9.71E?02 1.70E+00 4.97E?05 6.73E?05 2.03 2.42E?02 AHNAK 1.34 2.86E?05 1.21E+00 1.86E?01 6.58E?05 1.40 2.42E?02 ITFG2 ?1.36 1.07E?04 ?7.36E?01 4.28E?02 7.06E?05 ?0.97 2.47E?02 SLC7A14 ?0.44 1.89E?04 ?1.90E+00 2.43E?02 7.44E?05 ?0.48 2.54E?02 CD200 1.05 4.03E?04 2.51E+00 1.13E?02 7.74E?05 1.24 2.57E?02 NCF4 ?0.45 1.09E?01 ?1.62E+00 5.74E?05 8.44E?05 ?1.74 2.74E?02 GARS ?0.71 5.86E?05 ?1.37E+00 1.34E?01 1.01E?04 ?0.75 2.87E?02 LAMB3 ?1.61 1.67E?01 ?2.77E+00 5.05E?05 1.04E?04 ?0.48 2.87E?02 VHL ?0.32 3.76E?01 1.44E+00 2.77E?05 1.03E?04 1.37 2.87E?02 CCDC71L 0.43 4.05E?01 1.61E+00 2.58E?05 1.01E?04 1.12 2.87E?02 ARHGEF1 ?0.82 1.82E?05 3.31E?01 7.33E?01 9.67E?05 ?0.75 2.87E?02 AMDHD1 1.00E+00 ?3.43E+00 9.86E?05 9.86E?05 2.87E?02 LUM 1.22 5.18E?01 2.17E+00 2.18E?05 9.89E?05 1.56 2.87E?02 CCDC102A 1.00E+00 3.16E+00 1.22E?04 1.22E?04 3.24E?02 DOCK8 ?1.05 4.53E?05 4.39E?01 2.46E?01 1.25E?04 ?0.52 3.24E?02 RC3H1 ?0.91 4.24E?04 ?8.27E?01 1.81E?02 1.22E?04 ?1.02 3.24E?02 HVCN1 0.52 6.37E?02 1.43E+00 1.57E?04 1.42E?04 1.88 3.60E?02 RABGAP1 1.46 5.17E?04 7.96E?01 1.98E?02 1.60E?04 1.14 3.98E?02 RORA 0.14 6.69E?01 1.46E+00 3.27E?05 1.64E?04 1.07 4.01E?02 RAC1 ?1.00 1.08E?04 ?1.94E+00 1.26E?01 1.72E?04 ?1.03 4.05E?02 IZUMO1R ?0.89 2.76E?03 ?1.02E+00 3.72E?03 1.69E?04 ?1.97 4.05E?02 SPTAN1 ?1.12 4.17E?05 2.41E?01 5.78E?01 1.93E?04 ?0.77 4.41E?02 CD44 0.18 5.40E?01 1.82E+00 4.34E?05 1.94E?04 1.36 4.41E?02 RNH1 0.67 4.22E?05 8.23E?01 7.11E?01 2.13E?04 0.68 4.74E?02 MPHOSPH6 0.84 2.64E?04 ?1.07E+00 5.88E?02 2.16E?04 0.63 4.74E?02 SAA4 0.15 4.53E?01 ?1.68E+00 5.84E?05 2.34E?04 ?0.20 4.97E?02 SLC15A3 0.98 2.93E?02 1.24E+00 5.32E?04 2.31E?04 2.03 4.97E?02 AZIN2 ?2.18 6.54E?05 4.58E?01 3.86E?01 2.38E?04 ?0.12 4.97E?02 GINM1 0.08 6.96E?01 1.81E+00 4.94E?05 2.45E?04 1.43 5.05E?02 SERPINA3F ?3.97 5.18E?04 ?1.37E+00 3.34E?02 2.52E?04 ?0.69 5.06E?02 MIR703 0.17 2.73E?01 ?1.55E+00 8.91E?05 2.54E?04 ?2.61 5.06E?02 TESC ?0.89 1.40E?03 ?8.94E?01 1.27E?02 2.72E?04 ?1.70 5.16E?02 IER2 ?0.98 8.39E?05 ?5.54E?01 3.21E?01 2.67E?04 ?1.06 5.16E?02 HMGN2 ?0.63 1.38E?02 ?1.49E+00 1.32E?03 2.79E?04 ?1.08 5.16E?02 RNASEK 0.27 2.40E?01 3.28E+00 1.02E?04 2.64E?04 1.09 5.16E?02 SLC7A5 ?0.93 3.83E?03 ?1.08E+00 4.64E?03 2.78E?04 ?1.24 5.16E?02 PGAM1 0.66 5.65E?05 5.86E?01 8.08E?01 2.92E?04 0.67 5.19E?02 MTF2 ?0.31 3.26E?01 ?1.57E+00 9.07E?05 2.91E?04 ?1.24 5.19E?02 YKT6 ?0.73 1.43E?03 1.07E+00 1.32E?02 2.87E?04 ?0.06 5.19E?02 INPP5B 0.94 8.05E?05 4.90E?01 4.27E?01 3.07E?04 1.03 5.29E?02 ARF6 ?0.95 2.72E?04 ?8.36E?01 8.95E?02 3.13E?04 ?1.05 5.29E?02 CDT1 ?0.93 5.72E?04 ?8.47E?01 3.73E?02 3.03E?04 ?1.52 5.29E?02 TRIM24 ?1.17 3.45E?03 ?9.70E?01 5.92E?03 3.14E?04 ?0.96 5.29E?02 CAMK2B 1.00E+00 3.62E+00 3.37E?04 3.37E?04 5.60E?02 ZC3H12C ?1.13 1.68E?01 2.20E+00 1.77E?04 3.42E?04 0.41 5.61E?02 GABARAPL1 0.41 9.16E?02 3.08E+00 3.13E?04 3.64E?04 0.99 5.77E?02 BNIP3 0.32 2.23E?01 2.05E+00 1.48E?04 3.57E?04 1.66 5.77E?02 TMBIM4 0.06 7.87E?01 3.26E+00 7.20E?05 3.65E?04 1.01 5.77E?02 ETV5 0.23 5.98E?01 1.39E+00 8.49E?05 3.85E?04 1.61 6.01E?02 SERF1 0.86 4.65E?04 6.83E?01 6.59E?02 4.03E?04 1.39 6.07E?02 TRAF3IP3 ?0.43 9.12E?02 ?2.00E+00 3.47E?04 3.99E?04 ?1.18 6.07E?02 KHDRBS1 ?0.88 2.32E?04 ?7.20E?01 1.46E?01 3.96E?04 ?1.01 6.07E?02 GDF3 1.00E+00 ?3.20E+00 4.08E?04 4.08E?04 6.08E?02 SLC13A3 0.92 3.81E?01 1.99E+00 1.19E?04 4.16E?04 0.78 6.13E?02 ISG20 ?0.74 1.06E?01 ?1.37E+00 3.31E?04 4.30E?04 ?1.74 6.27E?02 PHPT1 ?0.18 5.04E?01 ?1.62E+00 1.09E?04 4.47E?04 ?1.42 6.43E?02 SLC17A9 0.77 8.71E?03 1.48E+00 3.63E?03 4.66E?04 1.29 6.64E?02 MT1 0.89 3.74E?04 1.16E+00 1.04E?01 4.77E?04 1.12 6.72E?02 SYNGAP1 ?0.49 3.12E?01 1.46E+00 1.60E?04 4.83E?04 0.48 6.74E?02 CSNK1G2 ?0.99 4.37E?04 5.87E?01 9.77E?02 5.24E?04 ?0.11 7.15E?02 PRMT5 ?0.83 1.02E?03 ?9.03E?01 3.76E?02 5.24E?04 ?1.18 7.15E?02 SOX5 0.67 3.12E?02 1.11E+00 1.24E?03 5.35E?04 1.10 7.22E?02 CYBRD1 ?0.24 3.12E?02 ?1.24E+00 1.36E?03 5.81E?04 ?0.35 7.68E?02 CALM2 0.52 1.45E?04 1.10E+00 4.89E?01 5.78E?04 0.54 7.68E?02 TMEM265 0.09 8.93E?01 1.77E+00 1.18E?04 5.99E?04 0.82 7.69E?02 GRINA ?0.82 1.71E?04 ?4.37E?01 3.90E?01 5.92E?04 ?0.94 7.69E?02 NUDCD1 1.23 4.20E?04 ?5.67E?01 1.21E?01 5.97E?04 0.53 7.69E?02 PKIB 0.32 5.35E?01 1.58E+00 1.55E?04 6.46E?04 0.92 8.21E?02 ITGB7 ?0.66 9.97E?03 ?1.55E+00 4.82E?03 6.80E?04 ?1.27 8.45E?02 EDA2R 1.00E+00 3.08E+00 6.74E?04 6.74E?04 8.45E?02 SLFN1 ?0.27 3.60E?01 ?1.59E+00 2.10E?04 6.85E?04 ?1.41 8.45E?02 USP20 ?1.25 1.89E?03 8.15E?01 2.71E?02 6.95E?04 0.33 8.46E?02 PERP 0.75 1.25E?02 1.09E+00 4.00E?03 7.05E?04 1.81 8.46E?02 SLC4A7 0.97 7.26E?04 8.29E?01 7.90E?02 7.08E?04 1.19 8.46E?02 MYLK 0.61 4.30E?01 1.70E+00 1.96E?04 7.11E?04 0.58 8.46E?02 GABARAP 0.62 1.44E?04 5.59E?01 8.83E?01 7.20E?04 0.62 8.48E?02 PADI2 ?0.20 4.73E?01 ?1.53E+00 1.93E?04 7.41E?04 ?0.62 8.65E?02 CD74 1.23 3.42E?03 8.19E?01 1.60E?02 7.60E?04 1.64 8.80E?02 ZFP420 1.00E+00 ?3.16E+00 7.87E?04 7.87E?04 8.95E?02 AKR1B8 0.31 2.95E?01 1.28E+00 2.78E?04 7.81E?04 1.89 8.95E?02 RPL30 ?0.30 1.59E?04 ?3.03E?17 1.00E+00 8.01E?04 ?0.30 9.03E?02 SHMT2 ?0.78 3.82E?03 ?1.31E+00 1.61E?02 8.44E?04 ?0.97 9.37E?02 RAD23B ?0.61 2.03E?03 ?9.57E?01 3.29E?02 8.80E?04 ?0.80 9.37E?02 NOL7 ?0.70 5.69E?04 ?9.39E?01 1.39E?01 8.81E?04 ?0.81 9.37E?02 JAK2 ?0.89 3.74E?03 8.62E?01 1.68E?02 8.60E?04 0.04 9.37E?02 CHD7 ?0.77 1.74E?04 4.52E?02 1.00E+00 8.79E?04 ?0.76 9.37E?02 AKNA ?0.73 6.84E?04 ?1.18E+00 1.07E?01 8.53E?04 ?0.83 9.37E?02 MMP11 1.03 3.94E?01 ?2.32E+00 2.57E?04 8.72E?04 ?0.45 9.37E?02 LAMP1 ?1.10 2.19E?04 ?2.71E?01 5.41E?01 8.98E?04 ?1.12 9.39E?02 TRIB3 ?1.58 1.90E?03 ?7.58E?01 3.61E?02 8.94E?04 ?1.43 9.39E?02 SGK1 2.86 3.53E?02 ?1.63E+00 2.06E?03 9.45E?04 ?0.30 9.73E?02 SPIRE1 0.38 4.69E?01 1.47E+00 2.50E?04 9.41E?04 0.92 9.73E?02 CLEC2I ?1.41 1.96E?04 7.37E?02 8.33E?01 9.54E?04 ?0.69 9.74E?02 ZFP109 0.12 9.13E?01 ?2.22E+00 2.00E?04 9.86E?04 ?0.56 9.91E?02 MARK4 ?1.43 4.30E?04 4.72E?01 2.28E?01 9.82E?04 ?0.07 9.91E?02

    TABLE-US-00008 TABLE 1C Th1 Combined Model Gene coefC pvalC coefD pvalD pvalH logFC FDR RPS2 1.32 4.71E?18 2.12E?16 1.00E+00 5.17E?17 1.32 3.66E?14 ANP32B 2.23 1.17E?14 ?4.90E?01 6.02E?01 1.00E?13 2.13 3.54E?11 1110008F13RIK 2.33 3.24E?09 1.51E+00 4.38E?04 5.09E?11 3.23 1.20E?08 RNF187 2.11 2.26E?09 2.21E+00 4.97E?03 3.37E?10 2.69 5.96E?08 H2-T23 ?1.06 5.68E?11 2.12E?16 1.00E+00 4.77E?10 ?1.06 6.74E?08 LSM4 1.53 1.33E?10 1.47E+00 2.88E?01 6.26E?10 1.59 7.37E?08 LAMP1 2.08 4.71E?09 1.06E+00 6.44E?02 6.42E?09 2.38 6.48E?07 LARS2 0.83 9.96E?10 2.12E?16 1.00E+00 7.82E?09 0.83 6.91E?07 RAC1 1.85 4.53E?09 1.91E+00 1.30E?01 1.09E?08 1.88 6.99E?07 IER2 1.72 1.72E?08 1.58E+00 2.61E?02 1.05E?08 2.19 6.99E?07 TESC 1.81 4.78E?06 1.75E+00 6.04E?05 9.17E?09 2.96 6.99E?07 PELI1 1.83 1.25E?07 2.10E+00 5.89E?03 1.92E?08 2.22 1.13E?06 VAPA 1.66 1.43E?08 1.79E+00 1.61E?01 3.91E?08 1.78 2.13E?06 RBMS1 1.18 9.16E?04 2.46E+00 5.99E?06 1.46E?07 2.64 6.44E?06 RN7S1 0.57 3.98E?02 2.26E+00 1.71E?07 1.40E?07 2.08 6.44E?06 RN7S2 0.57 3.98E?02 2.26E+00 1.71E?07 1.40E?07 2.08 6.44E?06 EIF3F 0.98 3.35E?08 2.12E?16 1.00E+00 2.39E?07 0.98 9.94E?06 PPP4C 1.29 6.66E?07 2.10E+00 7.73E?02 9.05E?07 1.47 3.55E?05 LRP10 1.09 6.44E?04 3.07E+00 8.61E?05 1.33E?06 1.82 4.94E?05 TMEM30A 1.11 1.06E?04 3.43E+00 7.12E?04 1.78E?06 1.55 5.76E?05 NOL7 1.42 5.48E?07 1.08E+00 2.14E?01 1.65E?06 1.52 5.76E?05 CLASP2 1.88 1.33E?06 1.48E+00 7.94E?02 1.79E?06 2.00 5.76E?05 TMEM160 1.36 1.86E?05 1.45E+00 5.29E?03 2.14E?06 2.12 6.58E?05 2310036022RIK 1.66 9.17E?06 1.06E+00 1.19E?02 2.25E?06 2.09 6.63E?05 FAM49B 1.22 6.37E?07 5.76E?01 4.62E?01 3.15E?06 1.25 8.90E?05 ARF6 1.60 1.04E?06 7.63E?01 2.44E?01 3.37E?06 1.63 9.17E?05 UCK2 1.47 2.84E?06 1.59E+00 7.81E?02 3.68E?06 1.69 9.63E?05 KHDRBS1 1.31 3.06E?06 1.16E+00 7.71E?02 3.91E?06 1.59 9.87E?05 TMEM161B ?2.04 1.88E?05 ?1.11E+00 1.46E?02 5.38E?06 ?0.98 1.31E?04 NUBP1 1.36 2.51E?06 7.50E?01 1.55E?01 5.61E?06 1.70 1.32E?04 UTP18 2.04 2.58E?06 5.60E?01 2.04E?01 7.07E?06 1.84 1.61E?04 ESYT1 1.12 5.72E?06 1.44E+00 1.25E?01 1.05E?05 1.32 2.31E?04 ENSA ?1.29 2.71E?04 ?1.59E+00 1.98E?03 1.10E?05 ?1.88 2.31E?04 STX6 1.27 3.60E?04 1.78E+00 1.50E?03 1.11E?05 2.12 2.31E?04 RALA 0.68 6.00E?03 2.51E+00 1.16E?04 1.37E?05 1.68 2.76E?04 PRKCH 1.27 1.09E?05 1.18E+00 9.69E?02 1.59E?05 1.61 3.12E?04 CBX3 ?0.76 2.96E?06 2.12E?16 1.00E+00 1.81E?05 ?0.76 3.46E?04 NDFIP2 0.01 9.72E?01 1.98E+00 4.48E?06 2.69E?05 2.05 5.00E?04 PANX1 0.81 4.76E?02 1.74E+00 3.85E?05 2.94E?05 2.42 5.26E?04 PRRC2A 0.88 5.23E?06 7.78E?01 7.56E?01 2.97E?05 0.88 5.26E?04 PHF20L1 0.91 8.52E?03 1.73E+00 2.15E?04 3.33E?05 1.52 5.75E?04 ACBD6 0.93 8.77E?04 1.72E+00 2.18E?03 3.60E?05 2.16 6.05E?04 RBM42 1.20 2.54E?05 1.47E+00 1.07E?01 3.85E?05 1.41 6.34E?04 ITSN2 1.76 6.90E?06 6.62E?02 8.74E?01 4.01E?05 1.41 6.45E?04 EIF4A2 ?0.85 2.00E?05 ?2.05E+00 1.61E?01 4.20E?05 ?0.97 6.59E?04 OPTN 2.39 1.15E?04 1.19E+00 2.29E?02 4.43E?05 1.31 6.81E?04 RBM17 1.01 1.47E?05 1.50E+00 2.76E?01 4.63E?05 1.02 6.96E?04 OST4 ?1.17 1.64E?05 ?1.21E+00 2.75E?01 5.11E?05 ?1.30 7.53E?04 NOP9 0.55 8.29E?02 2.08E+00 5.06E?05 6.03E?05 2.00 8.53E?04 UBA5 2.14 2.02E?05 4.70E?01 2.58E?01 5.98E?05 1.37 8.53E?04 CLPTM1 1.25 2.83E?04 1.24E+00 1.31E?02 6.33E?05 1.80 8.77E?04 GPSM2 2.50 2.30E?04 1.40E+00 1.75E?02 6.72E?05 1.37 9.13E?04 BLOC1S4 1.02 5.50E?02 1.78E+00 8.84E?05 7.29E?05 2.13 9.58E?04 RPL10A ?0.33 1.37E?05 2.12E?16 1.00E+00 7.82E?05 ?0.33 9.58E?04 WDR70 1.95 4.88E?05 6.94E?01 1.11E?01 7.34E?05 1.79 9.58E?04 RPL9 ?0.29 1.38E?05 2.12E?16 1.00E+00 7.86E?05 ?0.29 9.58E?04 THY1 0.93 1.43E?05 7.57E?01 7.48E?01 7.77E?05 0.95 9.58E?04 PGS1 1.29 3.68E?05 9.61E?01 1.67E?01 7.70E?05 1.52 9.58E?04 D030056L22RIK 1.71 1.75E?02 1.75E+00 2.87E?04 8.29E?05 2.06 9.77E?04 CFL1 0.38 1.45E?05 2.00E?01 1.00E+00 8.25E?05 0.38 9.77E?04 AMDHD1 1.00E+00 3.44E+00 8.76E?05 8.76E?05 1.01E?03 DUSP2 1.36 3.83E?03 1.57E+00 1.56E?03 1.02E?04 2.46 1.17E?03 ZFAND5 1.23 8.17E?04 1.12E+00 9.07E?03 1.23E?04 1.43 1.36E?03 POLR2M 1.08 3.84E?05 8.14E?01 3.03E?01 1.23E?04 1.26 1.36E?03 ZFP78 ?5.85 5.20E?05 ?1.19E+00 2.07E?01 1.26E?04 ?0.24 1.37E?03 RPL39 ?0.31 2.47E?05 2.12E?16 1.00E+00 1.37E?04 ?0.31 1.47E?03 ANKRD49 1.15 5.68E?04 ?1.02E+00 1.85E?02 1.64E?04 ?0.40 1.73E?03 LRP12 ?2.63 3.38E?05 1.45E?01 7.80E?01 1.78E?04 ?0.17 1.85E?03 TSEN34 0.98 1.74E?02 1.42E+00 6.80E?04 1.85E?04 2.09 1.86E?03 ZBTB38 1.35 6.47E?03 1.38E+00 1.74E?03 1.82E?04 1.90 1.86E?03 ATXN2L 1.05 6.53E?05 1.10E+00 2.81E?01 1.93E?04 1.10 1.90E?03 TPR 0.93 3.75E?05 4.02E?01 7.25E?01 1.92E?04 0.95 1.90E?03 MGAT2 0.97 9.70E?03 1.50E+00 1.28E?03 1.97E?04 2.07 1.91E?03 CD3E 0.91 3.71E?05 3.72E?02 1.00E+00 2.02E?04 0.91 1.93E?03 MAP3K1 ?1.02 1.17E?04 ?1.20E+00 1.51E?01 2.13E?04 ?1.12 2.01E?03 TMEM55B 1.59 6.60E?04 9.73E?01 2.38E?02 2.36E?04 1.45 2.04E?03 NOMO1 1.01 1.25E?03 1.55E+00 1.24E?02 2.41E?04 1.59 2.04E?03 RPS6KC1 0.76 2.02E?01 ?1.74E+00 9.89E?05 2.27E?04 ?0.99 2.04E?03 FAHD2A ?1.11 1.15E?02 ?1.40E+00 1.36E?03 2.43E?04 ?2.02 2.04E?03 SERBP1 0.49 4.06E?05 2.12E?16 1.00E+00 2.20E?04 0.49 2.04E?03 CYB5R4 1.21 4.50E?03 1.22E+00 3.36E?03 2.40E?04 1.86 2.04E?03 SCAND1 0.49 1.66E?01 1.66E+00 1.19E?04 2.32E?04 1.83 2.04E?03 EIF4B ?0.69 4.52E?05 3.61E?01 8.89E?01 2.42E?04 ?0.68 2.04E?03 EMC7 0.51 5.74E?03 2.99E+00 2.65E?03 2.41E?04 1.09 2.04E?03 SIRT1 ?2.52 6.79E?05 4.37E?01 4.03E?01 2.52E?04 ?0.18 2.10E?03 DUS2 1.61 3.53E?04 8.10E?01 5.31E?02 2.61E?04 1.72 2.14E?03 UBE2D3 0.57 5.48E?05 6.10E?01 7.65E?01 2.80E?04 0.57 2.23E?03 STYX 0.82 1.81E?02 1.52E+00 1.01E?03 2.76E?04 1.42 2.23E?03 SDHD ?0.90 5.29E?05 ?9.17E?02 9.04E?01 2.81E?04 ?0.90 2.23E?03 YKT6 1.05 3.87E?04 ?1.05E+00 6.13E?02 3.20E?04 0.48 2.51E?03 GM5111 1.00E+00 2.97E+00 3.54E?04 3.54E?04 2.75E?03 EIF3J1 1.47 1.06E?04 5.25E?01 3.74E?01 3.68E?04 1.54 2.83E?03 E130309D02RIK 1.48 3.46E?04 7.31E?01 8.77E?02 3.86E?04 1.55 2.87E?03 EMC10 0.53 1.17E?01 1.61E+00 2.65E?04 3.79E?04 1.76 2.87E?03 RPS26 ?0.26 7.32E?05 2.12E?16 1.00E+00 3.85E?04 ?0.26 2.87E?03 CAMK2D 0.95 1.68E?02 1.45E+00 1.65E?03 4.07E?04 1.55 2.97E?03 ITGB1 0.59 1.08E?01 1.84E+00 3.08E?04 4.08E?04 1.57 2.97E?03 ZFP622 1.51 1.77E?04 5.07E?01 2.26E?01 4.25E?04 1.30 3.05E?03 MAPK1 0.97 3.38E?03 1.59E+00 8.51E?03 4.27E?04 1.56 3.05E?03 RFNG 0.47 2.04E?01 1.60E+00 1.94E?04 4.31E?04 1.94 3.05E?03 NPTN ?1.37 3.67E?04 ?8.01E?01 9.73E?02 4.43E?04 ?1.37 3.10E?03 RPL7A ?0.28 8.68E?05 2.12E?16 1.00E+00 4.52E?04 ?0.28 3.13E?03 LYSMD2 1.10 3.47E?03 1.07E+00 9.46E?03 4.82E?04 1.86 3.31E?03 VPS37A 0.90 1.41E?02 1.43E+00 2.70E?03 5.47E?04 1.58 3.67E?03 SLC30A9 1.02 2.92E?02 1.41E+00 1.36E?03 5.51E?04 1.86 3.67E?03 RPS21 ?0.35 1.06E?04 2.12E?16 1.00E+00 5.44E?04 ?0.35 3.67E?03 POLE4 0.86 8.45E?04 1.60E+00 5.20E?02 5.77E?04 1.09 3.81E?03 IQGAP1 0.95 1.40E?04 ?7.52E?01 5.66E?01 6.03E?04 0.93 3.95E?03 MTRF1L 0.61 2.51E?01 1.69E+00 2.40E?04 6.09E?04 1.55 3.95E?03 HDAC9 ?4.55 1.23E?04 7.41E?02 1.00E+00 6.31E?04 ?0.26 4.05E?03 RPL36A ?0.33 1.29E?04 2.12E?16 1.00E+00 6.55E?04 ?0.33 4.17E?03 ANKLE2 1.22 1.88E?03 1.07E+00 2.56E?02 6.61E?04 1.49 4.17E?03 ABHD12 0.16 7.30E?01 1.66E+00 1.42E?04 6.79E?04 1.86 4.24E?03 UBQLN1 0.86 1.16E?02 1.61E+00 4.19E?03 6.83E?04 1.58 4.24E?03 SACS 0.34 6.27E?01 1.91E+00 1.54E?04 6.90E?04 1.06 4.24E?03 YIPF4 0.87 5.63E?04 1.47E+00 1.12E?01 7.41E?04 1.03 4.26E?03 ANXA2 0.77 1.43E?04 4.12E?01 8.60E?01 7.11E?04 0.77 4.26E?03 A530064D06RIK 0.43 2.35E?02 1.47E+00 2.25E?03 7.22E?04 0.38 4.26E?03 ARPC1B 0.43 1.44E?04 2.12E?16 1.00E+00 7.27E?04 0.43 4.26E?03 IFT57 0.97 2.20E?02 1.28E+00 2.44E?03 7.35E?04 1.65 4.26E?03 GTF2H5 0.88 2.01E?04 ?6.71E?01 4.17E?01 7.17E?04 0.75 4.26E?03 ATP2B1 1.19 1.44E?04 1.52E?01 7.97E?01 7.06E?04 1.08 4.26E?03 HIST2H2AC 1.63 1.81E?02 1.78E+00 2.94E?03 7.33E?04 1.24 4.26E?03 EEF1A1 ?0.30 1.51E?04 2.12E?16 1.00E+00 7.61E?04 ?0.30 4.34E?03 DDAH2 2.45 2.60E?03 ?1.25E+00 2.17E?02 7.69E?04 ?0.21 4.35E?03 AW554918 1.86 1.63E?04 ?1.42E?01 8.09E?01 7.94E?04 0.26 4.37E?03 RAB24 0.28 5.86E?01 1.65E+00 1.82E?04 7.82E?04 1.47 4.37E?03 INSL5 ?4.06 6.56E?03 ?1.73E+00 8.72E?03 7.98E?04 ?2.52 4.37E?03 THAP11 0.64 8.01E?02 1.47E+00 8.15E?04 7.97E?04 2.06 4.37E?03 ASF1A 0.68 5.82E?02 1.40E+00 1.15E?03 8.42E?04 1.70 4.58E?03 FAM162A ?0.76 1.73E?04 1.55E?01 9.93E?01 8.65E?04 ?0.76 4.63E?03 WRNIP1 1.19 3.37E?02 1.40E+00 1.95E?03 8.64E?04 1.38 4.63E?03 SRM 0.98 2.46E?03 1.37E+00 2.68E?02 8.78E?04 1.96 4.66E?03 GLIS2 4.24 9.05E?04 ?1.25E+00 8.07E?02 8.84E?04 0.07 4.66E?03 TRIM27 1.19 7.85E?04 9.23E?01 9.67E?02 8.95E?04 1.47 4.69E?03 ZDHHC7 1.04 2.63E?02 1.29E+00 2.58E?03 9.04E?04 1.85 4.70E?03 CCDC85B 0.64 3.91E?02 1.59E+00 1.82E?03 9.22E?04 1.20 4.73E?03 KARS ?0.76 1.87E?04 4.95E?01 8.53E?01 9.16E?04 ?0.73 4.73E?03 ARGLU1 ?0.84 1.91E?04 3.61E?01 9.11E?01 9.45E?04 ?0.83 4.77E?03 TNP2 ?0.74 8.97E?02 ?1.45E+00 8.83E?04 9.41E?04 ?1.86 4.77E?03 CELF1 0.94 1.99E?04 2.75E?01 8.30E?01 9.64E?04 0.94 4.80E?03 ALDOA ?0.33 1.95E?04 2.12E?16 1.00E+00 9.71E?04 ?0.33 4.80E?03 SUMF1 0.95 1.56E?01 1.59E+00 5.67E?04 9.63E?04 1.56 4.80E?03 PDCD4 ?0.82 4.50E?03 ?2.10E+00 1.61E?02 9.79E?04 ?1.33 4.81E?03 MRPL3 0.94 9.30E?04 1.07E+00 9.20E?02 1.01E?03 1.46 4.91E?03 LIMS1 0.66 3.32E?02 1.67E+00 2.36E?03 1.02E?03 1.37 4.93E?03 MLF2 0.72 2.37E?04 ?4.48E?01 6.68E?01 1.06E?03 0.64 5.11E?03 RAB33B 1.30 3.19E?04 ?4.65E?01 4.41E?01 1.14E?03 0.94 5.46E?03 DBI 0.76 2.41E?04 3.96E?01 8.92E?01 1.17E?03 0.76 5.55E?03 GFER 0.78 3.95E?03 ?1.76E+00 2.32E?02 1.19E?03 0.07 5.63E?03 RAP1A 0.88 2.75E?04 7.85E?01 7.26E?01 1.26E?03 0.88 5.90E?03 H1F0 1.32 1.79E?03 8.38E?01 5.89E?02 1.28E?03 1.67 5.96E?03 XDH 2.22 2.08E?02 1.70E+00 4.92E?03 1.32E?03 1.21 6.11E?03 APIP 1.51 5.49E?04 ?4.87E?01 2.59E?01 1.35E?03 0.06 6.16E?03 ANKRD13A 0.61 1.41E?01 1.45E+00 8.88E?04 1.35E?03 1.63 6.16E?03 HIST1H3A ?0.73 2.46E?01 2.23E+00 5.88E?04 1.39E?03 0.78 6.28E?03 PAXBP1 ?0.94 2.43E?03 ?1.11E+00 5.02E?02 1.48E?03 ?1.34 6.68E?03 6030458C11RIK ?1.38 3.12E?04 6.07E?02 8.95E?01 1.49E?03 ?1.02 6.68E?03 FAU ?0.25 3.17E?04 2.12E?16 1.00E+00 1.53E?03 ?0.25 6.79E?03 ERI1 0.58 3.08E?02 1.76E+00 3.98E?03 1.54E?03 1.12 6.79E?03 PRG4 1.02 4.05E?02 ?1.57E+00 3.14E?03 1.56E?03 ?0.09 6.87E?03 FZR1 0.82 1.77E?02 1.43E+00 6.97E?03 1.57E?03 1.72 6.87E?03 CHD7 0.91 3.47E?04 ?2.77E?01 8.59E?01 1.64E?03 0.88 7.10E?03 JUND 0.73 7.14E?04 4.85E?01 2.45E?01 1.66E?03 0.61 7.15E?03 MIDN 1.01 7.18E?04 5.70E?01 2.48E?01 1.68E?03 1.02 7.21E?03 EXOSC6 0.61 2.57E?01 1.56E+00 7.06E?04 1.70E?03 1.50 7.22E?03 RPS15 ?0.24 3.61E?04 2.12E?16 1.00E+00 1.72E?03 ?0.24 7.30E?03 OCIAD1 0.51 3.81E?04 6.44E?01 7.68E?01 1.74E?03 0.52 7.31E?03 STXBP1 0.96 1.20E?01 1.56E+00 1.34E?03 1.75E?03 1.22 7.32E?03 USP39 0.88 3.80E?03 1.44E+00 3.80E?02 1.76E?03 1.27 7.32E?03 DAXX 0.45 8.40E?02 ?2.44E+00 1.93E?03 1.84E?03 ?0.97 7.54E?03 RABGAP1 ?1.05 1.92E?02 ?1.11E+00 7.63E?03 1.83E?03 ?1.31 7.54E?03 GLB1L ?1.77 5.95E?03 ?1.14E+00 2.60E?02 1.91E?03 ?0.75 7.77E?03 HERPUD1 1.22 4.18E?04 1.40E?01 7.78E?01 1.90E?03 1.10 7.77E?03 MARC2 0.62 1.43E?02 ?1.54E+00 1.15E?02 2.05E?03 ?0.83 8.27E?03 RC3H1 1.10 5.92E?04 3.16E?01 4.61E?01 2.09E?03 0.83 8.38E?03 DONSON 1.03 4.12E?02 1.20E+00 4.27E?03 2.10E?03 1.75 8.39E?03 PDGFB 1.34 4.97E?04 1.88E?01 6.76E?01 2.13E?03 1.02 8.47E?03 RBPJ ?0.66 4.55E?04 9.10E?02 1.00E+00 2.14E?03 ?0.66 8.47E?03 SPATA5L1 0.31 6.51E?01 1.66E+00 5.23E?04 2.20E?03 1.30 8.62E?03 CYP4F17 ?1.50 6.37E?02 ?1.98E+00 3.02E?03 2.21E?03 ?0.41 8.62E?03 CHTF18 0.66 1.16E?01 1.66E+00 1.86E?03 2.29E?03 1.32 8.86E?03 HIST1H2AC 4.08 7.12E?04 ?6.84E?01 4.01E?01 2.28E?03 0.03 8.86E?03 NSUN2 0.89 1.07E?03 8.23E?01 2.40E?01 2.38E?03 1.21 9.08E?03 MAPK6 0.61 4.22E?02 2.39E+00 4.79E?03 2.38E?03 1.02 9.08E?03 FRMD6 ?1.29 5.03E?03 9.28E?01 4.17E?02 2.46E?03 ?0.04 9.29E?03 ODC1 1.13 5.40E?04 1.59E?01 8.26E?01 2.45E?03 1.12 9.29E?03 CTBP1 1.09 1.38E?03 5.97E?01 1.86E?01 2.49E?03 1.34 9.38E?03 PITHD1 0.70 5.45E?02 1.37E+00 4.25E?03 2.65E?03 1.81 9.90E?03 SSBP4 0.27 4.49E?01 1.54E+00 7.88E?04 2.68E?03 1.61 9.98E?03 RFX3 1.77 2.63E?03 ?9.27E?01 9.65E?02 2.72E?03 ?0.02 1.00E?02 TRIM24 1.30 3.48E?03 7.69E?01 6.99E?02 2.71E?03 0.80 1.00E?02 RPS20 ?0.30 5.92E?04 2.12E?16 1.00E+00 2.74E?03 ?0.30 1.00E?02 TEC ?1.94 6.18E?04 1.22E?01 8.05E?01 2.76E?03 ?0.28 1.01E?02 PHLDA3 0.96 4.66E?02 1.24E+00 5.55E?03 2.95E?03 2.09 1.06E?02 TRPM3 ?2.12 2.73E?03 1.35E+00 1.03E?01 2.96E?03 ?0.01 1.06E?02 TRAPPC6B 1.26 7.22E?04 2.31E?01 6.32E?01 2.94E?03 1.21 1.06E?02 RPL28 ?0.27 6.69E?04 2.12E?16 1.00E+00 3.07E?03 ?0.27 1.09E?02 1810026J23RIK 0.35 3.71E?01 1.47E+00 1.03E?03 3.06E?03 1.58 1.09E?02 GNAI2 0.73 1.13E?03 ?1.28E+00 3.54E?01 3.25E?03 0.69 1.15E?02 MXD4 5.26 4.14E?03 1.78E+00 7.29E?02 3.28E?03 0.74 1.15E?02 HPS6 1.30 1.20E?03 4.22E?01 3.30E?01 3.28E?03 1.08 1.15E?02 PJA1 ?1.02 7.27E?04 ?1.94E?02 1.00E+00 3.32E?03 ?0.82 1.16E?02 TDP2 0.52 2.81E?01 1.41E+00 1.39E?03 3.37E?03 1.84 1.17E?02 DGAT2 1.60 2.17E?01 ?2.78E+00 1.79E?03 3.55E?03 ?0.35 1.22E?02 TMEM102 ?7.18 2.07E?03 1.64E+00 1.92E?01 3.71E?03 ?0.01 1.27E?02 FBXO2 1.52 1.66E?02 1.20E+00 1.99E?02 3.78E?03 1.45 1.29E?02 GM4951 ?2.97 3.17E?03 ?8.57E?01 1.24E?01 3.94E?03 ?0.67 1.34E?02 ASPM 1.19 2.17E?03 8.42E?01 2.00E?01 4.01E?03 0.52 1.36E?02 RPL18 ?0.22 9.24E?04 2.12E?16 1.00E+00 4.14E?03 ?0.22 1.39E?02 ABHD15 4.36 3.50E?03 ?1.20E+00 1.24E?01 4.30E?03 0.08 1.44E?02 TUSC2 0.31 5.09E?01 1.41E+00 1.25E?03 4.41E?03 1.64 1.47E?02 ACTB ?0.36 1.00E?03 2.12E?16 1.00E+00 4.46E?03 ?0.36 1.48E?02 FBXL22 ?2.73 1.06E?03 1.69E?01 7.93E?01 4.54E?03 ?0.31 1.50E?02 GTF2A1 ?1.18 1.22E?03 2.36E?01 6.17E?01 4.72E?03 ?0.75 1.54E?02 CALM1 0.45 1.28E?03 ?9.16E?01 5.59E?01 4.71E?03 0.43 1.54E?02 UPF3A 0.68 1.19E?01 1.21E+00 4.08E?03 4.80E?03 1.66 1.56E?02 PIK3C2B ?0.56 3.39E?01 ?1.58E+00 1.82E?03 4.91E?03 ?0.62 1.59E?02 LRRFIP2 0.99 1.24E?02 8.81E?01 3.71E?02 5.01E?03 1.36 1.62E?02 TAF4 1.14 3.70E?02 ?1.14E+00 1.27E?02 5.10E?03 ?0.31 1.64E?02 TAF2 ?0.20 6.11E?01 1.36E+00 1.35E?03 5.15E?03 0.66 1.65E?02 GGNBP2 1.00 3.18E?03 9.19E?01 1.80E?01 5.25E?03 1.26 1.67E?02 GATAD2A 0.64 2.12E?02 1.87E+00 2.36E?02 5.43E?03 1.05 1.72E?02 GM8096 1.00E+00 2.30E+00 5.49E?03 5.49E?03 1.73E?02 AKR1B3 0.57 5.83E?03 1.51E+00 9.45E?02 5.52E?03 0.82 1.74E?02 LTA ?1.13 1.61E?03 ?5.70E?01 5.32E?01 5.69E?03 ?1.17 1.78E?02 WDR24 0.81 2.67E?02 1.01E+00 2.07E?02 5.90E?03 1.48 1.84E?02 LAPTM4B 2.03 1.40E?03 ?5.19E?02 8.89E?01 6.02E?03 0.52 1.87E?02 MARK4 1.48 2.96E?03 5.64E?01 2.43E?01 6.11E?03 0.78 1.89E?02 MICU2 0.63 3.65E?02 1.26E+00 1.60E?02 6.15E?03 1.53 1.89E?02 RPL12 ?0.25 1.43E?03 2.12E?16 1.00E+00 6.18E?03 ?0.25 1.89E?02 CCDC12 0.81 1.98E?03 6.55E?01 4.49E?01 6.28E?03 0.93 1.92E?02 CCR3 1.00E+00 3.05E+00 6.51E?03 6.51E?03 1.98E?02 UBXN2A 1.21 3.80E?03 5.67E?01 2.00E?01 6.66E?03 1.33 2.01E?02 CTSF 4.73 6.85E?03 ?1.20E+00 1.03E?01 6.84E?03 0.16 2.06E?02 SMARCA5 0.53 1.50E?01 1.36E+00 5.66E?03 7.71E?03 1.36 2.31E?02 PLEK ?0.36 4.84E?01 1.41E+00 2.45E?03 7.95E?03 1.42 2.37E?02 GZMB 1.01 1.28E?01 1.12E+00 6.96E?03 8.21E?03 2.11 2.44E?02 NRM ?1.15 4.65E?03 ?5.89E?01 2.14E?01 8.41E?03 ?1.43 2.48E?02 BHLHE40 ?0.73 2.03E?03 4.47E?01 8.55E?01 8.42E?03 ?0.73 2.48E?02 HIST1H2AH 2.10 3.16E?02 ?1.81E+00 2.65E?02 8.47E?03 ?0.15 2.48E?02 GM5177 0.23 1.44E?02 ?7.82E?01 6.02E?02 8.55E?03 ?0.03 2.50E?02 PSMD3 0.58 2.69E?03 7.33E?01 4.98E?01 8.80E?03 0.61 2.56E?02 ARID3A 0.75 4.66E?02 9.95E?01 2.02E?02 9.30E?03 1.01 2.69E?02 MRPL11 0.55 2.12E?02 ?1.14E+00 4.45E?02 9.32E?03 ?0.04 2.69E?02 IL22 1.00E+00 2.80E+00 9.43E?03 9.43E?03 2.71E?02 CANX ?0.44 2.27E?03 2.12E?16 1.00E+00 9.46E?03 ?0.44 2.71E?02 TMSB10 0.35 2.34E?03 2.12E?16 1.00E+00 9.76E?03 0.35 2.77E?02 RPGRIP1 ?0.59 8.48E?02 ?1.09E+00 1.21E?02 9.74E?03 ?1.03 2.77E?02 C2CD2L ?1.15 8.56E?03 6.49E?01 1.44E?01 1.09E?02 ?0.08 3.07E?02 RPS27A ?0.20 2.84E?03 2.12E?16 1.00E+00 1.16E?02 ?0.20 3.28E?02 RPS10 ?0.21 2.91E?03 2.12E?16 1.00E+00 1.19E?02 ?0.21 3.32E?02 ZBED6 0.67 8.45E?02 ?1.05E+00 1.53E?02 1.19E?02 ?0.28 3.32E?02 RPL19 ?0.17 2.92E?03 2.12E?16 1.00E+00 1.19E?02 ?0.17 3.32E?02 GPR18 0.63 5.19E?02 1.50E+00 2.46E?02 1.21E?02 1.34 3.35E?02 GARS 0.59 5.10E?03 1.38E+00 3.25E?01 1.22E?02 0.61 3.35E?02 MAP2K2 0.56 1.37E?02 2.10E+00 9.77E?02 1.22E?02 0.70 3.35E?02 A130010J15RIK ?1.19 1.81E?02 ?7.75E?01 7.36E?02 1.23E?02 ?1.19 3.35E?02 RBM3 ?0.36 3.02E?03 2.12E?16 1.00E+00 1.23E?02 ?0.36 3.35E?02 ISCU 0.65 2.38E?02 1.22E+00 5.47E?02 1.23E?02 1.23 3.35E?02 ADIPOR1 0.78 4.40E?03 7.02E?01 4.16E?01 1.25E?02 0.90 3.37E?02 ITFG2 1.22 3.84E?03 2.67E?01 5.33E?01 1.26E?02 0.50 3.40E?02 RPS28 ?0.26 3.16E?03 2.12E?16 1.00E+00 1.28E?02 ?0.26 3.45E?02 MAX 0.78 3.32E?03 1.53E?01 8.32E?01 1.31E?02 0.77 3.51E?02 CCDC102A 1.00E+00 ?1.97E+00 1.35E?02 1.35E?02 3.60E?02 RPL23 ?0.18 3.47E?03 2.12E?16 1.00E+00 1.40E?02 ?0.18 3.71E?02 GBF1 0.50 1.16E?01 1.19E+00 1.39E?02 1.41E?02 1.05 3.73E?02 ADAM28 0.34 7.76E?02 9.76E?01 2.01E?02 1.41E?02 0.37 3.73E?02 WIPI2 0.70 2.81E?02 1.14E+00 6.75E?02 1.69E?02 1.07 4.43E?02 GRINA 0.62 2.20E?02 ?1.30E+00 9.03E?02 1.73E?02 ?0.24 4.54E?02 CDH11 0.25 8.19E?02 ?1.02E+00 2.46E?02 1.76E?02 ?0.05 4.59E?02 ZFP420 1.00E+00 2.22E+00 1.77E?02 1.77E?02 4.59E?02 SLAIN2 1.41 8.38E?03 4.53E?01 2.91E?01 1.77E?02 0.60 4.59E?02 DNA2 ?0.97 4.82E?02 ?9.50E?01 4.36E?02 1.86E?02 ?1.06 4.79E?02 TMEM265 ?0.52 5.21E?01 ?1.59E+00 6.00E?03 1.87E?02 ?0.94 4.80E?02 APLF ?0.09 7.96E?01 ?1.34E+00 5.06E?03 1.90E?02 ?0.71 4.87E?02 DYNC1LI1 0.86 1.16E?02 9.87E?01 2.17E?01 1.93E?02 1.05 4.92E?02 SLC7A5 0.99 9.53E?03 4.57E?01 3.01E?01 2.04E?02 0.84 5.15E?02 NHLRC2 0.81 8.24E?02 9.32E?01 2.91E?02 2.04E?02 1.28 5.15E?02 CBLN3 0.59 6.31E?03 ?2.45E?01 5.69E?01 2.04E?02 0.21 5.15E?02 ZFP109 1.91 1.09E?01 1.49E+00 2.24E?02 2.05E?02 0.36 5.15E?02 MRS2 0.91 1.10E?02 5.15E?01 2.63E?01 2.11E?02 1.08 5.29E?02 CISD3 ?0.80 5.54E?03 7.77E?02 9.48E?01 2.13E?02 ?0.73 5.32E?02 HSH2D ?0.63 3.75E?01 ?1.47E+00 8.74E?03 2.17E?02 ?0.53 5.40E?02 RPS13 ?0.17 5.72E?03 2.12E?16 1.00E+00 2.20E?02 ?0.17 5.45E?02 MTX1 0.52 5.73E?02 ?1.38E+00 4.56E?02 2.23E?02 ?0.12 5.50E?02 BEND4 1.02 6.41E?03 1.86E?01 6.93E?01 2.25E?02 0.87 5.54E?02 SLC4A11 0.85 8.01E?03 3.68E?01 4.84E?01 2.33E?02 1.00 5.72E?02 NCOA1 1.00 6.14E?03 2.04E?02 9.86E?01 2.34E?02 0.67 5.73E?02 HIST2H3C2 0.77 1.16E?01 1.48E+00 2.53E?02 2.38E?02 1.77 5.80E?02 MTRF1 ?0.78 1.16E?01 1.09E+00 2.62E?02 2.45E?02 0.52 5.95E?02 CHCHD10 0.64 8.36E?03 7.25E?01 5.21E?01 2.51E?02 0.74 6.08E?02 EGFP_IRES_IL23R 1.59 8.29E?02 1.35E+00 3.70E?02 2.52E?02 2.43 6.09E?02 MMS22L 0.81 4.38E?02 8.49E?01 7.00E?02 2.54E?02 1.11 6.11E?02 PRDX2 ?0.42 6.84E?03 2.12E?16 1.00E+00 2.58E?02 ?0.42 6.19E?02 RNR1 0.54 6.98E?03 2.19E?02 1.00E+00 2.63E?02 0.54 6.28E?02 RBM43 ?0.48 2.17E?01 ?1.01E+00 1.73E?02 2.75E?02 ?1.28 6.54E?02 ZFP944 ?0.98 9.89E?03 3.41E?01 4.68E?01 2.76E?02 ?0.46 6.54E?02 ZC3H12C 2.14 3.34E?02 ?1.10E+00 1.11E?01 2.93E?02 ?0.01 6.92E?02 PRMT5 0.62 2.34E?02 8.63E?01 1.66E?01 2.94E?02 1.04 6.92E?02 DTD1 0.81 9.24E?03 ?2.67E?01 6.19E?01 2.98E?02 0.25 7.01E?02 WDR83 0.91 1.09E?02 ?3.24E?01 4.66E?01 3.00E?02 0.14 7.02E?02 KHNYN ?0.52 2.28E?01 ?1.02E+00 1.86E?02 3.03E?02 ?0.99 7.07E?02 NUDCD1 ?1.09 8.33E?03 4.01E?03 9.88E?01 3.08E?02 ?0.80 7.11E?02 SAA4 ?0.04 8.14E?01 1.36E+00 8.54E?03 3.06E?02 0.14 7.11E?02 PLBD2 0.35 3.00E?01 1.17E+00 1.52E?02 3.08E?02 1.17 7.11E?02 GM20939 ?0.80 1.48E?02 ?6.14E?01 3.32E?01 3.20E?02 ?0.92 7.36E?02 IFITM2 ?0.66 9.52E?03 6.88E?01 7.07E?01 3.23E?02 ?0.62 7.40E?02 ACTR2 ?0.41 8.79E?03 2.12E?16 1.00E+00 3.23E?02 ?0.41 7.40E?02 FURIN 0.41 2.08E?01 ?2.46E+00 2.19E?02 3.27E?02 0.11 7.44E?02 SKAP1 0.21 4.14E?01 ?2.05E+00 1.29E?02 3.26E?02 ?0.49 7.44E?02 SYNGAP1 0.81 1.56E?01 ?1.00E+00 2.86E?02 3.33E?02 ?0.16 7.51E?02 RBFOX2 2.97 1.62E?02 9.60E?01 3.11E?01 3.32E?02 0.50 7.51E?02 PGAM1 ?0.44 9.10E?03 5.37E?02 1.00E+00 3.33E?02 ?0.43 7.51E?02 GABARAP ?0.49 9.14E?03 3.72E?02 1.00E+00 3.35E?02 ?0.49 7.51E?02 ATP6V0D2 ?1.33 1.28E?02 3.65E?01 4.44E?01 3.37E?02 ?0.33 7.55E?02 TRP53I11 0.13 6.75E?01 ?1.21E+00 1.03E?02 3.42E?02 ?1.19 7.62E?02 ANKRD46 ?0.63 2.10E?02 ?7.77E?01 2.36E?01 3.45E?02 ?0.85 7.65E?02 P4HA2 ?0.92 2.25E?02 ?5.29E?01 2.17E?01 3.45E?02 ?1.24 7.65E?02 ARL6IP5 ?0.45 6.55E?02 ?2.03E+00 6.86E?02 3.50E?02 ?0.75 7.72E?02 GM10416 1.46 3.85E?02 ?9.71E?01 1.21E?01 3.54E?02 ?0.08 7.79E?02 TCTEX1D1 ?2.53 1.35E?02 6.12E?01 4.52E?01 3.56E?02 ?0.05 7.82E?02 PGP 0.73 1.66E?02 5.52E?01 3.39E?01 3.60E?02 0.98 7.87E?02 ATP5G2 ?0.29 1.03E?02 2.12E?16 1.00E+00 3.71E?02 ?0.29 8.10E?02 GYPC 0.89 1.40E?02 ?3.57E?01 4.66E?01 3.73E?02 0.48 8.11E?02 TAGAP 0.93 7.93E?02 ?8.82E?01 6.16E?02 3.74E?02 ?0.27 8.11E?02 SLC17A9 ?0.11 7.46E?01 ?1.54E+00 1.12E?02 3.80E?02 ?0.78 8.22E?02 COX15 0.22 6.24E?01 ?1.11E+00 1.23E?02 3.86E?02 ?0.37 8.33E?02 LGALS4 ?1.06 1.33E?02 2.38E?01 5.47E?01 3.89E?02 ?0.16 8.34E?02 PABPC4 0.71 4.66E?02 ?8.71E?01 1.11E?01 3.89E?02 ?0.05 8.34E?02 CDCA7 ?0.11 7.64E?01 ?1.49E+00 1.16E?02 3.96E?02 ?1.01 8.46E?02 CTSD 0.57 1.89E?02 1.40E+00 3.33E?01 3.99E?02 0.62 8.49E?02 NCAPH2 ?0.24 2.77E?01 ?2.29E+00 2.19E?02 4.01E?02 ?0.54 8.51E?02 ARPC3 0.54 1.28E?02 8.12E?01 6.35E?01 4.02E?02 ?0.51 8.51E?02 STAU1 0.65 2.56E?02 6.46E?01 2.32E?01 4.06E?02 0.90 8.57E?02 RINL 0.74 3.24E?02 ?6.96E?01 1.79E?01 4.11E?02 ?0.05 8.64E?02 CCDC184 0.48 5.50E?01 ?1.22E+00 1.41E?02 4.12E?02 ?0.54 8.65E?02 AGPAT5 0.42 1.68E?01 1.24E+00 3.64E?02 4.34E?02 0.45 9.07E?02 PAIP1 ?0.51 7.01E?02 ?9.91E?01 8.39E?02 4.35E?02 ?0.80 9.08E?02 AKNA 0.69 1.39E?02 1.83E?01 7.35E?01 4.58E?02 0.70 9.53E?02 MDFIC 0.79 1.33E?02 2.70E?02 9.58E?01 4.66E?02 0.65 9.65E?02 ZBTB7A 0.74 1.71E?02 ?4.46E?01 5.11E?01 4.69E?02 0.62 9.70E?02 KLF6 0.69 3.43E?02 ?8.59E?01 2.08E?01 4.83E?02 0.41 9.95E?02 TRAF3IP3 0.44 1.57E?01 1.26E+00 4.43E?02 4.86E?02 1.23 9.98E?02 PDE4B 0.86 4.37E?02 7.72E?01 1.60E?01 4.87E?02 1.17 9.98E?02

    TABLE-US-00009 TABLE 1D Th17 Ctrl GFP+ vs GFP? Gene coefC pvalC coefD pvalD pvalH logFC FDR IL23R 1.41 3.62E?02 4.02E+00 3.92E?22 5.36E?22 4.29 7.04E?18 OST4 1.71 3.76E?16 9.93E?01 6.10E?01 3.42E?15 1.74 2.25E?11 EGFP_IRES_IL23R 3.10 1.03E?02 3.77E+00 7.06E?14 2.50E?14 2.90 1.10E?10 LARS2 ?0.93 5.68E?15 1.18E?16 1.00E+00 5.65E?14 ?0.93 1.86E?10 SDHD 1.48 1.43E?13 1.20E+00 5.22E?01 1.10E?12 1.49 2.90E?09 CALM2 1.06 1.55E?13 1.18E?16 1.00E+00 1.46E?12 1.06 3.20E?09 IZUMO1R ?1.61 5.82E?07 ?2.57E+00 4.20E?07 1.05E?11 ?3.67 1.96E?08 IL12RB2 1.84 1.27E?08 2.35E+00 4.54E?05 2.29E?11 3.02 3.77E?08 RORA 1.18 2.84E?03 2.25E+00 2.86E?09 2.54E?10 2.30 3.71E?07 NPTN 1.80 2.52E?09 1.33E+00 3.87E?03 2.98E?10 2.18 3.92E?07 PRRC2A ?1.13 1.27E?10 ?1.80E+00 1.55E?01 3.80E?10 ?1.16 4.54E?07 LSM4 ?1.25 1.58E?10 1.08E+00 2.78E?01 7.21E?10 ?1.10 7.90E?07 CCDC71L 0.85 3.78E?02 2.34E+00 9.40E?10 8.55E?10 2.12 8.65E?07 CASP6 1.43 5.71E?10 1.20E+00 1.16E?01 1.32E?09 1.71 1.24E?06 RNH1 0.94 1.93E?10 1.18E?16 1.00E+00 1.57E?09 0.94 1.38E?06 COX17 0.93 2.98E?10 5.81E?01 8.63E?01 2.37E?09 0.93 1.95E?06 OSTF1 1.45 1.04E?08 1.87E+00 2.32E?02 5.82E?09 1.86 4.50E?06 EMB 1.22 1.31E?09 1.08E+00 4.87E?01 8.01E?09 1.24 5.85E?06 SMOX 1.66 2.99E?08 1.61E+00 1.60E?02 1.17E?08 2.34 8.13E?06 NCS1 1.49 1.97E?09 ?3.45E?01 5.45E?01 1.26E?08 1.32 8.32E?06 TRIP10 1.31 4.41E?06 1.55E+00 1.11E?04 1.51E?08 2.13 9.45E?06 RAD50 ?1.26 6.40E?09 ?6.14E?01 2.40E?01 2.40E?08 ?1.36 1.44E?05 TIAM1 ?1.42 2.41E?04 ?1.66E+00 4.28E?06 3.04E?08 ?1.68 1.74E?05 TIMP1 2.32 3.00E?03 1.83E+00 9.54E?07 7.44E?08 3.87 4.08E?05 HIVEP3 ?1.51 1.94E?07 ?8.81E?01 1.77E?02 7.87E?08 ?1.62 4.14E?05 S1PR1 1.25 1.96E?05 1.58E+00 1.56E?04 8.66E?08 2.33 4.38E?05 ARGLU1 1.09 1.53E?08 1.08E?01 1.00E+00 1.12E?07 1.08 5.46E?05 BHLHE40 1.43 2.00E?07 1.35E+00 6.42E?02 2.43E?07 1.77 1.14E?04 PDGFA 1.46 4.10E?02 2.29E+00 3.65E?07 2.99E?07 2.01 1.31E?04 AHCYL2 ?1.13 9.11E?05 ?1.73E+00 1.21E?04 2.92E?07 2.05 1.31E?04 IL4 ?1.42 1.60E?02 ?1.90E+00 9.98E?07 3.50E?07 ?2.52 1.48E?04 SBNO2 1.28 1.22E?07 1.70E+00 2.00E?01 3.68E?07 1.34 1.51E?04 NOL7 ?1.13 4.33E?06 ?1.81E+00 5.20E?03 5.25E?07 ?1.69 2.09E?04 H2-Q10 1.84 2.31E?05 1.13E+00 1.40E?03 7.84E?07 2.61 2.79E?04 FLOT1 1.14 3.82E?05 2.08E+00 8.11E?04 7.62E?07 1.92 2.79E?04 LGALS1 0.85 1.12E?07 1.18E?16 1.00E+00 7.71E?07 0.85 2.79E?04 TSPO 0.82 1.44E?07 1.07E+00 4.86E?01 7.71E?07 0.86 2.79E?04 JUNB 0.93 1.46E?07 1.18E?16 1.00E+00 9.95E?07 0.93 3.42E?04 TMEM258 0.70 1.49E?07 1.18E?16 1.00E+00 1.01E?06 0.70 3.42E?04 ACTB 0.53 1.66E?07 1.18E?16 1.00E+00 1.13E?06 0.53 3.70E?04 IL17F 7.41 1.04E?04 1.75E+00 4.86E?04 1.22E?06 2.68 3.92E?04 NPC2 0.82 2.04E?07 1.18E?16 1.00E+00 1.38E?06 0.82 4.31E?04 UBASH3A ?0.85 6.02E?03 ?1.59E+00 1.32E?05 1.73E?06 ?2.33 4.81E?04 PKIB 1.34 8.54E?02 2.19E+00 1.18E?06 1.70E?06 1.20 4.81E?04 STAT5A 1.11 2.72E?07 8.05E?01 7.53E?01 1.73E?06 1.12 4.81E?04 RPS2 ?0.78 2.68E?07 1.18E?16 1.00E+00 1.79E?06 ?0.78 4.81E?04 GNB5 0.55 6.89E?02 1.88E+00 1.43E?06 1.72E?06 2.48 4.81E?04 TPT1 ?0.39 2.69E?07 1.18E?16 1.00E+00 1.79E?06 ?0.39 4.81E?04 RNF187 ?1.40 1.45E?06 ?1.00E+00 6.32E?02 1.62E?06 ?1.82 4.81E?04 INPP5B 1.24 5.23E?07 7.84E?01 2.75E?01 1.88E?06 1.43 4.95E?04 NMT1 1.15 3.77E?06 1.85E+00 2.76E?02 2.02E?06 1.32 5.20E?04 ARHGDIA 0.47 3.30E?07 1.18E?16 1.00E+00 2.19E?06 0.47 5.47E?04 LTB ?1.61 1.35E?06 ?7.33E?01 1.01E?01 2.21E?06 ?1.95 5.47E?04 TREML2 ?1.13 3.47E?05 ?1.11E+00 3.46E?03 2.64E?06 ?1.84 6.44E?04 PABPC1 ?0.55 4.21E?07 1.18E?16 1.00E+00 2.77E?06 ?0.55 6.62E?04 SH2D3C ?1.34 7.23E?05 ?1.13E+00 1.74E?03 2.83E?06 ?1.82 6.64E?04 MT2 1.69 6.27E?06 8.36E?01 2.80E?02 3.32E?06 2.37 7.67E?04 NDUFA1 0.75 9.18E?07 1.36E+00 3.20E?01 3.58E?06 0.80 7.85E?04 TMEM160 ?1.20 1.04E?05 ?9.29E?01 1.75E?02 3.56E?06 ?1.79 7.85E?04 RNF10 ?1.21 9.36E?06 ?1.25E+00 1.93E?02 3.52E?06 ?1.56 7.85E?04 MYCN ?1.36 2.00E?01 2.53E+00 1.36E?06 3.77E?06 1.41 8.00E?04 SMIM3 0.56 1.37E?01 1.76E+00 1.81E?06 3.73E?06 2.64 8.00E?04 ILTIFB 1.00E+00 3.62E+00 4.09E?06 4.09E?06 8.16E?04 MTMR7 0.88 8.76E?03 1.60E+00 2.28E?05 4.09E?06 2.09 8.16E?04 H2-T23 0.68 6.16E?07 1.18E?16 1.00E+00 3.99E?06 0.68 8.16E?04 SUN2 ?1.20 3.48E?06 ?7.46E?01 7.00E?02 4.08E?06 ?1.50 8.16E?04 PTPN14 1.30 1.81E?02 2.10E+00 1.36E?05 4.78E?06 0.75 9.39E?04 SOCS3 1.22 2.93E?04 1.76E+00 7.74E?04 4.99E?06 2.20 9.66E?04 IL22 5.60 6.60E?03 2.47E+00 3.89E?05 5.27E?06 1.93 1.01E?03 ITSN2 ?1.03 3.75E?04 ?1.43E+00 7.03E?04 5.75E?06 ?1.74 1.05E?03 D17H6S53E 1.09 1.12E?05 9.75E?01 2.79E?02 5.77E?06 1.30 1.05E?03 ANXA2 1.18 8.81E?07 1.18E?16 1.00E+00 5.64E?06 1.18 1.05E?03 TUBA1A 0.97 2.13E?06 1.65E+00 2.19E?01 6.19E?06 1.09 1.12E?03 RPS28 0.38 1.02E?06 1.18E?16 1.00E+00 6.46E?06 0.38 1.15E?03 ERMN 1.44 2.99E?04 1.35E+00 1.09E?03 7.00E?06 2.52 1.23E?03 SPHK1 ?0.96 3.38E?01 2.32E+00 1.87E?06 7.34E?06 1.08 1.27E?03 SRRM2 ?0.76 1.22E?06 1.18E?16 1.00E+00 7.70E?06 ?0.76 1.32E?03 TRIM27 ?1.39 4.25E?06 ?6.99E?01 1.34E?01 8.34E?06 ?1.52 1.39E?03 ACSL4 0.98 1.85E?06 ?1.16E+00 4.23E?01 8.37E?06 0.94 1.39E?03 CRISPLD2 1.07 2.52E?01 2.14E+00 2.80E?06 8.87E?06 1.47 1.46E?03 MS4A6D 2.75 1.76E?06 2.58E?01 5.34E?01 9.03E?06 0.71 1.47E?03 ADAM8 1.71 1.20E?03 1.35E+00 3.63E?04 9.16E?06 1.66 1.47E?03 PRDX2 0.58 1.54E?06 1.18E?16 1.00E+00 9.64E?06 0.58 1.53E?03 SNAPC1 0.74 1.50E?03 3.11E+00 3.31E?04 1.03E?05 1.42 1.61E?03 HSD17B10 0.82 1.67E?06 3.40E?01 1.00E+00 1.06E?05 0.86 1.62E?03 SEPT2 0.90 2.16E?06 1.08E+00 4.87E?01 1.05E?05 0.92 1.62E?03 CKS2 0.78 4.87E?06 1.82E+00 1.59E?01 1.08E?05 0.90 1.63E?03 CLK4 ?0.40 1.53E?01 2.26E+00 5.11E?06 1.10E?05 1.15 1.64E?03 ATXN1 ?1.11 1.82E?06 4.97E?02 1.00E+00 1.14E?05 ?0.98 1.69E?03 CBX3 0.78 1.89E?06 1.18E?16 1.00E+00 1.17E?05 0.78 1.72E?03 UNC50 1.07 4.64E?06 1.02E+00 1.92E?01 1.19E?05 1.32 1.72E?03 RASGRP1 ?0.75 1.73E?02 ?1.59E+00 4.30E?05 1.37E?05 ?1.63 1.94E?03 TOMM7 0.56 2.22E?06 1.18E?16 1.00E+00 1.37E?05 0.56 1.94E?03 PRPF8 ?0.72 2.68E?06 ?1.73E?01 8.53E?01 1.61E?05 ?0.72 2.26E?03 IL16 ?0.11 7.04E?01 ?1.83E+00 2.95E?06 1.68E?05 ?1.87 2.32E?03 GPR34 1.00E+00 ?3.67E+00 1.85E?05 1.85E?05 2.53E?03 S100A10 0.87 3.33E?06 1.18E?16 1.00E+00 2.02E?05 0.87 2.69E?03 FCF1 0.74 1.77E?05 2.10E+00 7.21E?02 1.98E?05 0.96 2.69E?03 WNK1 ?0.76 6.78E?06 ?1.55E+00 2.41E?01 2.01E?05 ?0.79 2.69E?03 SERPINE1 0.62 3.12E?01 1.87E+00 6.49E?06 2.30E?05 1.15 3.02E?03 GIMAP4 ?0.78 5.99E?04 ?2.61E+00 2.15E?03 2.50E?05 ?1.32 3.25E?03 D630039A03RIK ?1.44 1.69E?02 ?1.73E+00 9.27E?05 2.77E?05 ?1.50 3.57E?03 RAB37 0.48 6.02E?01 ?2.32E+00 5.98E?06 3.09E?05 ?1.04 3.95E?03 GPBP1L1 ?1.16 2.08E?05 7.34E?01 1.20E?01 3.49E?05 ?0.67 4.42E?03 ZBTB7C ?0.78 5.08E?01 2.83E+00 8.21E?06 3.85E?05 0.61 4.75E?03 IL1R1 0.76 6.58E?01 2.78E+00 7.17E?06 3.83E?05 0.82 4.75E?03 NOTCH1 ?0.86 8.77E?06 ?5.79E?01 4.55E?01 3.87E?05 ?0.89 4.75E?03 LUM 2.31 1.70E?03 1.27E+00 1.23E?03 3.93E?05 2.08 4.79E?03 NANOG 0.86 1.05E?05 3.80E?01 3.71E?01 4.07E?05 0.82 4.91E?03 LY6A 0.86 7.69E?06 1.18E?16 1.00E+00 4.51E?05 0.85 5.40E?03 IL17A 3.32 3.20E?01 2.57E+00 1.31E?05 4.60E?05 2.42 5.42E?03 RAD23A 0.93 2.81E?05 1.91E+00 1.19E?01 4.62E?05 1.06 5.42E?03 GSK3B 0.87 1.38E?05 1.46E+00 3.15E?01 4.74E?05 0.92 5.52E?03 REST ?1.16 2.55E?05 ?5.71E?01 1.44E?01 4.87E?05 ?1.21 5.62E?03 WTAP 0.75 7.17E?04 2.79E+00 3.85E?03 5.02E?05 1.10 5.74E?03 CYP11A1 ?1.32 3.22E?03 ?1.16E+00 8.76E?04 5.14E?05 ?2.26 5.75E?03 RPSA ?0.37 8.85E?06 1.18E?16 1.00E+00 5.16E?05 ?0.37 5.75E?03 CYSTM1 0.95 6.59E?05 1.16E+00 5.00E?02 5.10E?05 1.46 5.75E?03 TNFSF9 1.64 1.28E?03 1.11E+00 2.26E?03 5.29E?05 1.75 5.84E?03 TNFAIP3 1.07 6.62E?04 1.44E+00 4.54E?03 5.41E?05 1.80 5.93E?03 CD3E ?0.86 9.85E?06 1.18E?16 1.00E+00 5.71E?05 ?0.86 6.19E?03 SDF2 0.81 4.79E?04 2.03E+00 6.77E?03 5.74E?05 1.40 6.19E?03 SDC4 0.14 7.01E?01 1.66E+00 1.08E?05 5.81E?05 1.64 6.21E?03 CRIP1 0.77 2.08E?04 2.53E+00 1.76E?02 6.17E?05 1.06 6.49E?03 MYLK 1.04 5.23E?01 2.95E+00 1.32E?05 6.15E?05 0.31 6.49E?03 GATM 1.41 1.91E?04 1.05E+00 2.04E?02 6.45E?05 2.05 6.73E?03 ACTR2 0.50 1.13E?05 1.18E?16 1.00E+00 6.52E?05 0.50 6.75E?03 RPGRIP1 0.56 2.42E?02 1.40E+00 1.67E?04 6.60E?05 1.24 6.78E?03 REPS1 ?0.86 1.72E?02 ?1.31E+00 2.49E?04 7.13E?05 ?1.40 7.27E?03 TNFRSF18 ?0.86 1.25E?05 1.18E?16 1.00E+00 7.18E?05 ?0.86 7.27E?03 PLAGL2 ?0.86 1.47E?05 7.98E?01 6.56E?01 7.56E?05 ?0.84 7.59E?03 KHSRP ?0.96 1.61E?05 ?2.22E?01 5.67E?01 7.74E?05 ?0.76 7.71E?03 GATA3 ?1.00 7.13E?04 ?2.28E+00 6.31E?03 7.82E?05 ?1.45 7.73E?03 TRAT1 ?0.68 5.61E?02 ?1.42E+00 9.49E?05 7.93E?05 ?2.63 7.78E?03 APOA1BP 0.83 1.24E?04 1.27E+00 4.22E?02 8.05E?05 1.34 7.79E?03 ATXN2L ?1.01 1.41E?05 ?1.13E?02 9.57E?01 8.05E?05 ?1.00 7.79E?03 POU2AF1 ?0.39 6.49E?01 ?2.32E+00 1.64E?05 8.38E?05 ?0.59 8.04E?03 CCR8 ?1.04 5.80E?03 ?1.52E+00 8.50E?04 8.52E?05 ?2.45 8.12E?03 SRRM1 ?0.65 1.58E?05 1.18E?16 1.00E+00 8.99E?05 ?0.64 8.51E?03 GNGT2 0.89 1.03E?04 9.36E?01 6.18E?02 9.32E?05 1.58 8.76E?03 RERE ?0.45 5.12E?02 ?1.76E+00 1.26E?04 9.63E?05 ?1.18 8.98E?03 ZFP467 0.60 2.73E?01 ?1.77E+00 3.25E?05 9.75E?05 ?0.89 9.03E?03 LMNA 0.88 2.02E?02 1.28E+00 3.19E?04 1.03E?04 2.10 9.52E?03 AMICA1 ?1.37 1.44E?01 ?2.19E+00 5.69E?05 1.04E?04 ?1.17 9.52E?03 KLF6 0.68 4.05E?03 1.70E+00 1.52E?03 1.06E?04 1.71 9.57E?03 ASB2 ?1.17 3.00E?02 ?1.29E+00 2.45E?04 1.14E?04 ?1.78 1.03E?02 UBR4 ?0.82 3.59E?05 1.45E+00 3.06E?01 1.16E?04 ?0.78 1.04E?02 RPS27 0.35 2.09E?05 1.18E?16 1.00E+00 1.17E?04 0.35 1.04E?02 ABCB9 ?0.82 1.64E?02 ?1.23E+00 4.46E?04 1.18E?04 ?1.71 1.04E?02 RORC 0.75 5.29E?02 1.34E+00 1.57E?04 1.22E?04 1.88 1.07E?02 CCDC88C ?0.86 5.25E?05 5.04E?01 2.18E?01 1.31E?04 ?0.43 1.14E?02 TRIM56 ?0.26 2.35E?01 ?1.50E+00 5.28E?05 1.39E?04 ?0.63 1.20E?02 LAMA5 ?0.90 3.98E?04 ?1.16E+00 2.23E?02 1.39E?04 ?1.22 1.20E?02 EIF3F ?0.83 2.56E?05 1.18E?16 1.00E+00 1.42E?04 ?0.83 1.21E?02 STOM 0.04 9.29E?01 1.56E+00 2.69E?05 1.48E?04 2.01 1.25E?02 BEND4 0.27 4.95E?01 1.50E+00 3.42E?05 1.48E?04 1.17 1.25E?02 ITPRIPL1 0.83 2.84E?05 8.11E?01 7.68E?01 1.50E?04 0.84 1.25E?02 CDKN2D 0.74 5.62E?05 9.31E?01 2.38E?01 1.49E?04 1.00 1.25E?02 CCR4 ?0.95 1.33E?04 ?9.50E?01 8.34E?02 1.51E?04 ?1.32 1.25E?02 KMT2A ?0.77 8.23E?05 ?7.95E?01 1.57E?01 1.58E?04 ?0.87 1.30E?02 MT1 0.93 2.33E?03 1.66E+00 4.34E?03 1.66E?04 1.64 1.35E?02 NUBP1 ?0.89 3.11E?05 ?8.06E?02 8.41E?01 1.68E?04 ?0.80 1.35E?02 MAP3K1 0.80 2.08E?04 1.12E+00 5.68E?02 1.68E?04 0.98 1.35E?02 RPS12 ?0.41 3.11E?05 1.18E?16 1.00E+00 1.71E?04 ?0.41 1.37E?02 DTWD1 1.39 3.72E?05 2.58E?01 5.97E?01 1.76E?04 1.23 1.40E?02 GTF2IRD1 ?0.14 7.41E?01 ?1.56E+00 3.48E?05 1.80E?04 ?0.68 1.43E?02 USMG5 0.49 3.33E?05 1.18E?16 1.00E+00 1.82E?04 0.49 1.44E?02 DNMT3A ?0.90 1.41E?04 ?8.99E?01 1.02E?01 1.87E?04 ?1.05 1.47E?02 PERP 0.68 7.71E?02 1.47E+00 1.86E?04 1.94E?04 2.44 1.51E?02 EGFR ?0.45 3.58E?01 1.47E+00 5.65E?05 1.97E?04 1.39 1.53E?02 ASAH2 1.00E+00 3.37E+00 2.00E?04 2.00E?04 1.53E?02 TNIP2 0.97 3.43E?04 1.28E+00 4.15E?02 2.06E?04 1.42 1.57E?02 RND1 0.83 3.29E?02 1.27E+00 4.41E?04 2.14E?04 1.25 1.62E?02 SYTL1 ?0.15 6.14E?01 ?1.50E+00 4.64E?05 2.20E?04 ?1.96 1.66E?02 TCEB1 0.63 4.33E?05 1.18E?16 1.00E+00 2.34E?04 0.63 1.76E?02 FERMT3 0.66 4.42E?05 1.18E?16 1.00E+00 2.39E?04 0.66 1.78E?02 BYSL 0.71 4.90E?03 2.16E+00 3.08E?03 2.39E?04 1.33 1.78E?02 TWF1 0.85 1.64E?04 1.16E+00 1.16E?01 2.41E?04 1.13 1.78E?02 EIF4EBP2 ?0.90 5.11E?03 ?1.11E+00 3.03E?03 2.45E?04 ?1.71 1.80E?02 DIAPH1 ?0.71 5.96E?03 ?1.30E+00 2.62E?03 2.46E?04 ?1.31 1.80E?02 RPS20 ?0.37 4.64E?05 1.18E?16 1.00E+00 2.50E?04 ?0.37 1.81E?02 FYB ?0.74 1.07E?04 ?1.21E+00 2.11E?01 2.53E?04 ?0.85 1.83E?02 EP300 ?0.62 5.27E?03 ?1.58E+00 3.17E?03 2.62E?04 ?1.06 1.88E?02 CHD4 ?0.71 6.06E?05 ?6.09E?01 5.41E?01 2.67E?04 ?0.72 1.89E?02 SETD5 ?0.90 1.53E?04 ?1.01E+00 1.44E?01 2.66E?04 ?1.01 1.89E?02 CAPN3 ?3.22 4.49E?02 ?2.50E+00 4.20E?04 2.66E?04 ?0.62 1.89E?02 FAM60A 1.06 6.50E?05 8.04E?01 4.82E?01 2.68E?04 1.15 1.89E?02 TRBC2 ?0.94 6.01E?05 ?6.29E?01 5.67E?01 2.71E?04 ?1.03 1.89E?02 FAM102A ?0.20 5.55E?01 ?1.44E+00 6.60E?05 2.93E?04 ?1.44 2.04E?02 KPNA2 0.72 1.33E?04 1.25E+00 1.97E?01 2.95E?04 0.89 2.04E?02 HN1 0.57 5.69E?05 1.18E?16 1.00E+00 3.03E?04 0.57 2.06E?02 CHURC1 0.74 5.63E?05 1.18E?16 1.00E+00 3.00E?04 0.74 2.06E?02 GPR83 ?1.30 1.01E?02 ?1.10E+00 1.94E?03 3.02E?04 ?1.51 2.06E?02 BCL2A1B ?1.05 2.94E?04 ?6.65E?01 8.05E?02 3.10E?04 ?1.67 2.08E?02 GSG1L 1.00E+00 ?3.15E+00 3.11E?04 3.11E?04 2.08E?02 SMG7 ?0.76 1.80E?03 ?1.42E+00 1.14E?02 3.12E?04 ?1.11 2.08E?02 ATRNL1 2.19 1.61E?03 1.24E+00 1.28E?02 3.11E?04 0.48 2.08E?02 MYL12A 0.47 5.92E?05 1.18E?16 1.00E+00 3.15E?04 0.47 2.09E?02 GGNBP2 ?0.85 2.13E?04 ?9.13E?01 1.22E?01 3.19E?04 ?1.05 2.11E?02 VEZT ?0.87 1.85E?04 5.14E?01 1.49E?01 3.26E?04 ?0.12 2.14E?02 D930015E06RIK ?0.81 7.05E?03 ?1.10E+00 3.04E?03 3.29E?04 ?1.30 2.15E?02 LRRC2 0.25 2.79E?02 1.24E+00 8.23E?04 3.32E?04 0.39 2.16E?02 PNO1 0.23 3.17E?01 3.35E+00 1.07E?04 3.35E?04 0.92 2.17E?02 HSF2 0.78 5.33E?03 1.68E+00 4.15E?03 3.39E?04 1.29 2.18E?02 SCOC 0.87 3.39E?04 6.47E?01 7.71E?02 3.41E?04 1.27 2.19E?02 MED12 ?0.83 6.61E?05 ?5.86E?02 8.75E?01 3.45E?04 ?0.79 2.20E?02 COTL1 ?0.80 7.53E?05 8.72E?01 6.20E?01 3.49E?04 ?0.78 2.22E?02 ATP6V0E 0.56 6.84E?05 5.76E?01 8.26E?01 3.52E?04 0.57 2.23E?02 ZHX1 ?0.21 4.28E?01 2.10E+00 9.70E?05 3.67E?04 0.78 2.30E?02 PRPF19 ?0.77 1.69E?04 6.25E?01 1.95E?01 3.67E?04 ?0.53 2.30E?02 EEF1D 0.47 7.05E?05 1.18E?16 1.00E+00 3.71E?04 0.47 2.30E?02 NUP210 ?0.73 3.74E?04 ?2.13E+00 7.63E?02 3.71E?04 ?0.81 2.30E?02 CHMP5 0.62 1.20E?04 1.49E+00 3.24E?01 3.77E?04 0.70 2.31E?02 SUPT4A 0.60 2.76E?04 ?1.76E+00 1.11E?01 3.77E?04 0.52 2.31E?02 NEDD8 0.54 7.51E?05 7.81E?01 7.54E?01 3.75E?04 0.56 2.31E?02 EZH2 ?1.08 2.16E?04 ?7.60E?01 1.53E?01 3.84E?04 ?1.27 2.34E?02 TESC ?0.36 2.94E?01 ?1.37E+00 1.41E?04 4.10E?04 ?1.94 2.49E?02 DYNLT1C 1.08 8.26E?05 2.83E?01 8.06E?01 4.18E?04 1.11 2.52E?02 BRMS1 0.81 1.82E?04 6.85E?01 2.19E?01 4.27E?04 1.14 2.55E?02 RAB24 ?1.12 1.67E?04 ?3.93E?01 2.46E?01 4.27E?04 ?0.82 2.55E?02 KDELR2 0.77 8.27E?05 1.18E?16 1.00E+00 4.32E?04 0.77 2.57E?02 CDC37 0.35 8.35E?05 1.18E?16 1.00E+00 4.35E?04 0.35 2.58E?02 AKNA ?0.59 1.64E?02 ?2.16E+00 1.85E?03 4.40E?04 ?1.09 2.60E?02 TUBA1C 0.52 1.23E?02 1.97E+00 2.50E?03 4.51E?04 1.05 2.65E?02 AHCY ?0.73 1.60E?04 ?1.46E+00 2.97E?01 4.67E?04 ?0.79 2.73E?02 MCTP2 ?0.14 7.16E?01 1.49E+00 9.93E?05 4.80E?04 1.06 2.79E?02 NDUFB8 ?0.60 1.27E?04 1.15E+00 4.46E?01 4.84E?04 ?0.55 2.80E?02 SHTN1 ?1.08 5.43E?02 ?1.57E+00 7.17E?04 5.13E?04 ?0.56 2.96E?02 DPYSL2 0.78 1.59E?04 ?1.32E+00 3.48E?01 5.16E?04 0.75 2.96E?02 PLEKHJ1 0.51 1.74E?03 2.47E+00 2.11E?02 5.20E?04 0.77 2.97E?02 MED14 ?0.22 5.51E?01 ?1.36E+00 1.25E?04 5.34E?04 ?1.00 3.04E?02 SNHG11 0.47 6.03E?04 7.75E?01 6.99E?02 5.39E?04 0.48 3.05E?02 H1F0 ?1.14 3.26E?04 ?5.40E?01 1.47E?01 5.49E?04 ?1.24 3.10E?02 AAK1 ?0.80 1.08E?04 ?1.06E?02 9.64E?01 5.56E?04 ?0.63 3.11E?02 ATP1A1 ?0.87 1.32E?03 ?8.58E?01 3.04E?02 5.54E?04 ?1.23 3.11E?02 STXBP3 0.84 5.13E?04 6.72E?01 8.82E?02 5.60E?04 1.30 3.12E?02 SKIV2L ?0.60 2.38E?03 1.21E+00 1.66E?02 5.62E?04 0.15 3.12E?02 TMEM8B ?0.91 2.72E?01 ?2.01E+00 2.15E?04 5.80E?04 ?0.19 3.18E?02 H2-Q4 ?1.06 1.17E?04 2.15E?01 7.99E?01 5.80E?04 ?1.02 3.18E?02 HCN3 ?0.44 7.55E?01 2.71E+00 1.19E?04 5.80E?04 0.53 3.18E?02 GPR18 0.80 9.91E?03 1.14E+00 4.10E?03 5.84E?04 2.01 3.18E?02 NAA15 ?0.81 9.38E?04 ?1.14E+00 4.75E?02 5.89E?04 ?1.10 3.20E?02 GALE 0.70 9.38E?04 1.11E+00 4.77E?02 5.92E?04 1.34 3.20E?02 SEC61G 0.53 1.16E?04 1.18E?16 1.00E+00 5.94E?04 0.53 3.20E?02 MLLT3 ?1.01 1.64E?04 ?3.61E?01 4.23E?01 5.97E?04 ?0.98 3.20E?02 TRIM28 ?0.68 1.40E?03 ?1.32E+00 3.17E?02 6.04E?04 ?1.06 3.23E?02 CHP1 0.72 1.21E?04 1.95E?01 1.00E+00 6.23E?04 0.73 3.27E?02 ECHDC1 0.82 6.67E?03 1.11E+00 6.45E?03 6.18E?04 1.67 3.27E?02 SLC39A8 0.52 2.11E?01 1.28E+00 2.79E?04 6.20E?04 1.50 3.27E?02 ZFAND5 ?0.68 4.48E?02 ?1.17E+00 1.05E?03 6.23E?04 ?1.09 3.27E?02 ANP32B ?0.93 4.10E?04 ?1.18E+00 1.30E?01 6.19E?04 ?1.07 3.27E?02 RAP1A ?0.66 1.28E?04 ?1.72E?01 8.12E?01 6.33E?04 ?0.66 3.29E?02 ZMIZ1 ?0.84 1.40E?04 ?2.37E?01 6.31E?01 6.33E?04 ?0.82 3.29E?02 PLSCR1 0.96 2.18E?04 6.32E?01 3.04E?01 6.36E?04 1.14 3.29E?02 YTHDF3 ?1.16 1.38E?04 1.10E?01 7.99E?01 6.76E?04 ?0.78 3.48E?02 RAB11FIP4 1.05 9.02E?02 ?1.48E+00 6.34E?04 6.94E?04 ?0.42 3.57E?02 D830030K20RIK 1.00E+00 ?3.19E+00 7.00E?04 7.00E?04 3.58E?02 BC031181 0.68 3.93E?04 1.78E+00 1.63E?01 7.07E?04 0.79 3.61E?02 GNPDA2 1.13 2.65E?04 4.75E?01 2.81E?01 7.21E?04 1.36 3.66E?02 SLC12A7 0.54 8.12E?02 1.18E+00 7.33E?04 7.30E?04 1.26 3.68E?02 MAGED1 1.04 3.85E?02 ?1.66E+00 1.44E?03 7.30E?04 ?0.54 3.68E?02 ALKBH5 0.77 4.01E?04 1.74E+00 1.72E?01 7.49E?04 0.81 3.76E?02 CYSLTR2 0.83 1.11E?02 1.26E+00 4.91E?03 7.59E?04 1.78 3.78E?02 ZIC5 1.00E+00 3.09E+00 7.59E?04 7.59E?04 3.78E?02 CD209C ?0.29 2.68E?01 1.29E+00 2.92E?04 7.65E?04 0.54 3.78E?02 TNFRSF4 ?0.73 5.37E?04 ?1.91E+00 1.23E?01 7.62E?04 ?0.88 3.78E?02 SLC4A11 0.34 2.54E?01 1.47E+00 3.05E?04 7.70E?04 1.85 3.79E?02 KLHL6 0.94 3.90E?04 9.03E?01 1.87E?01 7.75E?04 1.25 3.81E?02 BCKDHA 0.65 5.10E?03 1.09E+00 1.14E?02 8.03E?04 1.54 3.90E?02 TANGO2 0.92 1.96E?02 1.07E+00 3.00E?03 8.04E?04 1.81 3.90E?02 TREX1 0.55 2.54E?02 1.90E+00 2.33E?03 8.01E?04 1.63 3.90E?02 CTXN1 0.40 7.00E?01 2.16E+00 1.75E?04 8.14E?04 0.74 3.94E?02 ERCC4 0.95 1.85E?03 ?8.03E?01 3.37E?02 8.23E?04 0.28 3.96E?02 LFNG ?0.37 6.72E?01 ?1.91E+00 1.83E?04 8.36E?04 ?0.52 4.01E?02 UCK2 ?0.87 1.45E?03 ?1.19E+00 4.55E?02 8.48E?04 ?1.31 4.05E?02 MRGPRA6 ?0.36 1.70E?04 1.18E?16 1.00E+00 8.52E?04 ?0.36 4.06E?02 SLAIN1 ?1.15 7.18E?03 ?9.75E?01 8.68E?03 8.61E?04 ?0.96 4.09E?02 EML3 ?0.75 6.28E?03 1.15E+00 1.01E?02 8.73E?04 0.11 4.13E?02 ACOT8 0.42 1.14E?01 1.37E+00 6.76E?04 8.90E?04 1.70 4.16E?02 LAMP1 ?0.82 4.20E?03 ?1.04E+00 1.57E?02 8.98E?04 ?1.61 4.16E?02 BRCA2 ?0.86 9.09E?03 ?1.08E+00 7.19E?03 8.98E?04 ?0.76 4.16E?02 RPS6KA4 ?0.01 9.74E?01 1.52E+00 1.79E?04 8.93E?04 1.38 4.16E?02 HIST1H1E ?0.71 7.99E?03 ?9.86E?01 8.16E?03 8.97E?04 ?1.58 4.16E?02 PAPSS2 2.10 2.19E?04 ?2.67E?01 5.30E?01 8.88E?04 0.23 4.16E?02 EIF5B ?0.54 1.81E?04 4.15E?01 1.00E+00 9.04E?04 ?0.54 4.17E?02 SMC4 ?0.86 1.83E?04 1.26E?01 9.93E?01 9.12E?04 ?0.83 4.19E?02 TLR7 1.00E+00 ?3.06E+00 9.19E?04 9.19E?04 4.21E?02 MTA1 ?0.79 6.77E?04 ?6.03E?01 1.19E?01 9.23E?04 ?0.92 4.21E?02 SEC23B 0.81 1.93E?04 ?8.51E?02 8.05E?01 9.32E?04 0.77 4.23E?02 RN7S2 ?0.79 2.03E?04 ?1.49E?01 7.01E?01 9.35E?04 ?0.71 4.23E?02 RN7S1 ?0.79 2.03E?04 ?1.49E?01 7.01E?01 9.35E?04 ?0.71 4.23E?02 CHRNA1 0.45 4.87E?04 5.16E?01 1.82E?01 9.39E?04 0.45 4.23E?02 ANKRD17 ?0.79 2.20E?04 ?3.57E?01 6.03E?01 9.47E?04 ?0.80 4.25E?02 CTS8-PS 1.00E+00 ?3.09E+00 9.50E?04 9.50E?04 4.25E?02 HUWE1 ?0.64 2.71E?04 ?1.16E+00 4.23E?01 9.58E?04 ?0.65 4.26E?02 SLC43A1 ?3.09 1.49E?01 ?2.43E+00 5.84E?04 9.55E?04 ?0.50 4.26E?02 SLC43A2 ?0.04 9.01E?01 ?1.36E+00 1.97E?04 9.71E?04 ?0.71 4.30E?02 PRR12 ?0.34 2.00E?01 ?1.28E+00 4.72E?04 9.77E?04 ?0.58 4.31E?02 1110037F02RIK ?0.98 2.90E?04 ?3.06E?01 4.04E?01 9.94E?04 ?0.86 4.37E?02 ATP10D 0.12 7.14E?01 1.32E+00 2.19E?04 1.01E?03 0.83 4.43E?02 HPCAL4 1.00E+00 3.01E+00 1.03E?03 1.03E?03 4.51E?02 CPSF4 ?0.98 2.33E?04 ?1.80E?01 6.61E?01 1.04E?03 ?0.89 4.53E?02 FGF2 ?0.70 7.29E?01 ?2.62E+00 2.26E?04 1.05E?03 ?0.51 4.54E?02 HNRNPAB ?0.84 6.61E?04 ?1.02E+00 1.46E?01 1.05E?03 ?1.05 4.55E?02 SOX5 ?0.23 4.26E?01 1.35E+00 3.02E?04 1.06E?03 0.62 4.59E?02 ENSA 0.63 2.62E?02 1.48E+00 3.15E?03 1.08E?03 1.25 4.64E?02 DOK2 ?0.70 1.51E?02 ?1.69E+00 5.36E?03 1.08E?03 ?1.45 4.64E?02 ZFP622 ?0.97 2.42E?03 ?7.35E?01 3.58E?02 1.11E?03 ?1.02 4.72E?02 TUBB4B 0.48 2.84E?03 2.37E+00 3.01E?02 1.11E?03 0.74 4.72E?02 PRKCB ?0.24 4.15E?01 ?1.33E+00 3.24E?04 1.12E?03 ?1.06 4.74E?02 NUDT3 0.51 2.26E?02 2.78E+00 3.77E?03 1.12E?03 0.80 4.74E?02 FABP5 0.77 4.00E?04 ?8.10E?01 3.08E?01 1.13E?03 0.62 4.76E?02 SLC15A3 1.09 1.42E?03 9.35E?01 6.62E?02 1.14E?03 1.70 4.78E?02 CCNT1 ?0.83 7.75E?04 7.48E?01 1.34E?01 1.14E?03 ?0.16 4.78E?02 SYMPK ?0.68 5.07E?03 ?1.21E+00 1.70E?02 1.14E?03 ?1.02 4.78E?02 STK11 ?0.97 5.46E?04 4.53E?01 2.11E?01 1.16E?03 ?0.15 4.83E?02 PON3 2.13 8.53E?04 8.38E?01 1.26E?01 1.19E?03 0.35 4.95E?02 PGLYRP2 ?1.12 3.78E?02 ?1.23E+00 2.50E?03 1.20E?03 ?1.15 4.95E?02 VEZF1 ?0.84 3.05E?03 ?8.57E?01 3.14E?02 1.23E?03 ?1.17 5.05E?02 KMO 1.00E+00 ?3.13E+00 1.24E?03 1.24E?03 5.08E?02 PAIP1 0.68 1.90E?03 1.14E+00 5.34E?02 1.25E?03 0.96 5.09E?02 LRRN4CL ?0.28 5.48E?02 ?1.08E+00 1.86E?03 1.25E?03 ?0.42 5.09E?02 CYTIP 0.55 2.56E?04 1.18E?16 1.00E+00 1.25E?03 0.55 5.09E?02 TPST1 ?0.71 3.56E?01 ?1.63E+00 4.11E?04 1.27E?03 ?0.76 5.15E?02 HNRNPU ?0.76 4.24E?04 ?9.77E?01 3.40E?01 1.27E?03 ?0.80 5.15E?02 CXCR2 0.64 2.68E?04 2.88E?01 8.27E?01 1.28E?03 0.65 5.15E?02 PHGDH ?0.70 2.90E?04 7.78E?01 6.87E?01 1.30E?03 ?0.68 5.18E?02 SLAMF6 ?0.06 9.38E?01 ?1.37E+00 2.67E?04 1.30E?03 ?1.39 5.18E?02 DNTTIP1 ?1.28 7.47E?04 ?5.04E?01 1.65E?01 1.29E?03 ?0.71 5.18E?02 GZMB 0.44 5.20E?01 ?1.59E+00 3.33E?04 1.30E?03 ?0.98 5.19E?02 MRPL27 0.75 2.37E?03 1.44E+00 4.44E?02 1.31E?03 1.10 5.19E?02 FBXO46 ?0.90 1.84E?03 7.61E?01 5.92E?02 1.32E?03 ?0.15 5.22E?02 CCDC63 ?0.46 2.96E?01 1.33E+00 4.91E?04 1.33E?03 0.85 5.26E?02 CELF1 ?0.75 3.95E?04 ?8.32E?01 4.12E?01 1.34E?03 ?0.77 5.28E?02 TCF20 ?0.74 8.17E?04 ?1.41E+00 1.59E?01 1.37E?03 ?0.79 5.37E?02 TRIM17 1.00E+00 ?3.03E+00 1.38E?03 1.38E?03 5.40E?02 IL10RA ?0.19 6.76E?01 ?1.25E+00 3.13E?04 1.38E?03 ?1.39 5.40E?02 TPD52 0.28 1.86E?01 3.03E+00 7.30E?04 1.39E?03 0.90 5.41E?02 PTPN1 0.65 5.36E?04 1.50E+00 2.87E?01 1.42E?03 0.71 5.49E?02 CREBBP ?0.82 5.38E?04 ?4.53E?01 2.89E?01 1.43E?03 ?0.87 5.53E?02 ZFP704 ?0.17 8.59E?01 ?2.49E+00 3.01E?04 1.43E?03 ?0.05 5.53E?02 MCUR1 ?1.13 3.33E?04 ?1.34E?01 6.80E?01 1.47E?03 ?0.52 5.63E?02 TUBB6 0.76 1.88E?02 1.17E+00 6.06E?03 1.46E?03 1.92 5.63E?02 TAF2 ?0.66 1.42E?02 ?9.90E?01 8.02E?03 1.47E?03 ?1.09 5.64E?02 NT5C 0.55 4.46E?04 1.21E+00 4.06E?01 1.49E?03 0.59 5.64E?02 S100A13 0.51 1.38E?02 2.62E+00 8.34E?03 1.48E?03 0.98 5.64E?02 KMT2C ?0.74 5.12E?04 ?4.10E?01 3.30E?01 1.49E?03 ?0.72 5.64E?02 PPP6C 0.63 1.71E?03 1.55E+00 7.58E?02 1.51E?03 0.86 5.69E?02 SRGN 0.53 3.13E?04 1.18E?16 1.00E+00 1.51E?03 0.53 5.69E?02 AHDC1 ?0.02 9.47E?01 ?1.29E+00 3.13E?04 1.51E?03 ?0.48 5.69E?02 GDPD2 1.00E+00 3.28E+00 1.52E?03 1.52E?03 5.71E?02 ZFP65 ?0.51 3.22E?04 1.18E?16 1.00E+00 1.55E?03 ?0.51 5.74E?02 FBXO22 1.18 4.01E?04 3.00E?01 5.23E?01 1.55E?03 1.17 5.74E?02 TRAPPC2L 0.67 5.55E?03 1.10E+00 2.22E?02 1.57E?03 1.60 5.74E?02 EPAS1 ?1.29 1.26E?02 ?9.26E?01 9.68E?03 1.57E?03 ?1.01 5.74E?02 RELT 0.03 9.46E?01 ?1.31E+00 3.23E?04 1.55E?03 ?1.21 5.74E?02 RXRA ?0.32 5.82E?01 ?1.32E+00 3.81E?04 1.56E?03 ?0.98 5.74E?02 ZFP41 0.33 4.82E?01 ?1.55E+00 4.16E?04 1.54E?03 ?0.84 5.74E?02 MYL6 0.35 3.25E?04 1.18E?16 1.00E+00 1.56E?03 0.34 5.74E?02 RPL5 ?0.22 3.27E?04 1.18E?16 1.00E+00 1.57E?03 ?0.22 5.74E?02 SNX3 ?0.39 3.30E?04 1.18E?16 1.00E+00 1.59E?03 ?0.39 5.79E?02 CCDC66 ?1.26 3.42E?04 8.65E?02 8.23E?01 1.60E?03 ?0.70 5.82E?02 DCLRE1C 0.78 5.07E?04 1.21E+00 3.86E?01 1.63E?03 0.80 5.90E?02 BAG6 ?0.69 4.49E?04 ?3.49E?01 4.72E?01 1.63E?03 ?0.75 5.91E?02 NSMCE4A 0.07 8.71E?01 ?1.32E+00 3.56E?04 1.68E?03 ?1.22 5.94E?02 GOLT1B 0.77 1.12E?03 1.86E+00 1.43E?01 1.69E?03 0.88 5.94E?02 ACSL3 ?1.01 4.95E?03 ?7.79E?01 2.73E?02 1.69E?03 ?1.15 5.94E?02 CLIC5 1.70 2.11E?01 2.27E+00 7.99E?04 1.65E?03 0.25 5.94E?02 UBE3A ?0.68 2.13E?02 ?1.18E+00 6.15E?03 1.65E?03 ?1.24 5.94E?02

    [0520] Table 2A-2G. Tables related to the 10?, single-cell sequencing on T cells derived from the in-vivo mouse experiments. Table 2A-2Fresults of Tissue vs. Tissue differential expression comparisons (both between-tissue comparisons and within-tissue, genotype comparisons) Table 2GTissue combined.

    [0521] Table Description and Headings:

    [0522] Spleen Ctrl vs KG: Genotype comparison between cells extracted from the Spleen. Positive log FC associated with higher expression in Ctrl cells (compared with KG Cells).

    [0523] Colon LPL Ctrl vs KO: Genotype comparison between cells extracted from the Colon Lamina Propria. Positive log FC associated with higher expression in Ctrl cells (compared with KO Cells).

    [0524] Small Intestine LPL Ctrl vs KO: Genotype comparison between cells extracted from the Small Intestine Lamina Propria. Positive log FC associated with higher expression in Ctrl cells (compared with KO Cells).

    [0525] Colon IEL Ctrl vs KO: Genotype comparison between cells extracted from the Colon Epithelium. Positive log FC associated with higher expression in Ctrl cells (compared with KO Cells).

    [0526] LPL vs Spleen: Comparison between cells taken from the Lamina Propria (Colon and Small Intestine) vs. Spleen. Positive log FC associated with higher expression in Lamina Propria.

    [0527] IEL vs Spleen: Comparison between cells taken from the Colon Epithelium vs. Spleen. Positive log FC associated with higher expression in Colon Epithelium.

    [0528] Tissue Combined: ANOVA-like test for tissue-specific expression. Tests the inclusion of all tissue coefficients simultaneously. Reference levelSpleen.

    [0529] GeneID: Unique Ensembl identifier for the gene being tested

    [0530] GeneSymbol: Common symbol used for this gene

    [0531] log FC: log 2 coefficient of the linear model

    [0532] log CPM: log 2 counts-per-million average expression

    [0533] LR: likelihood ratio from which p-values are derived

    [0534] PValue: Associated p-value for this gene's coefficient

    [0535] FDR: Benjamini-Hochberg False Discover Rate

    TABLE-US-00010 TABLE 2A Spleen Ctrl vs KO GeneSymbol logFC logCPM LR PValue FDR B2m ?0.394594818 12.75972879 1444.404623 0 0 Rpl8 0.468048248 11.72273016 1161.570028 1.3719E?254 1.0569E?250 Rpl18 0.434763597 11.79581946 1104.869146 2.8881E?242 1.4833E?238 Ifi2712a ?1.367469104 10.39056913 1082.936188 1.689E?237 6.5061E?234 Rpl14 0.467863321 11.90179131 999.0735997 2.8552E?219 8.7985E?216 Rpl18a 0.40844965 12.7923771 976.338732 2.4971E?214 6.4125E?211 Rps5 0.425613673 12.21232007 963.9572813 1.2269E?211 2.7005E?208 Rpl17 0.406079885 12.23488643 922.7043597 1.1382E?202 2.1922E?199 Tmsb10 ?0.430569001 12.90243511 917.8571853 1.288E?201 2.2051E?198 Rpl13a 0.318130864 13.07963904 880.2603075 1.9189E?193 2.9566E?190 Rps6 0.387608536 12.2862602 879.5297959 2.766E?193 3.8744E?190 Ubb ?0.427975051 11.87538618 854.4454932 7.8543E?188 1.0085E?184 Rpl3 0.392996062 12.07431934 853.9654869 9.9877E?188 1.1838E?184 Rps18 0.441028555 12.56725217 846.7465436 3.7058E?186 4.0784E?183 Rps3 0.326489663 11.9717569 804.8381021 4.7882E?177 4.9185E?174 Rps14 0.361847774 12.58774591 790.9068962 5.1178E?174 4.9284E?171 Rpl29 0.403548785 11.32743279 789.2408217 1.1785E?173 1.0681E?170 Hbb-bs ?1.322316458 9.139899255 774.1781884 2.2197E?170 1.9001E?167 Rps23 0.366380189 12.42732913 772.3794594 5.4626E?170 4.4298E?167 Rpl32 0.342303232 12.55404626 755.0295723 3.2344E?166 2.4918E?163 Pfn1 ?0.384163523 12.60884857 710.1081556 1.8951E?156 1.3905E?153 Rplp0 0.316020006 12.54798341 706.666425 1.0618E?155 7.4367E?153 Rpl24 0.345910071 11.74324764 701.1303805 1.6978E?154 1.1374E?151 Rpl21 0.351304057 11.78074345 696.9180321 1.3993E?153 8.9833E?151 Rpl13 0.383449286 12.64381099 695.1792673 3.342E?153 2.0598E?150 Rps24 0.387091918 11.96746781 683.7521651 1.0208E?150 6.0497E?148 Rpl10a 0.399442811 11.25682159 681.0036857 4.0426E?150 2.307E?147 Il7r 1.03867114 9.716667054 678.6930989 1.2857E?149 7.0749E?147 Rps4x 0.331978848 11.96044745 670.9400055 6.24E?148 3.3154E?145 Rpl19 0.284781004 12.05752888 636.4445613 1.9824E?140 1.0182E?137 AW112010 ?0.543245425 11.59018241 633.9186211 7.0236E?140 3.491E?137 Rpl4 0.314340007 11.74124626 627.5348359 1.7178E?138 8.2712E?136 Rps19 0.395757239 12.83023757 615.6591388 6.5748E?136 3.0698E?133 Rps7 0.354149685 12.00850254 606.9322923 5.1998E?134 2.3564E?131 Rps3a1 0.299122173 11.79361689 588.9227548 4.2976E?130 1.8919E?127 Rps9 0.332982718 11.94213912 586.8353858 1.2225E?129 5.2324E?127 Rpl23a 0.320735899 12.0892703 578.7802504 6.9088E?128 2.877E?125 Rpl12 0.50132843 10.9317396 576.0114318 2.7649E?127 1.1211E?124 Tmsb4x ?0.270263653 14.50537537 568.0807108 1.4683E?125 5.8009E?123 Rpl23 0.338209227 11.6086807 556.8680667 4.0357E?123 1.5546E?120 Rps13 0.303056725 11.84034228 550.8608727 8.1793E?122 3.0738E?119 mt-Co1 0.322058669 12.25832103 542.7662554 4.7167E?120 1.7304E?117 Rps10 0.322943166 11.23934257 537.8337752 5.5807E?119 1.9997E?116 Rsrp1 ?0.547900074 10.29205708 531.868532 1.1077E?117 3.8791E?115 Rpl26 0.317557283 11.55435837 530.2211529 2.5283E?117 8.657E?115 Rps15a 0.328204873 12.2017224 529.9491858 2.8974E?117 9.7049E?115 Rpl6 0.299225556 11.6914612 522.7460832 1.0693E?115 3.5055E?113 Rpl30 0.376508954 10.91773473 522.2066548 1.4011E?115 4.4974E?113 Rplp1 0.335197804 11.71666386 510.0333892 6.2366E?113 1.9611E?110 Rps2 0.358100913 11.64912595 488.7668525 2.6432E?108 8.1453E?106 Hba-a1 ?0.920500794 9.095022031 476.6698426 1.1334E?105 3.4242E?103 Rps8 0.286460085 11.80270255 474.8469891 2.8251E?105 8.3711E?103 Rpsa 0.273857677 11.6751798 471.4739516 1.5312E?104 4.4514E?102 Rps16 0.275293093 12.28556335 448.530665 1.5062E?99 4.29771E?97 Rpl36a 0.442909207 10.94274968 446.158868 4.9438E?99 1.38498E?96 Sh3bgrl3 ?0.341561055 11.40559323 440.3930387 8.89009E?98 2.44604E?95 Rpl27a 0.294504688 11.64048213 438.3535946 2.47041E?97 6.67791E?95 Cfl1 ?0.314322281 11.4854451 437.6224597 3.56364E?97 9.46699E?95 Sub1 ?0.411655331 10.76071441 436.4866305 6.29648E?97 1.64434E?94 Myl6 ?0.314779512 11.36366325 433.2092611 3.25386E?96 8.35591E?94 Hspa1a ?1.336716152 9.242931161 430.8805791 1.04527E?95 2.64026E?93 Rpl34 0.278104357 11.77163488 430.4209651 1.31603E?95 3.27054E?93 Hnrnpa3 ?0.464034776 10.23003684 427.6656651 5.23551E?95 1.28046E?92 Eef2 0.294044382 11.17784701 424.7944526 2.20745E?94 5.31444E?92 Gnb2l1 0.351421332 10.53545348 417.6969993 7.73971E?93 1.83467E?90 Prdx1 ?0.443893585 10.25016103 405.1065332 4.25916E?90 9.9432E?88 Rps12 0.392808532 10.82428255 404.9917445 4.5114E?90 1.03749E?87 Eef1b2 0.464170287 10.11001442 404.8440126 4.85814E?90 1.1008E?87 Rplp2 0.281131176 11.78981311 403.697428 8.63098E?90 1.92734E?87 Rps27a 0.272166684 11.85785907 403.2559785 1.07685E?89 2.37031E?87 Eef1a1 0.230267534 12.30506479 395.0564055 6.56311E?88 1.42429E?85 Serf2 ?0.294324233 10.78514217 392.1550889 2.81006E?87 6.01352E?85 Rpl11 0.246557229 11.72200823 387.7373487 2.57314E?86 5.43108E?84 Rps20 0.363934892 11.13696988 381.8405125 4.94601E?85 1.02984E?82 Rps11 0.226974358 12.39603371 378.4530376 2.70247E?84 5.55196E?82 Hspa1b ?0.944735319 9.137289838 356.5410016 1.59507E?79 3.2338E?77 Rpl5 0.359361035 10.54545781 341.8660149 2.50316E?76 5.00892E?74 Ms4a4b ?0.306121376 11.83323511 339.3968419 8.63432E?76 1.70561E?73 Hmgn2 ?0.9381794 9.557710879 338.9838185 1.06213E?75 2.07156E?73 S100a11 ?0.412995978 10.68782699 337.6388092 2.08498E?75 4.01566E?73 Cd3e ?0.387729698 10.30595328 336.0488677 4.62777E?75 8.80304E?73 Hnrnpa2b1 ?0.40798608 10.28844325 326.7138354 4.99493E?73 9.38559E?71 Rps25 0.270160344 11.11755248 325.1522005 1.09312E?72 2.02925E?70 Rpl36 0.292774874 11.53238972 323.7246145 2.23673E?72 4.10281E?70 Rpl9 0.249983812 11.74080817 321.4482229 7.00566E?72 1.26992E?69 Plac8 1.012302318 9.652571139 318.2423485 3.49751E?71 6.26624E?69 Tsc22d3 0.697894281 9.554940607 317.6897125 4.61464E?71 8.17268E?69 Myl12a ?0.335034242 10.60425227 314.7301327 2.03621E?70 3.56521E?68 Bcl2 0.906160685 9.588703364 313.2636118 4.24894E?70 7.35592E?68 Hmgb2 ?0.696396429 11.06074981 311.7640665 9.01443E?70 1.54327E?67 Stat1 ?0.697258014 9.534895283 306.4652959 1.28603E?68 2.17748E?66 Psme2 ?0.393710072 10.13966069 300.8422195 2.15914E?67 3.61609E?65 Hba-a2 ?0.676429421 9.081900495 299.835836 3.57715E?67 5.92653E?65 Hspa8 0.261320173 11.52981983 289.4131945 6.67446E?65 1.09404E?62 Tpt1 0.204354222 11.56490731 286.7839208 2.49646E?64 4.04899E?62 Acp5 0.600613336 9.490932375 273.4792682 1.97986E?61 3.17768E?59 Ms4a6b ?0.294195147 10.88050411 272.369232 3.45584E?61 5.48944E?59 Pdia3 ?0.40435809 9.947067745 268.7935278 2.07901E?60 3.26871E?58 Cyba ?0.298957075 10.70076607 257.3695116 6.42556E?58 1.00005E?55 Rpl7 0.20397207 11.24994647 255.4080291 1.71985E?57 2.64994E?55 Dusp2 0.695936163 9.421733241 249.5519128 3.25182E?56 4.9608E?54 Calm3 ?0.457829973 9.738712517 249.1451719 3.98842E?56 6.02486E?54 Gm9844 ?0.598681314 9.498462623 246.8932384 1.23526E?55 1.84785E?53 Cdc42 ?0.266127107 10.66030324 245.2729444 2.78624E?55 4.12793E?53 Ppia ?0.24330961 11.96233228 242.3342812 1.21825E?54 1.7877E?52 Hbb-bt ?0.498398902 9.069464739 241.8093712 1.58558E?54 2.30477E?52 Fau 0.185333561 12.0738768 241.4373304 1.9112E?54 2.75213E?52 Rpl7a 0.267864394 10.57501611 239.9695494 3.99342E?54 5.69728E?52 Hsp90b1 ?0.491697038 9.746474506 236.6017656 2.16618E?53 3.06206E?51 Eno1 ?0.348932991 10.05496627 233.3201331 1.12538E?52 1.57635E?50 Ddit4 0.538960929 9.672816531 233.2496451 1.16592E?52 1.61843E?50 Ptma ?0.370972377 11.21833373 223.7026613 1.40854E?50 1.93775E?48 Ybx1 ?0.285294787 10.48744422 222.7185656 2.30893E?50 3.14832E?48 H3f3b ?0.260942477 11.14558946 221.6453302 3.95823E?50 5.34986E?48 Itgb1 ?0.666523293 10.23396472 220.1474805 8.39874E?50 1.12529E?47 Fxyd5 0.269233669 10.67479998 216.001067 6.74044E?49 8.95317E?47 Klf2 0.339556672 11.0136358 215.1873446 1.01437E?48 1.33585E?46 Gm10076 ?0.558406186 9.458585833 213.9666957 1.87276E?48 2.44538E?46 Eef1g 0.293402137 10.47224312 211.2066869 7.49211E?48 9.70071E?46 Ifngr1 0.49965726 9.929229799 209.6778484 1.61492E?47 2.07355E?45 Ly6a ?0.341921357 10.6371311 209.1069354 2.15134E?47 2.73949E?45 Tmbim6 ?0.296577287 10.12994397 206.583007 7.64514E?47 9.65543E?45 Anxa2 ?0.517046321 10.04332864 202.0678195 7.38922E?46 9.25635E?44 Cd52 ?0.210917208 12.51348717 195.7909614 1.73136E?44 2.15135E?42 Arl6ip1 ?0.405136227 10.09908166 195.5723749 1.93238E?44 2.38192E?42 Ndufa3 ?0.334866237 9.839878945 195.390331 2.11749E?44 2.58939E?42 Tuba1b ?0.67879043 10.00008493 195.1176906 2.42843E?44 2.94624E?42 Rtp4 ?0.793831448 9.147652434 194.6736275 3.03559E?44 3.65409E?42 Capg ?0.495718911 9.935583727 193.4909519 5.50006E?44 6.56937E?42 Hnrnpdl ?0.50199538 9.362300942 193.1180335 6.63376E?44 7.86254E?42 Tma7 ?0.269138523 10.19317796 189.7301451 3.64112E?43 4.28262E?41 Eif3f 0.233701824 10.65753688 188.392098 7.1336E?43 8.32686E?41 Lgals1 ?0.38078271 12.63361906 187.9718066 8.81159E?43 1.02082E?40 Rbm3 0.277674976 10.70166498 184.7747377 4.39516E?42 5.05378E?40 Uba52 ?0.408087039 9.952856342 183.6984284 7.55001E?42 8.61708E?40 Sh2d1a ?0.491016053 9.642697413 179.860533 5.19842E?41 5.88951E?39 Ctla2a 0.588010327 9.748854778 179.6570959 5.75825E?41 6.47614E?39 Tap1 ?0.415743191 9.53747222 178.4958846 1.03237E?40 1.15267E?38 Txn1 ?0.325654396 10.05357118 176.6338416 2.63285E?40 2.91849E?38 Arl4c 0.407528267 9.783232926 176.3804994 2.99053E?40 3.29129E?38 Gltscr2 0.305069843 10.068061 174.8774404 6.36752E?40 6.95821E?38 Ccng1 ?0.542528285 9.308847938 174.5743604 7.41577E?40 8.04663E?38 Cox7c ?0.258404342 10.16243436 174.2395106 8.77566E?40 9.45563E?38 Sec61g ?0.28454506 10.08219258 173.0412387 1.60311E?39 1.71533E?37 Psmb9 ?0.349239421 9.782360113 172.413577 2.19805E?39 2.3357E?37 Arhgdib ?0.188477383 11.23130777 172.327412 2.29539E?39 2.42242E?37 Rpl35a 0.170485936 11.73666243 171.8379009 2.93605E?39 3.07746E?37 Wdr1 ?0.338161055 9.787807742 171.5059364 3.46947E?39 3.612E?37 Itgb2 ?0.319512386 10.05832132 170.556406 5.59298E?39 5.78366E?37 Atp5k ?0.362856145 9.63851564 164.5794993 1.13023E?37 1.16098E?35 Rabac1 0.405039787 9.640125814 162.7941386 2.77456E?37 2.83116E?35 Rps27rt ?0.447016904 10.76991423 162.249778 3.64854E?37 3.69847E?35 Alyref ?0.535399757 9.490162415 162.2144125 3.71404E?37 3.74025E?35 Dtx1 0.560691764 9.35639362 160.7218922 7.86911E?37 7.8732E?35 Ndufa4 ?0.312282402 9.983525258 159.2954748 1.6128E?36 1.60323E?34 Lsm5 ?0.407548255 9.652256708 159.0796182 1.79781E?36 1.77568E?34 Il17re 0.590542136 9.074926885 158.4513557 2.46614E?36 2.42028E?34 Tpm3-rs7 ?0.294787222 9.951730222 158.186127 2.8182E?36 2.74828E?34 Tapbp ?0.360215199 9.633906361 158.1391765 2.88556E?36 2.79627E?34 Rpl27 0.199841065 11.18362874 157.30377 4.39311E?36 4.23057E?34 Tmem258 ?0.318818743 9.706925426 157.1801446 4.67505E?36 4.47411E?34 Btg1 0.36057321 10.56026433 157.00365 5.10919E?36 4.85941E?34 mt-Co2 0.178449904 11.53302585 156.9703025 5.19564E?36 4.91132E?34 Tmed2 ?0.296688017 9.866059965 156.6971734 5.96104E?36 5.60047E?34 Satb1 0.535626973 9.41396337 154.740485 1.59553E?35 1.48994E?33 Lcp1 ?0.251556666 10.3183034 154.3223776 1.96914E?35 1.82774E?33 Dnajc15 0.31387085 9.931084321 153.721031 2.66499E?35 2.45881E?33 Cd7 0.668431811 9.510504639 153.5856393 2.85288E?35 2.6165E?33 Sepw1 ?0.27518717 10.11754145 150.0979543 1.65025E?34 1.50456E?32 Ewsr1 ?0.345594062 9.627042746 150.0365057 1.70208E?34 1.54269E?32 Cdkn2c ?0.636702077 9.207647914 149.3358462 2.42175E?34 2.18213E?32 Actr2 ?0.34076163 9.642504656 148.8367424 3.11334E?34 2.78897E?32 Tubb5 ?0.417183951 10.30641471 145.4558067 1.70731E?33 1.52059E?31 Ngp ?0.763681094 9.100007972 145.0011994 2.14634E?33 1.90062E?31 Isg15 ?0.719651949 9.17520338 143.8950283 3.74577E?33 3.29799E?31 Tceb2 ?0.237515156 10.20307649 142.9938076 5.89637E?33 5.16201E?31 Rps15 0.168454585 11.47619806 142.2891217 8.40744E?33 7.31875E?31 Cytip 0.360334035 9.597191973 142.1887143 8.84338E?33 7.65498E?31 Clic1 ?0.218361527 10.68495514 140.1304999 2.49274E?32 2.1457E?30 Ube2s ?0.454337114 9.814291968 137.7313987 8.3432E?32 7.14178E?30 Klf13 0.398593604 9.628466206 137.2456797 1.06552E?31 9.07045E?30 Prr13 ?0.278815789 10.28885144 136.8919515 1.27328E?31 1.07795E?29 Cdkn2a ?0.609121377 9.14054978 135.9701759 2.0255E?31 1.7054E?29 Cox17 ?0.329594045 9.66363411 135.6492986 2.38076E?31 1.99363E?29 Stmn1 ?0.82419623 9.807967069 133.4210017 7.31357E?31 6.09121E?29 Uqcrb ?0.273218922 9.8678254 132.0266827 1.47622E?30 1.22288E?28 Pkm ?0.240731434 10.20918593 131.7398269 1.70571E?30 1.40543E?28 2810417H13Rik ?0.967373055 9.637529027 131.3105515 2.11748E?30 1.73543E?28 Rbm39 0.23545176 10.26100638 130.597203 3.0331E?30 2.4727E?28 Ube2n ?0.31188351 9.608778462 129.8514637 4.41618E?30 3.58129E?28 Ywhah ?0.296531841 9.906272871 129.0537086 6.60079E?30 5.32486E?28 Calm1 ?0.188744202 11.10279906 128.1469284 1.04234E?29 8.36476E?28 Lmnb1 ?0.553332185 9.492228417 127.3329829 1.57079E?29 1.25403E?27 Pdia4 ?0.417941212 9.32860591 126.601842 2.27046E?29 1.80326E?27 Psma2 ?0.250801241 9.885834901 126.3445928 2.5847E?29 2.04231E?27 Ppp4c ?0.306484664 9.664046883 125.3439349 4.27957E?29 3.36427E?27 mt-Co3 0.148713029 12.38729466 124.5410801 6.41375E?29 5.0164E?27 Cox6b1 ?0.201143661 10.26082572 122.5363554 1.76158E?28 1.37083E?26 Pomp ?0.26160036 9.873253648 122.454949 1.83536E?28 1.42106E?26 Dbi ?0.365045445 9.623042963 121.9090122 2.41671E?28 1.86183E?26 Cox7a2l 0.25365352 10.09942318 121.8347741 2.50885E?28 1.91816E?26 1810037I17Rik ?0.312590156 9.676973201 121.8301355 2.51473E?28 1.91816E?26 Zeb2 ?0.774138414 9.127424397 121.6173644 2.79941E?28 2.12479E?26 Atp5j ?0.228873779 10.1072932 121.0463043 3.73316E?28 2.81963E?26 Npm1 0.235150388 10.40971878 119.8911973 6.68273E?28 5.0228E?26 Atp1b3 0.318801787 9.708024434 119.2417087 9.27148E?28 6.93471E?26 Tmem176a 0.763367915 9.182539974 119.1449011 9.73518E?28 7.24636E?26 Pdcd4 0.420098355 9.642492644 118.9155041 1.09287E?27 8.09565E?26 Cd247 ?0.333565058 9.579185183 118.7057752 1.21475E?27 8.95546E?26 Rpl22l1 0.208609039 10.83580793 118.6842487 1.22801E?27 9.01007E?26 Hnrnpa1 ?0.369311881 9.492414828 118.3490179 1.45412E?27 1.06185E?25 Shfm1 ?0.229553147 10.0031327 117.0924606 2.73992E?27 1.99135E?25 Rps21 0.238376482 10.63600103 116.6726207 3.38588E?27 2.44928E?25 Tceb1 ?0.31869581 9.529590194 116.660403 3.40681E?27 2.4529E?25 Srrm2 0.30189204 9.744719687 116.4576604 3.7735E?27 2.70428E?25 Canx ?0.374606446 9.405124767 116.1573065 4.39053E?27 3.13191E?25 Cenpa ?0.706828827 9.37944655 115.835444 5.16417E?27 3.6668E?25 Lztfl1 0.577921378 9.128139284 115.7740802 5.32646E?27 3.76468E?25 Pglyrp1 ?0.371039398 9.700031151 114.7295603 9.01963E?27 6.34587E?25 Ifi27 ?0.367396341 9.485380503 114.4243909 1.05202E?26 7.36797E?25 Cox6c ?0.199529709 10.2464669 114.0849521 1.24844E?26 8.70403E?25 Myl12b ?0.219178436 10.11053816 113.7928401 1.44659E?26 1.00401E?24 Igfbp4 0.750607125 9.125936959 113.3553129 1.80375E?26 1.24628E?24 S100a9 ?0.788616203 9.108492579 112.2912902 3.08488E?26 2.12196E?24 Nkg7 ?0.352273992 11.35660318 112.1715336 3.27696E?26 2.24406E?24 Wsb1 ?0.434373342 9.210910529 110.9196712 6.16175E?26 4.2009E?24 Cox7a2 ?0.244165019 9.904372175 110.9093932 6.19378E?26 4.20413E?24 Erh ?0.267511865 9.871191334 110.0778456 9.42172E?26 6.3671E?24 Cks1b ?0.63195329 9.374265449 109.9305553 1.01484E?25 6.82826E?24 Ube2l6 ?0.474836411 9.105066783 108.9541719 1.66082E?25 1.1126E?23 Capza1 ?0.321589878 9.49698091 108.9198525 1.68982E?25 1.12713E?23 Pik3ip1 0.517288658 9.141032834 108.454519 2.13698E?25 1.41925E?23 S100a10 ?0.239806506 11.56390824 107.633748 3.23332E?25 2.13816E?23 Cd160 0.699025169 9.159417004 107.4577704 3.53355E?25 2.32671E?23 Rbx1 ?0.227759516 9.906193708 107.2191678 3.98563E?25 2.61322E?23 Gzma 1.120093335 10.5303845 106.7164441 5.13647E?25 3.3535E?23 Camp ?0.466568955 9.07752253 106.5101125 5.70009E?25 3.70578E?23 Ctsb ?0.318746012 9.577536052 106.4526506 5.86779E?25 3.79878E?23 Vcp ?0.290019259 9.600777235 105.6169585 8.94588E?25 5.76729E?23 Ppp1ca ?0.179862972 10.60111574 105.4922694 9.52689E?25 6.11626E?23 Ran ?0.290507861 10.03079907 105.213453 1.09663E?24 6.98217E?23 Zbp1 ?0.425278438 9.318275709 105.2157644 1.09535E?24 6.98217E?23 H2-D1 ?0.124251699 12.15670663 104.0015903 2.02154E?24 1.2818E?22 Myc 0.512412291 9.116237101 103.4698379 2.64389E?24 1.66955E?22 Atp8a2 0.33886315 9.069620419 101.2967204 7.91868E?24 4.98004E?22 Use1 0.333960173 9.51419359 100.7604386 1.03809E?23 6.502E?22 Iigp1 ?0.614742376 9.132296579 100.6538941 1.09546E?23 6.83355E?22 Eif4g2 ?0.258455174 9.738725432 100.5005074 1.18367E?23 7.354E?22 Cdk1 ?0.677159182 9.209723077 100.3484505 1.27812E?23 7.90893E?22 Pttg1 ?0.428228606 9.427760824 100.0562925 1.48127E?23 9.12934E?22 Tomm7 ?0.264886375 9.683676151 99.52716681 1.93491E?23 1.18777E?21 Ubl5 ?0.217789014 9.954866528 98.70357382 2.93272E?23 1.79315E?21 Gnb1 ?0.310852241 9.598111237 98.56239704 3.14943E?23 1.91804E?21 Hnrnpl ?0.318458149 9.458965323 98.41828059 3.38718E?23 2.05471E?21 Tecpr1 0.380153257 9.37320746 98.26258599 3.66424E?23 2.21406E?21 Hprt ?0.296022775 9.583675978 97.63539867 5.02967E?23 3.02723E?21 Tmem176b 0.699466756 9.197393426 97.44004885 5.55118E?23 3.32812E?21 Ywhaq ?0.251767896 9.876197724 97.04439604 6.77901E?23 4.04849E?21 Tmem234 0.291933521 9.600002857 96.25813041 1.0084E?22 5.99902E?21 Cd3g ?0.157389506 10.99201317 95.96100216 1.17169E?22 6.94361E?21 Arpc5 ?0.208198677 10.28464975 95.71542866 1.32643E?22 7.83049E?21 Lockd ?0.440867625 9.277369705 95.06964861 1.83803E?22 1.08093E?20 Ctsd ?0.266169224 10.13340333 94.71984408 2.19329E?22 1.28495E?20 Atp5j2 ?0.19242437 10.13808543 94.60218126 2.32762E?22 1.35848E?20 Pyhin1 ?0.418379849 9.287028936 92.6509167 6.23817E?22 3.62708E?20 Tox ?0.508928639 9.127330992 92.52335084 6.65351E?22 3.85403E?20 Gnai2 ?0.206265604 10.42766401 92.48466885 6.78484E?22 3.91538E?20 ler2 0.319611087 9.601826126 92.17549933 7.93207E?22 4.56035E?20 Erdr1 0.464102541 9.15671915 91.25689209 1.2618E?21 7.22743E?20 Polr2k ?0.3265931 9.353097422 91.23516042 1.27573E?21 7.28017E?20 Hspa5 ?0.281941206 9.834386077 90.86640181 1.53708E?21 8.73921E?20 Calr ?0.270251962 9.906445352 90.85450983 1.54634E?21 8.75957E?20 Hnrnpc ?0.276698646 9.578766056 90.02748793 2.34874E?21 1.32562E?19 Ccnb1 ?0.644827058 9.19263149 88.81860324 4.32727E?21 2.43338E?19 Ubc ?0.215315232 10.26377247 88.71348916 4.56343E?21 2.55685E?19 Gltp ?0.291647317 9.558026501 88.50731529 5.06472E?21 2.82744E?19 Lyz2 ?0.428623551 9.078273475 88.19924611 5.91825E?21 3.292E?19 Usmg5 ?0.24683068 9.690988814 87.30309401 9.31021E?21 5.16014E?19 Top2a ?0.71236757 9.359267312 86.94889885 1.11362E?20 6.15004E?19 Prc1 ?0.564899799 9.171688394 86.75767354 1.22667E?20 6.75019E?19 Mcm4 ?0.46256567 9.182537346 86.62660008 1.31072E?20 7.18705E?19 Fkbp5 0.406142801 9.186149988 86.58136614 1.34105E?20 7.32726E?19 Nebl 0.450513843 9.267107621 86.56702713 1.35081E?20 7.3545E?19 Ube2c ?0.742287675 9.351481647 86.45041123 1.43285E?20 7.77374E?19 Serinc3 ?0.415468602 9.341672534 86.3641674 1.49672E?20 8.06347E?19 Zfos1 0.384189119 9.321085288 86.37049565 1.49194E?20 8.06347E?19 Atp5b ?0.177130163 10.37817024 86.3041995 1.54281E?20 8.28277E?19 Hn1 ?0.246470949 9.902695291 85.15461992 2.75922E?20 1.47618E?18 Sumo2 ?0.192747248 10.32612922 85.14414532 2.77388E?20 1.47889E?18 Kpna2 ?0.504832734 9.174376154 84.76049621 3.36786E?20 1.78938E?18 Nrp1 ?0.485433003 9.201842589 84.64158269 3.57663E?20 1.89377E?18 Cd48 ?0.2378112 10.47381146 84.55076715 3.74475E?20 1.976E?18 Sec11c ?0.261864887 9.668953903 84.28019512 4.29395E?20 2.25806E?18 Psma1 ?0.24204948 9.631502029 84.05535049 4.81115E?20 2.52143E?18 Pdia6 ?0.351868353 9.419021935 83.95203204 5.06926E?20 2.6477E?18 Il2rg ?0.24963658 9.757825523 83.84407232 5.35379E?20 2.78686E?18 Gstp1 ?0.388378062 9.150648089 83.63583556 5.94849E?20 3.08601E?18 Phf11b ?0.316529852 9.423111324 83.42271577 6.62563E?20 3.42576E?18 Lsp1 ?0.184489544 10.86029924 83.39875856 6.70641E?20 3.45593E?18 Eif1 ?0.129281955 11.09222913 83.30726216 7.02411E?20 3.60758E?18 Cd82 ?0.251979593 9.997069085 83.03896084 8.0452E?20 4.11829E?18 Cox6a1 ?0.18589785 10.09965413 82.98347132 8.27424E?20 4.2215E?18 Mcm6 ?0.434741928 9.318941361 82.92037214 8.54262E?20 4.34405E?18 Klrg1 ?0.66112222 9.201832156 82.30022292 1.16909E?19 5.92544E?18 Tpx2 ?0.545063238 9.154537098 82.14046294 1.26751E?19 6.40321E?18 Gm4955 ?0.422636634 9.199318312 82.10881749 1.28797E?19 6.48529E?18 Birc5 ?0.689978042 9.419044284 82.03479723 1.33712E?19 6.71085E?18 Bcl2a1d ?0.405058381 9.237077308 81.62305429 1.64682E?19 8.21171E?18 Arpc3 ?0.180051392 10.13466789 81.62580935 1.64452E?19 8.21171E?18 Pim1 0.390466534 9.465218659 80.9601044 2.30321E?19 1.14477E?17 Ly6c1 0.593973796 9.127161031 80.76900017 2.53707E?19 1.25695E?17 Irf9 ?0.394471258 9.19085953 80.46333485 2.96149E?19 1.46252E?17 H2-Ke6 0.382623802 9.247819067 80.1878396 3.40456E?19 1.67596E?17 Rrm2 ?0.775593179 9.444956821 80.1075085 3.54582E?19 1.73994E?17 Gm12840 0.522105321 9.292404221 80.07311968 3.60808E?19 1.76486E?17 Reep5 ?0.24357654 9.869875747 80.00448864 3.7356E?19 1.82146E?17 Ghitm ?0.274937749 9.459227183 79.78746135 4.1693E?19 2.02652E?17 Ltf ?0.187637988 9.059775685 79.75490723 4.23857E?19 2.05371E?17 Gbp4 ?0.389063896 9.207766155 79.50041075 4.82125E?19 2.32871E?17 Glrx ?0.340129563 9.454384182 79.40690341 5.05492E?19 2.43394E?17 Kif20a ?0.451598251 9.112260701 79.35667874 5.18507E?19 2.48883E?17 Psmb2 ?0.226426476 9.718811454 79.29191389 5.35785E?19 2.56378E?17 mt-Atp6 0.121761131 12.70239722 78.91658426 6.47886E?19 3.0906E?17 Smc4 ?0.3872419 9.525409897 78.88407307 6.58636E?19 3.13218E?17 Gpr183 0.431381035 9.245014018 78.76805609 6.98474E?19 3.31141E?17 Ifit1 ?0.619753615 9.092845233 78.68290656 7.29238E?19 3.44666E?17 Mad2l1 ?0.454685107 9.179564856 78.45025661 8.20383E?19 3.86558E?17 Ccna2 ?0.640701651 9.236667297 78.27864952 8.94838E?19 4.20356E?17 Tacc3 ?0.502848596 9.173056684 77.6145441 1.25244E?18 5.86555E?17 Hnrnpk ?0.164547584 10.2842712 77.29445282 1.47279E?18 6.8766E?17 Klrc1 ?0.449082904 9.467992396 77.21304596 1.53476E?18 7.1443E?17 H2afx ?0.539317748 9.440262415 76.90569528 1.79319E?18 8.32214E?17 Lcn2 ?0.206390753 9.061453383 76.82683074 1.86625E?18 8.63518E?17 Rpa3 ?0.380997971 9.230128239 76.68099999 2.00927E?18 9.26912E?17 Rpl35 ?0.158961239 11.13831905 76.53702308 2.16123E?18 9.94037E?17 Fkbp2 ?0.362439923 9.306762226 76.51376299 2.18684E?18 1.00282E?16 Slc25a5 0.166065043 10.50386566 76.50621506 2.19521E?18 1.00367E?16 Cks2 ?0.49697529 9.402047794 76.41366059 2.30054E?18 1.04872E?16 Atp5e ?0.167024801 10.21622649 76.28704667 2.45288E?18 1.11486E?16 Banf1 ?0.308953202 9.400476146 75.55734849 3.54946E?18 1.60853E?16 Emb 0.269409659 9.697311771 75.23259584 4.18402E?18 1.89054E?16 Gbp2 ?0.415666499 9.261598091 74.89491319 4.96447E?18 2.23663E?16 Cenpe ?0.487374968 9.137306059 74.4729421 6.14751E?18 2.76154E?16 Nusap1 ?0.72741448 9.229804121 74.10995709 7.38847E?18 3.30935E?16 0610010K14Rik ?0.344310005 9.213495182 73.8659897 8.36044E?18 3.73385E?16 Cdc20 ?0.647281342 9.224041274 73.85642712 8.40104E?18 3.74113E?16 Capza2 ?0.218860051 9.723851677 73.74804301 8.87522E?18 3.94091E?16 Gramd3 0.340204113 9.380450868 73.42778822 1.04386E?17 4.62178E?16 Sept7 ?0.235753818 9.711512245 73.25364665 1.14014E?17 5.03362E?16 Actn2 0.525915728 9.209592958 73.0212856 1.28259E?17 5.64633E?16 Fbxo5 ?0.558938262 9.177037636 72.85443826 1.39573E?17 6.12691E?16 Kif22 ?0.493813608 9.15961124 72.47963983 1.68764E?17 7.38727E?16 Xaf1 ?0.393829891 9.158800712 72.38895324 1.767E?17 7.71274E?16 2700094K13Rik ?0.315350601 9.485438786 71.71621114 2.48483E?17 1.08153E?15 Ranbp1 ?0.272803989 9.7032701 71.66786291 2.54646E?17 1.10524E?15 Ssbp2 0.400331997 9.148764243 71.61265527 2.61872E?17 1.1334E?15 S100a8 ?0.942163941 9.144819806 71.51122989 2.75685E?17 1.18985E?15 Rbbp7 ?0.324552015 9.3940054 71.46912886 2.8163E?17 1.21211E?15 Rpl22 0.157903002 10.51485597 71.45778022 2.83255E?17 1.21571E?15 Rbbp4 ?0.279482571 9.494526185 71.18615873 3.25061E?17 1.39126E?15 Emp3 ?0.193585605 10.48526769 71.03770835 3.50462E?17 1.49582E?15 Rpl31 0.137375726 10.8998412 70.82973716 3.89423E?17 1.65752E?15 Dek ?0.326257475 9.575932497 70.56532173 4.45276E?17 1.89003E?15 Pdcd1 ?0.412579078 9.161776078 70.07124061 5.72009E?17 2.42129E?15 Pde2a 0.378065671 9.096741072 69.85305389 6.38911E?17 2.69708E?15 Timp2 0.426434752 9.155914851 69.76664138 6.67523E?17 2.81016E?15 Car5b ?0.401522657 9.137375624 69.60125161 7.25908E?17 3.04763E?15 Spc25 ?0.494263147 9.140489027 69.5855285 7.31718E?17 3.06367E?15 Nap1l1 ?0.297646823 9.452697682 69.31010443 8.41374E?17 3.51325E?15 Ifng ?0.470155564 9.195873407 69.27531811 8.56346E?17 3.5661E?15 Plscr1 ?0.366671337 9.165831717 69.15277185 9.11242E?17 3.78448E?15 Ncapg ?0.441222811 9.11714452 69.07600109 9.47412E?17 3.92412E?15 Capzb ?0.165768529 10.32096611 68.88018602 1.04631E?16 4.32212E?15 Mrps21 ?0.244713874 9.534978075 68.45138093 1.30045E?16 5.35756E?15 Ccnb2 ?0.590482352 9.326857307 68.23617077 1.45041E?16 5.95943E?15 Rpl39 0.126575039 11.54192101 68.06484771 1.58206E?16 6.48308E?15

    TABLE-US-00011 TABLE 2B Colon LPL Ctrl vs KO GeneSymbol logFC logCPM LR PValue FDR Hsp90aa1 ?1.296438691 10.855082 1796.189057 0 0 Rpl35 0.579539672 11.07230469 1743.711997 0 0 Dnaja1 ?1.10964182 10.81123241 1596.155309 0 0 Dnajb1 ?2.33531776 10.34134508 2179.594615 0 0 Hsp90ab1 ?0.982797393 11.27051881 2052.383487 0 0 Ubb ?0.694803098 12.95887764 2028.318147 0 0 Hspa8 ?0.737680613 12.41996892 1606.669603 0 0 Hspa1a ?3.015660998 11.06978681 1470.85346 0 0 Gm8730 0.693343323 10.36024832 1323.369049 9.437E?290 1.6608E?286 Malat1 ?0.593417954 14.67213889 1137.684854 2.1302E?249 3.374E?246 Hspe1 ?1.038624464 10.30562386 1074.381316 1.2219E?235 1.7594E?232 Rbm3 0.546053782 10.66488443 928.3699119 6.678E?204 8.8144E?201 Gm10076 0.869179815 9.517410456 890.0933345 1.3977E?195 1.703E?192 Chchd2 ?0.492618776 10.4561239 823.1952025 4.8876E?181 5.5296E?178 Hsph1 ?1.267762622 9.425286154 757.4238333 9.7545E?167 1.03E?163 Jund ?0.668130275 11.8228244 748.5293847 8.3785E?165 8.2942E?162 Rplp0 0.268693712 12.37075798 671.3237314 5.1491E?148 4.7975E?145 Hspa1b ?1.599727007 9.248134998 620.7646715 5.0985E?137 4.4864E?134 Ddx5 ?0.386151289 11.1817586 603.7799595 2.5213E?133 2.1019E?130 H2-D1 ?0.247894687 12.34520231 546.2254928 8.3388E?121 6.6039E?118 H2-K1 ?0.323864629 11.66121845 544.5044601 1.9747E?120 1.4894E?117 Hspd1 ?0.837182162 9.767644293 537.1408453 7.8966E?119 5.6852E?116 Fosb ?1.164635491 9.364618516 517.7187705 1.327E?114 9.1381E?112 H2-Q7 ?0.422171081 10.64378871 516.4435666 2.5136E?114 1.6589E?111 Eef2 0.274087183 11.28374076 505.1485441 7.2071E?112 4.5661E?109 mt-Co1 0.272956043 12.17896251 503.0154954 2.0983E?111 1.2783E?108 Eno1 0.551566329 9.902385531 499.021854 1.5517E?110 9.1025E?108 Rpl32 0.22194434 12.42741546 492.9658819 3.2246E?109 1.8241E?106 Rgcc ?1.118136609 9.550274028 486.3554888 8.8475E?108 4.8323E?105 Rpl6l 0.478179424 10.15590832 484.5969007 2.1354E?107 1.1274E?104 Fth1 ?0.335462508 11.63346883 472.0661866 1.138E?104 5.8146E?102 B2m ?0.19628426 12.80490735 466.5540764 1.8015E?103 8.9168E?101 Rpl29 0.283720025 11.21054861 459.7879827 5.346E?102 2.5659E?99 Arhgdib 0.386013595 10.67695562 447.048832 3.165E?99 1.47443E?96 Lmna ?0.94001507 9.757618312 441.2087912 5.90701E?98 2.67317E?95 Crem ?0.759239846 10.12298761 430.3980194 1.33125E?95 5.85713E?93 Ubald2 ?0.477416083 10.61574622 420.040934 2.39076E?93 1.02344E?90 Eif1 ?0.24664365 11.86551627 418.9616487 4.10635E?93 1.71159E?90 Odc1 ?0.632215319 10.52031093 405.1128919 4.24561E?90 1.72426E?87 Rpl3 0.197968255 12.08615037 391.114481 4.73428E?87 1.87466E?84 Gm2000 0.620129441 9.580454828 389.15096 1.26682E?86 4.89394E?84 Gm11808 0.472407768 10.12797784 386.6017314 4.54666E?86 1.71463E?83 Hspa5 ?0.400182424 11.01753787 383.96611 1.70407E?85 6.27694E?83 Coro1a 0.372189609 10.69909524 376.690267 6.53959E?84 2.3541E?81 Prr7 ?0.593803345 9.822329769 370.3859824 1.54225E?82 5.42837E?80 Rps11 0.197413243 12.24071835 370.1436999 1.74143E?82 5.9962E?80 Limd2 0.478902583 9.998680235 369.6083445 2.27756E?82 7.67538E?80 Bin2 0.616456928 9.522717136 361.9853895 1.04058E?80 3.43369E?78 Rpl22l1 0.33367178 10.80916121 354.53505 4.361E?79 1.40967E?76 Eif2s3y 0.846852212 9.189708727 353.9086731 5.97013E?79 1.89122E?76 Cd52 0.329531615 11.76968202 350.1895093 3.85364E?78 1.19682E?75 Gm9493 0.397130464 10.27648549 349.5148795 5.40483E?78 1.64629E?75 Cdkn1a ?0.794410975 9.655752351 348.30647 9.90677E?78 2.96063E?75 Junb ?0.439739713 11.78308969 344.4692692 6.78518E?77 1.9902E?74 Rpl27-ps3 0.564371664 9.812969165 341.4961833 3.01322E?76 8.67752E?74 Slc25a5 0.356515832 10.33629693 334.2365652 1.14835E?74 3.24799E?72 Klf2 0.966338109 9.87646467 331.2250796 5.19954E?74 1.44483E?71 Rac2 0.275882336 11.06163595 325.2530092 1.03923E?72 2.83799E?70 Rpl15 0.276369843 10.68387878 321.477891 6.90219E?72 1.85295E?69 Gm9844 0.5647633 9.461659088 318.7422393 2.72189E?71 7.18533E?69 Ptprcap 0.476661033 9.942632577 318.6711031 2.82076E?71 7.32426E?69 Rpl24 0.194887307 11.7645521 317.3192251 5.55699E?71 1.41963E?68 Fus ?0.428773907 9.866010533 316.630995 7.84794E?71 1.97307E?68 Rpl13-ps3 0.525225173 9.582684681 312.3660701 6.66497E?70 1.64948E?67 S100a6 0.525962148 11.03347261 310.3419701 1.83962E?69 4.48274E?67 Eif3f 0.27112225 10.61842693 309.6198908 2.64259E?69 6.34181E?67 H2-Q6 ?0.488240508 9.705178604 307.3949645 8.06718E?69 1.90711E?66 Eif5 ?0.462609431 9.797249973 305.4905297 2.09703E?68 4.88455E?66 Apobec3 0.625969666 9.401539187 304.9819365 2.70648E?68 6.21274E?66 Gm9843 0.405097402 10.47924093 303.2731905 6.37773E?68 1.4431E?65 H1f0 0.85409956 9.356160563 303.2280563 6.52377E?68 1.45535E?65 Cnn2 0.459644323 9.811452628 296.4205581 1.98439E?66 4.36538E?64 Sertad1 ?0.717279998 9.235302519 293.8116324 7.34606E?66 1.59389E?63 Lsp1 0.381730916 10.25962615 291.7842784 2.03134E?65 4.34789E?63 Rpl9-ps6 0.500123891 9.813279691 290.7553132 3.40393E?65 7.18865E?63 Rpl10-ps3 0.553256709 9.514158932 289.0389389 8.05312E?65 1.67833E?62 Ubc ?0.375514664 10.9972925 286.6902384 2.6166E?64 5.38238E?62 Zfp3612 0.599554856 9.691467426 281.0413259 4.45323E?63 9.0429E?61 Pycard 0.595529185 9.493681974 279.3579798 1.03634E?62 2.0778E?60 Gm10073 0.522116351 9.637520171 278.0697639 1.97803E?62 3.91625E?60 Rgs2 ?0.635850555 10.09899367 276.0893809 5.34329E?62 1.04484E?59 Rpl23a-ps3 0.343715493 10.69786568 274.1111792 1.44185E?61 2.78506E?59 S100a4 0.738831043 9.845301206 271.3430121 5.78373E?61 1.10372E?58 Epsti1 0.443939453 9.867770305 266.4193722 6.84401E?60 1.2905E?57 Ifrd1 ?0.474596587 10.00161652 262.3022178 5.40376E?59 1.00694E?56 Cacybp ?0.560229675 9.442844244 260.8502655 1.1199E?58 2.06257E?56 Uba52 0.356717075 10.18138302 260.7323335 1.18819E?58 2.16319E?56 Arf4 ?0.398360184 9.945640276 259.6927564 2.00211E?58 3.60357E?56 Mat2a ?0.579951827 9.446706214 253.6395059 4.17847E?57 7.43626E?55 Cd7 0.9863336 9.31700291 253.534729 4.40411E?57 7.75074E?55 Lcp1 0.350365569 10.21732737 253.1792183 5.26452E?57 9.16315E?55 Gm10020 0.626059668 9.179717204 250.3467675 2.18193E?56 3.75648E?54 Saraf ?0.367375045 10.20218079 248.9026846 4.50471E?56 7.67205E?54 Pglyrp1 0.745685753 9.248613864 248.7407525 4.88618E?56 8.23322E?54 Hmha1 0.4442368 9.65919282 245.5542415 2.4193E?55 4.03361E?53 Tbc1d10c 0.555749736 9.412018375 245.2494518 2.8193E?55 4.65155E?53 Il21r ?0.437344694 10.2017939 235.2828562 4.20044E?53 6.85885E?51 Got1 ?0.578693665 9.873061625 227.775993 1.82126E?51 2.94356E?49 Id2 ?0.428153652 10.67713064 227.1293055 2.52005E?51 4.03183E?49 Gzma 1.097864847 10.4314706 224.6382402 8.80465E?51 1.39457E?48 Ass1 0.551203488 9.461406247 224.0954108 1.1564E?50 1.81348E?48 Atf3 ?0.847490224 9.233159259 220.5128652 6.99061E?50 1.08553E?47 Gnai2 0.343784913 10.10321215 218.455168 1.96497E?49 3.02167E?47 Vgll4 ?0.495246625 9.708628848 217.328475 3.46041E?49 5.21994E?47 Gm10036 0.488692316 9.447957927 217.3445053 3.43266E?49 5.21994E?47 Vps37b ?0.356521425 10.62817923 213.0553128 2.96009E?48 4.42311E?46 Ctla4 ?0.425992423 10.1474776 212.5306436 3.85271E?48 5.70309E?46 Pfn1 0.240155328 12.08589684 211.5092731 6.43562E?48 9.43832E?46 Gm6133 0.385457869 9.838579615 210.5516257 1.04116E?47 1.51293E?45 Rgs10 0.482419062 9.543994531 209.2301427 2.02222E?47 2.91181E?45 Dgat1 ?0.509721261 9.781782774 202.6225445 5.59181E?46 7.97916E?44 Calm2 ?0.288834956 10.41747073 201.1940212 1.14623E?45 1.621E?43 Klf4 ?0.805778426 9.163911069 198.5381953 4.35348E?45 6.10219E?43 Gstp1 0.560007281 9.167288045 197.5281815 7.23193E?45 1.00479E?42 Clic1 0.288038175 10.28204409 197.2507071 8.31399E?45 1.14509E?42 Hmgb2 0.354889486 10.66675652 196.7520978 1.06813E?44 1.45846E?42 Il7r 0.473145073 9.661302261 195.7526991 1.76497E?44 2.38934E?42 Gm10250 0.518735292 9.261259604 193.764279 4.79415E?44 6.43513E?42 Cd48 0.460544257 9.63721787 192.5550895 8.80297E?44 1.17168E?41 Nmrk1 ?0.588456161 9.417758277 192.2468691 1.02779E?43 1.35659E?41 Rps18-ps3 0.492924084 9.426467835 191.4030749 1.57064E?43 2.05598E?41 Gmfg 0.288142784 10.16792471 190.062755 3.08058E?43 3.99946E?41 Cd160 0.772172194 9.171269402 187.9194935 9.04635E?43 1.16492E?40 Fos ?0.848606018 9.403276926 187.6453713 1.03827E?42 1.32623E?40 Calr ?0.332836814 10.00618833 187.4552473 1.14239E?42 1.44755E?40 Ltb 0.435310874 10.06047948 187.4344179 1.15441E?42 1.45117E?40 Sptssa 0.443750066 9.506220885 187.1311408 1.34451E?42 1.67683E?40 Rps19 0.163786035 12.56834608 186.4521678 1.8914E?42 2.34046E?40 Nop56 ?0.471203711 9.397440468 185.7941949 2.63281E?42 3.23265E?40 Cox4i1 0.202013585 10.64833002 185.2586938 3.44606E?42 4.19863E?40 Cnbp ?0.263558911 10.22998911 181.685277 2.07714E?41 2.51143E?39 Lck 0.257552685 10.24063704 179.7802094 5.41265E?41 6.49477E?39 AY036118 0.563399136 9.204622057 178.8367065 8.69799E?41 1.03585E?38 Itgae 0.682063184 9.148814961 178.4772671 1.04208E?40 1.23176E?38 Phlda1 ?0.673473912 9.377283171 178.2435364 1.17203E?40 1.37509E?38 Stat3 ?0.443604694 9.594221317 177.9403458 1.36502E?40 1.58975E?38 Cd47 0.266539976 10.2319394 176.5081391 2.80463E?40 3.24252E?38 Rpl18 0.144665747 11.79456362 175.0801355 5.75052E?40 6.60018E?38 Nr3c1 ?0.516138019 9.401251838 174.75596 6.7686E?40 7.7128E?38 Lrrc58 0.46964707 9.349073684 171.1319595 4.18736E?39 4.7374E?37 Isg15 ?0.670410352 9.423880415 169.027457 1.20665E?38 1.35548E?36 Dnaja4 ?0.644926354 9.231175487 168.0185211 2.00427E?38 2.23561E?36 Gramd1a 0.466406544 9.358991876 166.9212357 3.48044E?38 3.85502E?36 Satb1 0.439489127 9.719193943 166.7565659 3.78098E?38 4.15881E?36 Pitpna 0.435855152 9.418669714 166.5808975 4.13025E?38 4.51165E?36 Lmnb1 ?0.393042571 9.763928547 164.0771622 1.45514E?37 1.57863E?35 Rab8a 0.415127367 9.432790068 164.0612625 1.46683E?37 1.58048E?35 Rpl36-ps3 0.441944981 9.423156321 163.8405856 1.63903E?37 1.75409E?35 Dnajb6 ?0.293570643 10.00275021 162.2193209 3.70488E?37 3.93836E?35 Zyx 0.538469116 9.22950728 162.1601301 3.81685E?37 4.03034E?35 Gm42418 0.493993592 9.306589985 161.57956 5.11145E?37 5.3616E?35 Rpl13a 0.119258065 13.13921041 161.206428 6.16686E?37 6.42612E?35 Tpt1 ?0.145383512 11.80754119 160.7269708 7.84903E?37 8.12554E?35 Bag3 ?0.659792855 9.118691017 159.9745004 1.14609E?36 1.17876E?34 Ccnd2 ?0.396544062 9.784153549 159.2696002 1.63393E?36 1.66967E?34 Arhgap9 0.438276791 9.35894319 157.7278258 3.54905E?36 3.60343E?34 Glipr2 0.446096284 9.423554685 157.1318986 4.78992E?36 4.83233E?34 Fam110a ?0.472890454 9.453583185 157.1015845 4.86354E?36 4.87554E?34 Selplg 0.274720161 10.17793864 156.6736327 6.03206E?36 6.00892E?34 Cycs ?0.32552726 9.75607587 156.6281029 6.17184E?36 6.10974E?34 Il4ra ?0.452891333 9.452897121 156.4370671 6.79453E?36 6.68439E?34 Emp3 0.353071287 9.834646436 156.2537044 7.45123E?36 7.28518E?34 Rpl4 0.134730304 11.68362122 155.6700537 9.99467E?36 9.712E?34 Hnrnpa3 0.266912928 10.08163683 155.1519983 1.29711E?35 1.25274E?33 Rpsa 0.151911683 11.60418555 154.4391519 1.85677E?35 1.78238E?33 Sec62 ?0.329708774 9.701018261 152.843486 4.14456E?35 3.95456E?33 BC021614 0.531468977 9.186997015 152.6941588 4.46801E?35 4.23766E?33 Hnrnpf 0.226485212 10.3476999 152.4248087 5.1166E?35 4.82392E?33 Btf3 0.174817152 10.69728489 150.1944197 1.57204E?34 1.47335E?32 Tuba4a ?0.500013194 9.3182479 149.6257279 2.09299E?34 1.95005E?32 Rplp2 ?0.144805547 11.92184821 149.256893 2.51993E?34 2.3341E?32 Gch1 ?0.466693357 9.423417801 148.6833891 3.36316E?34 3.09704E?32 Arpc1b 0.211873522 10.49392739 148.4554378 3.77203E?34 3.45348E?32 Stk17b 0.281362595 10.00322266 148.0916995 4.52987E?34 4.12349E?32 Ppp1ca 0.240424662 10.26494776 148.060095 4.60251E?34 4.16567E?32 Rpl7a-ps5 0.486459932 9.2808747 148.0086319 4.72329E?34 4.25069E?32 Cyp51 ?0.517971726 9.223050414 146.0605091 1.25925E?33 1.12685E?31 Sub1 ?0.214884457 11.18398687 145.3238318 1.82458E?33 1.62357E?31 Actr3 0.249028441 10.16798322 145.0491999 2.0951E?33 1.85387E?31 Ms4a6b 0.294576449 10.12969439 144.501494 2.76025E?33 2.42886E?31 Tubb4b ?0.459637938 9.394536981 144.3920797 2.91655E?33 2.55222E?31 Eif3h 0.208541804 10.26895897 144.1508682 3.29311E?33 2.86591E?31 Coq10b ?0.411794907 9.435490542 144.0065092 3.54134E?33 3.0651E?31 Atp5c1 0.269041545 9.839431013 142.7411254 6.69627E?33 5.76425E?31 Rps18 0.122847279 12.46503118 139.9990592 2.6633E?32 2.28021E?30 Nr4a2 ?0.513897887 9.457054691 139.5805932 3.28798E?32 2.79991E?30 Calm1 ?0.187542883 10.85460141 139.4756112 3.46647E?32 2.93612E?30 Rpl13 0.114773349 12.62813742 138.4213697 5.89437E?32 4.966E?30 Ict1 0.423189272 9.30361635 138.3204015 6.20181E?32 5.19738E?30 Hmgn2 0.550119942 9.341504132 138.1803419 6.65501E?32 5.54783E?30 Lef1 0.504911527 9.197619018 137.0327804 1.18611E?31 9.836E?30 Grk6 0.422500161 9.358866658 136.6318883 1.45146E?31 1.19738E?29 Gm10263 0.500153042 9.186742654 136.3215546 1.69699E?31 1.39267E?29 Gem ?0.660716773 9.293071626 134.6824614 3.8743E?31 3.16314E?29 Klhl6 0.483227269 9.233459769 133.712411 6.31515E?31 5.12952E?29 Cd27 ?0.611171828 9.270411364 133.5494989 6.85521E?31 5.53978E?29 Rpl10a 0.159600898 11.11793653 133.4138158 7.34009E?31 5.90151E?29 Xbp1 ?0.375600558 9.506719641 132.8318821 9.84016E?31 7.87163E?29 Actb 0.349014866 13.2991423 132.5191377 1.15191E?30 9.16838E?29 Shisa5 0.187947346 10.97087 132.4670563 1.18253E?30 9.36503E?29 Dnajc15 0.287104543 9.848245672 132.2517602 1.31799E?30 1.03859E?28 Fmnl1 0.429752574 9.260548258 129.9782686 4.14289E?30 3.24847E?28 Cdkn2d 0.464791922 9.29200856 129.2330519 6.03052E?30 4.70529E?28 Fxyd5 0.182264591 10.89173272 128.760728 7.65071E?30 5.94018E?28 Arpc5 0.249915994 10.04618205 128.6880991 7.93585E?30 6.13151E?28 Tob1 ?0.446983839 9.361751749 128.221138 1.00408E?29 7.72024E?28 Sp100 0.378951326 9.450532416 127.737472 1.28117E?29 9.80309E?28 Cox7a2l 0.233483798 10.08201636 127.107975 1.75936E?29 1.33974E?27 Xist ?0.56767985 9.970373424 126.6271392 2.2417E?29 1.69887E?27 Hist1h1c 0.557306764 9.489015558 126.3156087 2.62273E?29 1.97816E?27 Pgk1 0.418281433 9.112923746 125.3115168 4.35006E?29 3.26543E?27 Actg1 0.182969375 12.14233273 125.146896 4.72632E?29 3.53114E?27 Mtch1 0.458946966 9.20177114 124.5864031 6.26892E?29 4.66166E?27 Atp2b1 ?0.38615604 9.501506429 124.1820724 7.68576E?29 5.68854E?27 Ncl ?0.245541061 10.05061385 123.9476575 8.64954E?29 6.3721E?27 S1pr1 0.528441748 9.211582313 123.7386899 9.61016E?29 7.04701E?27 Slc25a4 0.348268536 9.539790652 123.6240204 1.01819E?28 7.43185E?27 Tmem234 0.309086225 9.603992608 123.5902044 1.03569E?28 7.52492E?27 Ahsa1 ?0.373673862 9.394169648 123.4119192 1.13306E?28 8.19477E?27 Oat ?0.435562041 9.261683421 123.1811798 1.27279E?28 9.16353E?27 Eif4a1 ?0.209870948 10.40687573 123.0223878 1.37884E?28 9.88212E?27 Srsf5 ?0.243227861 10.03951019 121.6337503 2.77639E?28 1.98086E?26 Rasal3 0.417194458 9.277924457 121.128153 3.58228E?28 2.54438E?26 Txn1 ?0.257078553 9.989683557 120.9745987 3.87056E?28 2.73687E?26 Dusp5 ?0.290377017 9.972912538 120.6642471 4.526E?28 3.18611E?26 Mrfap1 ?0.307122783 9.592747399 120.576342 4.73107E?28 3.31572E?26 Srsf2 ?0.297033097 9.8103015 120.5673514 4.75256E?28 3.31611E?26 Sfn ?0.630910469 9.178735424 120.3008256 5.43595E?28 3.77632E?26 Rps12-ps3 0.308504409 9.879369687 120.1649948 5.82119E?28 4.02373E?26 Ccdc85b 0.376786261 9.099879984 120.1576082 5.84291E?28 4.02373E?26 Eif3e 0.216240052 10.08436298 119.78202 7.06084E?28 4.84141E?26 Smox ?0.474515311 9.123010044 119.5466722 7.95026E?28 5.42777E?26 Prelid1 0.300888669 9.653107806 119.1448432 9.73547E?28 6.61803E?26 Socs1 ?0.469790829 9.336838521 117.5893552 2.13272E?27 1.4436E?25 Gpi1 0.268069428 9.724725928 117.3315071 2.42881E?27 1.63702E?25 Gm8186 0.400557572 9.271352225 117.0049248 2.86356E?27 1.92186E?25 Gm26917 0.355608704 9.439877032 116.7023452 3.33552E?27 2.22917E?25 Kdm6b ?0.474669899 9.658683083 116.14973 4.40733E?27 2.9331E?25 Morf4l2 ?0.385016023 9.334072103 115.2078964 7.08649E?27 4.69635E?25 mt-Atp6 0.13109516 12.41359392 114.2993627 1.12049E?26 7.39475E?25 Rps21 ?0.181566483 10.91649475 114.161468 1.20118E?26 7.8944E?25 Traf1 ?0.259615851 10.09188115 113.4484171 1.72101E?26 1.12641E?24 Hmgb1 0.245489958 10.23428059 113.378642 1.78265E?26 1.16195E?24 Rps27 ?0.126585153 13.17754164 113.3397676 1.81794E?26 1.1801E?24 Gimap4 0.215414428 10.44074796 113.191718 1.95888E?26 1.2664E?24 Gnb2 0.258833488 9.763400839 112.9354823 2.22912E?26 1.43524E?24 Itgb7 0.274275587 9.895610202 112.219657 3.19837E?26 2.05097E?24 Kcnab2 0.416180538 9.204098465 110.340368 8.25308E?26 5.27099E?24 Rps6 0.103817085 12.19422287 109.8318232 1.06667E?25 6.78514E?24 Itpkb ?0.372082819 9.445651895 108.7449466 1.84571E?25 1.16937E?23 Kxd1 0.377030142 9.31810604 108.4195949 2.17497E?25 1.37248E?23 Gm5424 0.355390948 9.09348985 108.2876044 2.32474E?25 1.46117E?23 Ctsw 0.281167862 9.869959927 106.8287454 4.85349E?25 3.03852E?23 Qrfp 0.243034806 9.076767353 106.3828523 6.07814E?25 3.79022E?23 Capzb 0.213939408 10.11156981 106.153532 6.82381E?25 4.23853E?23 Tpgs1 0.420110336 9.169815546 105.7409159 8.40342E?25 5.19929E?23 Itga4 0.412518622 9.298709558 105.4396292 9.78336E?25 6.02952E?23 Ankrd11 0.350142771 9.482587467 104.8812954 1.29676E?24 7.96102E?23 Pkp3 0.331642575 9.632608745 104.763521 1.37618E?24 8.41594E?23 Znrf1 0.393356078 9.30009727 104.5615058 1.52389E?24 9.28341E?23 Gpsm3 0.273081602 9.652489804 103.3850532 2.75949E?24 1.67462E?22 Csrp1 ?0.407937762 9.37033353 103.2949394 2.8879E?24 1.74586E?22 Ier5l ?0.547686053 9.138751627 102.9398289 3.45484E?24 2.08065E?22 Vasp 0.227570734 9.975852973 102.8106476 3.68762E?24 2.21243E?22 Rbm39 ?0.167004852 10.64268875 102.3487305 4.65597E?24 2.78286E?22 Pnrc1 ?0.206120221 10.52842542 101.7477551 6.30616E?24 3.75501E?22 Arpc3 ?0.186319393 10.54396257 101.3233979 7.81274E?24 4.63468E?22 Lrch4 0.386196626 9.117920834 101.0593439 8.92685E?24 5.27583E?22 Tnfsf11 ?0.479155286 9.528185643 100.5769031 1.13888E?23 6.70585E?22 Ms4a4b 0.224364573 10.74767447 100.0145775 1.51279E?23 8.8745E?22 Wsb1 ?0.383939877 9.299259433 99.70808238 1.76599E?23 1.03216E?21 Cox17 ?0.255036164 9.759086926 99.34607039 2.12018E?23 1.23038E?21 Rps26-ps1 0.376422445 9.302607157 99.34560267 2.12068E?23 1.23038E?21 Aprt 0.302163807 9.570312455 97.89843718 4.40401E?23 2.54581E?21 Commd8 0.340663528 9.362522227 97.69437133 4.88208E?23 2.8119E?21 Cmtm7 0.347833176 9.445414037 97.66881931 4.94549E?23 2.8381E?21 Cdk2ap1 0.40313369 9.207010836 97.41784043 5.61379E?23 3.21E?21 Nhp2l1 ?0.25771889 9.660380552 97.18476802 6.31506E?23 3.59799E?21 Arhgap15 0.345069342 9.353711095 97.13997149 6.45956E?23 3.66713E?21 Ikzf1 0.364959967 9.314515256 97.12258211 6.51654E?23 3.68627E?21 Mrps6 ?0.445518043 9.167109148 97.06634456 6.70428E?23 3.77897E?21 Pdlim2 0.398459075 9.182597688 96.96123973 7.06979E?23 3.97086E?21 Hspa2 ?0.459505667 9.124122695 96.94098529 7.14248E?23 3.99752E?21 Vim 0.262752919 10.51559022 96.26760304 1.00359E?22 5.59713E?21 Traf4 ?0.411142056 9.288678658 96.17375062 1.05231E?22 5.84825E?21 Coro1b 0.359271007 9.291592437 95.80235442 1.26945E?22 7.03034E?21 Litaf ?0.434433383 9.369696159 95.74269972 1.30828E?22 7.22016E?21 Ier5 ?0.332369309 9.648355931 95.20641105 1.71534E?22 9.43377E?21 Cxcr6 0.285170249 10.38589926 94.75608108 2.15351E?22 1.18026E?20 Gyg 0.404072997 9.169055117 94.60060052 2.32948E?22 1.2723E?20 Gngt2 ?0.414175481 9.266095139 94.22857227 2.81113E?22 1.53009E?20 Srgn ?0.156866717 11.40960169 94.22033317 2.82286E?22 1.53121E?20 Traf3ip3 0.398126336 9.211377897 94.14101487 2.93827E?22 1.58837E?20 Slc25a3 ?0.223869744 9.929245406 93.89114737 3.33362E?22 1.79596E?20 C1d 0.358002392 9.257445341 93.60629381 3.84962E?22 2.06692E?20 Taf10 0.329789291 9.42027031 93.17625006 4.78387E?22 2.55986E?20 Rrad ?0.422165808 9.481942925 92.71155163 6.04994E?22 3.22643E?20 Myo1f 0.386024191 9.211461927 90.89289789 1.51663E?21 8.06104E?20 Hsd11b1 0.410088948 9.207302928 90.62179281 1.73934E?21 9.21385E?20 Ctla2a ?0.340237861 10.39420628 90.54680962 1.80652E?21 9.53783E?20 Tubb5 0.33277636 9.951843603 90.14093695 2.21785E?21 1.16706E?19 Gramd3 0.284054197 10.20990355 90.01056232 2.36892E?21 1.24243E?19 Jun ?0.655178909 9.472386028 89.47089847 3.11182E?21 1.62667E?19 Fam169b 0.401940452 9.20492433 89.45833686 3.13165E?21 1.63165E?19 Fermt3 0.346761961 9.277314729 89.42967881 3.17734E?21 1.65003E?19 Ikzf3 ?0.43554387 9.229056647 89.22703786 3.52005E?21 1.82203E?19 Caprin1 0.362718036 9.222741789 89.18692735 3.59215E?21 1.85329E?19 Bola2 ?0.279074797 9.545437178 89.07835747 3.7948E?21 1.95149E?19 1700097N02Rik 0.426479844 9.138943007 88.54524555 4.96853E?21 2.54682E?19 Akt1 0.388322632 9.186110081 88.23288633 5.81845E?21 2.97285E?19 Set 0.275235713 9.68026491 87.87236611 6.98173E?21 3.55574E?19 Lcn4 0.386003461 9.104970691 87.03518994 1.06607E?20 5.41203E?19 Ptpn6 0.374733064 9.254685928 86.45613527 1.42871E?20 7.20681E?19 Tmem71 0.392168946 9.18300717 86.45911911 1.42656E?20 7.20681E?19 Prkcq 0.385697348 9.187898023 86.1059948 1.70545E?20 8.57544E?19 Rps3a1 0.101927456 11.66239034 86.05600387 1.74911E?20 8.76715E?19 Hilpda ?0.363494493 9.621933344 85.85753408 1.93377E?20 9.66215E?19 Rpl13a-ps1 0.369121872 9.125886702 85.80554006 1.98529E?20 9.88838E?19 Cotl1 0.189250759 10.42452425 85.51065232 2.30457E?20 1.14426E?18 Kpna1 ?0.370106801 9.300870038 85.23248687 2.65268E?20 1.31299E?18 Gabpb1 ?0.35309655 9.443575937 85.20182613 2.69413E?20 1.32936E?18 Fosl2 ?0.360285481 9.496287214 85.06065057 2.89352E?20 1.42331E?18 mt-Nd2 ?0.223466869 9.877039562 84.76700348 3.3568E?20 1.64608E?18 Ctbp1 0.291313018 9.41304975 84.69950904 3.47337E?20 1.69798E?18 Stat4 ?0.316811236 9.451262982 84.38770905 4.06668E?20 1.98191E?18 Lgals1 0.205366044 11.71367544 84.2394234 4.38342E?20 2.12972E?18 Def6 0.357773345 9.254739348 84.07852182 4.75509E?20 2.30324E?18 Plscr1 ?0.37206631 9.476236025 83.60981525 6.02731E?20 2.91056E?18 Gltscr2 0.174676511 10.26087104 83.346365 6.88653E?20 3.31537E?18 Pik3ip1 0.330447087 9.095932723 83.00333665 8.1915E?20 3.93167E?18 Naca 0.132857132 10.78159304 82.76181285 9.2561E?20 4.41914E?18 Lbr 0.318806475 9.348045598 82.76035438 9.26293E?20 4.41914E?18 Ly6e ?0.164934597 10.75197012 82.47918371 1.06789E?19 5.07937E?18 Ubxn4 ?0.283952138 9.497877918 82.09781857 1.29515E?19 6.1419E?18 Maff ?0.449911666 9.211492069 81.93490116 1.40644E?19 6.64972E?18 Slc5a3 ?0.383528621 9.112932121 81.55251603 1.70666E?19 8.04516E?18 Ywhah 0.252414688 9.657038205 81.37024179 1.87155E?19 8.79628E?18 Susd3 0.35903436 9.274618606 81.24943703 1.98952E?19 9.29559E?18 Snhg12 ?0.372153059 9.217070705 81.25063679 1.98832E?19 9.29559E?18 Pim3 ?0.419460628 9.239693094 81.10803033 2.1371E?19 9.95573E?18 Sema4d 0.336007509 9.272910863 81.03992068 2.21204E?19 1.02746E?17 Nrip1 ?0.351147226 9.518465731 80.79922139 2.49856E?19 1.15716E?17 Errfi1 ?0.415709417 9.203060475 80.77279894 2.5322E?19 1.16931E?17 Adora2a ?0.337733868 9.371066602 80.11544679 3.53161E?19 1.62608E?17 Rps15a ?0.091705836 12.40648985 80.05818453 3.63545E?19 1.66904E?17 Tcf7 0.361212693 9.327301692 79.84620757 4.04716E?19 1.85269E?17 Klrb1f 0.310571128 9.09219065 79.5343695 4.73909E?19 2.16318E?17 Rpl23a ?0.093737153 12.18419476 79.4984072 4.82614E?19 2.19659E?17 Atp5l 0.148555301 10.43217254 79.40175043 5.06812E?19 2.30011E?17 Rps27rt 0.194128581 11.15059622 79.12000934 5.84493E?19 2.64508E?17 Hist1h2ap 0.371210153 9.098222032 79.03133498 6.11326E?19 2.75863E?17 Dad1 ?0.188540821 9.987070117 78.99222215 6.23549E?19 2.8058E?17 Pdia6 ?0.305181564 9.433423543 78.96680159 6.31625E?19 2.83408E?17 Dedd2 ?0.361161452 9.208472136 78.60470661 7.58684E?19 3.39458E?17 Capza1 0.275051341 9.421084656 78.45568471 8.18131E?19 3.65025E?17 Whsc1l1 0.286256556 9.465405344 77.97147828 1.04539E?18 4.65111E?17 Dusp14 ?0.490461557 9.164191183 77.49990377 1.32729E?18 5.88878E?17 Pabpc1 0.128653685 10.80961358 77.10286727 1.62282E?18 7.17983E?17 Flt3l 0.342999594 9.248983424 76.47498946 2.2302E?18 9.83958E?17 Arrb2 0.323205878 9.299307513 76.15477607 2.6228E?18 1.15396E?16 mt-Co3 0.113435634 12.04559976 76.05277042 2.76185E?18 1.21177E?16 Sept9 0.288906266 9.423194345 76.02239789 2.80465E?18 1.22715E?16 2810001G20Rik 0.388632897 9.147759194 75.85013039 3.06032E?18 1.33533E?16 1600014C10Rik 0.376989592 9.154287123 75.75980593 3.20356E?18 1.39399E?16 Tmem30a 0.308038318 9.310066934 75.25148409 4.14419E?18 1.79835E?16 Nfkbie ?0.336107134 9.343303521 75.20801706 4.23643E?18 1.83336E?16 Gpx4 ?0.205314323 10.06582643 75.20257186 4.24813E?18 1.83341E?16 Gm42726 0.320348649 9.104150123 75.1172932 4.43564E?18 1.90913E?16 Ramp3 ?0.440634397 9.976673631 75.0436194 4.60429E?18 1.97635E?16 Ifitm3 0.451646848 9.710327146 74.9885843 4.73444E?18 2.02672E?16 Cisd3 0.352850049 9.208350817 74.66564795 5.57579E?18 2.38046E?16 Top1 ?0.28395075 9.452133131 74.61436731 5.72252E?18 2.43653E?16 Sppl3 0.331427267 9.125075068 73.91656836 8.14895E?18 3.46035E?16 Usmg5 ?0.19994212 10.00954642 73.69959983 9.09573E?18 3.85207E?16 Bst2 ?0.31574848 9.349556332 73.67662979 9.2022E?18 3.88676E?16 Gm26740 ?0.290618009 9.614149283 73.6072547 9.53137E?18 4.01509E?16

    TABLE-US-00012 TABLE 2C Small Intestine LPL Ctrl vs KO GeneSymbol logFC logCPM LR PValue FDR Malat1 ?1.270390299 14.65408192 1391.007551 1.8902E?304 2.5698E?300 Dnajb1 ?2.989003621 10.24133724 1248.384643 1.8627E?273 1.2662E?269 Ubb ?0.928036045 12.68983308 1129.213594 1.4776E?247 6.6959E?244 Hsp90aa1 ?1.73334477 10.38503603 848.7603464 1.3523E?186 4.5961E?183 Hsp90ab1 ?1.124878483 10.88661857 744.3402084 6.8242E?164 1.8555E?160 Hspa1a ?3.477661443 10.7136333 610.5048084 8.6886E?135 1.9687E?131 Hspe1 ?1.481859098 10.17562846 609.4431434 1.4787E?134 2.8718E?131 Hspa1b ?2.45826073 9.673476745 541.557568 8.6415E?120 1.4685E?116 Hspa8 ?0.733021848 11.94760636 536.6824715 9.9348E?119 1.5007E?115 Dnaja1 ?1.142985442 10.58020182 500.7270965 6.6034E?111 8.9774E?108 Hsph1 ?1.674119669 9.693521287 391.0098358 4.98925E?87 6.16626E?84 Pfn1 0.556969656 12.36179331 354.5323953 4.36681E?79 4.94723E?76 Ifi27l2a ?1.526203755 10.06603444 308.5419345 4.53792E?69 4.74562E?66 Ddx5 ?0.569218691 11.28301838 295.0912662 3.86588E?66 3.75404E?63 Crip1 1.063247863 11.26439747 275.0510604 8.99683E?62 8.15413E?59 Ubc ?0.684801113 11.25718429 269.2572026 1.6474E?60 1.39978E?57 Jun ?1.621216633 10.08346217 267.8801831 3.28792E?60 2.62937E?57 Lgals1 1.123792206 11.27737133 266.4474621 6.7482E?60 5.09677E?57 Cd52 0.579508154 11.896613 259.9242984 1.78245E?58 1.27539E?55 Hspd1 ?1.123244696 9.873827325 248.7759061 4.80071E?56 3.26328E?53 Cd160 1.612792846 9.910004584 244.9841777 3.2209E?55 2.08515E?52 Rbm3 0.606449645 10.9936177 229.5941443 7.30892E?52 4.51658E?49 S100a6 1.204174767 10.87443069 219.9356841 9.34141E?50 5.52159E?47 Gzma 1.993209068 11.53461012 215.7661412 7.58466E?49 4.29639E?46 Rps29 ?0.33975966 12.45913805 214.1327455 1.72289E?48 9.3691E?46 Slc25a5 0.672711688 10.63606639 207.9571703 3.83322E?47 2.00433E?44 Cd7 1.532985299 10.09719296 198.2226571 5.10148E?45 2.56869E?42 Fos ?1.555883912 9.951733106 191.3239371 1.63437E?43 7.93543E?41 Junb ?0.603167841 12.24822312 187.5138271 1.10924E?42 5.20006E?40 Vim 0.928746254 10.32884884 180.8919276 3.09513E?41 1.40261E?38 S100a4 1.526515304 9.992761306 176.514377 2.79585E?40 1.22611E?37 Klf6 ?0.926855403 10.30217968 170.4261312 5.97167E?39 2.53703E?36 AY036118 ?1.061137817 9.604280179 168.5762641 1.51402E?38 6.23731E?36 Eif4a2 ?0.786277362 10.01209351 167.6815977 2.37437E?38 9.49399E?36 Rplp0 0.305778795 12.4630419 163.5750167 1.87328E?37 7.27635E?35 Zfp36l2 0.955324495 10.26398104 162.744194 2.84515E?37 1.07444E?34 Gm42418 ?1.048481014 9.719045857 160.8447438 7.3975E?37 2.71808E?34 Eif3f 0.463631301 10.85999602 157.5770827 3.8287E?36 1.36977E?33 Gadd45b ?1.017411734 9.987572676 156.6695014 6.04462E?36 2.10709E?33 Dusp1 ?0.925508201 10.28518602 154.6952798 1.63224E?35 5.54759E?33 Ier5 ?0.849926882 9.977632158 153.3008753 3.29244E?35 1.09172E?32 Rpl24 0.336154281 11.8173782 153.1549619 3.54329E?35 1.14693E?32 Itgb7 0.730684655 10.21660441 145.9816063 1.31027E?33 4.1426E?31 Ppp1r15a ?0.850080959 9.962305144 145.3477627 1.80274E?33 5.57004E?31 mt-Nd2 ?0.666229752 10.16694083 142.9422572 6.0514E?33 1.8282E?30 Rps27 ?0.280332283 13.43297512 140.2437348 2.35459E?32 6.95883E?30 Emp3 0.853721822 10.01923353 138.8508125 4.74812E?32 1.37342E?29 Jund ?0.511687126 11.88052936 138.1873795 6.63147E?32 1.87823E?29 Arpc5 0.641891287 10.33312177 137.1516697 1.11718E?31 3.0996E?29 Prkca ?0.936438709 9.803809383 135.1375687 3.08067E?31 8.37635E?29 Tagln2 0.728752002 10.27956689 132.3672087 1.24352E?30 3.31485E?28 Cacybp ?0.820907994 9.761275879 127.6377263 1.3472E?29 3.52215E?27 Itgae 1.141170294 9.754012995 127.2951357 1.60103E?29 4.10679E?27 Cd47 0.621464194 10.28476905 123.8215437 9.21714E?29 2.3205E?26 Rpl23a-ps3 ?0.389746504 10.83309006 119.834953 6.87492E?28 1.69935E?25 H2afz 0.681004033 10.6429052 118.7869428 1.16605E?27 2.83079E?25 S100a10 0.525127377 10.79175384 117.9491163 1.77894E?27 4.24292E?25 Fosb ?1.063020116 9.629543946 117.8377317 1.88169E?27 4.41063E?25 Cox5a 0.592668928 10.24515525 115.5012812 6.11196E?27 1.40234E?24 Rpl38 ?0.268147527 11.78716014 115.4764231 6.18905E?27 1.40234E?24 Ptprcap 0.548197307 10.41240534 109.6451952 1.17198E?25 2.61197E?23 Arhgdib 0.404256062 10.95537113 109.2336833 1.44238E?25 3.16277E?23 Rpl37a ?0.219867372 12.67658574 108.9253496 1.68514E?25 3.63643E?23 Rps27rt ?0.377704095 11.22532454 107.7024833 3.12311E?25 6.63417E?23 Atf3 ?0.833608127 9.564432286 107.484863 3.48557E?25 7.29021E?23 Rpl32 0.234928384 12.53119065 107.2016913 4.02093E?25 8.28252E?23 Rpl29 0.348661409 11.2510885 106.283271 6.39137E?25 1.29688E?22 Zfp36 ?1.069360095 9.720937454 105.7272946 8.46138E?25 1.69165E?22 Nfkbia ?0.548369836 11.02410921 105.552441 9.24194E?25 1.82093E?22 Tnfaip3 ?0.556203662 10.4976442 105.1592788 1.12702E?24 2.18884E?22 Rpl3 0.23946729 12.12971157 103.4841404 2.62487E?24 5.02607E?22 Lcp1 0.476475494 10.58352627 101.648977 6.62859E?24 1.25161E?21 Dnaja4 ?0.883775551 9.627504548 101.2617633 8.05967E?24 1.50097E?21 Fus ?0.583225585 10.0621585 100.5551387 1.15146E?23 2.11543E?21 Eef2 0.30089659 11.36578563 98.60722272 3.07894E?23 5.5811E?21 Gm10073 ?0.587468651 9.971221351 98.04010631 4.09994E?23 7.33404E?21 H2-Q6 ?0.666621999 9.913841776 96.58296852 8.55813E?23 1.51101E?20 Lsp1 0.478483224 10.575597 96.3577739 9.58906E?23 1.67132E?20 Cxcr6 0.682928486 10.4358259 95.40449085 1.55201E?22 2.67084E?20 Rplp1 ?0.248800579 11.77289572 95.07571795 1.83241E?22 3.0755E?20 Itpkb ?0.755356088 9.788344057 95.07750247 1.83076E?22 3.0755E?20 Bag3 ?0.73666804 9.556132624 92.98437325 5.27089E?22 8.73875E?20 H2-Q4 ?0.600298455 10.03136803 92.46838803 6.84088E?22 1.1205E?19 Cd69 ?0.675277132 10.22899337 91.3465498 1.2059E?21 1.95169E?19 Son ?0.580002512 9.985249388 89.75818 2.69123E?21 4.30439E?19 Gm8797 ?0.760754138 9.695703486 89.16169111 3.63827E?21 5.75142E?19 Reep5 0.715048932 9.86923952 89.08940618 3.77366E?21 5.89689E?19 Ermn 0.936240345 9.607995489 88.5867298 4.86542E?21 7.51652E?19 Cyba 0.440199696 10.55096537 86.79334234 1.20474E?20 1.84028E?18 Emp1 ?0.831580324 9.618680989 86.48342872 1.40913E?20 2.12857E?18 Hnrnpf 0.389350328 10.63476331 86.40296267 1.46765E?20 2.1926E?18 Capzb 0.449426755 10.36936752 85.10253926 2.83287E?20 4.18617E?18 Arpc2 0.346828272 10.81151028 84.90559109 3.12957E?20 4.57489E?18 Cd48 0.616642092 10.0606017 83.06747655 7.92997E?20 1.14689E?17 Clic1 0.426604672 10.51946677 82.45485129 1.08112E?19 1.54713E?17 Actn2 0.736387991 10.03167641 81.77982597 1.52123E?19 2.15429E?17 Atp51 0.360702257 10.67458586 80.93617442 2.33127E?19 3.26738E?17 Dedd2 ?0.731727354 9.632338182 79.43149123 4.9924E?19 6.92568E?17 Ltb4r1 0.814916101 9.601858422 78.85441688 6.68598E?19 9.1814E?17 Ctsw 0.566396655 10.24368719 78.62204359 7.52055E?19 1.02242E?16 Prelid1 0.656109752 9.891171439 78.22322584 9.20301E?19 1.23876E?16 Tra2b ?0.488661709 10.19577356 78.08892868 9.85045E?19 1.31291E?16 AA467197 0.877651163 9.704984918 77.24922157 1.50691E?18 1.98897E?16 Pycard 0.6838354 9.919490954 77.04275231 1.67297E?18 2.18693E?16 Rac2 0.29382085 11.24349839 76.89574027 1.80225E?18 2.31148E?16 Pim1 ?0.515291779 11.06070107 76.91273522 1.78681E?18 2.31148E?16 H2-Q7 ?0.386384264 10.55176719 76.55241546 2.14445E?18 2.72465E?16 Sdhb 0.633252714 9.861109849 76.36407516 2.35904E?18 2.96955E?16 Ctla4 ?0.596909051 10.20745116 75.50013879 3.65381E?18 4.55721E?16 Clk1 ?0.544683385 10.07692244 75.47808739 3.69485E?18 4.56649E?16 Gngt2 ?0.726299968 9.753641865 74.79477041 5.22279E?18 6.39674E?16 Ltb 0.532854208 10.5105756 74.55802359 5.8882E?18 7.14732E?16 Nkg7 0.509213128 11.37225605 74.38601574 6.42425E?18 7.729E?16 Maff ?0.79964788 9.685276468 73.36704807 1.07648E?17 1.28375E?15 Uba52 ?0.358108045 10.48612483 72.43979314 1.72206E?17 2.03578E?15 Cyb5a 0.670808798 9.838120266 72.29714293 1.85115E?17 2.16952E?15 Hmgb2 0.48219955 10.90748683 71.21488181 3.20363E?17 3.7225E?15 Ccl5 0.756221662 13.88516502 71.19613316 3.23421E?17 3.7262E?15 Gm9843 ?0.351089612 10.56964271 70.95037373 3.66324E?17 4.18502E?15 Rbm39 ?0.311869482 10.84233663 70.52963247 4.53405E?17 5.1367E?15 Myl12a 0.366072373 10.71572431 70.13817584 5.52925E?17 6.21241E?15 Dnajb4 ?0.770020972 9.617001768 70.05549857 5.76592E?17 6.42522E?15 Gm11808 ?0.372654204 10.38068834 69.90975696 6.20806E?17 6.86167E?15 Fyn ?0.550598359 9.891289908 69.7258551 6.8147E?17 7.47143E?15 Actg1 0.324605067 11.94604458 69.47463064 7.74037E?17 8.41843E?15 Itm2b 0.314557643 11.12684555 69.30828715 8.4215E?17 9.08653E?15 Ap2s1 0.644724334 9.796122343 68.94810314 1.01089E?16 1.08213E?14 Ass1 0.738922713 9.844567328 68.21415472 1.46669E?16 1.55779E?14 Btf3 0.303005054 10.81309008 67.9718735 1.65844E?16 1.74779E?14 Glipr2 0.730000014 9.753269937 67.88661614 1.73173E?16 1.81099E?14 Avl9 ?0.653986116 9.731535525 67.59763449 2.00508E?16 2.08084E?14 Ccr9 0.832857974 9.857154544 66.4667878 3.55839E?16 3.66487E?14 Phlda1 ?0.788431684 9.719239609 66.02764339 4.44643E?16 4.54505E?14 Tcf7 ?0.644655858 9.792717352 65.67511056 5.31732E?16 5.39469E?14 Selplg 0.423459877 10.38010922 65.19224058 6.79365E?16 6.84146E?14 mt-Atp8 ?0.67106869 9.60986082 65.17736304 6.84513E?16 6.84262E?14 Rps15 ?0.216414105 11.50041078 64.92079989 7.79697E?16 7.73721E?14 mt-Nd4 ?0.330338383 10.75014686 64.82286657 8.19427E?16 8.07254E?14 Anxa2 0.722644648 9.881882506 64.73674853 8.56034E?16 8.3725E?14 Cmtm7 0.647790672 9.807118552 64.60455779 9.15434E?16 8.88951E?14 Tnfsf8 0.902577267 10.03565206 64.1198142 1.17078E?15 1.12885E?13 Eno1 0.487848032 10.1319159 64.08709309 1.19039E?15 1.13967E?13 Nfkbiz ?0.574034994 9.90564368 62.46141902 2.71716E?15 2.5832E?13 Fxyd5 0.312416423 10.90172663 62.20646567 3.09271E?15 2.91982E?13 Eif3h 0.357810898 10.43681116 60.86483882 6.1131E?15 5.73156E?13 Epsti1 0.463984054 10.26085662 60.42054667 7.66091E?15 7.13357E?13 Cdc42 0.336991213 10.5652973 59.55545044 1.18896E?14 1.09959E?12 Oas1a ?0.500430515 9.548339965 59.48066541 1.23502E?14 1.13446E?12 Tox ?0.678206587 9.574160554 59.40704481 1.28209E?14 1.1698E?12 Eif1 ?0.213223134 11.84549357 58.9703578 1.60065E?14 1.45072E?12 Rsrp1 0.438310679 10.37261005 58.78113414 1.76223E?14 1.58659E?12 Mbd2 ?0.588160192 9.73972323 58.59763888 1.93448E?14 1.73022E?12 Sumo2 0.349177283 10.46272601 58.53783873 1.99419E?14 1.77196E?12 Rpl13a 0.155012279 13.10930771 58.46581604 2.06854E?14 1.82609E?12 Tm2d2 0.70831406 9.63412223 58.26594334 2.28974E?14 2.00832E?12 Fam101b ?0.645014148 9.557985731 58.10375522 2.48651E?14 2.16693E?12 Cotl1 0.387933321 10.63154185 57.52288348 3.3407E?14 2.87448E?12 Anxa6 0.529264421 9.947806186 57.53218843 3.32493E?14 2.87448E?12 Ppp1ca 0.358071833 10.45650421 57.42631271 3.50882E?14 3.00015E?12 Lat 0.30090055 10.83480524 57.38755335 3.57865E?14 3.04073E?12 Dusp10 ?0.701807188 9.734497108 57.23375587 3.86972E?14 3.26763E?12 Plac8 0.676955079 10.50997571 56.88041406 4.63136E?14 3.88662E?12 Rasgrp1 ?0.606007374 9.755482259 56.82249163 4.7698E?14 3.97824E?12 Ostf1 0.446931969 10.18723338 56.7994366 4.82605E?14 4.00062E?12 Coro1a 0.296036382 11.05941162 56.57479441 5.41009E?14 4.45759E?12 3830403N18Rik 0.585483615 9.565458172 56.42066917 5.85121E?14 4.792E?12 Lncpint ?0.683465689 9.609082259 56.32648915 6.13829E?14 4.99701E?12 Uhrf2 ?0.636453151 9.805742233 56.23935181 6.41644E?14 5.19235E?12 Slc5a3 ?0.573447632 9.553448168 56.14658929 6.72642E?14 5.41099E?12 Dnajc15 0.456892242 10.09941767 55.77454562 8.12771E?14 6.49978E?12 Rpsa 0.216885157 11.60513144 55.21856755 1.07845E?13 8.57401E?12 Arpc1b 0.273302652 10.796252 55.10881601 1.14038E?13 9.01366E?12 Cxcr5 ?0.518113656 9.543138573 54.75402302 1.36599E?13 1.07345E?11 Klf4 ?0.752577219 9.566058556 54.6749753 1.42206E?13 1.11108E?11 Rpl4 0.194418668 11.72659741 54.3921545 1.64217E?13 1.27573E?11 Ifngr1 0.390565787 10.81929358 54.24193902 1.77263E?13 1.36925E?11 Ifng ?0.868111197 9.899362081 54.09247489 1.91272E?13 1.46802E?11 Rps6 0.165515494 12.27313172 54.08288209 1.92208E?13 1.46802E?11 Rhoh ?0.534449576 9.837142269 54.02000635 1.98459E?13 1.50729E?11 Cfl1 0.250192333 11.29422153 53.90728076 2.10177E?13 1.58742E?11 Sptssa 0.543646713 9.96326749 53.71520935 2.31762E?13 1.74078E?11 mt-Cytb ?0.262082792 11.3111964 53.61065466 2.4443E?13 1.82584E?11 Rps16 ?0.163309899 12.29143504 53.35615702 2.78238E?13 2.06702E?11 Bcl2 ?0.704176859 9.768025777 52.18045653 5.06275E?13 3.74066E?11 Txk ?0.607016555 9.712272046 52.10336758 5.26546E?13 3.8694E?11 Acp5 0.578040126 9.78903337 51.61203372 6.76258E?13 4.94287E?11 Tspo 0.428503603 10.1185085 51.38616936 7.58712E?13 5.51588E?11 Ccl20 ?0.810411094 9.550654384 51.08543215 8.84322E?13 6.39487E?11 Rpl22l1 0.261648578 11.13468717 50.8848051 9.79489E?13 7.04558E?11 Ywhah 0.468443163 10.00113273 50.82097896 1.01186E?12 7.24015E?11 Srrm2 ?0.411464931 10.16628193 50.49824308 1.19272E?12 8.45462E?11 Cox4i1 0.260656313 10.85377808 50.49607584 1.19403E?12 8.45462E?11 AW112010 0.291301825 11.71248698 50.43757707 1.23016E?12 8.6653E?11 Pnrc1 ?0.326990414 10.78196761 50.29780369 1.32097E?12 9.25702E?11 mt-Nd1 ?0.2653544 11.28494672 50.0634124 1.48857E?12 1.0378E?10 Saraf ?0.365543292 10.30384933 49.9328995 1.59095E?12 1.10352E?10 Ppib 0.404822673 10.10011401 49.89019449 1.62595E?12 1.12207E?10 Pgls 0.555219426 9.786227624 49.5295049 1.95411E?12 1.34172E?10 Dusp2 0.724800828 9.811340529 49.34390873 2.148E?12 1.46744E?10 Plp2 0.604877901 9.591056513 49.25934175 2.24263E?12 1.52443E?10 Chst12 0.650249975 9.626540055 48.68536907 3.005E?12 2.03249E?10 Ldha 0.363117284 10.40180441 48.62626572 3.09694E?12 2.0843E?10 Fcer1g ?0.360864211 9.537643508 48.33462077 3.59351E?12 2.40659E?10 Actr3 0.317519138 10.50564793 47.9423529 4.38937E?12 2.92517E?10 Lpxn 0.464741167 9.978535981 47.92799909 4.42162E?12 2.93229E?10 Ybx3 0.60013217 9.599423261 47.61601782 5.18432E?12 3.4214E?10 mt-Nd4l ?0.576765365 9.612318145 47.30905404 6.06315E?12 3.98163E?10 Ccnl1 ?0.505607902 9.806469989 47.29981488 6.0918E?12 3.98163E?10 Tmed2 0.388398507 10.11413497 47.23996875 6.28066E?12 4.08543E?10 Hnrnpk 0.324953239 10.40058528 46.9167236 7.4068E?12 4.79502E?10 Gpr171 0.492019928 9.992435057 46.74373012 8.09034E?12 5.21271E?10 Ifi27 ?0.48213806 9.837918078 46.66378408 8.42721E?12 5.40415E?10 Rpl8 0.187142948 11.68698224 46.50058276 9.15912E?12 5.84593E?10 Furin ?0.58250301 10.5517053 46.2400125 1.04618E?11 6.64621E?10 Chd3 ?0.531844197 9.761077098 46.22174406 1.05599E?11 6.67726E?10 Socs3 ?0.606438847 9.77952663 45.945977 1.21559E?11 7.65092E?10 Klrd1 0.740622758 9.641291475 45.83007932 1.28968E?11 8.07981E?10 Atp5f1 0.407703841 10.0510207 45.80329176 1.30744E?11 8.15349E?10 mt-Co1 0.185405435 12.35512272 44.9562193 2.01489E?11 1.2508E?09 Vasp 0.352930373 10.31326066 44.93521323 2.03662E?11 1.25854E?09 Mxd1 ?0.513254014 9.919607654 44.40709369 2.66719E?11 1.64074E?09 Lgals3 0.683541289 10.03825331 44.0922441 3.1326E?11 1.91836E?09 Sh2d1a ?0.486118075 9.853138169 44.01761352 3.25434E?11 1.98398E?09 Srsf5 ?0.338591946 10.31310722 43.5233511 4.1893E?11 2.54257E?09 Ywhae 0.464501426 9.922516842 43.45147215 4.34605E?11 2.61436E?09 Adam8 0.535877549 9.576468918 43.45269502 4.34333E?11 2.61436E?09 Hmgb1 0.323083852 10.55704335 43.41280646 4.43278E?11 2.65478E?09 Cisd3 0.602086754 9.632969394 43.28209301 4.73901E?11 2.82574E?09 Ccdc117 ?0.570173683 9.594031621 42.87429725 5.83726E?11 3.46539E?09 Ubald2 ?0.36571417 10.66143541 42.56689302 6.83058E?11 4.03747E?09 Tram1 0.459368816 9.883728186 42.3939177 7.46217E?11 4.3917E?09 Ddx60 ?0.373678564 9.541837476 41.90575092 9.57805E?11 5.61266E?09 Rpl18 0.16500821 11.86839686 41.52080501 1.16623E?10 6.80469E?09 Ftl1 ?0.254126258 11.02867874 41.24955394 1.33982E?10 7.78415E?09 Cnn2 0.351443965 10.25976365 41.23898797 1.34709E?10 7.79304E?09 Arf5 0.335902191 10.19854297 41.17413621 1.39253E?10 8.0218E?09 Rps28 ?0.17669445 11.84765533 41.03874747 1.49241E?10 8.56089E?09 Nrip1 ?0.533322514 9.859993551 40.99470604 1.52642E?10 8.7192E?09 Uqcrfs1 0.407154567 9.966955579 40.84086269 1.65144E?10 9.3547E?09 Ddx24 ?0.456807659 9.828797982 40.84178616 1.65066E?10 9.3547E?09 Spcs3 0.558898275 9.669879283 40.41720553 2.05127E?10 1.15714E?08 Psmd13 0.539440109 9.697470476 40.40366824 2.06553E?10 1.16037E?08 Sdcbp 0.448461817 9.891466083 40.3625637 2.10945E?10 1.18016E?08 Rtp4 ?0.563163546 9.565691325 39.98728135 2.55622E?10 1.42425E?08 Cd28 ?0.364314583 10.50430705 39.97688609 2.56986E?10 1.42601E?08 Gm10076 ?0.363789063 10.01444869 39.8563226 2.73348E?10 1.51064E?08 1500009L16Rik 0.542202591 9.583684757 39.7287938 2.91792E?10 1.60604E?08 S100a13 0.386023024 10.11272451 39.59415967 3.12617E?10 1.71372E?08 Tprgl 0.439315767 9.937270565 39.49031889 3.2969E?10 1.80005E?08 Uqcrh 0.258509129 10.66055691 39.26239503 3.70509E?10 2.01483E?08 Hnrnpdl ?0.425883748 9.851559277 39.24467677 3.73886E?10 2.02509E?08 Trps1 ?0.581094547 9.593491566 39.22474925 3.77722E?10 2.03775E?08 Sh3bgrl3 0.234852888 11.18097545 39.21492611 3.79627E?10 2.03993E?08 Nr4a1 ?0.490052945 9.985650751 39.19056878 3.84393E?10 2.05741E?08 Zfand2a ?0.537861078 9.566631043 39.02336362 4.18764E?10 2.23259E?08 Irf1 ?0.514113223 9.768522493 38.96928106 4.30527E?10 2.28633E?08 Limd2 0.322761237 10.43727909 38.93205538 4.38815E?10 2.31229E?08 Zbtb20 ?0.581062467 9.584425294 38.93617746 4.3789E?10 2.31229E?08 Asb2 ?0.544248262 9.850342678 38.84496818 4.58835E?10 2.40844E?08 Tiparp ?0.580123163 9.609123279 38.4953443 5.48845E?10 2.86982E?08 Isg15 ?0.584150245 9.800573377 38.45870296 5.59246E?10 2.91301E?08 Csrnp1 ?0.517948042 9.779414893 38.26534917 6.17494E?10 3.20414E?08 Tmem50a 0.386836955 10.00814313 38.15703896 6.52738E?10 3.37414E?08 Actn1 ?0.533996189 9.567435546 38.08192888 6.78355E?10 3.49327E?08 Psmd8 0.424531567 9.892382532 38.00538221 7.05497E?10 3.60573E?08 Gm26699 ?0.473480345 9.765120668 38.00550982 7.05451E?10 3.60573E?08 Cd244 0.388278993 9.55144543 37.91921304 7.37355E?10 3.75444E?08 Rps11 0.141420944 12.35636328 37.86091045 7.59723E?10 3.85173E?08 Ilk 0.536823666 9.680259126 37.85474135 7.62129E?10 3.85173E?08 Sdcbp2 ?0.542086538 9.622445807 37.59342632 8.71377E?10 4.38754E?08 Ahr ?0.59092619 9.672948429 37.54436013 8.93574E?10 4.48271E?08 Rps21 ?0.21136896 10.97596554 37.1282141 1.10612E?09 5.52855E?08 Plin2 ?0.537264515 9.575959069 37.10475461 1.1195E?09 5.57497E?08 Rpl10a 0.200698396 11.2570968 37.0300252 1.16324E?09 5.77163E?08 Sdf2l1 0.529962562 9.709620662 37.00327913 1.17931E?09 5.83007E?08 Cox5b 0.305999662 10.32202341 36.9673266 1.20125E?09 5.91705E?08 Apobec3 0.437401019 9.902621042 36.93631025 1.22052E?09 5.99022E?08 Rpl9-ps6 ?0.351320591 9.989161867 36.53264344 1.50131E?09 7.34183E?08 Gem ?0.682793999 9.688105676 36.46631611 1.55327E?09 7.56873E?08 Eprs 0.53788575 9.694503208 36.43986079 1.5745E?09 7.64476E?08 Gstp1 ?0.504141129 9.64657452 36.38114233 1.62266E?09 7.85054E?08 Trp53inp1 ?0.513550556 9.595006556 36.2425247 1.74227E?09 8.39935E?08 Ahnak 0.498211225 9.785411173 36.12837239 1.84737E?09 8.87458E?08 Arpc4 0.366807267 10.06345714 36.05320569 1.92003E?09 9.19111E?08 Rap1b 0.315806112 10.27367424 36.01786076 1.95517E?09 9.32651E?08 Kcnk5 ?0.515305339 9.574931238 35.71192387 2.2876E?09 1.08741E?07 Cd9 ?0.471749722 9.565476632 35.54177757 2.49639E?09 1.18252E?07 Ostc 0.453743376 9.79984885 35.34117534 2.7672E?09 1.30625E?07 Gnai2 0.271442641 10.46001918 35.19685572 2.98004E?09 1.40186E?07 Npm3 0.426799674 9.885664227 34.91904872 3.43702E?09 1.61125E?07 Hif1a ?0.430822834 9.908262886 34.69387483 3.85844E?09 1.80259E?07 Spcs2 0.323040264 10.17009625 34.61830814 4.01116E?09 1.86752E?07 Ap2m1 0.423344592 9.842161501 34.58702108 4.07615E?09 1.89101E?07 Edf1 0.331625317 10.10367538 34.58068966 4.08943E?09 1.89101E?07 Izumo1r ?0.621017876 9.606866954 34.41958125 4.44231E?09 2.0462E?07 Manf 0.417472957 9.905200221 34.41397814 4.45512E?09 2.0462E?07 Tgfb1 0.456071377 9.908533916 34.35865156 4.58358E?09 2.09811E?07 Rps3 0.136732909 11.97017084 34.23146089 4.89315E?09 2.22666E?07 Degs1 0.499847178 9.710625605 34.22985792 4.89718E?09 2.22666E?07 Ciapin1 0.505447675 9.69209499 33.8265408 6.02513E?09 2.73039E?07 Btg2 0.338891136 10.81509287 33.75955166 6.23621E?09 2.81665E?07 Hint1 0.319099291 10.22665553 33.64099662 6.6281E?09 2.9711E?07 Casp4 ?0.476037532 9.726331048 33.63641218 6.64373E?09 2.9711E?07 Anxa11 0.487304216 9.703047741 33.64158832 6.62608E?09 2.9711E?07 Rnf115 0.477692622 9.719266495 33.60418158 6.75474E?09 3.01084E?07 Coq10b ?0.435536512 9.823130381 33.38844922 7.54709E?09 3.35303E?07 Gltscr2 0.281894891 10.46438057 33.12678111 8.63413E?09 3.82348E?07 Ero1l 0.519056603 9.611552364 33.00007472 9.21553E?09 4.0677E?07 Tomm7 ?0.313476679 10.05823488 32.94049529 9.50232E?09 4.18071E?07 Ywhaq 0.413376988 9.880284734 32.91496101 9.62795E?09 4.22232E?07 Psmb8 0.247937082 10.58696086 32.69682093 1.07713E?08 4.70856E?07 Rhob ?0.466893188 9.565551549 32.68298283 1.08483E?08 4.727E?07 Rps10 0.169459818 11.27074258 32.67170702 1.09114E?08 4.73931E?07 Cd82 0.343430004 10.23707609 32.59801177 1.13331E?08 4.90678E?07 Abcb1a ?0.490964544 9.634618666 32.5330167 1.17185E?08 5.05754E?07 Ecm1 ?0.428948374 9.548168048 32.5121924 1.18447E?08 5.09585E?07 Chchd2 ?0.242250124 10.4145197 32.4935448 1.19589E?08 5.12875E?07 Stmn2 0.31474375 9.547934398 32.44033935 1.22908E?08 5.25453E?07 Ptprk 0.322461174 9.547124172 32.39925874 1.25534E?08 5.34997E?07 Zfp280d ?0.455933504 9.577105785 32.39298477 1.2594E?08 5.3505E?07 RP24-48411.3 0.45581967 9.573621121 32.28892999 1.32868E?08 5.62724E?07 Vps37b ?0.330737492 10.53077373 32.22402668 1.37381E?08 5.80031E?07 Tuba4a ?0.495588026 9.695802967 32.05135878 1.5015E?08 6.31978E?07 Cd27 ?0.623155836 9.654241658 31.96170218 1.57242E?08 6.59787E?07 Rps19 0.147463744 12.62869486 31.76897993 1.73644E?08 7.26366E?07 Ndufa11 0.395844467 9.869001574 31.75589903 1.74817E?08 7.29032E?07 Pglyrp1 0.554448261 9.675823263 31.7328135 1.76908E?08 7.35493E?07 Gpr132 ?0.347377843 10.08111363 31.62652046 1.8686E?08 7.74501E?07 Dnajb2 ?0.398965682 9.552710551 31.53488229 1.9589E?08 8.09458E?07 Sfr1 0.436841829 9.79905978 31.52744207 1.96642E?08 8.10103E?07 Stmn1 0.869255435 9.718320163 31.23884134 2.28155E?08 9.3709E?07 Chn2 0.50726472 9.602283449 31.11036095 2.43767E?08 9.98195E?07 Atp8a2 0.515838144 9.630965479 30.97464046 2.61422E?08 1.06728E?06 Cd40lg ?0.471028099 9.806462091 30.89285541 2.72674E?08 1.10895E?06 Cxcl10 ?0.727462227 9.649729541 30.88867223 2.73262E?08 1.10895E?06 Egr1 ?0.58434076 9.573320341 30.82712287 2.82068E?08 1.14128E?06 Nubp1 0.473403814 9.680677072 30.783805 2.88435E?08 1.16358E?06 Eif3m 0.33858974 10.03086842 30.533751 3.28108E?08 1.31971E?06 Gm26917 ?0.386612599 9.867968155 30.27290912 3.75332E?08 1.5052E?06 Atp5a1 0.330745474 10.05398237 30.25219304 3.79362E?08 1.51689E?06 Sytl1 0.450310542 9.57672802 30.16768361 3.96258E?08 1.5798E?06 Mier1 0.429759379 9.849073912 29.99380834 4.33428E?08 1.71869E?06 Tagap ?0.481023723 9.753295815 29.99293376 4.33624E?08 1.71869E?06 Ahsa1 ?0.415991957 9.7343473 29.8494272 4.66935E?08 1.84534E?06 Acot9 0.486670609 9.629157206 29.79529145 4.80157E?08 1.8921E?06 Rps3a1 0.144785051 11.73486958 29.76024635 4.88915E?08 1.92104E?06 Serinc3 0.488696277 9.653334653 29.75265681 4.90833E?08 1.92302E?06 Rplp2 ?0.134128458 11.87909328 29.57476782 5.38008E?08 2.10179E?06 Eif5a 0.271331035 10.45412985 29.306058 6.18022E?08 2.40745E?06 Tmem176a 0.659501681 9.760786899 29.24814254 6.36772E?08 2.47341E?06 Sh2d2a 0.372695089 10.07434142 29.15725241 6.67355E?08 2.58481E?06 Prmt1 0.433541135 9.752599757 29.09939463 6.87585E?08 2.64808E?06 Wdr89 ?0.260435474 10.29803674 29.10467471 6.85713E?08 2.64808E?06 Msn 0.303992139 10.11460226 28.9457299 7.44347E?08 2.85859E?06 Ict1 0.436674726 9.753338871 28.93128095 7.4992E?08 2.87188E?06 Ythdc1 ?0.434898908 9.695559663 28.82288915 7.93083E?08 3.02864E?06 Rpl13-ps3 ?0.319707654 9.989340753 28.73260083 8.30931E?08 3.16429E?06 Gimap6 ?0.244548357 10.59710866 28.72414041 8.34569E?08 3.16926E?06 Tmem30a 0.437623733 9.744492786 28.69389532 8.47705E?08 3.21018E?06 Rac1 0.311594293 10.06053352 28.63136373 8.75526E?08 3.29865E?06 Sesn1 ?0.368525972 9.551406608 28.63049009 8.75921E?08 3.29865E?06 4930503L19Rik ?0.444136554 9.569307661 28.62410095 8.78815E?08 3.30041E?06 Gramd3 0.454475792 10.22334111 28.60513397 8.87466E?08 3.32372E?06 Nt5c 0.418853625 9.783355854 28.57256775 9.02518E?08 3.3708E?06 Zyx 0.49949057 9.653615873 28.51246827 9.3097E?08 3.46755E?06 Jmjd1c ?0.470611575 9.671839485 28.41495083 9.79063E?08 3.63671E?06 Oaz1 0.157157942 11.32703266 28.22495552 1.08003E?07 4.00082E?06 Atp5o 0.340449858 9.966789533 28.09237029 1.15661E?07 4.27285E?06 Slc25a4 0.403613648 9.854301686 28.07715311 1.16574E?07 4.29491E?06 2810417H13Rik 0.864238455 9.675098575 28.05895758 1.17675E?07 4.32377E?06 Cmpk1 0.392640439 9.806513171 27.94059504 1.25098E?07 4.5841E?06 Stat3 ?0.40036914 9.799207752 27.92008019 1.26431E?07 4.6205E?06 Tmem160 0.361394762 9.896444569 27.89373698 1.28164E?07 4.67128E?06 Atf4 ?0.416309212 9.732097606 27.83823326 1.31894E?07 4.79437E?06 Zfp706 0.377304609 9.852188098 27.77685472 1.36145E?07 4.93572E?06 Prr13 0.259162854 10.44540802 27.68287373 1.42922E?07 5.16764E?06

    TABLE-US-00013 TABLE 2D Colon IEL Ctrl vs KO GeneSymbol logFC logCPM LR PValue FDR Hspa1a ?4.912418231 10.69640911 4353.406085 0 0 Ubb ?0.77403293 12.42365996 2268.704696 0 0 Malat1 ?0.969266612 14.67682077 2468.851731 0 0 Rbm3 0.950879034 10.81487562 1615.458299 0 0 Dnajb1 ?2.106865401 9.893638618 1434.569266 0 0 Jun ?2.095847257 10.05710788 1333.458514 6.0574E?292 1.4803E?288 Fos ?2.354918413 10.11294467 1287.060873 7.3297E?282 1.5354E?278 Ubc ?0.885778987 10.8737827 1160.271008 2.6281E?254 4.8169E?251 Hspa1b ?1.572519816 9.464180989 1005.757106 1.0067E?220 1.6401E?217 Rps27rt ?0.855944525 10.45058647 960.5894229 6.6203E?211 9.7073E?208 Rps27 ?0.456664488 12.77091707 884.4000389 2.416E?194 3.2205E?191 Rsrp1 ?0.7538665 10.47574847 825.1217025 1.8632E?181 2.2767E?178 Rpl38 ?0.450854758 11.36672195 727.8453794 2.6346E?160 2.9716E?157 S100a4 1.196877127 10.20124983 675.3497526 6.858E?149 7.1828E?146 Hsp90ab1 ?0.625671337 10.70244953 672.3653519 3.0564E?148 2.9878E?145 Rplp0 0.358265483 12.22246018 637.178858 1.3725E?140 1.2578E?137 Rpl37a ?0.341973881 12.31974039 618.461248 1.616E?136 1.3938E?133 Asb2 ?1.087110199 9.986148994 587.987702 6.8646E?130 5.592E?127 Dusp2 1.140087471 10.1241259 564.8664371 7.3454E?125 5.6687E?122 Hsp90aa1 ?0.884650897 10.03922356 545.7934307 1.0354E?120 7.5908E?118 Uba52 ?0.715686894 10.02413792 535.1932376 2.0948E?118 1.4627E?115 Rps29 ?0.3494107 11.76226086 526.5778531 1.5684E?116 1.0453E?113 S100a6 0.665033272 11.40505169 473.014171 7.0773E?105 4.5119E?102 Rpl22l1 0.492941427 10.81346165 469.0919932 5.0508E?104 3.0858E?101 Slc25a5 0.48478658 10.63486828 453.0258552 1.5835E?100 9.28738E?98 Ass1 1.043502352 9.681786921 439.9535277 1.10805E?97 6.24899E?95 Rpl32 0.270960395 12.3093303 421.5380521 1.12894E?93 6.131E?91 Tmsb10 ?0.379217961 12.59401337 403.7190476 8.53796E?90 4.47115E?87 Dynll1 0.539955191 10.37288347 403.0311001 1.20534E?89 6.09443E?87 Rps28 ?0.361971479 11.20834805 399.8352948 5.98121E?89 2.92342E?86 Rpl3 0.251619694 12.09990026 380.8827502 7.99417E?85 3.78124E?82 H2-K1 ?0.345378791 11.57577177 372.4393757 5.50898E?83 2.52432E?80 H2-D1 ?0.260139164 12.2312739 355.6894705 2.44458E?79 1.08621E?76 Rpl29 0.374981802 11.0435012 354.0148476 5.66062E?79 2.44122E?76 Mptx1 ?0.940597371 9.428866314 349.7728959 4.74892E?78 1.95256E?75 Gngt2 ?0.855819774 9.686351451 349.7541182 4.79384E?78 1.95256E?75 Gm10076 ?0.737584834 9.708049893 340.536643 4.87528E?76 1.93206E?73 Fosb ?0.857299353 9.419033424 337.6702214 2.05239E?75 7.91953E?73 H2-Q7 ?0.485711612 10.45033154 337.4095826 2.33896E?75 8.79391E?73 Rpl24 0.274190325 11.71749233 330.3088265 8.23237E?74 3.01778E?71 Rpl41 ?0.209689141 12.53198319 315.3142841 1.51906E?70 5.43268E?68 Plac8 0.788837939 10.43214592 307.2290402 8.76735E?69 3.06085E?66 Rps2 0.31789432 11.392 298.9635462 5.54091E?67 1.88945E?64 Klf6 ?0.788289496 10.16162079 294.3554236 5.59207E?66 1.86356E?63 BC021614 0.881668333 9.536127554 287.8216032 1.48325E?64 4.8331E?62 Stat1 ?0.701927733 9.831890541 283.3313126 1.41143E?63 4.4991E?61 Ifngr1 0.611436865 10.15474423 279.8164944 8.23351E?63 2.56868E?60 Crip1 0.445133772 11.63845182 278.3682928 1.70285E?62 5.20186E?60 B2m ?0.192178232 12.76962568 273.0340514 2.47551E?61 7.40783E?59 Rpsa 0.27943496 11.44702036 271.2401369 6.09017E?61 1.786E?58 Gm11808 ?0.543144555 9.925523693 269.4920183 1.46427E?60 4.20993E?58 Eif4a2 ?0.603016602 9.902866294 267.009303 5.09016E?60 1.43533E?57 Tomm7 ?0.49876914 9.956780815 256.1536398 1.18292E?57 3.27266E?55 Vim 0.478069679 10.67155362 255.4815988 1.6575E?57 4.50071E?55 Rps3a1 0.242880798 11.51721161 254.1602609 3.21732E?57 8.57738E?55 Rps11 0.21510739 12.18975268 245.7818357 2.15808E?55 5.65071E?53 Cox17 ?0.476013244 10.03899143 243.7133207 6.09623E?55 1.56823E?52 Rpl8 0.248159642 11.41010456 240.8276921 2.59557E?54 6.56187E?52 Ptprcap 0.389634275 10.51759166 240.350875 3.29761E?54 8.1954E?52 Dusp1 ?0.904271717 10.0322272 236.1269017 2.74943E?53 6.71914E?51 Pycard 0.564371274 9.949662724 231.922578 2.27022E?52 5.45709E?50 Bhlhe40 0.630615216 9.942561935 230.8478654 3.89438E?52 9.21022E?50 Rcbtb2 ?0.742317781 9.655868727 229.5682165 7.4047E?52 1.72342E?49 Rps6 0.203977864 12.02748398 229.4067809 8.02998E?52 1.83974E?49 Rpl10a 0.28962533 11.05684293 227.5062085 2.0855E?51 4.70456E?49 Wdr89 ?0.524129877 9.860629364 225.9165989 4.63338E?51 1.02938E?48 Ccnd2 ?0.468969455 10.33483348 218.2900005 2.13493E?49 4.67232E?47 Rps21 ?0.33368489 10.56800568 217.5306651 3.12624E?49 6.74118E?47 Eif3f 0.304579066 10.76016509 214.3927099 1.51198E?48 3.21307E?46 H2afz 0.505010513 10.64921003 214.215217 1.65298E?48 3.46252E?46 Gm9843 ?0.436865437 10.06758138 211.9041073 5.27779E?48 1.08998E?45 Neat1 0.7478016 9.746628843 210.8010385 9.18551E?48 1.87066E?45 Rpl18 0.221574798 11.68576023 209.1814055 2.07234E?47 4.16257E?45 Ltb 0.524512641 10.49312487 205.1159497 1.59766E?46 3.16575E?44 Phlda1 ?0.955844714 9.533129244 202.73707 5.27912E?46 1.0321E?43 Cd160 0.733852101 9.934715958 202.6916375 5.40102E?46 1.04204E?43 Actg1 0.281414796 12.31487365 196.162142 1.43674E?44 2.73596E?42 Eif2s3y 0.687418848 9.547993406 195.8072505 1.71724E?44 3.22819E?42 Satb1 0.751494377 9.529465747 194.8575828 2.76754E?44 5.13677E?42 Serf2 ?0.250130527 10.9456737 193.9668336 4.33015E?44 7.93662E?42 Ccl4 1.485785617 11.36531232 192.365257 9.68418E?44 1.75308E?41 Ldha 0.357711111 10.5986605 192.321415 9.89993E?44 1.77028E?41 Ndufa3 ?0.395696872 10.08011666 190.6069001 2.34347E?43 4.14003E?41 Jund ?0.387305885 11.36254002 189.980835 3.21007E?43 5.60348E?41 Emp3 0.438130914 10.18357209 189.0713646 5.07031E?43 8.74659E?41 Cd52 0.210775009 12.64363478 184.4061463 5.28984E?42 9.01918E?40 Cd47 0.384229869 10.24153152 181.0529042 2.85451E?41 4.81101E?39 Bola2 ?0.500931151 9.816144873 180.209206 4.36257E?41 7.26913E?39 Nop10 ?0.447267852 9.964174868 178.3896367 1.08902E?40 1.79419E?38 Cotl1 0.347861789 10.82474878 177.3790784 1.81008E?40 2.94901E?38 Gpr18 0.707432613 9.62318615 176.8067404 2.41364E?40 3.88914E?38 Cbx4 ?0.657383357 9.485214987 175.6581823 4.3001E?40 6.85351E?38 Rps10 0.235850397 11.06031224 174.7426765 6.81396E?40 1.07433E?37 Alyref 0.562801095 9.80640343 173.2604322 1.4358E?39 2.2397E?37 Hspe1 ?0.498929135 9.822812601 172.3436082 2.27677E?39 3.51413E?37 Mif4gd 0.596663991 9.624117642 171.0774302 4.30377E?39 6.57356E?37 Btg1 0.33237651 11.54672282 170.0633984 7.16671E?39 1.08335E?36 Ywhae 0.451607278 9.886722446 169.5446464 9.30296E?39 1.39193E?36 Fgl2 ?0.599214624 9.754853926 167.848361 2.18335E?38 3.23378E?36 Abi3 ?0.514355959 9.839809501 166.8618241 3.58601E?38 5.25817E?36 Cox7c ?0.295724359 10.44152118 166.0753922 5.32595E?38 7.73213E?36 S100a11 ?0.296848696 10.91816565 165.5905177 6.79695E?38 9.77095E?36 Coro1a 0.233952804 11.24278869 161.3819745 5.64562E?37 8.03706E?35 Zyx 0.598281587 9.607741404 160.0838661 1.08474E?36 1.52938E?34 Rad23a ?0.620382828 9.457741846 156.8432936 5.5385E?36 7.73439E?34 Gmfg 0.341067596 10.34860251 155.1988037 1.26692E?35 1.75253E?33 Hmgb2 0.55422263 10.54001319 154.9366563 1.44556E?35 1.96262E?33 Snrpg ?0.37093984 10.05500868 154.9375473 1.44491E?35 1.96262E?33 Cd247 ?0.484714034 9.801664107 154.4549065 1.84211E?35 2.47806E?33 Icos 0.610190592 9.74486266 153.8284708 2.52473E?35 3.33515E?33 Gapdh 0.301102423 10.80087158 153.8412635 2.50853E?35 3.33515E?33 Rgs10 0.478781426 9.963476703 153.4973144 2.98254E?35 3.90473E?33 Lpar6 ?0.636355346 9.566478995 153.46167 3.03652E?35 3.94022E?33 Klf2 0.990778098 10.07901749 150.7316392 1.19962E?34 1.54298E?32 Ifi27 ?0.461697659 9.803250594 149.8692448 1.85157E?34 2.36083E?32 H2afy ?0.325716736 10.24951783 147.3520485 6.57313E?34 8.30878E?32 Rasgrp4 ?0.504364183 9.405509348 147.1171723 7.39804E?34 9.27158E?32 Limd2 0.371058117 10.22214485 146.6145931 9.52761E?34 1.18393E?31 mt-Co1 0.202675662 12.19348251 143.8546255 3.82274E?33 4.71032E?31 Btf3 0.238036805 10.77125033 143.4716622 4.63559E?33 5.66431E?31 Grcc10 ?0.537895935 9.60614827 143.4452179 4.69772E?33 5.69278E?31 Lax1 0.604314275 9.491039638 142.4955928 7.57737E?33 9.10713E?31 Tpm4 0.511683249 9.75042318 142.4364652 7.80633E?33 9.30603E?31 Rpl4 0.175431416 11.61378607 142.0480365 9.49244E?33 1.12248E?30 Gm9844 ?0.536348989 9.601478567 141.5180167 1.23957E?32 1.45406E?30 Gm8797 ?0.579685824 9.452636417 138.8347619 4.78665E?32 5.57037E?30 Txnip ?0.547016389 9.661178104 137.4469207 9.62828E?32 1.11165E?29 Pglyrp1 0.644569275 9.565961199 135.9739899 2.02161E?31 2.31585E?29 Gm42418 ?0.592774056 9.478911026 134.3456302 4.59061E?31 5.218E?29 Ost4 ?0.422518077 9.806199001 133.7229779 6.28163E?31 7.08519E?29 Atp5e ?0.277541227 10.36033547 133.4118899 7.34721E?31 8.22383E?29 Dkkl1 ?0.607062031 9.511202131 132.8270224 9.86427E?31 1.09576E?28 Ifi27l2a ?0.682729091 9.830872885 132.0563095 1.45435E?30 1.60339E?28 PISD ?0.578023174 9.545282024 131.4161277 2.00781E?30 2.19705E?28 Usmg5 ?0.349820825 9.9964598 130.3323663 3.46601E?30 3.7646E?28 Gpr171 0.438173645 9.903960288 127.5732549 1.39168E?29 1.50046E?27 Rgs1 0.397257884 11.60966783 125.5147395 3.92663E?29 4.20264E?27 Fxyd5 0.228232386 10.90619274 125.1071312 4.82199E?29 5.12354E?27 Ppp3r1 ?0.54142838 9.487871313 124.5160325 6.49522E?29 6.85176E?27 Rpl37 ?0.161343968 11.81568565 124.1329903 7.87824E?29 8.25133E?27 Cmtm7 0.454020607 9.769874757 122.7886537 1.55123E?28 1.61317E?26 Prelid1 0.389762152 9.89081496 122.7394091 1.59021E?28 1.64206E?26 Cox5a 0.261555498 10.46343799 122.650577 1.66303E?28 1.70524E?26 Cd4 ?0.379389302 9.985453892 121.4080927 3.11084E?28 3.16766E?26 H3f3b 0.195676561 11.62147274 120.5475044 4.80034E?28 4.8543E?26 Sfpq 0.426928473 9.766528868 119.9027458 6.64394E?28 6.67261E?26 Rpl23a-ps3 ?0.284048391 10.26446957 118.2728016 1.51108E?27 1.50728E?25 Ctsw 0.287951157 10.51671124 118.1709245 1.59072E?27 1.576E?25 Il27ra ?0.536474502 9.51098448 116.3402136 4.00371E?27 3.94003E?25 Nab1 0.501005233 9.58946001 115.9990896 4.75515E?27 4.64832E?25 Rpl39 ?0.176812196 11.51658061 115.8551826 5.11303E?27 4.96505E?25 Esm1 0.580091419 9.435676786 115.739511 5.42012E?27 5.22864E?25 Rpl31 0.236225624 10.69362592 113.5096718 1.66865E?26 1.59918E?24 Glipr2 0.451381886 9.775168242 113.0218075 2.13415E?26 2.02059E?24 Rps26 0.232520083 10.83772226 113.0201539 2.13593E?26 2.02059E?24 Rps5 0.148067744 11.95622251 112.7529071 2.44413E?26 2.29732E?24 S1pr1 0.588401834 9.457285155 112.1393936 3.33051E?26 3.11053E?24 Sh3bgrl3 ?0.168091093 11.68103931 112.1252361 3.35438E?26 3.11299E?24 Slc25a4 0.38380581 9.862505837 111.5888161 4.39661E?26 4.05456E?24 Rps19 0.154571784 12.45475351 111.1783432 5.40801E?26 4.9561E?24 Lgals1 0.264441023 11.89998374 111.0088631 5.89068E?26 5.3649E?24 Psmb9 ?0.328731197 9.976063465 108.9172043 1.69208E?25 1.53154E?23 Gnai2 0.222498644 10.64920018 108.8441011 1.75565E?25 1.57934E?23 Mir142hg 0.551042944 9.496107108 108.2667593 2.34932E?25 2.10049E?23 Cd3e ?0.223197162 10.83627589 107.8485188 2.90126E?25 2.57826E?23 Fus ?0.355382378 9.87695395 107.2238774 3.97617E?25 3.51221E?23 Ppm1h ?0.510426159 9.531317964 106.7556798 5.03577E?25 4.42153E?23 Rpl36 ?0.169365981 11.60496907 106.6065855 5.42925E?25 4.73864E?23 Ppp1r15a ?0.547132695 9.584142239 106.4313775 5.93112E?25 5.14603E?23 Ahrr ?0.268421399 9.388438844 104.7234475 1.40429E?24 1.21124E?22 Erdr1 0.54023863 9.475463995 104.6521757 1.45573E?24 1.24826E?22 Atp5k ?0.358970242 9.829102548 103.4309785 2.69626E?24 2.29856E?22 Shisa5 0.218856868 11.19765366 103.3840867 2.76083E?24 2.34001E?22 Eif3h 0.242394534 10.41255751 102.9208658 3.48806E?24 2.9394E?22 Mmp9 ?0.359554026 9.392330763 102.2123398 4.98782E?24 4.17923E?22 Ubl3 0.463107639 9.607014043 102.0906527 5.30382E?24 4.41875E?22 Pet100 ?0.433689861 9.632374387 101.939089 5.72555E?24 4.74315E?22 Capzb 0.223546007 10.5338718 101.9175981 5.788E?24 4.76795E?22 Rpl26 0.158164308 11.42098645 101.7241051 6.3819E?24 5.22781E?22 Reg3b ?0.500721243 9.406631246 101.3406774 7.74489E?24 6.30907E?22 Ub15 ?0.252423517 10.30008476 99.79503049 1.69014E?23 1.3692E?21 Ptpn22 0.348842201 10.01581807 98.94795597 2.59225E?23 2.08847E?21 Bst2 ?0.480431543 9.573589557 98.81392257 2.77378E?23 2.22251E?21 Ptp4a2 0.336132395 9.932198353 98.33705988 3.52899E?23 2.81226E?21 Ndufa5 ?0.391689506 9.697497933 97.92740041 4.34006E?23 3.43991E?21 Fam189b ?0.444063386 9.678923066 97.73586286 4.78085E?23 3.7689E?21 Pim1 0.475298479 10.00737164 97.41181842 5.63089E?23 4.41528E?21 Hilpda 0.552369546 9.501052392 97.15607765 6.40723E?23 4.9973E?21 Fth1 ?0.182222184 11.1646769 96.91852629 7.22396E?23 5.60449E?21 Bcl2a1b 0.376789448 10.02781406 96.24135593 1.01698E?22 7.84843E?21 Psme2 ?0.259919999 10.31903574 96.15844171 1.06048E?22 8.14125E?21 Rps3 0.130737293 11.81737892 95.9917874 1.15361E?22 8.76445E?21 Rps16 ?0.128415044 12.15232601 95.99483852 1.15183E?22 8.76445E?21 Bin2 0.33387622 9.94413916 95.89670834 1.21036E?22 9.14824E?21 Timp2 0.500779729 9.554063201 95.71940824 1.32376E?22 9.95402E?21 Rps4x 0.141401747 11.71126116 95.58313032 1.4181E?22 1.0609E?20 Agr2 ?0.405588336 9.399615257 95.57125335 1.42663E?22 1.06186E?20 Ly6e ?0.239270346 10.72940372 95.54576674 1.44512E?22 1.07019E?20 2010107E04Rik ?0.282366294 10.06037516 95.05323724 1.85333E?22 1.3656E?20 Ywhah 0.314522758 10.03215277 94.92177622 1.98059E?22 1.45207E?20 S1pr4 0.461593658 9.637339017 94.89959417 2.00291E?22 1.46113E?20 Atf7ip ?0.497497145 9.522767261 94.00649346 3.1449E?22 2.28286E?20 Hnrnpf 0.206540192 10.67023919 93.76002102 3.56194E?22 2.57284E?20 Cxcr3 0.411891354 9.824285959 93.20771164 4.70843E?22 3.3843E?20 Rps15 ?0.157626985 11.27418535 92.7653109 5.88782E?22 4.21137E?20 Rps18 0.12718884 12.37845441 92.51742519 6.67346E?22 4.75014E?20 Map2k3 0.484872054 9.558650852 91.50771196 1.11158E?21 7.87397E?20 Romo1 ?0.364175595 9.742699809 90.79819383 1.59099E?21 1.12157E?19 Hic1 ?0.486819612 9.58081968 90.32504307 2.02079E?21 1.41774E?19 Spink4 ?0.422462121 9.400067934 90.00579616 2.37463E?21 1.65806E?19 Ang4 ?0.232083493 9.386587169 89.63651639 2.86193E?21 1.98884E?19 Muc3 ?0.250250477 9.387731659 88.43624664 5.24999E?21 3.63116E?19 1500009L16Rik 0.542706342 9.449829859 88.40371265 5.33705E?21 3.67405E?19 Mien1 ?0.347724265 9.765232979 88.18655845 5.95633E?21 4.0812E?19 Gramd3 0.55125369 9.499432993 88.06414473 6.33659E?21 4.32155E?19 Pkm 0.240126678 10.49678124 88.04399147 6.40148E?21 4.3456E?19 Rpl27 ?0.157552345 11.22543808 87.99513948 6.56155E?21 4.43373E?19 Dpm3 ?0.360538159 9.721395651 87.74227048 7.45637E?21 5.01527E?19 Rhob ?0.532371904 9.442446398 87.18704808 9.87282E?21 6.61028E?19 Cxcr6 0.260123251 11.11844547 86.10298628 1.70805E?20 1.13841E?18 Sec61g ?0.221864807 10.42657775 86.01134149 1.78907E?20 1.18702E?18 Rps8 0.157110222 11.43109006 85.75218409 2.03959E?20 1.34714E?18 Cox7a2 ?0.253012989 10.14397168 85.33018222 2.5248E?20 1.66014E?18 Il2rb 0.4060724 9.69063229 85.14880794 2.76735E?20 1.8115E?18 Cox14 ?0.351555119 9.765850837 84.88340428 3.16488E?20 2.06252E?18 Srsf3 0.313008472 9.979900806 84.60915088 3.63579E?20 2.35892E?18 Tagln2 0.299483696 10.35627371 84.45265033 3.93527E?20 2.54198E?18 H2-Q6 ?0.394471662 9.687987566 83.5063727 6.35109E?20 4.08448E?18 Arpc1b 0.173890126 10.87245212 83.26504726 7.17572E?20 4.59466E?18 Krt8 ?0.403281524 9.403467815 82.98133851 8.28317E?20 5.2807E?18 Rps15a ?0.124996535 12.34731808 82.92709526 8.51362E?20 5.40412E?18 Wbscr16 ?0.410455344 9.411788422 82.02708053 1.34235E?19 8.48399E?18 Rpl7 0.154932946 11.11907579 81.95526321 1.39202E?19 8.76017E?18 Penk 1.313010388 9.664975606 81.20109876 2.03879E?19 1.27755E?17 Rps7 0.129528661 11.72687307 80.86606628 2.41546E?19 1.50714E?17 Hsd11b1 0.447395686 9.606894656 80.84119223 2.44606E?19 1.51977E?17 Naca 0.178706035 10.80182933 80.33963058 3.15282E?19 1.95062E?17 Fcgbp ?0.217260104 9.386487028 80.30030325 3.2162E?19 1.98147E?17 Gltscr2 0.258412919 10.25123713 79.51651322 4.78212E?19 2.9339E?17 Socs3 0.641425478 9.534871697 79.32402869 5.27147E?19 3.22065E?17 Rpl10 0.162358681 11.36672343 79.30037032 5.33497E?19 3.24592E?17 Arpc2 0.162260977 10.92620521 79.11050195 5.87313E?19 3.55858E?17 Gstp1 ?0.434068798 9.504080093 79.07810684 5.97023E?19 3.60253E?17 Krt19 ?0.391532021 9.402773272 78.95610969 6.35052E?19 3.8163E?17 Itm2c ?0.366659839 9.727481117 78.79268166 6.89821E?19 4.12851E?17 Itga4 0.470754127 9.548703143 78.60469602 7.58688E?19 4.52222E?17 mt-Co2 0.156269384 11.43908237 78.49872805 8.00498E?19 4.7521E?17 Lamtor2 ?0.320200859 9.784237142 78.001988 1.02937E?18 6.08614E?17 Rplp2 ?0.128947756 11.60786585 77.94171939 1.06126E?18 6.2495E?17 Eif3e 0.229380939 10.26281367 77.57368334 1.27862E?18 7.48572E?17 Atp5c1 0.238726429 10.16724288 77.56940157 1.2814E?18 7.48572E?17 Il7r 0.426216078 9.82476784 77.38599496 1.40609E?18 8.18153E?17 Acot9 0.433260317 9.502553768 76.63286792 2.05884E?18 1.19323E?16 Epsti1 0.290518536 10.14939008 76.08122385 2.72234E?18 1.57156E?16 Pitpna 0.304228394 9.828351065 75.94567837 2.91577E?18 1.67662E?16 Lgals4 ?0.431804311 9.417498631 75.87867365 3.0164E?18 1.72772E?16 Ccl3 1.454717185 9.969073606 75.79213983 3.15153E?18 1.79809E?16 Son ?0.321404034 9.820683121 75.4525749 3.7429E?18 2.12721E?16 Nfkb1 0.419614213 9.561478136 75.28061286 4.0835E?18 2.31183E?16 Tgoln1 ?0.393359511 9.57609321 75.24554336 4.15668E?18 2.3442E?16 Atp5j2 ?0.213360835 10.28220098 75.01663083 4.66766E?18 2.62229E?16 Car1 ?0.319128886 9.392996933 75.00343268 4.69896E?18 2.62981E?16 Hnrnpdl ?0.372863275 9.619707402 74.56253495 5.87476E?18 3.27534E?16 Pfn1 0.121037041 12.58660393 74.20797213 7.03058E?18 3.9049E?16 Uqcrb ?0.231417337 10.14719696 73.86549321 8.36255E?18 4.62717E?16 Clca1 ?0.232891953 9.388355562 73.82187536 8.54939E?18 4.71277E?16 ler5 ?0.353397065 9.877196287 73.48444421 1.01432E?17 5.54964E?16 Stk17b 0.287659497 10.00946148 73.4861738 1.01344E?17 5.54964E?16 Rpia ?0.369007261 9.412241636 73.08643749 1.24094E?17 6.76429E?16 Syce1 ?0.185525854 9.385331258 72.9581642 1.32427E?17 7.19179E?16 Tox ?0.427585214 9.428121663 72.61849444 1.57298E?17 8.47964E?16 H2-T23 ?0.40377288 9.555965873 72.62324991 1.56919E?17 8.47964E?16 Cd44 ?0.364888789 9.66492874 72.55033094 1.62826E?17 8.74548E?16 Atp1b3 0.41433275 9.580707758 72.36048167 1.79268E?17 9.59346E?16 Muc2 ?0.224942562 9.387606097 72.28636024 1.86129E?17 9.92442E?16 Swt1 ?0.41385543 9.494442155 71.64189782 2.58019E?17 1.37077E?15 Mpv17 ?0.378283479 9.414892521 71.13939089 3.32858E?17 1.76198E?15 Xcl1 1.410763345 9.9045535 71.09150442 3.41035E?17 1.79878E?15 Gimap6 ?0.242600873 10.32529467 71.01180327 3.55094E?17 1.86622E?15 mt-Atp6 0.124721425 12.48272412 70.91305335 3.7332E?17 1.955E?15 Slc3a2 0.341605532 9.804740905 70.51801022 4.56084E?17 2.37747E?15 Pigr ?0.280051952 9.389838816 70.51302832 4.57237E?17 2.37747E?15 Os9 ?0.333807082 9.73183663 70.40523305 4.82917E?17 2.50212E?15 Gpr55 ?0.377093893 9.4164776 70.06607575 5.73508E?17 2.96104E?15 Hist1h1e 0.382731133 9.412783797 69.86440121 6.35246E?17 3.26829E?15 Usp50 ?0.40726079 9.47788197 69.75271034 6.72254E?17 3.4466E?15 Ifng 0.586034647 10.08145339 68.9524593 1.00866E?16 5.15329E?15 Chmp4b 0.279912699 9.888899548 68.63971522 1.182E?16 6.01792E?15 Marcksl1 0.566499192 9.462957421 68.27387403 1.42294E?16 7.21956E?15 Arf5 0.21433798 10.20061958 68.25797953 1.43445E?16 7.2529E?15 Ets1 ?0.265183278 10.06484846 68.00483487 1.63095E?16 8.21809E?15 Errfi1 ?0.506623695 9.438930011 67.59798357 2.00472E?16 1.00669E?14 Plp2 0.413929934 9.492940408 67.57578957 2.02742E?16 1.01461E?14 Rcn1 ?0.40907025 9.519216091 66.03242907 4.43565E?16 2.20474E?14 Rtp4 ?0.379831897 9.409532416 66.03488329 4.43013E?16 2.20474E?14 5430421N21Rik 0.469971619 9.44775018 65.67951525 5.30545E?16 2.62817E?14 Tpi1 0.400390794 9.596173139 65.25696016 6.57416E?16 3.24569E?14 Grb2 0.295777902 9.791814485 65.08737903 7.16495E?16 3.52549E?14 Arpc5 0.205320349 10.43833468 64.93908067 7.72497E?16 3.78834E?14 Gm20069 ?0.42431626 9.468444875 64.77221814 8.40762E?16 4.10937E?14 Gm27166 ?0.395023504 9.408886931 64.69484784 8.74432E?16 4.25973E?14 Atp6v0e ?0.220993968 10.11729457 64.50744858 9.61681E?16 4.66925E?14 Pkp3 0.260630633 10.14960699 64.12737993 1.16629E?15 5.64402E?14 Gm8186 ?0.384808147 9.50310457 64.06797442 1.202E?15 5.77968E?14 Rbms1 0.355457007 9.624050922 64.06762225 1.20221E?15 5.77968E?14 Mns1 ?0.413951384 9.50381656 64.02853318 1.2263E?15 5.87623E?14 Toporsos ?0.40742359 9.471023228 64.01861969 1.23249E?15 5.88664E?14 Tspan31 ?0.373860991 9.600422269 63.53853721 1.5726E?15 7.4867E?14 Tyrobp ?0.256002079 9.38856945 63.32068377 1.7565E?15 8.33514E?14 Smim11 ?0.348900564 9.59541229 62.78883943 2.30099E?15 1.08837E?13 Dusp5 0.43286125 9.605908356 62.67423675 2.43885E?15 1.14735E?13 Gnb2l1 0.185704553 10.46584315 62.67223491 2.44133E?15 1.14735E?13 Hspa8 0.143712814 11.71849799 62.55214913 2.59482E?15 1.21559E?13 3830403N18Rik 0.406986395 9.402762899 62.5092234 2.652E?15 1.23842E?13 Cd200r4 ?0.437039881 9.478380078 61.39944901 4.65941E?15 2.16892E?13 Flna 0.405123767 9.466784234 61.36779384 4.73493E?15 2.1971E?13 Vasp 0.208908637 10.30936964 61.32523678 4.83839E?15 2.23802E?13 Sub1 0.172336396 10.71571666 61.2872353 4.93268E?15 2.27446E?13 Slc16a3 0.361619599 9.420568619 61.03912894 5.59516E?15 2.57185E?13 Phf11b 0.377804723 9.570888004 60.72994541 6.54667E?15 2.99981E?13 Ostf1 0.226133252 10.18287746 60.70239948 6.63892E?15 3.0326E?13 Vimp 0.357852382 9.630389398 60.39765297 7.75053E?15 3.52938E?13 Lypd8 ?0.390113249 9.406877274 60.34483363 7.96132E?15 3.61415E?13 Mrpl52 ?0.280626279 9.865813964 60.25390377 8.33773E?15 3.77334E?13 Gbp9 ?0.384088329 9.438016299 60.13147871 8.87279E?15 4.00313E?13 Gnb2 0.225652666 10.06366194 60.06352254 9.18448E?15 4.13104E?13 Prkca ?0.382483897 9.504593373 59.99856572 9.49265E?15 4.2566E?13 Nudt21 0.308378932 9.720296786 59.88459376 1.00586E?14 4.49661E?13 1700025G04Rik 0.352987835 9.414190726 59.85240893 1.02244E?14 4.55686E?13 Cd3c ?0.153434384 10.94640525 59.77094849 1.06565E?14 4.73503E?13 Arhgdib 0.152619993 11.04633827 59.54265492 1.19672E?14 5.30136E?13 Ppp1cc 0.238784091 10.02736042 59.42918784 1.26775E?14 5.59909E?13 Eif1ax 0.353361615 9.588431037 59.17084112 1.4456E?14 6.36542E?13 Fau ?0.098888973 12.14505857 59.09913899 1.49925E?14 6.58188E?13 Rhoc ?0.387685476 9.453376689 58.34747412 2.19679E?14 9.61536E?13 Metap2 0.320908991 9.689184268 58.25059244 2.30767E?14 1.00707E?12 Sumo3 0.363648648 9.56114032 58.19517047 2.37361E?14 1.03277E?12 Gm12840 0.529072179 9.692861276 58.17118308 2.40273E?14 1.04234E?12 Tmem258 ?0.239649837 9.950028733 57.86056954 2.81371E?14 1.21373E?12 Cytip 0.291537672 9.828704032 57.86012562 2.81435E?14 1.21373E?12 Selplg 0.207253382 10.43074656 57.58231875 3.24126E?14 1.39374E?12 Napsa 0.378797818 9.426630211 57.53254537 3.32433E?14 1.42528E?12 Rps17 0.195072222 10.51281529 57.36114851 3.62702E?14 1.55052E?12 Fas 0.397724601 9.519041189 56.98223888 4.39766E?14 1.8745E?12 Tbc1d10c 0.239368702 10.02017144 56.89287049 4.60211E?14 1.95596E?12 Rpl36-ps3 ?0.368028492 9.521129953 56.68238187 5.12204E?14 2.17065E?12 Cox5b 0.205874088 10.23822956 56.60953206 5.31536E?14 2.24608E?12 Wbp1 ?0.35246475 9.588426001 56.54338706 5.49719E?14 2.31625E?12 Gm8730 0.208874873 10.17481148 56.32847716 6.13208E?14 2.57635E?12 Tmbim6 ?0.186680089 10.30239205 56.20299569 6.53619E?14 2.73829E?12 Rpl28 0.170032447 10.65239961 55.96849437 7.36417E?14 3.07638E?12 Ptpn1 0.303817614 9.726537881 55.73155029 8.30743E?14 3.46056E?12 Dnajb4 ?0.355898832 9.426224573 55.55704902 9.07857E?14 3.77108E?12 Rap1a 0.229851445 10.02152566 55.44147997 9.62831E?14 3.98813E?12 Clec12a 0.407493649 9.44431809 55.2921659 1.03882E?13 4.29076E?12 Cirbp ?0.294228645 9.79666609 55.26784248 1.05175E?13 4.32478E?12 Zfp207 0.298332611 9.707086273 55.26559828 1.05295E?13 4.32478E?12 Nkg7 0.161386214 11.93144149 55.10052132 1.14521E?13 4.69054E?12 Ybx3 0.37881093 9.487988706 55.03788543 1.18229E?13 4.82894E?12 AY036118 ?0.290741331 9.40297876 54.54808416 1.5169E?13 6.17844E?12 1110008F13Rik 0.315450921 9.63797391 54.46226129 1.58462E?13 6.43636E?12 Akt1 0.337984736 9.572351874 54.42636768 1.61383E?13 6.5369E?12 Klf10 ?0.383277795 9.492201262 54.33969083 1.68661E?13 6.81286E?12 Gpr183 0.432865552 9.527212243 54.26631414 1.75078E?13 7.05264E?12 Rps27l 0.285042685 9.82708366 54.23787371 1.7763E?13 7.13586E?12 Zbtb20 ?0.398415973 9.422971 54.10646146 1.89916E?13 7.60856E?12 Tpgs1 0.351098997 9.528091017 53.97780948 2.02767E?13 8.10128E?12 Hpgds ?0.332016761 9.41069171 53.93805376 2.06911E?13 8.2444E?12 Ppp3cc ?0.357588437 9.462008133 53.67190385 2.36927E?13 9.41481E?12 Skap1 ?0.217904307 10.0596894 53.6434695 2.40381E?13 9.52625E?12 Sepw1 ?0.202083637 10.28598242 53.38429242 2.74281E?13 1.08404E?11 Dapk2 ?0.346083162 9.615406468 53.30411175 2.85708E?13 1.12617E?11 Il12rb2 ?0.419238551 9.511930592 53.19792577 3.01577E?13 1.18553E?11 Cd53 0.216440054 10.33331217 52.86673853 3.56964E?13 1.39811E?11 Rps12 0.175598473 10.54841503 52.86346056 3.5756E?13 1.39811E?11 Cers4 ?0.370534066 9.475950653 52.85080455 3.59871E?13 1.4034E?11

    TABLE-US-00014 TABLE 2E LPL vs Spleen GeneSymbol logFC logCPM LR PValue FDR Vps37b 4.009558718 10.15969053 23880.81061 0 0 Plac8 1.581001007 10.261266 2298.679714 0 0 Arl4c ?1.096267234 9.613739122 2298.057615 0 0 Gch1 1.451694506 9.324851002 2284.134024 0 0 Hspe1 1.120375739 10.04122428 2264.096349 0 0 Rps27 0.45403743 13.06487318 2254.517103 0 0 Vcpkmt 1.340902143 9.338076923 2247.925659 0 0 Zfp36l2 1.282113838 9.632863878 2245.382999 0 0 Clic1 ?0.600757562 10.48551744 2235.204657 0 0 S1pr4 ?1.034174133 9.576670552 2210.175336 0 0 Ehd1 1.34833462 9.340919328 2195.710203 0 0 Vgll4 1.246877772 9.565538844 2194.672026 0 0 Relb 1.295849411 9.344579138 2181.915352 0 0 Rpl41 0.311798353 12.67215529 2161.526683 0 0 Chd2 1.272965567 9.362981374 2130.251594 0 0 Psmb8 ?0.521650348 10.57770041 2126.610125 0 0 Emb 0.955845249 10.04817873 2119.007483 0 0 Ninj1 1.323056016 9.256191245 2095.293443 0 0 Birc3 1.298784799 9.307476648 2040.969039 0 0 Anxa1 ?1.543033853 9.396439695 2030.512514 0 0 Hsp90ab1 0.695394356 10.97592722 2021.815733 0 0 Nrp1 ?1.298891806 9.180343991 1989.469145 0 0 Gm26532 1.340633117 9.201977563 1986.395582 0 0 Nr3c1 1.335661273 9.320572183 1975.598067 0 0 Fos 1.939072126 9.356513533 1949.123994 0 0 Ptpn7 ?1.098586112 9.378744957 1946.818351 0 0 Herpud1 1.160978832 9.421398845 1921.000688 0 0 Lpxn 0.972160773 9.577823699 1912.201507 0 0 Dusp10 1.450167924 9.339187515 1910.235573 0 0 Cebpb 1.354746762 9.345842525 1906.273395 0 0 Cfl1 ?0.480630683 11.2788147 2308.202655 0 0 Snx18 1.251604623 9.230155635 1884.711722 0 0 Cnbp 0.723097233 10.09221857 2327.043345 0 0 Smim3 1.463749514 9.239342615 2362.38165 0 0 Serpinb9 1.701828092 9.633156639 2778.027215 0 0 Nmrk1 1.703580609 9.325880651 2775.614 0 0 Lmna 1.988196567 9.500793605 2775.326852 0 0 Kcnn4 ?1.280719622 9.426740809 2763.826967 0 0 Cnn2 ?0.796651795 10.07688931 2733.152098 0 0 Ets1 0.865935776 10.06873785 2730.781656 0 0 Ifnar1 1.394023698 9.39348068 2702.666246 0 0 Nfkb2 1.416451857 9.378018127 2696.575281 0 0 Rpl38 0.479291508 11.50231551 2689.835505 0 0 Kdm2b 1.49910175 9.314276976 2668.313076 0 0 Hist1h1c 1.899413675 9.376902339 2666.207296 0 0 Tnfrsf1b 1.486664627 9.318747024 2637.622067 0 0 Fosb 1.843370572 9.275443905 2631.524006 0 0 Pfn1 ?0.471336396 12.35410724 2630.65958 0 0 Ly6c2 ?2.353611076 9.526958136 2598.695467 0 0 Tnfsf11 1.874016005 9.378727031 2597.403773 0 0 Rac2 ?0.470957461 11.26305817 2586.49052 0 0 Per1 1.427684134 9.218646505 2584.621529 0 0 Rrad 1.697678281 9.38211759 2577.710629 0 0 Ddit4 ?1.378670763 9.499428949 2548.030456 0 0 Nrip1 1.534927003 9.422635525 2531.038897 0 0 Dennd4a 1.439765985 9.24072726 2516.239312 0 0 Map3k8 1.567239393 9.298416412 2506.429161 0 0 Maff 1.476351404 9.20355435 2486.721122 0 0 Gpr183 1.345546371 9.514196163 2445.661726 0 0 Anxa6 ?0.826956439 9.887832738 2436.02059 0 0 Litaf 1.609729506 9.308467153 2431.541523 0 0 Tbc1d10c ?0.950810827 9.643337868 2373.820075 0 0 Rpl37a 0.39133888 12.46681026 2368.041434 0 0 Rbm39 0.607400682 10.52053927 2327.915783 0 0 Actr3 ?0.664337821 10.4077094 2779.972955 0 0 Plcxd2 1.339741239 9.251069352 1883.281793 0 0 Tspo ?0.647613294 10.04645974 1882.222917 0 0 Cdc42 ?0.463632709 10.51588855 1603.493133 0 0 Selk 0.625079555 9.913225022 1602.885033 0 0 Zfp3611 1.170501061 9.40624196 1597.645418 0 0 Nr4a3 1.016389034 9.172429909 1596.136019 0 0 Cxcl10 1.598883919 9.240851428 1591.202272 0 0 Zyx ?1.045672086 9.373220658 1590.948124 0 0 Lin54 1.190845071 9.222484632 1579.909581 0 0 Rpl37 0.321884655 11.9503646 1579.248798 0 0 mt-Cytb ?0.421897009 11.23550207 1579.172468 0 0 Hnrnpf ?0.455123386 10.52390819 1578.292187 0 0 Peli1 0.916803098 9.61652175 1577.029497 0 0 Malat1 0.546709942 14.46716245 1575.560381 0 0 Insig1 1.23314691 9.265929909 1572.809776 0 0 Ppp1r16b 1.143580107 9.365739316 1572.696243 0 0 Reep5 ?0.746733789 9.737965346 1566.865393 0 0 Gpx4 0.724736901 9.927359165 1560.006316 0 0 Ifng 1.694424607 9.500982203 1559.868513 0 0 Fkbp1a ?0.649924112 9.83535715 1555.689567 0 0 Stx11 1.159910256 9.327908379 1555.317141 0 0 Socs3 1.280365319 9.361846802 1552.722296 0 0 Phlda1 1.392376646 9.315470837 1528.438748 0 0 Mfsd6 1.164224359 9.264014917 1526.311577 0 0 Gzmb 1.732500572 10.06757702 1511.117786 0 0 Hbp1 1.068823826 9.308365307 1505.133032 0 0 Traf4 1.168895052 9.255444042 1498.895049 0 0 Ddit3 1.179486367 9.269696228 1491.285564 0 0 Dtx4 1.034303937 9.178017295 1490.811143 0 0 Sik1 1.038369744 9.179583562 1489.469987 0 0 AB124611 ?1.056831806 9.18576542 1487.66957 0 0 Cdc42se1 ?0.903345939 9.439589721 1606.39814 0 0 Gabpb1 1.275991664 9.34485467 1882.835108 0 0 Kpna1 1.188926205 9.266532319 1609.29646 0 0 Ldlrad4 1.213360812 9.205367734 1622.44325 0 0 Sp100 ?0.864441892 9.662295373 1868.043867 0 0 Gpr171 1.021072703 9.57636816 1834.625452 0 0 Atf3 1.325297273 9.196373801 1802.980884 0 0 Tnfaip8l2 ?1.05719081 9.395004626 1800.880544 0 0 Spn ?0.928132208 9.500542247 1791.461043 0 0 Plscr1 1.309849059 9.383402199 1789.387598 0 0 Aebp2 1.116047127 9.343970926 1785.470204 0 0 Dnajb9 1.24033724 9.281272707 1779.954261 0 0 Arl6ip5 ?0.682541103 9.890325667 1770.083233 0 0 Tob2 1.323296597 9.313589329 1750.65385 0 0 Ppp1ca ?0.517869863 10.43097858 1746.20318 0 0 Ifi27l2a ?1.251027487 10.08297152 1740.339055 0 0 Crip1 ?0.764501171 11.97479307 1738.170641 0 0 Wdr1 ?0.778630406 9.661982528 1729.765806 0 0 Stat3 1.077543403 9.486265548 1729.317606 0 0 Nabp1 1.103465745 9.487243674 1721.614948 0 0 Arpc3 0.554163297 10.38658938 1713.609041 0 0 Hk2 1.233253218 9.197875054 1701.077294 0 0 Prkcq ?1.046433802 9.3213095 1691.976912 0 0 Areg 1.913703104 9.255472455 1691.701767 0 0 Rgcc 1.578501766 9.406425986 1661.879727 0 0 Bcl2l11 1.250982211 9.230833464 1657.235805 0 0 Uhrf2 1.180900948 9.419077555 1649.885224 0 0 Prdx1 ?0.634280751 10.07947019 1648.801939 0 0 Jun 1.867730862 9.427464308 1639.113455 0 0 Ywhaq ?0.743677921 9.740986041 1631.460167 0 0 Nfkbie 1.19011788 9.287419751 1627.853905 0 0 Fut7 ?1.062699209 9.158108524 1627.249297 0 0 Rpl36 0.367174335 11.74359785 1627.246697 0 0 Txndc5 ?1.090326933 9.243654724 1617.22599 0 0 Ppia ?0.511777146 11.74358668 2794.793642 0 0 Sema4a ?1.424308061 9.241797243 2470.2212 0 0 S100a6 ?1.045197044 11.39764863 2830.471179 0 0 Itgb1 ?2.897673381 9.764726657 7266.956354 0 0 Nr4a1 2.692070423 9.419456526 7059.962503 0 0 Btg2 1.671637356 10.22813028 7057.938285 0 0 Ifrd1 2.113629694 9.751098304 6942.518787 0 0 Slc3a2 1.818065901 9.824654011 6939.012246 0 0 Rnf157 1.564061754 9.236925083 2811.277242 0 0 Cd48 ?1.552731996 10.08313072 6733.969626 0 0 Orai1 2.031182755 9.642689825 6709.374791 0 0 Ms4a6b ?1.10429405 10.51708752 6525.231353 0 0 Mxd1 2.454007515 9.403127833 6451.949777 0 0 Gpr132 1.862994857 9.638154261 6304.793777 0 0 Prdx6 1.568918578 9.939310118 6301.185371 0 0 Nfkbiz 2.356142607 9.431478134 6262.978333 0 0 Fth1 0.904024109 11.31936277 6242.555727 0 0 Bcl2a1d 2.042665993 9.693840798 6226.697766 0 0 Ddx5 0.952948791 10.94169958 6176.842997 0 0 Neurl3 2.291995793 9.422883382 6083.82123 0 0 Pde4b 2.141569839 9.459117556 6048.258702 0 0 Ramp3 2.930687962 9.642864931 5988.463883 0 0 Cd52 ?0.796245466 12.13359984 5974.617413 0 0 Kdm6b 2.638646687 9.504202492 5850.261738 0 0 Coro1a ?0.838091837 11.0659365 5816.078249 0 0 Fosl2 2.335832539 9.352839289 5695.725353 0 0 Got1 2.334162607 9.599631296 5680.076036 0 0 Gramd3 1.916759134 9.918543027 5620.679858 0 0 Zc3h12a 2.176380795 9.362848531 5610.099047 0 0 Klf2 ?1.767005406 10.48569203 5373.578517 0 0 Gadd45b 2.426306327 9.500826601 5239.796282 0 0 Hif1a 1.780128237 9.565953875 5140.654989 0 0 Nfkbia 2.074463071 10.45274542 7539.224662 0 0 Emp3 ?1.213102789 10.15411072 5128.633776 0 0 Traf1 1.897847312 9.834035476 7663.691793 0 0 Akap13 1.663872351 10.02648752 8049.393054 0 0 Junb 2.921231675 11.34612064 21369.42787 0 0 Btg1 2.116029741 11.76687431 18450.45163 0 0 Tnfaip3 3.546622186 9.77629499 17313.81847 0 0 Ubald2 2.898183798 10.20759585 16609.50842 0 0 Rgs1 3.741819446 10.58284028 16488.72974 0 0 H3f3b 1.419705723 11.96347813 16463.45133 0 0 Bhlhe40 2.475029045 10.31956761 15891.72535 0 0 Jund 2.107406468 11.36637401 15261.14463 0 0 Ctla4 3.553585624 9.803253865 14522.85331 0 0 Pnrc1 2.15434723 10.22062858 13387.98624 0 0 Pim1 2.650738825 10.39640396 12688.13388 0 0 Odc1 3.273282194 10.05458095 12438.55364 0 0 Ms4a4b ?1.388879734 11.2982785 12023.83633 0 0 Hspa5 1.762426402 10.61032756 10372.84498 0 0 Dusp5 2.558389281 9.706009226 10293.91778 0 0 Crem 3.182372679 9.742097098 10249.83742 0 0 Tnfrsf4 2.842699768 10.21808516 9824.168095 0 0 Ifngr1 1.731994699 10.73718794 9664.17174 0 0 Eif1 0.89426742 11.59142126 9507.112454 0 0 Furin 3.228695217 9.993985472 9448.5407 0 0 Ubb 1.103098222 12.5650094 9356.998296 0 0 Dusp1 3.172241508 9.640554712 9051.339287 0 0 Bcl2a1b 2.039441995 10.06905308 8924.378246 0 0 Rgs2 3.216003123 9.735808693 8865.377702 0 0 Tgif1 2.669467418 9.488421786 8609.872205 0 0 Icos 2.257604109 9.939093266 8555.625143 0 0 Gna13 2.210200992 9.714523893 8465.331307 0 0 Il21r 2.276530222 9.883875602 8187.01809 0 0 Prr7 2.588699784 9.57070472 8146.897164 0 0 Srgn 1.128130336 11.07156455 8022.942843 0 0 Nr4a2 2.380718393 9.345009261 5127.819344 0 0 Dgat1 2.502339096 9.536306398 6766.351571 0 0 Lilr4b 2.068066286 9.554402213 5105.653595 0 0 Pglyrp1 ?1.578157174 9.494896552 3736.717229 0 0 Clk1 1.412333559 9.582346831 3707.927922 0 0 Hsp90aa1 1.398095596 10.45163337 3583.071262 0 0 S100a10 ?0.838341879 11.23216634 3576.86891 0 0 Srsf5 1.06692542 9.897475047 3538.850894 0 0 AI467606 ?1.477840682 9.366543594 3529.615644 0 0 D16Ertd472e 1.538790532 9.456346393 3480.361308 0 0 Pycard ?1.186370114 9.771692598 3477.954478 0 0 Ptpn22 1.180249407 9.888180464 3456.544416 0 0 Il4ra 1.73212666 9.347559129 3449.594642 0 0 Hsd11b1 ?1.455842293 9.399808528 3413.567354 0 0 Cirbp 1.295170619 9.642760985 3349.752172 0 0 Dnaja1 1.152714388 10.49300516 3345.386455 0 0 Myl6 ?0.594146002 11.12573097 3316.559472 0 0 Fasl 1.646552093 9.427586977 3258.871927 0 0 Cd28 1.075016619 10.15896389 3221.672715 0 0 Csrnp1 1.751004019 9.322536386 3211.316895 0 0 Sqstm1 1.424220111 9.492387286 3195.177459 0 0 Klf6 1.575786258 9.681592634 3153.720756 0 0 Ptprcap ?0.830524912 10.24764013 3140.577969 0 0 Dnajb6 1.025227273 9.838018226 3095.166709 0 0 Coq10b 1.529034118 9.363466488 3063.979793 0 0 Rel 1.688619703 9.305031672 3052.495801 0 0 Itgb2 ?1.323533083 9.794213175 5122.905985 0 0 Rnf125 1.43084709 9.410691476 3015.190192 0 0 Atp1b3 ?1.188356367 9.541177167 2959.565466 0 0 Crbn 1.35989983 9.537037527 2862.044372 0 0 Lilrb4a 1.62136421 9.469548765 2849.108644 0 0 Tnfsf8 2.003699437 9.748893292 2841.22511 0 0 Fam110a 1.855968483 9.339616307 3742.547868 0 0 Lsp1 ?0.85697683 10.56861487 3749.810676 0 0 Ccnd3 ?1.115585967 9.67648159 3025.973562 0 0 Stk17b 1.121601456 9.887717235 3796.865615 0 0 Hilpda 2.295082881 9.459740509 5096.687516 0 0 P2ry10 2.00384552 9.406978436 5064.082883 0 0 Skil 2.104468774 9.381816818 5012.624057 0 0 Itgb7 ?1.084543942 10.22214203 4961.314584 0 0 Ubc 1.107062199 10.77239943 4775.13384 0 0 Hspa8 0.861483141 12.05339949 4723.217104 0 0 Arf4 1.361714648 9.759651944 4573.762943 0 0 S100a4 ?1.822225081 10.3993079 4512.496598 0 0 Lgals1 ?1.14532414 12.13039325 4400.084682 0 0 Samsn1 1.812848974 9.577321817 4380.19289 0 0 Rora 1.625105758 9.750458338 4279.038537 0 0 Cd69 1.956584843 9.648469291 4244.509669 0 0 Itk 1.558211507 9.611291599 4240.243249 0 0 Arid5a 1.670309896 9.477417365 4224.262832 0 0 Dnajb1 2.4916257 9.971238873 4317.921832 0 0 Arhgap31 1.920161613 9.463440841 4211.687512 0 0 Tnfrsf18 1.32855039 9.848184871 3814.199865 0 0 Gm12840 2.186828689 9.862794257 3868.008163 0 0 Ctsd ?1.262237547 9.86539271 4217.656935 0 0 Sh2d2a 1.535581984 9.642030852 4029.081971 0 0 Cytip 1.135941313 9.972903526 4032.840636 0 0 Hspa1a 3.929295111 10.49028171 3753.849294 0 0 Ptp4a1 1.541286869 9.515613922 4057.508994 0 0 Cdkn1a 2.230173637 9.480758236 3950.6614 0 0 Arhgdib ?0.675912229 10.95838921 4102.421066 0 0 Tspan32 ?1.853896914 9.311138568 4112.407261 0 0 Bin2 ?1.121802636 9.796752534 4061.613939 0 0 Glipr2 ?1.355596511 9.677643142 4113.247068 0 0 Rasgrp2 ?1.490656382 9.547266701 4194.458667 0 0 Ppp1r15a 1.921918974 9.417222937 4206.958192 0 0 Rps27l ?0.790585793 9.634266967 1451.086527 0 0 Lztfl1 1.239473856 9.305427356 1450.149784 0 0 Tmem123 0.845950877 9.530098905 1448.989968 0 0 Actn2 1.250413478 9.425542778 1448.693327 0 0 Ndufa4 ?0.671796207 9.843210891 1446.791341 0 0 Vim ?0.707157046 10.6775884 1442.832741 0 0 Arpc1b ?0.403868405 10.67217992 1440.52746 0 0 Phf11b ?0.946380058 9.358275331 1438.351162 0 0 Capn2 ?0.91793996 9.369740513 1428.333582 0 0 Mxi1 1.087678308 9.216625774 1426.267933 0 0 Tgif2 1.040060076 9.18888498 1415.219631 0 6.605E?308 Apobec3 ?0.782739383 9.585116167 1403.461263 3.7178E?307 2.3626E?305 Tnfrsf9 1.369904528 9.278619133 1396.683257 1.1045E?305 6.9933E?304 Esyt1 ?0.897252948 9.384944625 1382.905158 1.0894E?302 6.8727E?301 Flna ?0.978570065 9.307490367 1380.264205 4.084E?302 2.5671E?300 Usmg5 0.63064033 9.923002096 1378.078435 1.2192E?301 7.6359E?300 Adora2a 1.059391205 9.316041201 1370.747214 4.7772E?300 2.9814E?298 D8Ertd738e 0.617633538 9.895276459 1370.032005 6.8326E?300 4.2489E?298 Id3 ?1.333328527 9.200499915 1367.64552 2.2552E?299 1.3974E?297 Prdx4 ?1.059670059 9.193532854 1363.160708 2.127E?298 1.3133E?296 Sdf4 0.70306217 9.785099467 1362.622111 2.7849E?298 1.7134E?296 Nfil3 1.075323099 9.192168652 1362.527538 2.9198E?298 1.7901E?296 Il2rg 0.652629336 9.986962428 1360.726772 7.1891E?298 4.3921E?296 H2-Q4 0.817421022 9.616635172 1357.777577 3.1445E?297 1.9144E?295 Gimap6 0.618227968 10.30516051 1355.495711 9.8496E?297 5.9756E?295 Zeb1 1.106302599 9.265995084 1354.501578 1.6198E?296 9.7928E?295 Avl9 1.038144975 9.286737515 1345.10992 1.7796E?294 1.0722E?292 Rps27rt 0.555934358 11.01209013 1344.386415 2.556E?294 1.5346E?292 Btg3 1.056866822 9.23085599 1337.533638 7.8836E?293 4.7172E?291 Rsrp1 ?0.606429022 10.12693264 1333.093968 7.2695E?292 4.3348E?290 Gngt2 1.116293195 9.262770571 1332.833959 8.2796E?292 4.9203E?290 Gm20186 1.128143873 9.208968634 1331.733776 1.4358E?291 8.5034E?290 Lck ?0.448015594 10.43154115 1327.416216 1.2455E?290 7.3514E?289 Zcchc11 1.033365137 9.25900753 1326.729463 1.7562E?290 1.0331E?288 Dtx1 ?1.112944741 9.293744389 1324.589255 5.1247E?290 3.0044E?288 Polg2 1.008383697 9.189277582 1324.203906 6.2146E?290 3.6311E?288 Pde4d 0.978758479 9.184653426 1318.71138 9.7051E?289 5.6517E?287 Il22 2.340701289 9.319200911 1307.314053 2.9092E?286 1.6885E?284 Ms4a4c ?1.131637582 9.194976637 1297.197315 4.595E?284 2.6581E?282 Map3k14 1.068225388 9.243899938 1290.032314 1.6571E?282 9.5541E?281 Dusp4 0.943758908 9.167405616 1289.59139 2.0662E?282 1.1873E?280 Hexb ?0.955449076 9.253917287 1284.064918 3.2821E?281 1.8799E?279 Calm1 ?0.398344969 10.95709394 1280.097217 2.39E?280 1.3644E?278 S100a13 ?0.556791844 9.994311271 1273.779414 5.6411E?279 3.2099E?277 Lfng ?0.911433167 9.448019615 1270.087278 3.5788E?278 2.0298E?276 Abcb1a 1.030096997 9.210772627 1262.459651 1.6269E?276 9.1972E?275 Cyba ?0.443659225 10.54811046 1258.623632 1.1092E?275 6.2501E?274 Tmsb4x ?0.267366545 14.35989227 1257.793098 1.6807E?275 9.4401E?274 Ccr5 1.14137339 9.386994832 1254.698733 7.906E?275 4.4263E?273 Dynll1 ?0.533721052 10.16004138 1245.450142 8.0885E?273 4.514E?271 Cdc25b ?1.011124608 9.240089381 1241.171393 6.8823E?272 3.8286E?270 Itpkb 0.954598204 9.393345749 1231.44857 8.9273E?270 4.9504E?268 Ifi47 ?1.019302639 9.324191671 1226.120429 1.2843E?268 7.0989E?267 Pim3 1.120079893 9.232710072 1223.737702 4.2313E?268 2.3315E?266 Mir142hg 1.002778292 9.203588598 1221.931528 1.0447E?267 5.7384E?266 Slc38a2 0.980080989 9.356984714 1217.969539 7.5865E?267 4.154E?265 Add3 ?0.936691018 9.260409169 1206.100053 2.8813E?264 1.5727E?262 H2-Q6 0.761009186 9.610491146 1203.68587 9.644E?264 5.2475E?262 Asb2 1.117112448 9.36183005 1199.915336 6.3635E?263 3.4518E?261 Sesn3 0.935543404 9.346703299 1196.855271 2.9426E?262 1.5912E?260 Fus 0.646782373 9.766633699 1195.296437 6.4197E?262 3.4607E?260 Myo1f ?0.873721079 9.342854295 1195.091822 7.1119E?262 3.822E?260 Hsph1 1.166689856 9.349269322 1192.706446 2.3464E?261 1.2571E?259 Ptpn6 ?0.882603255 9.388975554 1187.971213 2.509E?260 1.3401E?258 Def6 ?0.806896845 9.38910456 1185.235824 9.8624E?260 5.2515E?258 Sub1 0.452332616 11.00148656 1179.659467 1.6066E?258 8.5285E?257 Abcb1b 1.031343273 9.207220814 1177.281825 5.28E?258 2.7944E?256 4930523C07Rik 0.720136823 9.698992642 1167.683789 6.4357E?256 3.3957E?254 Traf3ip3 ?0.853000826 9.34798616 1163.769696 4.5631E?255 2.4004E?253 Ube2b 0.610256432 9.791411125 1160.573155 2.2593E?254 1.1849E?252 Sytl3 0.90845429 9.39100109 1157.949128 8.3997E?254 4.392E?252 Smad7 0.993817761 9.276173853 1155.62533 2.6872E?253 1.4009E?251 Casp4 0.970497764 9.304035945 1150.905397 2.8518E?252 1.4822E?250 Cxcr3 ?0.782625551 9.636541469 1140.943197 4.1712E?250 2.1616E?248 Zc3hav1 0.783012423 9.545786673 1139.080842 1.0593E?249 5.4732E?248 Prkar1a 0.51534633 9.989784924 1129.99109 1.0013E?247 5.1583E?246 Stat4 0.87162553 9.393938041 1124.641897 1.456E?246 7.4785E?245 Pabpc1 0.354811986 10.74945661 1118.678903 2.8785E?245 1.4741E?243 Tpst2 ?0.683138851 9.562387953 1118.595548 3.0011E?245 1.5324E?243 Camk2n1 1.044877893 9.246195314 1099.512516 4.2154E?241 2.1461E?239 Rcsd1 ?0.841278225 9.314558222 1097.472831 1.1699E?240 5.9389E?239 Irf4 0.93980886 9.17631645 1097.239553 1.3148E?240 6.6549E?239 Fam65b ?0.901719998 9.278382726 1091.496759 2.3282E?239 1.175E?237 Lbr ?0.742593678 9.489271039 1091.478886 2.3491E?239 1.1822E?237 Apbb1ip ?0.734076752 9.476988831 1091.350028 2.5056E?239 1.2573E?237 Ctla2a 0.918347724 10.12270773 1087.781562 1.4945E?238 7.4778E?237 Ndfip1 0.723456574 9.542168744 1087.435345 1.7773E?238 8.867E?237 Ubl5 0.460259851 10.14988664 1085.990773 3.6621E?238 1.8218E?236 Fam46a 1.216427371 9.373607718 1084.141952 9.2377E?238 4.5825E?236 Kcnab2 ?0.822790253 9.316762961 1080.193997 6.6626E?237 3.2957E?235 Ahr 1.055054007 9.234738845 1079.788424 8.1619E?237 4.0259E?235 Hbb-bs ?0.875475832 9.153071488 1078.386874 1.646E?236 8.0958E?235 Osgin1 0.942209138 9.166127069 1076.502703 4.2261E?236 2.0728E?234 Il12rb2 1.030381194 9.249916639 1075.546924 6.8183E?236 3.3348E?234 Fau 0.234758491 12.21265562 1071.940035 4.146E?235 2.0221E?233 Mier1 0.825393149 9.428014107 1070.148889 1.0161E?234 4.942E?233 mt-Co3 ?0.275253772 12.22313569 1069.075336 1.7389E?234 8.4338E?233 Rasa3 ?0.903689186 9.255738017 1058.61195 3.2696E?232 1.5814E?230 E2f2 ?0.8392467 9.159524644 1053.99296 3.2995E?231 1.5914E?229 Ptp4a2 0.574398647 9.844619398 1050.023682 2.4054E?230 1.157E?228 Rpl27 0.281823678 11.36103815 1048.388203 5.4533E?230 2.6158E?228 Pomp ?0.550362574 9.774637428 1047.45567 8.6966E?230 4.16E?228 Ube2j1 0.830125377 9.345358827 1046.789853 1.2136E?229 5.7893E?228 Dbi ?0.752178664 9.531198139 1041.960926 1.3604E?228 6.4718E?227 Rbpj 0.922052977 9.288273063 1040.747485 2.4969E?228 1.1846E?226 Racgap1 ?1.030040933 9.267128908 1032.284027 1.7258E?226 8.1657E?225 Rinl ?0.701653781 9.499382409 1031.73747 2.2688E?226 1.0706E?224 Map1lc3a 0.930943669 9.222575159 1025.770847 4.4945E?225 2.1151E?223 Stk38 ?0.839920214 9.310126564 1016.59735 4.4323E?223 2.0802E?221 Rom1 ?0.922814364 9.186853274 1016.525731 4.5941E?223 2.1503E?221 Ier5l 0.849227509 9.153032957 1016.270631 5.2197E?223 2.4366E?221 Atic ?0.890335932 9.211770003 1015.191565 8.9576E?223 4.1703E?221 Bcl2l1 0.976985439 9.276721393 1013.469591 2.1207E?222 9.8469E?221 Abracl ?0.493515818 10.02337263 1012.64476 3.2046E?222 1.484E?220

    TABLE-US-00015 TABLE 2F IEL vs Spleen GeneSymbol logFC logCPM LR PValue FDR Rgs1 4.262079706 10.67767028 16605.4657 0 0 Cd160 1.993212278 9.512810414 2102.741037 0 0 Actn2 1.659090902 9.531861239 2089.000144 0 0 Pglyrp1 ?1.501489373 9.640341062 2053.499203 0 0 Gngt2 1.675642097 9.359655682 1985.016955 0 0 Ifng 2.245135482 9.611310602 1971.078308 0 0 Atp1b3 ?1.310004856 9.650252258 1944.791465 0 0 Osgin1 1.626820627 9.262214394 1937.431479 0 0 Ubc 0.849179414 10.53817088 1905.724403 0 0 Ckb 1.739428091 9.348935381 1902.202899 0 0 Ly6c2 ?2.504398179 9.67510089 2151.306825 0 0 Rps19 ?0.525105269 12.68187153 1875.342571 0 0 mt-Cytb ?0.557479877 11.32634498 1739.463783 0 0 Litaf 1.571091076 9.323626777 1730.972116 0 0 Lgals1 ?0.864462482 12.37139459 1689.543998 0 0 Dapk2 1.539044461 9.314819002 1679.288972 0 0 Ms4a4b ?0.585021214 11.67414781 1629.224356 0 0 Emp3 ?0.828192522 10.36526113 1589.900258 0 0 Rplp0 ?0.402486196 12.41844544 1541.987891 0 0 Ddx5 0.577762999 10.6942535 1491.549434 0 0 Gpr34 1.45129199 9.307758489 1483.078432 0 0 Rps8 ?0.501436752 11.65645422 1855.710838 0 0 Tspan32 ?1.857483249 9.43206433 2309.54436 0 0 Ubb 0.587733421 12.12717783 2159.371295 0 0 Btg2 1.389291695 10.01747436 2562.865196 0 0 Junb 2.384505986 10.73966867 7545.660651 0 0 Dusp1 3.030607317 9.53465407 4234.923152 0 0 Itgb1 ?2.870641087 9.973925881 4205.16325 0 0 Cd69 2.283758528 9.690665292 4092.761065 0 0 Abi3 2.236724652 9.438058313 4047.605221 0 0 Jund 1.265368178 10.81995682 3897.741946 0 0 Fos 3.359701466 9.582648832 3867.81214 0 0 Klf2 ?1.774396751 10.69289158 3810.169639 0 0 Jun 2.95696533 9.570921865 3765.507669 0 0 Ms4a6b ?0.806571053 10.73301473 2352.116967 0 0 Btg1 1.17808929 11.04741079 3248.989903 0 0 Cxcr6 1.462933277 10.57309895 3323.908054 0 0 Hspa1a 3.860361274 9.996281107 3132.38968 0 0 Ctsw 1.202949028 10.10085922 2877.890061 0 0 Rasgrp2 ?1.634496669 9.675037233 2872.189184 0 0 Klf6 1.892054861 9.70857084 2829.292235 0 0 Asb2 2.111944299 9.548775661 2817.279328 0 0 Amica1 1.953284071 9.478445084 2779.961972 0 0 Furin 2.413436865 9.609122409 2776.783836 0 0 Itm2b 0.705576535 11.21870081 2774.794338 0 0 Cd3g 0.678489262 11.28334695 2737.378773 0 0 Itgae 2.265437232 9.373851416 3164.762104 0 0 Crip1 ?0.770514594 12.07555511 1477.500162 0 0 mt-Atp6 ?0.388845529 12.61166871 1444.234208 0 0 S100a4 ?1.18365345 10.66366393 1435.922499 0 0 Rpl8 ?0.45414365 11.59716841 1428.757788 0 0 mt-Co3 ?0.393548607 12.29236826 1428.055822 0 0 Skil 1.402316776 9.30797085 1426.937262 0 0 Ifi2712a ?1.450531959 10.18524586 1396.949077 9.6694E?306 3.1179E?303 Gadd45b 1.580780927 9.341379728 1381.831612 1.8641E?302 5.9015E?300 Ccl4 3.686687264 10.50318841 1373.907492 9.8271E?301 3.0555E?298 AW112010 0.590006061 11.88680588 1344.968361 1.9103E?294 5.8353E?292 Hic1 1.42721533 9.293785776 1341.859244 9.0517E?294 2.7174E?291 Ly6g5b 1.413897369 9.280717651 1325.037738 4.0946E?290 1.2084E?287 Bcl2a1d 1.240479361 9.479817541 1319.618632 6.1637E?289 1.7887E?286 Dusp2 1.29812206 9.739066913 1311.780358 3.1131E?287 8.8861E?285 S1pr4 ?1.041809426 9.681229931 1297.038961 4.9739E?284 1.3969E?281 Sgk1 ?1.39232095 9.335085016 1280.164904 2.3104E?280 6.3856E?278 Mapkapk3 1.160234155 9.443868055 1274.296635 4.3548E?279 1.1848E?276 Rps3a1 ?0.385150761 11.68169968 1260.878972 3.5881E?276 9.6118E?274 Glipr2 ?0.940668004 9.853250247 1246.002646 6.1347E?273 1.6185E?270 Rps20 ?0.56020392 10.99041833 1243.157128 2.5479E?272 6.6216E?270 Rps17 ?0.563047054 10.69497822 1233.249546 3.6252E?270 9.2825E?268 Malat1 0.588800482 14.37997813 1223.18936 5.5673E?268 1.4049E?265 Tnfaip3 1.426715741 9.302203564 1222.117432 9.5192E?268 2.3678E?265 Slamf6 ?1.452746909 9.424776552 1207.916821 1.1608E?264 2.8467E?262 Lag3 1.863437794 9.404044177 1184.663271 1.3135E?259 3.1764E?257 Rps6 ?0.367229946 12.18088129 1181.87815 5.2931E?259 1.2625E?256 Bcl2a1b 1.013192394 9.692981785 1171.176339 1.1209E?256 2.6373E?254 S100a10 ?0.611743271 11.3818739 1171.100606 1.1641E?256 2.7027E?254 Ehd1 1.245626999 9.349651414 1170.157928 1.8659E?256 4.2748E?254 H2afz ?0.815169676 10.88644706 1166.361727 1.2472E?255 2.8202E?253 Apol9b 1.139074323 9.225731368 1166.140287 1.3933E?255 3.1103E?253 Cd38 1.278780699 9.321520345 1155.58763 2.7384E?253 6.0356E?251 Rpl29 ?0.451553781 11.21299617 1154.787878 4.0861E?253 8.8935E?251 Rbpj 1.213743294 9.354366621 1142.009944 2.4458E?250 5.2575E?248 Gpr171 0.992352465 9.586322101 1112.18461 7.4241E?244 1.5764E?241 Dnajb1 1.309635611 9.56298969 1106.132968 1.5343E?242 3.2188E?240 Plac8 1.290227127 10.01229068 1102.413441 9.8705E?242 2.046E?239 Aldoa 0.640398084 10.2226702 1095.154589 3.7326E?240 7.6461E?238 Rps5 ?0.368948183 12.10797403 1089.924265 5.1144E?239 1.0355E?236 Anxa1 ?1.436448141 9.514591367 1086.543383 2.7773E?238 5.5584E?236 Rgs2 1.44060445 9.304465505 1075.968262 5.522E?236 1.0926E?233 Rgs10 1.055568254 9.634558763 1068.444474 2.3845E?234 4.665E?232 Rplp1 ?0.407337669 11.58510276 1067.917965 3.1033E?234 6.0039E?232 Rpl21 ?0.372542865 11.67596432 1061.07808 9.5166E?233 1.8209E?230 Camk2n1 1.271116935 9.309540856 1052.321018 7.6181E?231 1.4418E?228 Arhgdib ?0.41229592 11.15444337 1045.725621 2.0672E?229 3.8703E?227 Neat1 1.195998299 9.446396783 1025.145275 6.1469E?225 1.1386E?222 Rpl32 ?0.325305646 12.45425636 1010.039595 1.1804E?221 2.1635E?219 Mxd1 1.25624995 9.266182111 1003.274001 3.4883E?220 6.327E?218 mt-Nd4 ?0.510585429 10.65212475 996.4531242 1.0598E?218 1.9024E?216 Ctla4 1.2913399 9.290657695 984.1703115 4.9556E?216 8.8048E?214 Rps4x ?0.339096552 11.85896399 976.6294311 2.159E?214 3.7972E?212 Hbb-bs ?1.006330094 9.230738885 976.6079899 2.1823E?214 3.7997E?212 Cd3e 0.493125143 10.54127341 975.2453323 4.3162E?214 7.441E?212 Srgn 0.536001419 10.69028649 969.6923156 6.9529E?213 1.1869E?210 Rps7 ?0.361780836 11.89493797 958.9162718 1.5296E?210 2.5858E?208 Smim3 1.114768141 9.249649885 955.3599849 9.0702E?210 1.5186E?207 Fasl 1.135893724 9.368313371 945.8583186 1.0545E?207 1.7487E?205 Nr4a1 1.432783006 9.262165007 943.1908477 4.0077E?207 6.5831E?205 Lpxn 0.860705006 9.573491654 939.7712079 2.2194E?206 3.6117E?204 Nrp1 ?1.151078008 9.269548869 922.0870285 1.5504E?202 2.4995E?200 Hcst 0.587237628 10.53140426 918.4462426 9.5912E?202 1.5321E?199 Cd9 ?1.245593031 9.317378372 913.1639268 1.3495E?200 2.1361E?198 Susd3 0.938349002 9.478294991 907.2901186 2.553E?199 4.0047E?197 Rpl38 0.391339203 11.2758405 896.3541086 6.0869E?197 9.4629E?195 Itgb7 ?0.559510469 10.45112407 894.290745 1.7098E?196 2.6346E?194 Bin2 ?0.632699558 9.986168083 887.0930266 6.2757E?195 9.5853E?193 Rps11 ?0.292018742 12.31112894 886.2098796 9.7646E?195 1.4784E?192 Neurl3 1.119559655 9.280786296 858.9627424 8.1858E?189 1.2287E?186 Hmgb2 ?0.947980515 10.87140735 857.9515297 1.358E?188 2.021E?186 Tnfrsf25 ?1.141346675 9.325984856 852.1182469 2.518E?187 3.7155E?185 Il21r 0.94141111 9.484637076 838.9198588 1.8639E?184 2.7273E?182 H3f3b 0.374221947 11.35853232 838.6673109 2.1151E?184 3.069E?182 Ccr7 ?1.230256877 9.274847488 834.9590376 1.3537E?183 1.9481E?181 Sh2d1a ?0.93528822 9.633910801 834.4242155 1.7693E?183 2.5252E?181 Fam65b ?1.061529155 9.353791259 831.196016 8.9052E?183 1.2606E?180 Rpsa ?0.326786093 11.58222174 826.7117255 8.4056E?182 1.1803E?179 S1pr1 ?1.045505474 9.378176807 823.4981118 4.1999E?181 5.8503E?179 Ldlrad4 1.006112174 9.235552707 809.9266305 3.7484E?178 5.18E?176 Prdx4 ?1.066608254 9.276690245 808.031196 9.6816E?178 1.3274E?175 AB124611 ?1.023170957 9.268582849 807.8449459 1.0628E?177 1.4457E?175 Klf3 ?1.186891126 9.31685725 805.2114908 3.9719E?177 5.3611E?175 Nedd9 0.99989357 9.334070971 800.3269765 4.5811E?176 6.1359E?174 Ppp1r15a 1.114264497 9.318633918 796.3865749 3.2937E?175 4.3779E?173 Ahr 1.105381504 9.279326539 796.2018926 3.6128E?175 4.7656E?173 Rps2 ?0.38282646 11.545051 795.678974 4.6939E?175 6.1451E?173 Rpl35a ?0.310787517 11.63257095 791.8001781 3.2724E?174 4.2521E?172 Gzmb 1.515904822 9.944249279 782.411994 3.598E?172 4.6406E?170 Cish 0.979424054 9.414754089 780.9865643 7.3449E?172 9.4036E?170 Akap13 0.752120035 9.708953687 778.3867251 2.6993E?171 3.4307E?169 Gzma 1.951748481 11.34314196 773.458912 3.1819E?170 4.0148E?168 Gadd45g 1.350903661 9.293836915 771.2493214 9.6188E?170 1.2049E?167 Ccr5 1.055098668 9.400279713 767.3790788 6.6776E?169 8.305E?167 Ccl5 1.208924468 13.67587951 757.739843 8.3271E?167 1.0283E?164 Limd2 ?0.586230549 10.26889424 757.5864436 8.9918E?167 1.1026E?164 Plekhf1 1.019330549 9.263192932 728.2887944 2.11E?160 2.5692E?158 Rpl28 ?0.391130178 10.77653256 726.4014939 5.4284E?160 6.5639E?158 Nkg7 0.578359003 11.62073593 723.3444287 2.5085E?159 3.0123E?157 Sema4a ?1.025446315 9.351055105 722.8049034 3.2865E?159 3.9195E?157 Rps12 ?0.454488734 10.7143326 716.5056658 7.7001E?158 9.1207E?156 Mir142hg 0.981584406 9.249452604 714.3596403 2.255E?157 2.653E?155 Nr4a2 1.310458939 9.245298726 710.3616104 1.6693E?156 1.9507E?154 Plk3 1.067784554 9.346984393 699.4513487 3.9356E?154 4.5685E?152 Rps27a ?0.296136488 11.76900547 698.3920575 6.689E?154 7.7132E?152 Bhlhe40 0.858136819 9.662074795 696.7934058 1.4894E?153 1.7061E?151 Ms4a4c ?1.088441443 9.282107963 693.3564808 8.3251E?153 9.4743E?151 mt-Nd1 ?0.380326867 11.2629884 690.4436462 3.5795E?152 4.0471E?150 Med10 0.73641002 9.523002102 687.5656361 1.5124E?151 1.699E?149 Rpl10a ?0.355092665 11.17378178 687.3757938 1.6632E?151 1.8564E?149 S100a6 ?0.583209178 11.66425634 676.2798097 4.3047E?149 4.7741E?147 Flna ?0.915188626 9.394672482 676.1026688 4.704E?149 5.1839E?147 Slc3a2 0.786942874 9.537633493 675.8712633 5.2819E?149 5.7841E?147 Fth1 0.349796278 10.96871293 669.4836567 1.2939E?147 1.4081E?145 Pim1 0.899833541 9.699776734 669.2064071 1.4866E?147 1.6077E?145 Ermn 1.063075406 9.259478586 668.7191115 1.8974E?147 2.0394E?145 Rps18 ?0.298129514 12.48866118 668.1114963 2.5722E?147 2.7476E?145 Pnrc1 0.704253854 9.692827582 667.913303 2.8405E?147 3.0158E?145 Hist1h1c 1.172958994 9.29446422 656.8278894 7.3146E?145 7.7189E?143 Pdlim1 ?0.922335931 9.370260078 656.2072833 9.9807E?145 1.0469E?142 Rnf149 0.917040109 9.334081045 653.6098152 3.6648E?144 3.8211E?142 Tff1 1.026000433 9.22546748 648.9038566 3.8681E?143 4.009E?141 Hsd11b1 ?0.77670808 9.561647283 629.6623451 5.9191E?139 6.0985E?137 Cd47 ?0.476883342 10.29751655 617.2298436 2.994E?136 3.0666E?134 Rpl31 ?0.363933126 10.81463059 616.0827323 5.3181E?136 5.4151E?134 Gpr18 0.981990926 9.352283484 615.5237916 7.0359E?136 7.1227E?134 Pycard ?0.59566406 9.979121804 610.9981535 6.7865E?135 6.8305E?133 Runx3 0.728527491 9.562720515 609.0561824 1.7949E?134 1.7961E?132 Ubac2 0.756993118 9.471979592 604.7793569 1.5285E?133 1.5208E?131 Gimap7 0.557513099 10.02409941 604.3949278 1.853E?133 1.8332E?131 Cd27 ?1.036859444 9.404666177 603.3770562 3.0851E?133 3.0349E?131 Fut7 ?0.813298011 9.241991725 601.2763096 8.8347E?133 8.6421E?131 Cd7 1.054957536 9.801914175 598.3586942 3.8089E?132 3.705E?130 Hspa8 0.305700865 11.60840881 597.894494 4.8058E?132 4.6488E?130 Coro1a ?0.302618405 11.3347192 596.775756 8.4159E?132 8.096E?130 Cdc25b ?0.926265339 9.328139226 594.1243079 3.1756E?131 3.0381E?129 Gramd3 ?0.898686441 9.420567345 593.3827375 4.6038E?131 4.3804E?129 Ccl3 2.761276819 9.496917967 588.348771 5.729E?130 5.4213E?128 Nsg2 ?0.821700106 9.230550514 581.3504475 1.9069E?128 1.7948E?126 Prdx6 0.617318162 9.661183975 580.9418509 2.34E?128 2.1905E?126 Dok2 ?0.748098844 9.542583178 575.0766093 4.416E?127 4.1118E?125 Apol9a 0.687625082 9.203228477 574.0747894 7.2937E?127 6.7552E?125 Mptx1 0.725791051 9.203528419 573.8140249 8.3113E?127 7.6569E?125 Ptpn22 0.614248744 9.745489627 570.9953324 3.4104E?126 3.1254E?124 Gm26532 0.863998792 9.218766316 567.0071602 2.5139E?125 2.2917E?123 Adgrg1 0.666167406 9.202504636 561.9069435 3.2344E?124 2.9332E?122 Prdx5 0.626969797 9.618053492 558.211872 2.0587E?123 1.8573E?121 Rps3 ?0.233251504 11.90667401 557.2016632 3.4147E?123 3.0648E?121 Ypel3 0.698378192 9.67572785 555.8482393 6.7262E?123 6.006E?121 Pmepa1 0.722569784 9.209646525 555.5816234 7.6873E?123 6.8291E?121 P2rx7 0.872094397 9.290334827 553.6533556 2.0195E?122 1.7849E?120 Rftn1 0.780530727 9.38529654 553.5817803 2.0932E?122 1.8408E?120 Rps15 ?0.281171407 11.39272392 550.2446875 1.1137E?121 9.7444E?120 Ier2 0.664096741 9.809742381 549.9735323 1.2757E?121 1.1106E?119 Cotl1 0.432498996 10.57561017 548.7207422 2.3894E?121 2.0698E?119 Rpl14 ?0.278682856 11.83763413 544.6000766 1.8824E?120 1.6226E?118 Id2 0.489582245 10.94720261 538.5213781 3.9546E?119 3.392E?117 Nabp1 0.775579548 9.441457345 538.4457335 4.1073E?119 3.5057E?117 Serpina3g 0.932154861 9.583786505 537.5406431 6.4634E?119 5.4675E?117 Ywhaq ?0.525927234 9.879377712 537.5390489 6.4686E?119 5.4675E?117 mt-Nd2 ?0.534446067 9.939205918 537.222614 7.5797E?119 6.3757E?117 Cpd 0.725500446 9.212757368 536.6810278 9.942E?119 8.3226E?117 Samhd1 ?0.727184214 9.58455645 535.8115532 1.5368E?118 1.2804E?116 Prkcg ?0.768998828 9.429526956 533.8722419 4.06E?118 3.3663E?116 Slc9a3r1 0.50081584 9.871867879 531.9985034 1.0379E?117 8.5651E?116 Prdx1 ?0.436919808 10.23820402 515.5474221 3.9379E?114 3.2343E?112 Cd2 ?0.451491441 10.25558839 514.4176199 6.9355E?114 5.6695E?112 Ly6c1 ?0.845983228 9.223958343 514.1576066 7.9003E?114 6.4281E?112 Rom1 ?0.874065681 9.273403894 511.8000784 2.5738E?113 2.0844E?111 Aim2 0.8277845 9.261912654 504.4701056 1.0125E?111 8.1526E?110 Sec61g 0.400877072 10.22586732 504.4630547 1.016E?111 8.1526E?110 Gstm5 0.902058784 9.230637004 503.3328649 1.7898E?111 1.4296E?109 mt-Co2 ?0.264507091 11.49074591 502.8822201 2.2432E?111 1.7835E?109 Tspo ?0.42076822 10.19442167 501.8646488 3.7348E?111 2.9559E?109 Map3k8 0.886100204 9.270683592 501.6110699 4.2407E?111 3.3411E?109 St6galnac3 0.883785968 9.281772021 499.8464583 1.0265E?110 8.0514E?109 Ucp2 0.468618682 10.01352738 497.1644322 3.9349E?110 3.0724E?108 Lsp1 ?0.374419062 10.79768635 495.9820381 7.1155E?110 5.531E?108 Hba-a1 ?0.61069366 9.205576591 495.0296708 1.1466E?109 8.8734E?108 Fgl2 0.806015418 9.503341859 493.6372642 2.3035E?109 1.7747E?107 Efhd2 0.593457057 9.629719472 493.1402658 2.9548E?109 2.2665E?107 Stk17b 0.544966261 9.749708021 491.2101692 7.7713E?109 5.9348E?107 Cd4 0.566897576 9.757520572 491.0179769 8.5568E?109 6.5062E?107 1600014C10Rik 0.804522875 9.336807011 490.7645054 9.7155E?109 7.355E?107 Cmah ?0.647892227 9.221071111 490.4164898 1.1566E?108 8.7182E?107 Wbp1 0.78371793 9.336308361 483.5355138 3.6344E?107 2.7277E?105 Smad7 0.824276691 9.295734689 482.9761258 4.81E?107 3.5945E?105 5430421N21Rik 0.787547001 9.216296912 482.101492 7.4553E?107 5.5475E?105 Igfbp4 ?0.890958237 9.223424268 479.0282947 3.4768E?106 2.5761E?104 Rhob 0.762632846 9.215115957 477.1124388 9.0798E?106 6.699E?104 Rpl4 ?0.233195869 11.68632408 476.3582095 1.3249E?105 9.7341E?104 Ccl1 3.115968281 9.596379606 475.9162433 1.6534E?105 1.2096E?103 Gramd1a 0.681833843 9.490134539 474.69533 3.0482E?105 2.2207E?103 Prkar1a 0.427630344 9.98187113 474.2673884 3.7771E?105 2.7403E?103 Lilrb4a 0.909524168 9.363990735 472.8669947 7.6189E?105 5.5046E?103 Kcnn4 ?0.660071444 9.574572775 471.6792428 1.3815E?104 9.94E?103 Rps26 ?0.315405888 10.92694571 470.3775483 2.6522E?104 1.9004E?102 Isg20 0.825783773 9.282559299 468.9706448 5.3674E?104 3.8302E?102 Tnfsf11 0.884737646 9.274816839 466.9953633 1.4441E?103 1.0263E?101 Cd82 0.481854251 10.17845419 466.5620801 1.7943E?103 1.27E?101 Tpm4 ?0.612729082 9.709350388 466.1516286 2.204E?103 1.5537E?101 2810474O19Rik ?0.765852699 9.427307461 464.4024391 5.2949E?103 3.7175E?101 Gcnt2 0.670930148 9.208179265 463.4609738 8.4865E?103 5.9344E?101 Dusp5 0.823340659 9.351651501 459.0693513 7.6633E?102 5.3373E?100 Dok1 0.747411005 9.32999967 458.9167176 8.2724E?102 5.7386E?100 Tmem256 0.61810974 9.531009831 458.096344 1.2478E?101 8.622E?100 Adgrg5 0.685604528 9.212262974 457.8845661 1.3875E?101 9.5494E?100 Pfdn5 0.361119936 10.44951346 454.7727164 6.5986E?101 4.5234E?99 Traf1 0.665520256 9.518543672 454.3640596 8.0981E?101 5.5296E?99 Rps10 ?0.264905947 11.16449461 454.1113701 9.1913E?101 6.2515E?99 Itga1 0.74909445 9.228969457 453.097764 1.5274E?100 1.03485E?98 Lilr4b 0.858881674 9.344215918 451.2048016 3.9438E?100 2.66163E?98 Rasa3 ?0.781161253 9.347767194 450.5315409 5.5263E?100 3.71524E?98 Izumo1r ?1.216792535 9.314620339 448.5664961 1.4794E?99 9.90745E?98 Rpl12 ?0.365836896 10.8499333 448.4935947 1.5344E?99 1.02367E?97 Tnfaip8l2 ?0.656173911 9.525752027 444.3087909 1.24939E?98 8.30319E?97 Txndc5 ?0.757766414 9.346388362 443.7890437 1.62111E?98 1.07326E?96 Lef1 ?0.800271093 9.363794019 442.1237796 3.7345E?98 2.46307E?96 Prrt1 0.602550339 9.204288164 440.8898295 6.93083E?98 4.55395E?96 St6galnac2 0.639011431 9.20894446 436.5796195 6.00979E?97 3.93393E?95 Tcf7 ?0.852294436 9.454127633 429.8926644 1.71494E?95 1.11837E?93 Frmd4b 0.73174728 9.22917364 425.8933346 1.27266E?94 8.26851E?93 Bcl2 ?0.888178196 9.591081981 423.7626419 3.7023E?94 2.39645E?92 Rpl10 ?0.249865961 11.48093566 423.7211872 3.78002E?94 2.43769E?92 Penk 1.86460897 9.328467588 423.0442881 5.30673E?94 3.40962E?92 Rps24 ?0.243016167 11.88186655 420.8311132 1.60896E?93 1.02997E?91 Dgka ?0.685020808 9.458704546 420.0237087 2.41149E?93 1.53805E?91 Cox17 0.477747199 9.819102932 418.0059291 6.62952E?93 4.21289E?91 Nt5e 0.784054933 9.259960638 417.8805506 7.05947E?93 4.4698E?91 Plcxd2 0.772699883 9.245478992 414.2485755 4.35845E?92 2.74961E?90 Reep5 ?0.488697469 9.868713475 412.7987005 9.01418E?92 5.66624E?90 Cd244 0.705384043 9.214900481 411.9645549 1.36929E?91 8.57629E?90 Ifitm3 ?1.027216242 9.940629422 411.873886 1.43295E?91 8.94286E?90 Arid5a 0.713220342 9.354599172 411.1681094 2.04108E?91 1.26926E?89 Myl6 ?0.261289897 11.30790412 409.3658743 5.03686E?91 3.12106E?89 Ppp2r2c 0.519156642 9.197405353 408.2335859 8.88447E?91 5.48569E?89 Ly6e ?0.333786835 10.78770429 406.6496223 1.96528E?90 1.20917E?88 Sike1 ?0.692535807 9.394852686 405.2866661 3.89146E?90 2.38585E?88 Ndufa4 ?0.441522604 9.985023527 404.1704464 6.80914E?90 4.16003E?88 1500009L16Rik ?0.898102208 9.364736674 404.1467767 6.89041E?90 4.19496E?88 Nt5c ?0.559849517 9.571043992 402.8215085 1.33885E?89 8.12269E?88 Icam2 ?0.738300082 9.298358105 401.7927545 2.24221E?89 1.3556E?87 Id3 ?0.987410593 9.302895586 399.6777741 6.47261E?89 3.89969E?87 Znrf1 0.698891421 9.390734877 399.2341991 8.08426E?89 4.8539E?87 Kcnab2 ?0.660175762 9.41152398 398.2712409 1.30998E?88 7.83829E?87 Satb1 ?0.760996699 9.4527421 396.169245 3.75709E?88 2.24036E?86 Ccdc107 0.654848921 9.378243207 393.4693721 1.45412E?87 8.64132E?86 Add3 ?0.706199058 9.360336043 393.3945083 1.50972E?87 8.94125E?86 Ppia ?0.251687631 11.88768862 392.2838879 2.63436E?87 1.5549E?85 Tnf 0.969127686 9.271925014 391.1558162 4.6372E?87 2.7278E?85 Fkbp1a ?0.411230721 9.974773786 389.5576999 1.03316E?86 6.05702E?85 Ppp1r16b 0.748777981 9.348007448 389.2877898 1.18284E?86 6.91129E?85 Acot7 0.540236341 9.607603124 387.5039543 2.8925E?86 1.68442E?84 Rps25 ?0.258837917 11.05911713 387.094298 3.55188E?86 2.06151E?84 Gfi1 0.715163437 9.250672945 386.1958488 5.57257E?86 3.22358E?84 Plscr1 0.753523551 9.338606765 381.7694026 5.12551E?85 2.95514E?83 Gm10076 0.602471507 9.555749844 380.8630837 8.07337E?85 4.63939E?83 Ubl5 0.359954618 10.09812301 377.4561365 4.45456E?84 2.55141E?82 Capg 0.525034521 10.11973006 375.9622763 9.41997E?84 5.37772E?82 Xcl1 2.334924237 9.473572265 373.6035421 3.07328E?83 1.74875E?81 Hemk1 0.683812596 9.224911739 373.2693929 3.63374E?83 2.06094E?81 Fam101b ?0.826001151 9.238078205 371.9127234 7.17361E?83 4.05542E?81 Sub1 ?0.312398738 10.73812115 371.8733076 7.31678E?83 4.12297E?81 Tnfrsf1b 0.703666663 9.266812765 370.9442092 1.16577E?82 6.54784E?81 Arl4c 0.52714599 9.791946773 366.58533 1.03677E?81 5.80458E?80 Hba-a2 ?0.455920224 9.198210536 366.2675731 1.21582E?81 6.78522E?80 AU020206 0.673883407 9.367737735 365.5506469 1.74169E?81 9.68894E?80 Hnrnpf ?0.273127308 10.67200379 365.2988081 1.97609E?81 1.09579E?79 Hilpda 0.741609608 9.26631349 364.3414744 3.19342E?81 1.7652E?79 Il12rb2 0.780042435 9.272220666 363.7489147 4.29814E?81 2.36833E?79 Cd200r4 0.745073965 9.245788536 363.332146 5.29697E?81 2.90949E?79 Selm 0.724967002 9.255274695 362.2132873 9.2822E?81 5.08244E?79 Rpl13 ?0.20692553 12.59341642 358.9936129 4.66361E?80 2.54554E?78 Itga4 ?0.709429771 9.457128938 355.272428 3.01313E?79 1.63952E?77 Eef1b2 ?0.395983278 10.08532252 354.6347115 4.14843E?79 2.25023E?77 Rps27rt 0.40920376 10.6486322 352.6986737 1.09514E?78 5.92194E?77 Zap70 0.480186036 9.677477571 352.1255183 1.45976E?78 7.86915E?77 Rpl26 ?0.219220515 11.49710179 350.9988084 2.56824E?78 1.38019E?76 Ass1 ?0.614408133 9.641662833 348.5785901 8.64318E?78 4.63062E?76 Gm26740 ?0.613073552 9.548079775 348.4571538 9.18583E?78 4.90625E?76 Zfp36 0.755036205 9.294838731 346.525669 2.41955E?77 1.28836E?75 Csrnp1 0.702657077 9.254044021 346.1586592 2.90843E?77 1.54395E?75 Cd226 0.652794243 9.387067308 345.9790994 3.18245E?77 1.68428E?75 Gpr68 0.666874983 9.328829504 344.9771686 5.25962E?77 2.77517E?75 Pabpc1 0.253543554 10.71757424 344.7679366 5.84144E?77 3.07284E?75 Gm12840 0.891047188 9.457231655 344.4593021 6.81918E?77 3.57637E?75 Cd48 ?0.38459015 10.43479465 343.3816553 1.17062E?76 6.12098E?75 Sh2d2a 0.579542848 9.466676588 343.2133641 1.2737E?76 6.64001E?75 Cxcr5 ?0.530471666 9.20561145 343.1932453 1.28661E?76 6.68732E?75 Il6ra ?0.569058542 9.20917833 342.7785351 1.58403E?76 8.20865E?75 Rpl37a 0.203138206 12.26116013 342.1077689 2.21738E?76 1.14567E?74 Lypd8 0.44842715 9.193249939 340.9066075 4.04975E?76 2.08622E?74 H2afy 0.371108067 10.00724113 340.4917522 4.98627E?76 2.56109E?74 Vmp1 0.567628617 9.458764331 339.5017466 8.19184E?76 4.19519E?74 Sh3bgrl3 0.23283736 11.52323202 339.0176875 1.04424E?75 5.33207E?74 Gzmm ?0.713492859 9.237177807 338.9103634 1.10198E?75 5.61045E?74 Pld3 0.591215902 9.428245291 335.7969448 5.25095E?75 2.66558E?73 Rpl7 ?0.20865182 11.19387534 329.5334866 1.21449E?73 6.14731E?72 Sephs2 0.578851155 9.452454792 328.8405202 1.71919E?73 8.6767E?72 Sepp1 ?0.737185666 9.351250863 328.6008691 1.93875E?73 9.75651E?72 Eef1g ?0.318644983 10.44466423 328.1917319 2.38031E?73 1.19441E?71 Anxa6 ?0.378854677 10.05966028 327.9775338 2.65025E?73 1.32604E?71 Rps16 ?0.187940518 12.22909973 325.4524705 9.40299E?73 4.69126E?71 Rhoh 0.549715634 9.52013598 325.1010815 1.12151E?72 5.57934E?71 Pelo 0.667576923 9.295180382 324.3424209 1.64077E?72 8.13934E?71 Rpl15 ?0.29061008 10.58474029 322.6470854 3.83987E?72 1.89942E?70 Klrg1 ?0.895311661 9.277471359 322.4765157 4.18282E?72 2.06321E?70 Tmem71 ?0.63467876 9.368776477 322.1358738 4.96211E?72 2.44069E?70 Ier5 0.533178217 9.643609832 320.6619551 1.03923E?71 5.09723E?70 Hspa5 0.441769561 9.991491978 320.244836 1.28106E?71 6.2657E?70 Gm27166 0.478783135 9.194488904 319.8860088 1.53367E?71 7.48017E?70 2310001H17Rik ?0.69570124 9.36500569 319.8349174 1.57347E?71 7.65289E?70 Fam3c 0.611290084 9.369315527 319.6288024 1.74484E?71 8.46273E?70 Rpl18 ?0.200629143 11.74785 317.5684137 4.9041E?71 2.37195E?69 Reg3b 0.438054199 9.193236754 314.9256552 1.846E?70 8.90373E?69 Ran ?0.432537043 10.02805166 314.4525328 2.34041E?70 1.12573E?68 Tesc 0.585196699 9.463706763 310.4006473 1.78627E?69 8.56818E?68 Nrgn 0.67256668 9.21031371 310.1873651 1.98796E?69 9.50946E?68 E2f2 ?0.632366672 9.24570481 309.703225 2.5344E?69 1.20901E?67 Sidt1 ?0.607133596 9.231615429 309.1636563 3.32214E?69 1.58047E?67 Metrnl 0.670144523 9.278658789 307.297602 8.47095E?69 4.01897E?67 Ddit4 ?0.556082538 9.690594056 307.1181298 9.26894E?69 4.38562E?67 Itgb2 ?0.379932245 10.0524446 306.9472813 1.00983E?68 4.7651E?67 Ptk2b 0.589498004 9.37852549 304.9252424 2.78455E?68 1.3104E?66 Stk38 ?0.601169306 9.410018622 302.5222046 9.29556E?68 4.36265E?66 Krt8 0.394913343 9.191735533 301.4893461 1.56061E?67 7.29917E?66 Asap1 ?0.713638856 9.28327877 301.4854993 1.56363E?67 7.29917E?66 Glrx 0.526069658 9.6245233 301.1671216 1.83441E?67 8.54031E?66 Cd96 0.50746649 9.566029171 300.5855052 2.4559E?67 1.14032E?65 Msn ?0.354638678 9.969662732 300.3359931 2.78336E?67 1.28893E?65 Mmd 0.683389713 9.258719061 299.6070719 4.01215E?67 1.85304E?65 Rpl30 ?0.249820608 10.85133779 297.5170069 1.14483E?66 5.27347E?65 Car5b ?0.612063244 9.237859904 296.8403488 1.60755E?66 7.38541E?65 Crbn 0.554618233 9.427304818 296.368566 2.03683E?66 9.33296E?65 Phlda1 0.803113616 9.291148392 296.236558 2.17628E?66 9.94579E?65 Ggt1 ?0.702663215 9.290810258 295.9132706 2.55948E?66 1.16664E?64 Atic ?0.635349325 9.302037984 295.1729731 3.71062E?66 1.68693E?64 Rgs16 0.765148476 9.216610114 293.8288353 7.28293E?66 3.30235E?64 Csnk2b 0.416324203 9.685639631 290.8795747 3.1982E?65 1.44642E?63 Gm9843 0.381109199 10.19320765 290.8378149 3.26592E?65 1.47322E?63 Rps271 ?0.43391813 9.777142341 290.2792293 4.3223E?65 1.9447E?63 Iqgap2 ?0.638076071 9.307359719 289.8537682 5.3508E?65 2.40124E?63 Cirbp 0.504746243 9.53720808 289.2138674 7.37646E?65 3.30177E?63 Cd200r1 0.672026366 9.260019867 288.664971 9.71515E?65 4.33744E?63 Btla ?0.591546048 9.228534142 286.415877 3.00276E?64 1.33719E?62 Phfl1b ?0.53811808 9.475914441 284.1505726 9.35702E?64 4.15624E?62 Gng2 0.468934308 9.57488742 282.8266548 1.81815E?63 8.05538E?62 Lztfl1 0.726684698 9.295833236 281.3215644 3.86907E?63 1.70985E?61 Scn1b 0.440541002 9.1964611 280.6666827 5.37422E?63 2.36901E?61 Rpl17 ?0.180962475 12.17902552 279.7927545 8.33218E?63 3.66363E?61 Tgfb1 0.484671853 9.622712466 279.7162695 8.65817E?63 3.79738E?61 Ikzf3 0.655518838 9.312842571 279.698909 8.73392E?63 3.82098E?61 Sdf4 0.413417447 9.734416359 279.5030756 9.63574E?63 4.20154E?61 2900026A02Rik 0.349760831 9.191105265 279.4997042 9.65205E?63 4.20154E?61 Calm1 ?0.231941553 11.07867785 278.0942215 1.9539E?62 8.48413E?61

    TABLE-US-00016 TABLE 2G Tissue Combined GeneSymbol logFC.TissueColon_IEL logFC.TissueColon_LPL logFC.TissueSI_LPL Vps37b 0.777474128 3.99446302 3.903208385 Rps8 ?0.462894732 ?0.282560786 ?0.227185564 Dnajb9 0.242194076 1.230337941 1.179743784 Gm8369 ?0.434682295 0.68750399 0.476744935 Ckb 1.683488654 0.985367182 1.041027108 Nr3c1 0.596866537 1.3763776 1.026938489 Sp100 ?0.276734925 ?0.946107553 ?0.567656721 Gabpb1 0.40379582 1.330686374 0.891949362 Uhrf2 0.100713404 1.227704361 0.927995577 Gm8730 ?0.398463357 ?0.292225535 0.59358649 Dtx1 ?0.612484351 ?1.44822264 ?0.207521149 Areg 0.212427582 1.905811086 1.755119712 Gpr171 1.020738775 1.026142826 0.96946795 Dusp2 1.26074017 ?0.285136711 ?0.04232493 Cebpb 0.417904147 1.289160943 1.492710901 Snx18 0.253512243 1.181248291 1.402214668 Lpxn 0.960187902 0.964976389 0.97218611 Atf3 0.221926725 1.430600805 0.663376037 Plcxd2 0.80714267 1.178350458 1.765824897 Tspo ?0.459439563 ?0.604962665 ?0.816095379 Rps19 ?0.488789043 ?0.220762212 ?0.310099291 Ppp1ca ?0.138260669 ?0.481445397 ?0.664694124 Prkcq ?0.831805974 ?1.064405565 ?0.910979538 Bcl2l11 0.298668059 1.269735942 1.018797786 Nfkbie 0.320540429 1.253990691 0.778292075 Tnfaip8l2 ?0.656745597 ?1.002594927 ?1.249789844 AB124611 ?1.071538249 ?1.025761529 ?1.069656175 Rsrp1 0.045934577 ?0.695910085 ?0.308240957 Vim ?0.426911231 ?0.60007612 ?1.201605759 Zfp36l1 0.409767222 1.004959319 1.615568571 Ninj1 0.456984649 1.330843731 1.146988409 Fut7 ?0.902591648 ?1.053104849 ?0.949863456 Gm26532 0.78795718 1.322682827 1.290107828 Lin54 0.125129429 1.125966706 1.315252047 Tob2 0.373497726 1.295279865 1.335778732 Stx11 0.108734331 1.219878433 0.820456389 Cxcl10 0.238497963 1.594973302 1.451352068 Rpl37 0.116065648 0.27929211 0.479609638 Malat1 0.589352269 0.540521994 0.566513255 Tmsb4x 0.034205633 ?0.250963133 ?0.32512786 Wdr1 ?0.110386912 ?0.7976657 0.69312976 Plscr1 0.820629431 1.375621367 0.946173857 Rpl36 0.109936658 0.304016116 0.591038405 Relb 0.452701151 1.315929558 1.088010985 Ehd1 1.350600781 1.355200628 1.225979164 Rps28 ?0.052612178 0.164343875 0.733603222 Hsp90ab1 0.183973249 0.770065508 0.382334631 Anxa6 ?0.440796803 ?0.777608644 ?1.033157811 Map3k8 0.786413742 1.533242075 1.57543773 Hist1h1c 1.156393093 1.914039852 1.713398295 Clic1 ?0.126278872 ?0.577454964 ?0.698476892 Ddit4 ?0.550655713 ?1.322882165 ?1.549423159 AW112010 0.530350631 ?0.269167964 ?0.120512172 Rbm39 0.121133079 0.591211818 0.666508922 Actn2 1.674186971 1.09423599 1.668343285 Sema4a ?1.076586289 ?1.381910022 ?1.47235225 S1pr4 ?1.055213166 ?1.004407804 ?1.132415542 Tnfrsf1b 0.839325851 1.485819835 1.360630531 Anxa1 ?1.511107054 ?1.396051355 ?2.188471733 Rpl41 0.089207305 0.269891062 0.458372809 Dennd4a 0.40921547 1.450236431 1.196022302 Emb 0.256860695 1.031210454 0.639730557 Sub1 ?0.212606624 0.525046364 0.171178095 Arl4c ?0.49415572 ?0.985244078 ?1.582854063 Smim3 1.157858029 1.41368162 1.507860613 Ifng 2.239791472 1.729179922 1.492569488 Rgcc 0.283384363 1.767101847 0.447220961 Psmb8 ?0.110504023 ?0.489140738 ?0.649175005 Satb1 ?0.73170529 0.829100852 0.63424116 mt-Cytb ?0.546265334 ?0.42351736 ?0.415001765 Dusp10 0.166031321 1.460807234 1.313007697 Osgin1 1.638804775 0.665375907 1.581835883 Vcpkmt 0.485718496 1.353540366 1.181968319 Chd2 0.490638634 1.209409986 1.442340463 Ifi27l2a ?1.447651542 ?1.320038979 ?1.014727105 Cnbp 0.328954303 0.714682188 0.750969488 Gngt2 1.6715869 1.008170978 1.394249117 Ptpn7 0.034473291 ?1.133069364 ?0.919157917 Herpud1 0.052692615 1.177557859 1.034451055 Nrp1 ?1.191469771 ?1.264227267 ?1.279785482 Gch1 0.60986345 1.540707807 0.845457397 Birc3 0.178272259 1.269097181 1.31937574 Cfl1 ?0.181428647 ?0.482315806 ?0.478158167 Vgll4 0.553934184 1.336407518 0.803366983 Kcnn4 ?0.66182234 ?1.259249871 ?1.318323926 Kpna1 0.236709891 1.160296596 1.200898507 Nabp1 0.898469347 1.13108023 0.937505709 Hsph1 0.063771251 1.223646137 0.804849095 Il22 0.636407037 1.727603551 3.375767379 Lrrc58 ?0.280678767 ?0.931657812 0.078861966 Polg2 0.115967235 0.988832852 0.963823755 Lck ?0.046016642 ?0.478587291 ?0.328836522 Rps27l ?0.422405737 ?0.706969497 ?1.151277553 4930523C07Rik ?0.049553342 0.77439766 0.458814483 Capg 0.444179609 ?0.258086072 ?1.063350641 Rbpj 1.221814752 0.931669327 0.810911354 Aldoa 0.602520735 0.466664486 ?0.004097069 Rps17 ?0.554098377 ?0.38055098 ?0.294626154 Zc3hav1 ?0.118281001 0.800121918 0.686580555 Ddit3 0.633412182 1.056768321 1.505656004 Camk2n1 1.281680699 1.103759494 0.695796302 Il2rg 0.199050169 0.585724189 0.878628642 Traf4 0.387903813 1.143370115 1.166481487 Hnrnpf ?0.289637392 ?0.457763526 ?0.442403466 Ppp1r16b 0.722505925 1.131785945 1.123510124 Usmg5 0.338211483 0.562446426 0.884243935 Gm9493 ?0.373348956 ?0.119724093 0.654836138 Gm20186 0.376387595 0.983081489 1.508057083 Cyba ?0.12164775 ?0.398081178 ?0.628053762 Zeb1 0.268976051 1.117792672 0.955359161 Gm9843 0.050245934 0.036828943 0.933575173 Rpl27 0.112631873 0.224950706 0.508803925 Dusp4 0.153431151 0.94029633 0.821545552 Tnfrsf9 0.954876882 1.509800497 0.514373324 PhIda1 0.741010016 1.447979137 1.083660668 Map3k14 0.236317904 0.977429196 1.3068537 Slamf6 ?1.45895434 ?0.965084691 ?0.811078956 Ctla2a 0.298799669 1.071932508 0.251123192 Hdac1 0.284581969 ?0.596423747 ?0.759024583 H2-Q4 0.275988306 0.749276391 1.06798585 Fam46a 0.080223304 1.343132414 0.596687066 Fam65b ?1.112352618 ?0.915624467 ?0.779034525 Mxi1 0.327724833 1.096423847 0.916698704 Ccr5 1.136442096 1.03663238 1.414443159 D8Ertd738e 0.149173189 0.591554745 0.705970327 Gzmb 1.484474865 1.671588876 1.899825501 Sdf4 0.478973842 0.771120166 0.376506356 Stat3 0.590121867 1.132951528 0.779233082 Zyx ?0.565107863 ?1.017829067 ?1.105422427 Ms4a4c ?1.135742662 ?1.080990165 ?1.214454415 Hic1 1.490225264 0.64937241 1.158758155 Rpl23a-ps3 ?0.108683292 ?0.042050175 0.797803645 Hbp1 0.153253653 1.045263235 1.08918818 Ywhaq ?0.50728297 ?0.695383339 ?0.933175471 Dtx4 0.325907203 0.900111631 1.402409997 Prdx1 ?0.441253622 ?0.579820321 ?0.84275194 Dapk2 1.504802415 0.556414029 1.01750907 Rpl35 ?0.198257565 ?0.137039195 0.501566337 Tgif2 0.028216662 1.039982456 0.913047919 Aebp2 0.532530932 1.101390751 1.10384383 Spn ?0.442218027 ?0.924628279 ?0.908993083 Peli1 0.180571514 0.945055781 0.778179164 Rplp0 ?0.40462238 ?0.178016 ?0.146562691 Insig1 0.334913953 1.102843857 1.570247867 Arpc3 0.335449112 0.581367164 0.431387866 Hk2 0.400462873 1.272037672 0.895345873 Arl6ip5 ?0.350457803 ?0.638658603 ?0.860140937 Reep5 ?0.543838571 ?0.696314196 ?0.957208206 Gpx4 0.416949548 0.78623455 0.456449996 Prdx4 ?1.087776303 ?1.023745704 ?1.086234685 mt-Co3 ?0.373726515 ?0.283800873 ?0.245313316 Slc38a2 0.027794305 0.890981228 1.265084578 Fkbp1a ?0.457711587 ?0.609776872 ?0.807238893 Cdc42se1 ?0.509406321 ?0.94083351 ?0.723317952 Mfsd6 0.322475507 1.177204896 0.993936731 Hbb-bs ?0.951439469 ?0.833727323 ?0.920809369 Sgk1 ?1.401626324 ?0.881994243 ?1.153947764 Ccr9 0.472499792 0.23501735 2.246312713 Cdc42 ?0.194978171 ?0.457363489 ?0.492606763 Nr4a3 0.37734512 1.000912689 0.932683465 Sash3 0.284465257 ?0.904496449 ?0.450998844 Flna ?1.021845631 ?0.972657753 ?0.939784581 Id2 0.546829646 ?0.150446648 ?0.594648468 Ccl4 3.615166269 0.52950705 1.537818194 Sik1 0.187430647 1.003588487 1.049624518 Ldlrad4 0.983465129 1.170317969 1.242760762 Sh3bgrl3 0.178502582 ?0.151124267 ?0.520462292 Selk 0.20817301 0.633800345 0.574745819 Txndc5 ?0.793923149 ?1.079044363 ?1.044409331 Lztfl1 0.811919165 1.025717051 1.778608941 Lilrb4a 1.040771731 1.662603733 1.34866513 Plac8 1.367181977 1.647105676 1.336533536 Pfn1 ?0.227374524 ?0.464331976 ?0.494146426 Got1 0.912228134 2.351604957 2.113401784 Lgals1 ?0.94241438 ?0.994539931 ?1.811527329 Coro1a ?0.383867449 ?0.878811184 ?0.690027583 Neurl3 1.260230617 2.259242074 2.263083272 Bcl2a1d 1.325205435 1.991992964 2.161429488 Fosl2 0.686981772 2.317777656 2.162692641 Ddx5 0.655299575 0.933006654 1.022505971 Mxd1 1.185545347 2.408175848 2.46113118 Prdx6 0.739133202 1.540245599 1.651132315 Btg2 1.340461972 1.610387778 1.855311255 Zc3h12a 0.368012894 2.196963947 1.920529072 Nr4a1 1.42026219 2.585195396 2.900870393 Fth1 0.438172042 0.958382191 0.695953321 Kdm6b 0.591919262 2.601159919 2.643867444 Ms4a6b ?0.855435822 ?1.113772966 ?1.061157866 Gpr132 0.493626692 1.832550927 1.916165176 Dgat1 1.068086006 2.507427706 2.268265285 P2ry10 0.323139521 1.961409192 2.046154573 Hspa8 0.262418528 0.947116547 0.507076538 Hif1a 0.506541402 1.846412062 1.394299692 Emp3 ?0.885092139 ?1.135130594 ?1.534190065 Cytip 0.137241836 1.150444566 1.050113634 Arhgap31 0.592761886 1.828812646 2.147009927 Cd160 1.958868733 0.090626817 1.530097888 Ubc 0.781082329 1.059189076 1.267041913 Rora 0.393843317 1.626184495 1.580189974 Arf4 0.450172863 1.33901057 1.4270623 Dnajb1 1.088486132 2.625921173 1.768476477 S100a4 ?1.381786387 ?1.735446939 ?2.192760959 Slc3a2 0.924990309 1.747063943 2.041745429 Skil 1.356501548 2.046292284 2.167743506 Tspan32 ?1.855941613 ?1.830468648 ?1.826575438 Gadd45b 1.644895671 2.363959806 2.524371898 Cd69 2.140083096 1.914092308 2.039146629 Lilr4b 0.990097521 2.072444849 1.943112929 Itgb2 ?0.437930531 ?1.311953723 ?1.34504361 Rasgrp2 ?1.64073261 ?1.468891321 ?1.529423898 Hilpda 0.905718851 2.266685919 2.255743112 Klf2 ?1.908273266 ?1.798692995 ?1.640237406 Itgb7 ?0.626689284 ?1.091031288 ?1.049129185 Samsn1 0.78733775 1.881432949 1.370388308 Nfkbiz 0.564142293 2.33024327 2.303550906 Cd48 ?0.503647963 ?1.580728968 ?1.440014098 Crem 1.206942842 3.204559128 2.776895991 Tnfrsf4 0.711364773 2.978807129 2.192236669 Hspa5 0.512591422 1.816140229 1.534632246 Ifngr1 0.1883354 1.834862227 1.306178775 Ms4a4b ?0.69284433 ?1.322205103 ?1.664468636 Pim1 0.795270671 2.633332305 2.675211977 Pnrc1 0.753615753 2.106610657 2.294488941 Odc1 0.740493817 3.345533836 2.810015439 Jund 1.182643946 2.186035889 1.805102708 Ctla4 1.41332301 3.559115658 3.332369379 Bhlhe40 0.657224846 2.50015099 2.34894059 H3f3b 0.477447103 1.445573521 1.329294416 Junb 2.293137211 2.821816343 3.206316002 Btg1 1.136233966 2.049380574 2.322550341 Tnfaip3 1.367360021 3.427648559 3.788144571 Rgs1 4.407235959 3.620285869 4.048113626 Ubald2 0.135059491 2.902661389 2.820329823 Dusp5 0.88846288 2.589658521 2.324825039 Tgif1 0.340947728 2.662628566 2.532311028 Eif1 0.243600213 0.897018313 0.883631546 Gramd3 ?0.887373725 2.001685574 1.518112402 Ramp3 0.522452694 2.929582726 2.693749522 Orai1 0.427837319 2.054256414 1.840750897 Cd52 ?0.037974717 ?0.76219941 ?0.92083237 Srgn 0.650406948 1.163382845 0.975668862 Akap13 0.784905453 1.650364325 1.687843023 Traf1 0.731922421 1.939073251 1.667369064 Dusp1 2.876266732 3.102439229 3.283532744 Nfkbia 0.475871735 2.098426093 1.964656983 Pde4b 0.340023511 2.135521921 2.032281316 Il21r 1.066352442 2.30984097 2.07051372 Bcl2a1b 1.159629853 2.026583358 2.045369986 Rgs2 1.759347044 3.276603612 2.690971945 Itgb1 ?2.939748656 ?2.801847036 ?3.211007959 Icos 0.760296669 2.291146199 2.058091574 Prr7 0.576910072 2.642494452 2.148843937 Gna13 0.539301733 2.190136992 2.212428937 Ubb 0.608762321 1.16229746 0.888058795 Ifrd1 ?0.341562044 2.123182298 2.008949468 Furin 2.373523387 3.208611369 3.210149442 Lmna 0.355749856 2.240959029 ?0.139418188 Ctsd ?0.140445912 ?1.256042585 ?1.271899886 Dnaja1 0.065582453 1.228590453 0.7971197 Crip1 ?0.848292102 ?0.618979571 ?1.41225136 Gpr183 ?0.01113956 1.374005606 1.168714694 Rrad 0.234847579 1.697004089 1.594487107 Ccnd3 ?0.329577306 ?1.091466059 ?1.193102261 Nmrk1 0.428665057 1.738810544 1.410635343 Rps29 ?0.118044035 0.078118241 0.675561481 Itgae 2.118239644 0.501790147 1.613848439 Rps27rt 0.111778933 0.348355098 1.256433873 Dnajb6 0.42215896 1.048311667 0.903790169 Ptprcap ?0.333296008 ?0.877052246 ?0.657134231 Itm2b 0.681017998 0.052557376 0.053940026 Maff 0.050178399 1.358068789 1.717191704 Coq10b 0.487474641 1.48815124 1.590649725 Nr4a2 1.446906214 2.322415055 2.418160579 Rnf157 0.220493355 1.530141868 1.533565628 Csrnp1 0.705386191 1.723900036 1.723469654 Asb2 2.113128181 1.044679174 1.30745449 Fosb 0.448314652 1.939752943 1.173309182 Per1 0.223435351 1.324161399 1.655894131 Tnfsf8 0.591517515 2.049539473 1.756714493 Jun 2.701679209 1.602621976 2.540136604 Rpl37a 0.189109219 0.337383963 0.57738162 Ppia ?0.260468097 ?0.515647244 ?0.498914699 Actr3 ?0.264798485 ?0.678531948 ?0.608192443 Ets1 0.308769926 0.854380244 0.897921106 Tbc1d10c ?0.086644317 ?1.048383269 ?0.603012764 Ctsw 1.133912136 0.290339316 0.428742181 Rac2 ?0.090279627 ?0.457497646 ?0.519640137 Hspe1 0.125328811 1.183289599 0.848573905 Cirbp 0.671161615 1.276126719 1.325610584 Nrip1 0.295798404 1.495372547 1.599803514 Amica1 1.912537743 0.540771353 0.63720074 Tnfsf11 1.000192602 2.011665838 1.063992968 Ifnar1 0.410475913 1.357726581 1.453941357 Cd3g 0.649613891 0.161480653 0.074462457 Kdm2b 0.35110053 1.500408169 1.365103199 Litaf 1.724751835 1.533159899 1.755054093 Nfkb2 0.309083464 1.45267526 1.126281499 Cnn2 ?0.125436839 ?0.833705916 ?0.656443942 Crbn 0.689883175 1.357746765 1.315931184 Hsd11b1 ?0.845495767 ?1.422255063 ?1.515881372 Fasl 1.24195807 1.680829553 1.40489363 Myl6 ?0.303122474 ?0.557407151 ?0.743323701 Tnfrsf18 0.51027686 1.418821878 0.897476585 Sh2d2a 0.683649276 1.523838419 1.534011293 S100a6 ?0.701943112 ?0.925981609 ?1.558846918 Bin2 ?0.716008243 ?1.168500998 ?0.929495808 Arhgdib ?0.47819901 ?0.678544906 ?0.662983446 Abi3 2.169958211 0.784928318 1.430075624 Ppp1r15a 1.012213891 1.834038062 2.123484272 Serpinb9 ?0.332079489 1.762867925 1.404007136 Cdkn1a 0.659293662 2.26693393 1.978030213 Itk 0.717407706 1.534128909 1.605916535 Glipr2 ?1.012290006 ?1.288705972 ?1.608611968 Pglyrp1 ?1.560081733 ?1.527481278 ?1.707966652 Fam110a 0.441701934 1.956309955 1.205559948 S100a10 ?0.686684425 ?0.755853614 ?1.196982129 Ptp4a1 0.423511875 1.501139578 1.631998685 Arid5a 0.615734799 1.671003212 1.588627125 Hsp90aa1 0.265232836 1.516738352 0.86998671 Fos 3.307489836 1.662604426 2.60078825 Il4ra 0.262122295 1.768613781 1.41559797 Gm12840 0.852894278 2.038425581 2.604479224 Lsp1 ?0.469255726 ?0.871230904 ?0.802596375 Rel 0.328871591 1.654583385 1.684956995 Rpl38 0.304384053 0.391714781 0.80557411 Pycard ?0.68605811 ?1.204678987 ?1.095961376 Cxcr6 1.481967857 0.614235458 0.242141429 Zfp36l2 ?0.069112161 1.097355571 1.827830136 Ptpn22 0.637640602 1.105479795 1.407606827 AI467606 ?0.359100183 ?1.428559988 ?1.619259014 Sqstm1 0.312316129 1.45874511 1.187923862 D16Ertd472e 0.528778168 1.560727657 1.355501147 Ly6c2 ?2.635976447 ?2.243628333 ?2.730896442 Hspa1a 3.317587579 4.024832432 3.280867889 Atp1b3 ?1.338905265 ?1.163595102 ?1.260436923 Srsf5 0.318943246 1.058847246 1.077088912 Rps27 0.105449775 0.336978206 0.811170641 Stk17b 0.539893656 1.082520549 1.239142099 Cd28 0.068398706 1.095601812 0.97109367 Rnf125 ?0.044505337 1.467264431 1.164227533 Clk1 0.561911434 1.338154822 1.645145128 Klf6 1.842955526 1.439880235 1.966650811 Apobec3 ?0.366808091 ?0.852090391 ?0.527398995 Ndufa4 ?0.442428302 ?0.680313916 ?0.62851769 Apol9b 1.129514917 0.060106654 0.431228775 Tmem123 0.395783307 0.858468607 0.762317881 Pim3 0.156477935 1.049132589 1.270764685 Rpl39 ?0.003885791 0.14733345 0.492421372 Adora2a 0.327386179 1.093504821 0.814533896 Id3 ?0.983976649 ?1.278212723 ?1.408714151 Abcb1b 0.084811939 1.03652624 0.878461297 Calm1 ?0.195447541 ?0.347331831 ?0.60335137 Cdc25b ?1.001522994 ?0.97877959 ?1.052446445 Phf11b ?0.595465154 ?0.962170945 ?0.832403232 Arpc1b ?0.172988304 ?0.41263938 ?0.36702828 Btg3 0.40302651 0.954493008 1.329566612 Socs3 0.534617386 1.276515071 1.205826408 Gpr34 1.406180781 0.523866618 0.752660178 Cd7 0.935530259 ?0.713133698 0.512262464 Capn2 ?0.394029971 ?0.888329339 ?1.003188684 Pde4d 0.245207794 0.967356097 0.893857778 Nfil3 0.397653866 1.106103131 0.792415119 Gimap6 0.349265811 0.588644836 0.727785154 Ly6g5b 1.33303203 0.485097242 0.157396087 mt-Atp6 ?0.360413265 ?0.197400255 ?0.170326369 Lfng ?0.266671791 ?0.820206738 ?1.30945717 Avl9 0.413463318 0.992356488 1.138418506 Esyt1 ?0.466108154 ?0.899494199 ?0.850901825 Itpkb 0.167612218 0.953070885 0.909004332 Irf4 0.02354066 0.928322708 0.868943333 Mir142hg 1.033642023 0.963245615 1.048769847 Nkg7 0.53133988 ?0.169812636 ?0.218528706 Zcchc11 0.416794184 0.991651408 1.111287695 Prkarla 0.498190887 0.547270984 0.36703625 Def6 ?0.079903039 ?0.845247189 ?0.627240921 Slc9a3r1 0.490368769 ?0.270993821 ?0.330351807 GeneSymbol logCPM LR PValue FDR Vps37b 10.03454595 30072.7125 0 0 Rps8 11.62809538 2038.340013 0 0 Dnajb9 9.316221247 2038.542663 0 0 Gm8369 9.792018318 2044.58434 0 0 Ckb 9.342944532 2055.399452 0 0 Nr3c1 9.352262661 2059.924855 0 0 Sp100 9.725036992 2060.348785 0 0 Gabpb1 9.366278776 2073.287426 0 0 Uhrf2 9.439369633 2077.350399 0 0 Gm8730 10.38863469 2087.887702 0 0 Dtx1 9.344984765 2098.163291 0 0 Areg 9.282241434 2108.862759 0 0 Gpr171 9.650575449 2109.203412 0 0 Dusp2 9.611670263 2127.669358 0 0 Cebpb 9.3841575 2133.511667 0 0 Snx18 9.268008725 2190.232089 0 0 Lpxn 9.6426486 2193.717339 0 0 Atf3 9.235797229 2208.396751 0 0 Plcxd2 9.299070121 2035.025508 0 0 Tspo 10.07426107 2023.345914 0 0 Rps19 12.63595929 2023.3203 0 0 Ppp1ca 10.49158341 1994.14525 0 0 Prkcq 9.361161976 1853.113558 0 0 Bcl2l11 9.267192159 1854.01069 0 0 Nfkbie 9.322134913 1856.618069 0 0 Tnfaip8l2 9.437338541 1861.9971 0 0 AB124611 9.228809043 1871.487619 0 0 Rsrp1 10.20843239 1878.782142 0 0 Vim 10.67445805 1885.643262 0 0 Zfp36l1 9.441704346 1885.761429 0 0 Ninj1 9.293255705 2231.202495 0 0 Fut7 9.205232517 1929.797777 0 0 Gm26532 9.255741547 1938.00365 0 0 Lin54 9.261013077 1938.45873 0 0 Tob2 9.34461902 1940.459028 0 0 Stx11 9.356175668 1942.830244 0 0 Cxcl10 9.271930887 1943.092733 0 0 Rpl37 11.92011245 1950.728079 0 0 Malat1 14.51807182 1976.820212 0 0 Tmsb4x 14.40631533 1989.761718 0 0 Wdr1 9.737409412 1932.290417 0 0 Plscr1 9.425543981 1845.833759 0 0 Rpl36 11.71243313 2232.517819 0 0 Relb 9.371248744 2289.99945 0 0 Ehd1 9.407112899 2500.528557 0 0 Rps28 11.51231021 2511.446233 0 0 Hsp90ab1 10.9175943 2531.925683 0 0 Anxa6 9.925148315 2535.31738 0 0 Map3k8 9.344670944 2540.995063 0 0 Hist1h1c 9.414339905 2569.222047 0 0 Clic1 10.5597468 2577.83152 0 0 Ddit4 9.550516634 2600.936733 0 0 AW112010 11.67788795 2611.060111 0 0 Rbm39 10.50344179 2642.465618 0 0 Actn2 9.546273651 2644.093081 0 0 Sema4a 9.283140537 2653.703924 0 0 S1pr4 9.586568308 2654.674252 0 0 Tnfrsf1b 9.355129694 2660.647695 0 0 Anxa1 9.411481213 2691.011076 0 0 Rpl41 12.6407868 2731.32137 0 0 Dennd4a 9.274100293 2760.713271 0 0 Emb 10.0275267 2499.689705 0 0 Sub1 10.94059551 2495.827025 0 0 Arl4c 9.658613942 2472.060488 0 0 Smim3 9.29654546 2450.775194 0 0 Ifng 9.645960024 2313.756922 0 0 Rgcc 9.423330348 2323.950455 0 0 Psmb8 10.64253999 2337.404757 0 0 Satb1 9.601014895 2341.400318 0 0 mt-Cytb 11.21803568 2343.700873 0 0 Dusp10 9.359033873 2356.458156 0 0 Osgin1 9.252826914 2372.802143 0 0 Vcpkmt 9.367243143 2393.600427 0 0 Chd2 9.393875664 2268.146622 0 0 Ifi27l2a 10.02903758 2393.718927 0 0 Cnbp 10.09284839 2394.16337 0 0 Gngt2 9.361328315 2400.498408 0 0 Ptpn7 9.466595096 2419.001687 0 0 Herpud1 9.439096692 2425.533038 0 0 Nrp1 9.223298204 2432.20787 0 0 Gch1 9.354399974 2433.304066 0 0 Birc3 9.33752681 2433.841201 0 0 Cfl1 11.32725331 2444.786376 0 0 Vgll4 9.587844265 2393.91655 0 0 Kcnn4 9.466905719 2772.34088 0 0 Kpna1 9.300137202 1843.522866 0 0 Nabp1 9.532328268 1838.067205 0 0 Hsph1 9.370438221 1557.836398 0 0 Il22 9.338583329 1562.121908 0 0 Lrrc58 9.493596476 1562.433427 0 0 Polg2 9.233059976 1579.366602 0 0 Lck 10.49845031 1579.753574 0 0 Rps27l 9.674913084 1579.872913 0 0 4930523C07Rik 9.699182127 1581.475882 0 0 Capg 9.985868123 1585.265244 0 0 Rbpj 9.368575331 1587.924302 0 0 Aldoa 10.22924571 1589.244945 0 0 Rps17 10.6596725 1592.755036 0 0 Zc3hav1 9.554454222 1593.51781 0 0 Ddit3 9.316873219 1601.418493 0 0 Camk2n1 9.323686292 1602.078899 0 0 Il2rg 10.00219656 1605.322872 0 0 Traf4 9.292948329 1608.521941 0 0 Hnrnpf 10.55525903 1613.128498 0 0 Ppp1r16b 9.413801897 1557.800865 0 0 Usmg5 9.936350613 1552.872437 0 0 Gm9493 10.23217758 1549.335257 0 0 Gm20186 9.253161772 1546.807571 0 0 Cyba 10.60431895 1498.529546 0 0 Zeb1 9.301751944 1502.294376 0 0 Gm9843 10.33749646 1503.691737 0 0 Rpl27 11.33055291 1504.195501 0 0 Dusp4 9.213500374 1507.49956 0 0 Tnfrsf9 9.321390476 1509.427303 0 0 PhIda1 9.361394132 1509.496196 0 0 Map3k14 9.283321913 1519.537609 0 0 Slamf6 9.377252261 1615.425761 0 0 Ctla2a 10.09921699 1523.777018 0 0 Hdac1 9.546612696 1527.943772 0 0 H2-Q4 9.630172513 1528.27877 0 0 Fam46a 9.394476103 1532.18059 0 0 Fam65b 9.310020493 1535.116406 0 0 Mxi1 9.258459389 1535.331101 0 0 Ccr5 9.453526865 1545.929884 0 0 D8Ertd738e 9.906338542 1546.031392 0 0 Gzmb 10.14452997 1546.525056 0 0 Sdf4 9.821782432 1526.727595 0 0 Stat3 9.515695899 1840.239522 0 0 Zyx 9.42338924 1618.184248 0 0 Ms4a4c 9.23739877 1629.796583 0 0 Hic1 9.283045422 1737.143544 0 0 Rpl23a-ps3 10.57494605 1741.679055 0 0 Hbp1 9.340839113 1751.790252 0 0 Ywhaq 9.77397317 1756.913129 0 0 Dtx4 9.223206978 1775.308624 0 0 Prdx1 10.11192982 1776.398305 0 0 Dapk2 9.293084109 1780.844891 0 0 Rpl35 11.13718458 1785.683581 0 0 Tgif2 9.23223275 1790.943013 0 0 Aebp2 9.382936752 1810.668654 0 0 Spn 9.544899055 1812.185322 0 0 Peli1 9.632602802 1812.607057 0 0 Rplp0 12.40493661 1817.429013 0 0 Insig1 9.305878553 1819.439028 0 0 Arpc3 10.3928013 1822.685843 0 0 Hk2 9.240976423 1830.502099 0 0 Arl6ip5 9.930300727 1836.898892 0 0 Reep5 9.767497293 1733.322052 0 0 Gpx4 9.948950125 1731.797924 0 0 Prdx4 9.235537849 1731.056056 0 0 mt-Co3 12.20719178 1713.852782 0 0 Slc38a2 9.380152268 1635.802681 0 0 Fkbp1a 9.869140443 1647.111254 0 0 Cdc42se1 9.485319255 1658.571945 0 0 Mfsd6 9.299958076 1663.612597 0 0 Hbb-bs 9.200640448 1664.72306 0 0 Sgk1 9.293049535 1668.770669 0 0 Ccr9 9.24920942 1669.561887 0 0 Cdc42 10.55125063 1672.292717 0 0 Nr4a3 9.219687388 1624.091677 0 0 Sash3 9.392380929 1680.800024 0 0 Flna 9.339442013 1690.430613 0 0 Id2 10.81654571 1695.187398 0 0 Ccl4 10.14764842 1696.147403 0 0 Sik1 9.224860652 1703.135534 0 0 Ldlrad4 9.264750802 1703.376687 0 0 Sh3bgrl3 11.4029623 1704.291179 0 0 Selk 9.923482712 1709.896179 0 0 Txndc5 9.289175725 1710.771391 0 0 Lztfl1 9.35467745 1684.358705 0 0 Lilrb4a 9.500994059 2799.837328 0 0 Plac8 10.29800915 2666.923532 0 0 Pfn1 12.40959764 2823.18042 0 0 Got1 9.572501168 6155.123374 0 0 Lgals1 12.08066005 6170.117639 0 0 Coro1a 11.10558954 6173.409649 0 0 Neurl3 9.445974691 6174.776117 0 0 Bcl2a1d 9.713856957 6253.274041 0 0 Fosl2 9.360613737 6382.142761 0 0 Ddx5 10.94756817 6396.297438 0 0 Mxd1 9.428217948 6638.119592 0 0 Prdx6 9.932199951 6693.369054 0 0 Btg2 10.27784938 6722.847197 0 0 Zc3h12a 9.375963011 6767.694681 0 0 Nr4a1 9.441853787 6805.260947 0 0 Fth1 11.28479407 6872.446213 0 0 Kdm6b 9.499428313 6926.302094 0 0 Ms4a6b 10.51149168 7027.371621 0 0 Gpr132 9.625285306 7072.34788 0 0 Dgat1 9.520162453 7113.950101 0 0 P2ry10 9.409785965 6070.471392 0 0 Hspa8 11.98283195 6067.230307 0 0 Hif1a 9.566468789 5800.541484 0 0 Emp3 10.15792608 5634.940442 0 0 Cytip 9.939689328 4728.057313 0 0 Arhgap31 9.474258321 4796.907361 0 0 Cd160 9.433702154 2814.080819 0 0 Ubc 10.79352095 4856.266946 0 0 Rora 9.735274165 4955.577014 0 0 Arf4 9.74527555 4956.839167 0 0 Dnajb1 9.951049781 4962.650222 0 0 S100a4 10.35643749 5050.816426 0 0 Slc3a2 9.817091287 7244.608843 0 0 Skil 9.427601511 5070.343816 0 0 Tspan32 9.333183118 5088.9466 0 0 Gadd45b 9.530669537 5134.595901 0 0 Cd69 9.782614588 5148.722666 0 0 Lilr4b 9.559633455 5221.957907 0 0 Itgb2 9.853071355 5228.958886 0 0 Rasgrp2 9.546231995 5314.353412 0 0 Hilpda 9.465091188 5456.24451 0 0 Klf2 10.40246321 5566.904066 0 0 Itgb7 10.24576431 5083.968747 0 0 Samsn1 9.573511029 4684.830967 0 0 Nfkbiz 9.434908969 7264.143413 0 0 Cd48 10.15245869 7549.34267 0 0 Crem 9.682165373 11246.04429 0 0 Tnfrsf4 10.12383994 11439.35552 0 0 Hspa5 10.52876384 11491.98875 0 0 Ifngr1 10.6249228 12241.35701 0 0 Ms4a4b 11.32479865 12696.72714 0 0 Pim1 10.31487793 14315.81915 0 0 Pnrc1 10.16392663 14881.26408 0 0 Odc1 9.952419577 15414.75011 0 0 Jund 11.36341037 15875.17087 0 0 Ctla4 9.751318648 16157.30951 0 0 Bhlhe40 10.24123106 18383.23837 0 0 H3f3b 11.89130548 18628.63053 0 0 Junb 11.37526503 19488.80684 0 0 Btg1 11.71813077 19540.27276 0 0 Tnfaip3 9.733547635 19674.48034 0 0 Rgs1 10.88182319 21795.32212 0 0 Ubald2 10.08974357 22204.07143 0 0 Dusp5 9.681302178 11216.17781 0 0 Tgif1 9.475989105 10855.11363 0 0 Eif1 11.52939519 10657.53 0 0 Gramd3 9.833476646 10324.26187 0 0 Ramp3 9.589354936 7595.304751 0 0 Orai1 9.620559436 7682.097248 0 0 Cd52 12.265481 7737.734437 0 0 Srgn 11.04442682 7769.393006 0 0 Akap13 10.01433481 8164.656794 0 0 Traf1 9.817235232 8193.623841 0 0 Dusp1 9.732110949 8513.455523 0 0 Nfkbia 10.38534176 8552.271703 0 0 Pde4b 9.456656488 7281.724662 0 0 Il21r 9.854712698 8723.721998 0 0 Bcl2a1b 10.05711684 8913.380572 0 0 Rgs2 9.702426281 8964.070432 0 0 Itgb1 9.705679139 9226.334266 0 0 Icos 9.895747212 9291.702058 0 0 Prr7 9.545379603 9695.382535 0 0 Gna13 9.680943589 9786.483787 0 0 Ubb 12.53331081 9989.288582 0 0 Ifrd1 9.693003713 10167.64578 0 0 Furin 10.01245811 8904.797941 0 0 Lmna 9.487124604 4658.20846 0 0 Ctsd 9.949305296 4845.431139 0 0 Dnaja1 10.42008114 4631.648037 0 0 Crip1 11.90464273 3132.064265 0 0 Gpr183 9.513344586 3141.680794 0 0 Rrad 9.39537213 3149.5252 0 0 Ccnd3 9.736841478 3152.424211 0 0 Nmrk1 9.349533747 3167.947491 0 0 Rps29 12.07015461 3191.395691 0 0 Itgae 9.329438603 3234.931065 0 0 Rps27rt 10.90517839 3265.713412 0 0 Dnajb6 9.840231332 3283.455427 0 0 Ptprcap 10.30898425 3310.884109 0 0 Itm2b 11.11270922 3315.950892 0 0 Maff 9.240293623 3337.823207 0 0 Coq10b 9.389551852 3344.97829 0 0 Nr4a2 9.378053303 4644.481088 0 0 Rnf157 9.270523021 3363.842169 0 0 Csrnp1 9.355377363 3381.74524 0 0 Asb2 9.517846942 3394.318362 0 0 Fosb 9.303641607 3126.413381 0 0 Per1 9.256131905 3124.848247 0 0 Tnfsf8 9.718612422 3082.301398 0 0 Jun 9.585203942 3082.055112 0 0 Rpl37a 12.4341219 2829.244733 0 0 Ppia 11.75036121 2843.993406 0 0 Actr3 10.45956272 2849.847024 0 0 Ets1 10.064916 2856.422455 0 0 Tbc1d10c 9.730725723 2875.702927 0 0 Ctsw 10.03070607 2876.03227 0 0 Rac2 11.32889337 2877.122189 0 0 Hspe1 9.993360632 2881.352973 0 0 Cirbp 9.674191382 3397.589205 0 0 Nrip1 9.435157115 2943.750441 0 0 Amica1 9.41423544 2949.790876 0 0 Tnfsf11 9.406688169 2954.591251 0 0 Ifnar1 9.421114289 2964.121212 0 0 Cd3g 11.2059335 2977.399621 0 0 Kdm2b 9.339281333 2987.835357 0 0 Litaf 9.380464881 3000.045609 0 0 Nfkb2 9.395165675 3024.090259 0 0 Cnn2 10.16482738 3076.591106 0 0 Crbn 9.56278392 2946.210161 0 0 Hsd11b1 9.443353968 3412.966153 0 0 Fasl 9.476220888 3349.320794 0 0 Myl6 11.14840445 3511.339172 0 0 Tnfrsf18 9.841475941 4250.584103 0 0 Sh2d2a 9.653507549 4255.040768 0 0 S100a6 11.39787222 3469.674452 0 0 Bin2 9.826963154 4264.487697 0 0 Arhgdib 10.97661097 4277.750305 0 0 Abi3 9.391339833 4283.327994 0 0 Ppp1r15a 9.451226916 4287.130131 0 0 Serpinb9 9.595001511 4348.90624 0 0 Cdkn1a 9.482496831 4408.038615 0 0 Itk 9.614921991 4410.719519 0 0 Glipr2 9.696046944 4420.494789 0 0 Pglyrp1 9.506947739 4470.0937 0 0 Fam110a 9.361980417 4511.411134 0 0 S100a10 11.19773491 4516.927676 0 0 Ptp4a1 9.525742489 4529.394015 0 0 Arid5a 9.50033819 4544.040212 0 0 Hsp90aa1 10.36821572 4593.064023 0 0 Fos 9.552464487 4202.563514 0 0 Il4ra 9.363165505 4128.939871 0 0 Gm12840 9.824287347 4262.194424 0 0 Lsp1 10.59943054 3987.168317 0 0 Rel 9.330686608 3532.720938 0 0 Rpl38 11.47201227 3553.915854 0 0 Pycard 9.8090997 3566.116382 0 0 Cxcr6 10.49165114 4030.459915 0 0 Zfp36l2 9.621046058 3625.420712 0 0 Ptpn22 9.913891288 3635.182121 0 0 AI467606 9.43007721 3640.142865 0 0 Sqstm1 9.498888294 3650.157793 0 0 D16Ertd472e 9.472104236 3737.310203 0 0 Ly6c2 9.502687689 3618.463071 0 0 Hspa1a 10.53633121 3787.129231 0 0 Atp1b3 9.546244885 3800.287392 0 0 Srsf5 9.897879383 3863.410621 0 0 Rps27 13.00250321 3869.553469 0 0 Stk17b 9.912060431 3906.395949 0 0 Cd28 10.12482917 3764.96956 0 0 Rnf125 9.417495282 3924.712406 0 0 Clk1 9.595487126 3970.918448 0 0 Klf6 9.797177616 3972.157002 0 0 Apobec3 9.640320763 1495.459668 0 0 Ndufa4 9.876365917 1492.897357 0 0 Apol9b 9.199371767 1487.707525 0 0 Tmem123 9.564567543 1487.503495 0 0 Pim3 9.272489284 1486.441633 0 0 Rpl39 11.64815567 1484.740228 0 0 Adora2a 9.348672319 1483.853226 0 0 Id3 9.247020127 1483.833186 0 0 Abcb1b 9.244761887 1482.289748 0 0 Calm1 10.97692159 1481.737386 0 0 Cdc25b 9.279842463 1481.142685 0 0 Phf11b 9.40303954 1474.921118 0 0 Arpc1b 10.71697209 1472.676489 0 0 Btg3 9.276956785 1467.968361 0 0 Socs3 9.39717008 1464.828407 0 0 Gpr34 9.284399972 1464.226552 0 0 Cd7 9.668408289 1454.523736 0 0 Capn2 9.422824606 1450.935801 0 0 Pde4d 9.22996209 1445.702756 0 0 Nfil3 9.237942693 1431.837424 0 0 Gimap6 10.30711133 1428.814757 0 7.8975E?308 Ly6g5b 9.254627632 1426.806364 0 2.1484E?307 mt-Atp6 12.54893107 1421.705249 5.7448E?308 2.7405E?306 Lfng 9.501444391 1418.204835 3.3025E?307 1.5711E?305 Avl9 9.328579122 1409.911793 2.0816E?305 9.8758E?304 Esyt1 9.431724645 1407.121941 8.3901E?305 3.9698E?303 Itpkb 9.419678004 1402.3989 8.8845E?304 4.1923E?302 Irf4 9.221609323 1396.730424 1.5089E?302 7.1006E?301 Mir142hg 9.267707121 1391.820647 1.754E?301 8.232E?300 Nkg7 11.44730108 1387.945816 1.2157E?300 5.6904E?299 Zcchc11 9.302440385 1383.018269 1.4258E?299 6.6559E?298 Prkarla 10.04221526 1363.674016 2.2468E?295 1.046E?293 Def6 9.460419037 1358.115422 3.6117E?294 1.677E?292 Slc9a3r1 9.774883184 1355.051977 1.6689E?293 7.7286E?292

    [0536] Table 3A-3Y. Tables related to the 10?, single-cell sequencing on T cells derived from the in-vivo mouse experiments originating from the small intestine or colonic lamina propria. Table 3A-X Contains the results of 1 vs all differential expression tests for each of the 12 clusters defined in the study. Additionally, contains the results of within-cluster, between-genotype differential expression comparisons. Table 3YGWAS.

    [0537] Table Description and Headings:

    [0538] Table 3B-3X: Each section contains the output from an edgeR likelihood ratio test

    [0539] LPL-X vs. All: Differential expression between cells of cluster LPL-X and the remaining cells. Positive log FC values are associated with genes with higher expression in LPL-X than in the remaining clusters.

    [0540] LPL-X Ctrl vs. KG: Differential expression between the Ctrl cells of cluster LPL-X and the KG cells of cluster LPL-X. Positive log FC values are associated with genes with higher expression Ctrl cells.

    [0541] Table 3Y: LogFC and FDR are from the respective LPL-X Ctrl vs. KG data. GWAS?represents whether or not the gene is associated with an JBD GWAS loci

    TABLE-US-00017 TABLE 3A LPL-0 vs. All GeneSymbol logFC logCPM LR PValue FDR Kdm6b 2.107587482 9.740581499 2670.288539 0 0 Actb 1.497848932 13.40498915 2396.01558 0 0 Pim1 1.461379632 10.82584099 2720.504688 0 0 Pdcd4 1.219186897 9.736968363 1010.192462 1.0935E?221 4.4192E?218 Ptpn22 0.952379409 10.09353484 1004.31626 2.0705E?220 6.6942E?217 Cdkn1b 1.406854085 9.41746112 924.3880645 4.9003E?203 1.3203E?199 Skil 1.075200413 9.558821973 630.5081997 3.8752E?139 8.9495E?136 Insig1 1.236303319 9.37347705 609.4877932 1.446E?134 2.9219E?131 Cbx3 1.138162421 9.518041852 583.4355315 6.711E?129 1.2054E?125 Ppp1r16b 1.071177085 9.488149826 577.2586691 1.4804E?127 2.3932E?124 Abhd2 1.264504281 9.292308214 557.0948216 3.6024E?123 5.2943E?120 Kmt2d 1.182934835 9.264164205 501.3129014 4.9239E?111 6.6333E?108 Malat1 0.469300018 14.66860135 468.8149754 5.8028E?104 7.216E?101 Notch2 1.144895562 9.219647316 460.7171162 3.3561E?102 3.8753E?99 Srrm2 0.728412434 9.808238582 450.9545447 4.4708E?100 4.81828E?97 Ric1 1.070534111 9.254655607 415.4351764 2.40462E?92 2.42957E?89 B4galt1 0.929978748 9.375488034 378.7315027 2.35036E?84 2.23505E?81 Gm2a 0.806274736 9.581878937 372.8559359 4.47069E?83 4.01518E?80 Gnb1 0.683710369 9.703253309 339.4692154 8.32657E?76 7.0846E?73 Akap13 0.490064243 10.3088199 317.9684284 4.0126E?71 3.24338E?68 Birc6 0.899837946 9.320978822 316.6681692 7.70296E?71 5.92981E?68 Ncoa3 0.950672833 9.252526077 311.806689 8.82375E?70 6.48385E?67 Furin 0.768132247 10.38141056 304.7209557 3.08504E?68 2.16838E?65 Actg1 ?0.386910949 12.09926089 303.0075558 7.2868E?68 4.90827E?65 Klf13 0.673649384 9.695536973 286.8107826 2.46304E?64 1.5927E?61 Alkbh5 0.7944529 9.368743909 269.8374031 1.23125E?60 7.65554E?58 Marf1 0.860276436 9.233752654 237.0707291 1.71172E?53 1.02488E?50 Slc39a1 0.870689481 9.215151083 236.7856356 1.97515E?53 1.14037E?50 Acot2 0.85369456 9.215557552 228.5059564 1.26233E?51 7.03684E?49 Rpgrip1 0.891339331 9.229068972 226.3087385 3.80516E?51 2.05047E?48 Lgals1 ?0.482229612 11.62762181 224.1163784 1.14428E?50 5.96725E?48 S100a10 ?0.401281287 10.93996309 224.0265794 1.19707E?50 6.04744E?48 Arglu1 0.754488666 9.336509872 221.4240554 4.42349E?50 2.16697E?47 Srsf2 0.517320857 9.857790838 219.0310508 1.47143E?49 6.99619E?47 Dpysl2 0.723664118 9.405651172 217.5019153 3.17171E?49 1.46497E?46 S100a4 ?0.950902667 9.86649183 208.771962 2.54561E?47 1.14312E?44 Atxn1 0.741510873 9.344913237 202.2253919 6.82676E?46 2.98274E?43 Zc3hav1 0.547715562 9.665242259 200.5016307 1.62318E?45 6.90533E?43 Klf2 ?1.069853137 9.96079822 200.3107523 1.78657E?45 7.40554E?43 Supt16 0.80168198 9.269926089 199.557353 2.60872E?45 1.05432E?42 Crip1 ?0.533283322 11.66663236 199.1348964 3.22566E?45 1.27185E?42 Btg1 0.311293881 12.25006794 188.8750979 5.59599E?43 2.15392E?40 Myh9 0.651340239 9.438500102 187.5898867 1.06764E?42 4.01382E?40 Emp3 ?0.572932793 9.864609149 179.6697432 5.72175E?41 2.10222E?38 Pitpnc1 0.634559946 9.3795869 168.1865931 1.84181E?38 6.6166E?36 S100a6 ?0.529021515 10.99619486 159.8843786 1.19925E?36 4.21459E?34 Ppm1h 0.63807851 9.32382984 154.0799487 2.22463E?35 7.65177E?33 Erdr1 0.702265193 9.351150867 153.7127232 2.67615E?35 9.01305E?33 H2afz ?0.426974884 10.7655434 153.4276703 3.08892E?35 1.01909E?32 Cdk6 0.69278665 9.323662785 148.8770447 3.05082E?34 9.86392E?32 Whsc1l1 0.512329382 9.540585951 145.903876 1.36256E?33 4.31904E?31 Jund 0.351175103 11.8341681 144.7390714 2.4491E?33 7.61388E?31 Mbnl1 0.413036368 9.849897993 142.1924147 8.82692E?33 2.69238E?30 Rbm15 0.628984036 9.221090464 133.4475927 7.21627E?31 2.16034E?28 Vim ?0.437802323 10.47337793 131.8303156 1.62971E?30 4.79015E?28 Pan3 0.626656499 9.234208712 129.8623289 4.39208E?30 1.2679E?27 Btg2 0.352738759 10.53793205 129.3740822 5.6169E?30 1.59303E?27 Tmf1 0.627601139 9.275192923 129.1549672 6.27249E?30 1.74829E?27 2810417H13Rik ?1.247677001 9.337299453 126.8996408 1.95409E?29 5.35422E?27 Stmn1 ?1.206782014 9.430175049 126.1409638 2.864E?29 7.71656E?27 Yme1l1 0.579622353 9.30034005 126.1065549 2.91409E?29 7.72281E?27 Tacc1 0.604302394 9.2685904 124.1370695 7.86206E?29 2.04997E?26 Rps2 ?0.205226981 11.63566325 123.1141609 1.31652E?28 3.37823E?26 Paip1 0.551270107 9.192203166 115.9410137 4.89646E?27 1.23681E?24 Actr2 0.392668307 9.67646915 114.132176 1.21906E?26 3.03189E?24 Picalm 0.555431958 9.321258484 113.9378103 1.3446E?26 3.29346E?24 Sbno1 0.513517128 9.426293354 113.1197864 2.03125E?26 4.90107E?24 Inpp4a 0.587876896 9.237580327 112.0650956 3.45769E?26 8.22015E?24 Ldha ?0.320721971 10.35600944 111.3867557 4.86835E?26 1.12431E?23 Sik1 0.602626506 9.263004564 111.4022104 4.83054E?26 1.12431E?23 Wtap 0.491265482 9.408000204 110.6189664 7.17102E?26 1.63277E?23 Ets1 0.290857133 10.24994698 109.3408892 1.36644E?25 3.06804E?23 Coro1a ?0.280380953 10.77303317 107.8067187 2.9631E?25 6.56185E?23 Junb 0.298950285 11.89123884 106.8133985 4.89122E?25 1.06853E?22 Slc25a36 0.582838679 9.248175989 106.3278949 6.24906E?25 1.34696E?22 Vps54 0.565971111 9.235814078 103.7126119 2.33898E?24 4.97525E?22 Slc24a5 0.553964628 9.200019039 103.63554 2.43176E?24 5.10543E?22 Tra2b 0.370231771 9.814904189 103.315665 2.85785E?24 5.92307E?22 Gm11713 0.572636965 9.228906171 103.2557973 2.94552E?24 6.02751E?22 Ms4a4b ?0.307441662 10.75184171 100.524946 1.16915E?23 2.36256E?21 Ubc ?0.296729819 11.05003167 100.4017801 1.24416E?23 2.4831E?21 Gapdh ?0.27320874 10.56202545 99.15190914 2.33857E?23 4.61041E?21 Atp5b ?0.290696215 10.21322353 98.82442542 2.7591E?23 5.37394E?21 Clk1 0.36378697 9.76646424 96.66015417 8.23092E?23 1.58406E?20 Rbm39 0.215576064 10.68049787 92.55576108 6.54543E?22 1.24486E?19 Tuba1b ?0.552571308 9.729974254 92.05832174 8.41593E?22 1.582E?19 Ass1 ?0.523431526 9.534289055 91.07958592 1.38008E?21 2.56441E?19 Gm28875 0.563226861 9.244792702 90.68509289 1.68458E?21 3.09464E?19 Ran ?0.404512958 9.801116978 89.98963 2.39412E?21 4.34868E?19 Mxd1 0.445030151 9.600631761 88.53118238 5.00398E?21 8.98826E?19 Cdc42 ?0.241615643 10.40474043 88.09235834 6.24685E?21 1.10974E?18 Dctn4 0.515634719 9.226791755 87.91551187 6.83109E?21 1.20034E?18 Tagln2 ?0.315292626 10.29861125 85.67548392 2.12025E?20 3.68559E?18 Pycard ?0.480518193 9.577079204 85.3625029 2.48386E?20 4.27172E?18 Iqgap1 0.367736638 9.634427689 85.30814659 2.55309E?20 4.34456E?18 Ccna2 ?0.429260011 9.193741049 85.24349744 2.63795E?20 4.44219E?18 Rps17 ?0.238111557 10.6149625 84.2556873 4.34751E?20 7.24555E?18 Tspo ?0.3241737 9.918108481 82.82928905 8.94546E?20 1.47564E?17 Birc5 ?0.774306859 9.251476471 82.78125795 9.16549E?20 1.49666E?17 Rps20 ?0.199278964 11.06854686 82.45020041 1.08366E?19 1.75185E?17 Lsp1 ?0.289441501 10.32146402 82.23662981 1.20732E?19 1.93242E?17 Tmsb4x ?0.124205111 14.24920305 81.97789106 1.37618E?19 2.1811E?17 Anxa2 ?0.424357411 9.842409891 81.44249127 1.80436E?19 2.83198E?17 Slc25a5 ?0.256183417 10.39387945 80.44715179 2.98585E?19 4.64127E?17 Twistnb 0.466840475 9.374854863 80.3380422 3.15535E?19 4.85804E?17 Vmp1 0.412669378 9.490475476 79.90893633 3.92069E?19 5.97943E?17 Erh ?0.369077248 9.741195422 79.50363006 4.8134E?19 7.27228E?17 Luc7l2 0.340413015 9.66558153 78.75848933 7.01865E?19 1.05059E?16 Hmgb2 ?0.305301671 10.71128878 77.75424372 1.16692E?18 1.73069E?16 2310035C23Rik 0.479288441 9.250856289 77.25219276 1.50464E?18 2.21128E?16 D17H6S53E 0.406173804 9.17696648 76.49933424 2.20287E?18 3.20826E?16 Fhl3 0.398167305 9.169266684 76.3836551 2.33577E?18 3.37143E?16 Rpl10a ?0.169361349 11.14217591 73.76932407 8.78005E?18 1.25609E?15 Ube2c ?0.641235053 9.233348605 72.70415792 1.50616E?17 2.13585E?15 Rpl32 ?0.117506557 12.44734553 72.55274494 1.62627E?17 2.28611E?15 Rpl7 ?0.15134652 11.21186942 71.29300761 3.07925E?17 4.26112E?15 Rpl28 ?0.19927858 10.72551078 71.29000083 3.08395E?17 4.26112E?15 4933434E20Rik 0.427011884 9.335042118 71.15520058 3.30201E?17 4.52376E?15 Myef2 0.473342591 9.220160509 70.98360765 3.60205E?17 4.89334E?15 Asf1b ?0.519244424 9.223192204 69.8277614 6.47156E?17 8.71827E?15 Hsf2 0.362266417 9.168337049 69.71039283 6.86833E?17 9.17631E?15 Arhgdib ?0.215029523 10.73176838 69.28228906 8.53324E?17 1.13072E?14 Ube2h 0.460203792 9.263527957 68.76398418 1.10981E?16 1.45863E?14 Gsk3b 0.407848736 9.383828957 68.63067832 1.18742E?16 1.54806E?14 Itgb1 ?0.651985291 9.299264118 68.61024305 1.19979E?16 1.55167E?14 Rps27a ?0.126520352 11.80972706 68.55707054 1.23258E?16 1.58142E?14 Brd4 0.414924172 9.358976296 68.13900406 1.52367E?16 1.9395E?14 Pkm ?0.263117525 10.16193974 67.81711708 1.79385E?16 2.26558E?14 Eif4a1 ?0.22402961 10.43971408 67.73133076 1.87363E?16 2.34799E?14 Rpl10 ?0.154085529 11.48655718 67.63680055 1.96564E?16 2.44435E?14 Cdca3 ?0.407079178 9.196715741 67.36575915 2.25532E?16 2.78317E?14 Rps8 ?0.141029567 11.59257343 67.11812291 2.55717E?16 3.13176E?14 Cd48 ?0.386951826 9.721176096 66.9921926 2.72585E?16 3.31323E?14 Paxbp1 0.466529975 9.251251081 66.57229938 3.37293E?16 4.06916E?14 Rps3 ?0.111776312 11.96705488 66.29601134 3.88043E?16 4.64674E?14 Otub1 0.41672661 9.332259923 66.2658541 3.94026E?16 4.68369E?14 Myl6 ?0.177794839 10.93119837 65.70031043 5.24976E?16 6.19472E?14 Rnf157 0.433755297 9.351493602 64.59611437 9.19365E?16 1.07699E?13 Rps10 ?0.147538768 11.22179603 64.31354938 1.06113E?15 1.23412E?13 Eef1a1 ?0.110321731 12.38176503 63.52961517 1.57974E?15 1.82415E?13 Rps12 ?0.195856238 10.77060475 63.26015038 1.81132E?15 2.07672E?13 Gnb2l1 ?0.190267377 10.54006448 62.23026714 3.05555E?15 3.4786E?13 Nusap1 ?0.491535516 9.207147356 61.59057605 4.22838E?15 4.78013E?13 Il18r1 0.368848685 9.526791354 61.355196 4.76532E?15 5.34973E?13 Gzmk ?0.690300473 9.363676844 61.27842647 4.9548E?15 5.52409E?13 Tyms ?0.498994778 9.238838131 61.20745879 5.13666E?15 5.66822E?13 Lrrc8a 0.409765583 9.190599691 61.20074377 5.15421E?15 5.66822E?13 Cdca8 ?0.458035324 9.207869503 60.94749215 5.86176E?15 6.40278E?13 Rrm2 ?0.611980984 9.247497636 60.56190851 7.13004E?15 7.73586E?13 Ccnb2 ?0.485513492 9.212240288 59.84990711 1.02374E?14 1.10332E?12 Rpl31 ?0.170290124 10.87151483 59.78576465 1.05766E?14 1.13232E?12 Pnrc1 0.208894663 10.57788165 59.46508287 1.24483E?14 1.32395E?12 Clic1 ?0.227413644 10.32554613 59.07912283 1.51458E?14 1.6003E?12 Ccnb1 ?0.297805543 9.183009169 58.84515862 1.70581E?14 1.79066E?12 Gnl3l 0.393730748 9.189382723 58.79316531 1.75149E?14 1.82674E?12 Zscan26 0.396044821 9.188162719 58.13789649 2.44373E?14 2.53239E?12 B2m ?0.093766772 12.79982 57.0257555 4.30142E?14 4.42909E?12 Gm26699 0.375519253 9.394464865 56.90560992 4.5724E?14 4.67831E?12 Rplp0 ?0.108717289 12.38775842 56.85972585 4.68034E?14 4.75864E?12 Rpsa ?0.129421707 11.60009635 56.83524585 4.73896E?14 4.78813E?12 Plcxd2 0.426020085 9.360396846 56.77268616 4.89214E?14 4.9122E?12 Wnk1 0.324700375 9.627959621 56.58347879 5.38625E?14 5.37494E?12 Foxo3 0.45328937 9.215455773 56.21309552 6.5027E?14 6.44924E?12 Fbxo46 0.342072366 9.178401822 56.16217377 6.67331E?14 6.5781E?12 Abcg1 0.404303623 9.204739969 56.05560672 7.045E?14 6.90239E?12 Cks1b ?0.545261815 9.261603647 55.41157135 9.77593E?14 9.52034E?12 Eomes ?0.641532838 9.215520909 55.26385568 1.05389E?13 1.02019E?11 Ddx3y 0.488648104 9.286792787 55.16274371 1.10952E?13 1.06765E?11 Lbh 0.382006384 9.408476281 54.62758716 1.45676E?13 1.39349E?11 Ppia ?0.134187803 11.56530329 54.30730708 1.71463E?13 1.62098E?11 Cdkn1a 0.406730252 9.693181563 54.31309281 1.70959E?13 1.62098E?11 Rpl7a ?0.167038867 10.71263743 53.61755631 2.43573E?13 2.2893E?11 Gngt2 0.409025485 9.363461133 52.9479409 3.42507E?13 3.20056E?11 Rps7 ?0.11087119 11.94311471 52.54889015 4.1967E?13 3.89907E?11 Itgb7 ?0.270792151 9.956558259 52.49357441 4.31658E?13 3.98754E?11 Neurl3 0.323822382 9.619672539 52.41712233 4.48794E?13 4.12227E?11 Rplp1 ?0.124745324 11.7032513 52.07151016 5.35158E?13 4.88777E?11 Mcmbp 0.413813179 9.263665081 51.20857013 8.30552E?13 7.5431E?11 Itpkb 0.339679714 9.50966549 51.02768436 9.10724E?13 8.22501E?11 Rpl23 ?0.117810619 11.70858916 50.8216993 1.01149E?12 9.08433E?11 Glipr2 ?0.378200114 9.484106509 50.74315683 1.05279E?12 9.40298E?11 Rplp2 ?0.114755509 11.91005984 50.19613435 1.39122E?12 1.23574E?10 Ppib ?0.241497971 9.880914383 49.93316246 1.59073E?12 1.40523E?10 Rbbp7 ?0.389687456 9.3983099 49.65461608 1.83338E?12 1.61079E?10 Etv3 0.407752576 9.25329147 49.62740311 1.85899E?12 1.62446E?10 Ptma ?0.16554087 11.28820186 49.53884871 1.94482E?12 1.69032E?10 Hmgb1 ?0.226258893 10.2970404 49.01334479 2.54227E?12 2.19777E?10 Arhgap31 0.330556748 9.65435635 48.91411752 2.67419E?12 2.29952E?10 Gigyf1 0.347864515 9.189703078 48.79333282 2.84405E?12 2.41067E?10 Txn1 ?0.239849684 10.00206855 48.790484 2.84818E?12 2.41067E?10 Rasgrp2 ?0.418570333 9.377071127 48.79152979 2.84667E?12 2.41067E?10 Clasp2 0.332052036 9.17236319 48.4325801 3.41841E?12 2.86332E?10 Rps3a1 ?0.108391678 11.67388738 48.43755822 3.40975E?12 2.86332E?10 Hnrnpk ?0.203363418 10.15623829 48.37079186 3.52784E?12 2.93974E?10 Dut ?0.4252743 9.370293948 47.66015211 5.06891E?12 4.20225E?10 1500009L16Rik ?0.436094888 9.246962693 47.54794259 5.36751E?12 4.4271E?10 Rps23 ?0.091493016 12.48529685 47.41265727 5.75101E?12 4.71933E?10 Rpl5 ?0.166750551 10.56753913 47.10915065 6.71415E?12 5.48187E?10 Cdc45 ?0.176040165 9.168332637 46.94437406 7.30303E?12 5.9327E?10 Psma4 ?0.320075079 9.543453421 46.8948269 7.49002E?12 6.05418E?10 Dusp5 0.244343465 9.994465583 46.81799425 7.78949E?12 6.26492E?10 Tgif1 0.288197973 9.720285893 46.55851466 8.8923E?12 7.11648E?10 Iqsec1 0.306868317 9.175097412 46.31161233 1.00864E?11 8.03238E?10 Arhgap26 0.362226979 9.20131511 46.26928545 1.03067E?11 8.16756E?10 Smc2 ?0.457838158 9.240576863 46.18600984 1.07542E?11 8.48062E?10 Aurkb ?0.227897739 9.176287527 46.17329213 1.08243E?11 8.49441E?10 Themis 0.338780405 9.406121809 46.15809092 1.09086E?11 8.51922E?10 Rad51ap1 ?0.168933582 9.168873929 45.83353646 1.28741E?11 1.00059E?09 Ddit4 ?0.457302383 9.366175801 45.70124776 1.37735E?11 1.06285E?09 Set 0.268072579 9.77371175 45.6965463 1.38066E?11 1.06285E?09 Bcl2l1 0.374282608 9.376443509 45.58015518 1.46519E?11 1.12257E?09 Tpx2 ?0.255816003 9.180936262 45.48370732 1.53914E?11 1.17367E?09 Uvssa 0.357771198 9.191219939 45.45775589 1.55967E?11 1.18374E?09 Uhrf2 0.345073862 9.554452999 45.43283888 1.57964E?11 1.19329E?09 Rbm3 ?0.174412186 10.73098646 45.27873534 1.70895E?11 1.28497E?09 Rap2b 0.386872593 9.217861261 45.25646564 1.72849E?11 1.29365E?09 Ahnak 0.279946145 9.648666059 45.20386587 1.77554E?11 1.32274E?09 Anp32a ?0.238121521 9.878253526 44.91218759 2.06071E?11 1.52814E?09 Anxa6 ?0.266357286 9.747058157 44.88962553 2.08459E?11 1.53879E?09 Hspa5 ?0.188078636 10.97852379 44.34155639 2.75799E?11 2.02662E?09 Calr ?0.237935659 10.02077588 44.24976673 2.89039E?11 2.1143E?09 Tk1 ?0.276494249 9.186384692 44.05815286 3.18763E?11 2.32123E?09 Ezr ?0.28511791 9.722755344 43.93118787 3.40126E?11 2.46568E?09 Peli1 0.262373761 9.756230653 43.77706211 3.67993E?11 2.65579E?09 Hmmr ?0.151166002 9.167541924 43.57211811 4.0862E?11 2.93589E?09 Dbi ?0.354303671 9.462114256 43.44556351 4.35919E?11 3.11817E?09 Hint1 ?0.205762868 10.08266688 43.31598681 4.65763E?11 3.31697E?09 Snrpe ?0.239207361 9.827296541 43.27064695 4.76681E?11 3.37984E?09 Tppp3 ?0.326363173 9.18599552 43.02109733 5.41527E?11 3.82285E?09 Cct8 ?0.301160499 9.521391609 42.40689585 7.41282E?11 5.21025E?09 Hmgcr 0.36841636 9.25124838 42.32625686 7.72485E?11 5.40606E?09 Ly6c2 ?0.697969266 9.265996044 42.30561042 7.80683E?11 5.43988E?09 Tnfaip3 0.227027416 10.12507605 42.22671488 8.12821E?11 5.61541E?09 Mki67 ?0.3515189 9.202982177 42.22810773 8.12242E?11 5.61541E?09 Rrm1 ?0.384070718 9.219634699 41.86633532 9.77309E?11 6.72305E?09 Hist1h2ap ?0.286036608 9.18659925 41.65572091 1.08846E?10 7.45598E?09 Stim2 0.362672122 9.238378298 41.47872855 1.1916E?10 8.12805E?09 Fn3krp 0.184846223 9.161101118 41.29537404 1.30878E?10 8.88982E?09 Bmp2k 0.358909864 9.218888635 41.24306732 1.34428E?10 9.05483E?09 Rps24 ?0.101666272 12.00584544 41.25017653 1.3394E?10 9.05483E?09 Spc24 ?0.346692321 9.204100128 40.95893737 1.55461E?10 1.04282E?08 Hnrnpa2b1 ?0.196534148 10.12046099 40.88778863 1.61225E?10 1.07274E?08 S1pr1 ?0.422059619 9.290338593 40.88748874 1.6125E?10 1.07274E?08 mt-Atp6 0.102698372 12.47134724 40.86302484 1.63281E?10 1.08181E?08 Prdx1 ?0.232856001 9.945082204 40.62557883 1.84377E?10 1.21659E?08 Xist ?0.490990751 9.888398691 40.56781288 1.89909E?10 1.248E?08 Smap2 0.28963393 9.515102178 40.50424865 1.96189E?10 1.28404E?08 Rpl26 ?0.103119108 11.57423238 40.39614168 2.0735E?10 1.35162E?08 Btf3 ?0.134387238 10.715474 40.35161787 2.1213E?10 1.37722E?08 Rps4x ?0.09543889 11.84794084 40.24202475 2.24369E?10 1.45086E?08 Naca ?0.135088853 10.80132827 40.22731503 2.26065E?10 1.456E?08 Zbtb21 0.346325707 9.20850205 40.1126819 2.39728E?10 1.53787E?08 Ppp1ca ?0.180999333 10.29795938 40.09980116 2.41314E?10 1.54193E?08 Anp32e ?0.31717177 9.516881137 39.89016764 2.68652E?10 1.70985E?08 Cct4 ?0.269302589 9.5936703 39.78464151 2.83566E?10 1.7977E?08 Yes1 0.387710552 9.221085842 39.58488074 3.14106E?10 1.98353E?08 Reep5 ?0.27118009 9.637135956 39.51909329 3.24867E?10 2.04351E?08 Sept2 0.342873186 9.274290012 39.48946663 3.29834E?10 2.0667E?08 Rpl35a ?0.09831683 11.7234212 39.28221717 3.66766E?10 2.28925E?08 Cotl1 ?0.182341504 10.46112717 39.11250618 4.00073E?10 2.48753E?08 Il7r 0.272892916 9.753485896 38.72699605 4.87421E?10 3.01902E?08 Psmb7 ?0.295620167 9.46523868 38.2618874 6.18591E?10 3.81685E?08 Atf7ip 0.365085149 9.253987334 37.9190664 7.3741E?10 4.53269E?08 Hnrnpul1 0.306269675 9.37910581 37.75916648 8.00397E?10 4.90122E?08 Cdkn3 ?0.220464584 9.177347936 37.69331595 8.27877E?10 5.05037E?08 Dnajb1 0.393957367 10.31781379 37.62379926 8.57913E?10 5.21392E?08 Cd2 ?0.195141092 10.31973533 37.56156193 8.85728E?10 5.3628E?08 Klhl9 0.321655077 9.198908172 37.50704817 9.10833E?10 5.49422E?08 Cenpm ?0.21208704 9.175769069 37.44666956 9.3947E?10 5.6459E?08 Mcm2 ?0.372335465 9.227695356 37.4049719 9.59771E?10 5.74654E?08

    TABLE-US-00018 TABLE 3B LPL-1 vs. All GeneSymbol logFC logCPM LR PValue FDR Actb ?1.788578756 13.40456535 1969.985989 0 0 Vps37b 0.895007394 10.60462528 1103.972392 4.5239E?242 3.6566E?238 S100a4 ?2.066980708 9.866840932 990.3446629 2.2542E?217 1.2147E?213 S100a6 ?1.154115196 10.99649875 760.3528646 2.2508E?167 9.0966E?164 Crem 1.135777664 10.06722635 752.2332434 1.3116E?165 4.2408E?162 Ifngr1 0.612024932 11.11302914 721.8445664 5.3157E?159 1.4322E?155 Pfn1 ?0.538711172 12.14558847 686.3702201 2.7519E?151 6.3553E?148 Plac8 1.128214216 10.5691871 665.727518 8.4869E?147 1.715E?143 Klf2 ?1.940850631 9.960578273 662.9676093 3.3803E?146 6.0718E?143 Rgs2 1.097780206 10.06000559 658.8370261 2.6746E?145 4.3237E?142 Got1 1.084074843 9.855972072 655.3423412 1.5391E?144 2.2619E?141 Il21r 0.809669496 10.19619539 636.1687863 2.276E?140 3.0662E?137 Coro1a ?0.610607496 10.77323885 589.3688971 3.437E?130 4.2741E?127 Serpinb9 1.081184718 9.858313142 578.5602139 7.7137E?128 8.9071E?125 Eif1 0.337833647 11.85889679 560.5165898 6.49E?124 6.9945E?121 Lgals1 ?0.72773285 11.62802019 535.1379291 2.1536E?118 2.176E?115 Lsp1 ?0.654984065 10.32147718 488.4511929 3.0961E?108 2.9442E?105 Ptprcap ?0.783000793 10.0401488 488.2382418 3.4447E?108 3.0937E?105 Pycard ?1.085203588 9.577184042 487.7836331 4.3258E?108 3.6806E?105 Dgat1 0.89679146 9.778871165 483.8844962 3.0514E?107 2.4664E?104 Fosl2 0.952434136 9.53162468 477.9445926 5.9841E?106 4.6066E?103 Rps27rt 0.520913608 11.16205822 470.2190332 2.8715E?104 2.11E?101 Neurl3 0.799145197 9.619598144 457.07289 2.0839E?101 1.46474E?98 Rps27 0.285776264 13.23482323 418.9475401 4.13549E?93 2.7856E?90 Fth1 0.376259293 11.58476825 415.2458293 2.644E?92 1.64396E?89 Tmsb4x ?0.273689693 14.24925717 415.3072706 2.56382E?92 1.64396E?89 H2-K1 0.343352537 11.6100296 411.2718478 1.93767E?91 1.16016E?88 KIrc1 1.023930603 9.658425729 411.0322548 2.1849E?91 1.26147E?88 Ubald2 0.549709616 10.62002464 403.3569592 1.0237E?89 5.70662E?87 Cd52 ?0.444841022 11.79358725 396.9799802 2.50243E?88 1.34847E?85 Cfl1 ?0.392116577 11.11291947 384.8948211 1.06979E?85 5.57879E?83 Il4ra 0.774913613 9.499541933 367.1576528 7.78158E?82 3.93116E?79 Dusp5 0.581228407 9.994361734 364.1948693 3.43699E?81 1.68371E?78 Samsn1 0.721144616 9.795511159 359.8134916 3.09169E?80 1.47001E?77 Fgl2 0.863824189 9.496139473 356.3691619 1.7386E?79 8.03034E?77 Rps21 0.368294596 10.92388869 355.6060267 2.54903E?79 1.14466E?76 Arhgdib ?0.446836849 10.7318272 353.5929365 6.9942E?79 3.0559E?76 H2-D1 0.251752892 12.28194438 353.1089558 8.91515E?79 3.79269E?76 Gna13 0.565688846 9.98513228 340.9752456 3.91273E?76 1.62188E?73 Ddx5 0.344568543 11.1991571 340.3406904 5.37866E?76 2.17379E?73 Cnn2 ?0.654811498 9.902885218 336.4034115 3.87396E?75 1.52748E?72 Emp3 ?0.70120027 9.864713566 333.8561537 1.38972E?74 5.34909E?72 Cd48 ?0.798426594 9.72124298 328.3159143 2.23659E?73 8.40854E?71 Pik3r1 0.73885528 9.484799174 319.99719 1.45049E?71 5.32921E?69 Lilrb4a 0.738717163 9.646925283 318.7921692 2.65457E?71 9.5364E?69 Ndufa4 ?0.679488465 9.73553315 315.5972178 1.31808E?70 4.6322E?68 mt-Co3 ?0.28661259 12.09929008 308.8719528 3.8456E?69 1.32272E?66 Prr7 0.638751806 9.824437298 306.931633 1.01779E?68 3.42783E?66 Fasl 0.69087468 9.594176945 306.2337496 1.44442E?68 4.7654E?66 Slc25a5 ?0.452500278 10.39410252 304.0526899 4.31366E?68 1.39469E?65 Rac2 ?0.337772566 11.09602488 296.8583091 1.59313E?66 5.04992E?64 Dnaja1 0.566084182 10.76357045 294.7162074 4.66622E?66 1.45066E?63 Nrip1 0.732165744 9.582519625 288.2422587 1.20104E?64 3.59555E?62 Arpc3 0.372459303 10.54021408 288.2457578 1.19893E?64 3.59555E?62 Litaf 0.809822856 9.445009121 284.4411901 8.08743E?64 2.37712E?61 Arpc1b ?0.375752302 10.55364549 281.7754455 3.08106E?63 8.89436E?61 Tubb5 ?0.772688378 10.00334547 281.1572307 4.20163E?63 1.19164E?60 Ctla2a 0.700790544 10.33575323 279.3695207 1.03036E?62 2.87186E?60 Rpl37a 0.210248664 12.61564007 277.6971692 2.38468E?62 6.53402E?60 Bin2 ?0.728028996 9.612828291 277.1285376 3.17211E?62 8.54673E?60 Wdr89 0.513393949 10.42643281 274.3649881 1.26942E?61 3.36418E?59 Eif5 0.511485385 9.823441033 269.7699212 1.27366E?60 3.32097E?58 Nabp1 0.636082496 9.632410631 268.2210034 2.77101E?60 7.11051E?58 Klrk1 0.934839579 9.564414696 268.1106967 2.92873E?60 7.3978E?58 Rplp0 ?0.218100349 12.38791042 267.9073344 3.24342E?60 8.06663E?58 Rcbtb2 0.809053481 9.39894406 265.5508845 1.05829E?59 2.59216E?57 Rpl38 0.237996532 11.67460313 258.5201237 3.60659E?58 8.70212E?56 Tmem176a ?1.165497721 9.404480668 252.8672547 6.15696E?57 1.46373E?54 mt-Atp6 ?0.243334052 12.4711756 248.1279894 6.64601E?56 1.55709E?53 Capzb ?0.431404911 10.15899075 247.9573988 7.24023E?56 1.67208E?53 Clic1 ?0.422522733 10.32564272 246.7932166 1.29887E?55 2.95739E?53 Ifrd1 0.521730657 10.02583298 238.8278921 7.08402E?54 1.59056E?51 Nfkbia ?0.581770075 10.83335684 237.7851151 1.1958E?53 2.64812E?51 Usmg5 0.41505392 10.06859317 237.6977148 1.24944E?53 2.72953E?51 Nr3c1 0.688319036 9.448726347 237.0161873 1.75925E?53 3.792E?51 Actr3 ?0.415162569 10.23427966 234.8065523 5.33531E?53 1.13488E?50 Ppp1ca ?0.397132915 10.29810957 233.8723064 8.52878E?53 1.7906E?50 Cnbp 0.356953072 10.25780671 233.8107991 8.7963E?53 1.82309E?50 Gimap6 0.391836768 10.4658122 231.7934375 2.42231E?52 4.95685E?50 Gnai2 ?0.456079708 10.17424924 231.4370798 2.89697E?52 5.85405E?50 Pglyrp1 ?0.932489522 9.331204668 231.4010017 2.94993E?52 5.88747E?50 Rplp2 0.21411519 11.91020827 230.6878952 4.22012E?52 8.31982E?50 Lilr4b 0.578605702 9.77812791 228.9456823 1.01222E?51 1.97151E?49 Irak2 0.726366279 9.278620156 226.4881484 3.47731E?51 6.69217E?49 Rpl35 ?0.293445674 11.18862876 225.0845461 7.03672E?51 1.3383E?48 Lmna 0.838878501 9.713616963 223.8901563 1.28196E?50 2.40979E?48 Cbx3 ?0.793973529 9.51797351 221.1859312 4.98546E?50 9.26378E?48 Itk 0.497130976 9.814380172 220.0345571 8.88885E?50 1.63292E?47 Jun ?1.278105538 9.603448288 218.9495885 1.53288E?49 2.78433E?47 Ifitm2 0.728838581 10.68450898 218.2894633 2.13551E?49 3.83585E?47 Nr4a2 0.715704419 9.52121308 217.1365889 3.81052E?49 6.76933E?47 P2ry10 0.557735676 9.588148915 216.0497309 6.57768E?49 1.15581E?46 Dennd4a 0.661822792 9.353169932 215.1945639 1.0107E?48 1.75688E?46 Dnajb6 0.402259307 10.0235756 214.4131266 1.49656E?48 2.57376E?46 Rps24 0.201933056 12.00595021 212.9332807 3.14722E?48 5.35558E?46 Il12rb2 0.713180429 9.345960823 210.587897 1.02236E?47 1.72161E?45 Fus 0.415736893 9.89924265 209.6682075 1.62276E?47 2.70449E?45 Actg1 ?0.305072557 12.09966478 209.2739452 1.97821E?47 3.26323E?45 Cotl1 ?0.387624119 10.46139499 208.5595047 2.83234E?47 4.62502E?45 Hilpda 0.643315922 9.667586402 207.5609804 4.67741E?47 7.5615E?45 Abracl ?0.459491705 9.935333895 204.9361765 1.74868E?46 2.79893E?44 Stmn1 ?1.408402171 9.430733602 204.5829412 2.08827E?46 3.3097E?44 S100a13 ?0.460207609 9.897903663 200.3466085 1.75467E?45 2.75397E?43 Zyx ?0.78157278 9.311171714 198.7702945 3.87423E?45 6.02219E?43 mt-Co1 ?0.219039635 12.21547146 198.0155703 5.66095E?45 8.71571E?43 Tnfrsf1b 0.594415005 9.452768175 197.5495441 7.15471E?45 1.09116E?42 Cks1b ?0.902420001 9.26180276 197.452059 7.51393E?45 1.13524E?42 Cdkn1a 0.684828228 9.693082603 197.3870862 7.7633E?45 1.16205E?42 Rpl36 0.191378672 11.87412411 196.3232522 1.325E?44 1.96514E?42 Prdx6 0.387419462 10.19719876 195.9655521 1.58592E?44 2.33073E?42 2810417H13Rik ?1.348762706 9.337778098 195.5943825 1.91112E?44 2.78335E?42 Pkp3 ?0.590268938 9.709686255 194.7192546 2.96677E?44 4.28222E?42 H2-Q7 0.318794872 10.6210556 194.3215104 3.6232E?44 5.18343E?42 Rps28 0.239174935 11.70755238 194.1805529 3.88917E?44 5.51512E?42 Myl6 ?0.272160511 10.93133884 189.5951424 3.89676E?43 5.47782E?41 Itgb7 ?0.467285899 9.956624675 189.2773925 4.57154E?43 6.37099E?41 1700097N02Rik ?0.721214639 9.227389704 187.3734805 1.19032E?42 1.64468E?40 Prkca 0.631509347 9.472730429 185.026078 3.87351E?42 5.30671E?40 Abcb1b 0.705256247 9.297095082 184.288226 5.61288E?42 7.62503E?40 Bcl2l11 0.679389484 9.333331974 183.929455 6.72219E?42 9.05591E?40 Slc3a2 0.401407628 10.08963433 183.7616752 7.31374E?42 9.7714E?40 Osbpl9 0.664999167 9.306537304 183.4761973 8.44237E?42 1.10959E?39 Lcp1 ?0.387042933 10.2911179 183.490149 8.38337E?42 1.10959E?39 S1pr1 ?0.798212974 9.290347096 183.128455 1.0055E?41 1.31088E?39 Sh2d1a ?0.668941826 9.507382786 182.7651867 1.20696E?41 1.56094E?39 Rabac1 0.420182689 9.787494723 182.5076575 1.37378E?41 1.76258E?39 Sec61b ?0.425196971 9.885092925 181.610947 2.15622E?41 2.74469E?39 Riok1 0.638753261 9.379978763 181.4859042 2.29612E?41 2.89993E?39 Gpr132 0.416559375 9.8660454 180.8336852 3.1871E?41 3.994E?39 Crip1 ?0.493199874 11.66680468 180.0759095 4.66494E?41 5.80103E?39 Rps16 0.16161083 12.35143085 179.5347494 6.12356E?41 7.55676E?39 Abcb1a 0.648799063 9.300398573 178.4612223 1.05052E?40 1.28657E?38 BC021614 ?0.744896507 9.270925728 178.3219969 1.12669E?40 1.36948E?38 Orai1 0.43534957 9.884592153 176.58257 2.70161E?40 3.25927E?38 Gabpb1 0.596714389 9.478113973 175.9501956 3.71289E?40 4.44611E?38 Rexo2 ?0.610677527 9.465244675 175.0647112 5.79529E?40 6.88873E?38 Hspa8 0.298364729 12.33067999 171.6427177 3.23885E?39 3.82184E?37 Tbc1d10c ?0.609447245 9.522567817 171.179049 4.08936E?39 4.79048E?37 Ap2s1 ?0.560849494 9.498112489 171.1596432 4.12946E?39 4.80266E?37 Atp5c1 ?0.393590419 9.901816954 170.3699703 6.14273E?39 7.0931E?37 Chchd2 0.281156025 10.44216726 169.2568613 1.07517E?38 1.23271E?36 Glipr2 ?0.62575301 9.484139571 169.1833807 1.11565E?38 1.27011E?36 Ltb ?0.525135472 10.15487923 169.094768 1.16649E?38 1.31871E?36 Apobec3 ?0.614418213 9.503277979 168.9346551 1.26431E?38 1.41936E?36 Hsp90ab1 0.358235846 11.19703839 168.5749929 1.51499E?38 1.68906E?36 Traf4 0.618977528 9.359798595 168.1736074 1.85388E?38 2.05273E?36 Gch1 0.58977029 9.459478409 167.9384628 2.08662E?38 2.29471E?36 Rps15a 0.15887194 12.4038352 167.7357859 2.31053E?38 2.52379E?36 Pim1 ?0.449599367 10.82518403 166.6702327 3.94877E?38 4.28429E?36 AW112010 ?0.356352013 11.38310706 166.0238903 5.46572E?38 5.89059E?36 Arpc5 ?0.374716295 10.09994182 165.8699709 5.90568E?38 6.32259E?36 Tmem176b ?0.88387982 9.4480561 164.2381697 1.34194E?37 1.42722E?35 Pde4b 0.463371289 9.65862148 164.1390035 1.41057E?37 1.49041E?35 Cdc42 ?0.290733616 10.40483847 164.0282804 1.49136E?37 1.56554E?35 Rbm3 ?0.303875972 10.73119655 163.8078342 1.66626E?37 1.73785E?35 Stat4 0.509660197 9.50654617 161.4842906 5.36238E?37 5.55694E?35 Pomp ?0.461350255 9.70146416 160.7695414 7.68272E?37 7.91076E?35 Isg15 0.724401352 9.495169432 160.4188089 9.16525E?37 9.37756E?35 Tspo ?0.399054221 9.918101434 160.304487 9.70783E?37 9.87023E?35 Arf4 0.373788321 9.974865872 159.6926899 1.32066E?36 1.33437E?34 Gm11808 0.354253549 10.17414183 159.250362 1.64982E?36 1.65659E?34 Flna ?0.685998565 9.27108819 159.1706353 1.71734E?36 1.71374E?34 Uba52 0.326559163 10.2399743 158.987408 1.88318E?36 1.8677E?34 Hsp90aa1 0.484135824 10.76861348 157.8713379 3.30183E?36 3.25472E?34 Adora2a 0.552025884 9.426699157 157.5091965 3.96173E?36 3.88153E?34 Gm9843 0.337819429 10.49171063 156.9213278 5.32526E?36 5.18603E?34 Vim ?0.444021646 10.47382906 156.4739419 6.66963E?36 6.45636E?34 Hspe1 0.476979188 10.27539148 156.3922483 6.9495E?36 6.68724E?34 Pkm ?0.357373771 10.1621659 155.5786776 1.04649E?35 1.00104E?33 Ccnd2 0.45234154 9.824519901 155.4920344 1.09313E?35 1.0395E?33 Kpna1 0.56949201 9.374027049 155.1833538 1.27681E?35 1.20707E?33 D16Ertd472e 0.457345281 9.624068057 154.0966474 2.20601E?35 2.07339E?33 S100a10 ?0.30141114 10.94016781 154.0320192 2.27893E?35 2.12955E?33 Ccnb2 ?0.632375053 9.212365668 153.0418621 3.7508E?35 3.4848E?33 Arf5 ?0.352340754 9.981775241 152.9596822 3.90917E?35 3.61118E?33 Wdr1 ?0.508723478 9.566638472 150.3847378 1.42845E?34 1.31207E?32 Slamf6 ?0.73893756 9.319065378 149.892996 1.82957E?34 1.671E?32 Nfkb2 0.481830243 9.521885906 149.3244526 2.43568E?34 2.21209E?32 Ctla4 0.427747962 10.1530728 149.2551209 2.52217E?34 2.27785E?32 Gm26740 0.475205161 9.65890753 147.7317529 5.42961E?34 4.8764E?32 Ube2c ?0.767726489 9.233532012 147.2871077 6.79154E?34 6.06586E?32 Ago2 0.552705416 9.333716732 147.1394927 7.31539E?34 6.49784E?32 Birc5 ?0.876229377 9.251711307 146.9093125 8.21402E?34 7.25617E?32 Gapdh ?0.299112432 10.56241857 146.8533552 8.44868E?34 7.4229E?32 Tagln2 ?0.374638047 10.29890981 145.9056211 1.36136E?33 1.18961E?31 H2-Q6 0.403745938 9.740233488 145.8383905 1.40822E?33 1.22394E?31 Slc25a4 ?0.505941443 9.597149244 145.6070287 1.58216E?33 1.36777E?31 Limd2 ?0.388646178 10.08900365 145.4829362 1.68415E?33 1.44819E?31 Eif3h ?0.278504501 10.29703998 144.4345701 2.85483E?33 2.44186E?31 Acadl 0.535803555 9.426500038 143.2243213 5.2503E?33 4.46718E?31 Set ?0.454430557 9.773657326 143.1546396 5.43776E?33 4.60245E?31 Ifi27l2a ?0.716236939 9.817229705 143.0476155 5.73879E?33 4.83194E?31 Naca ?0.227053893 10.80149233 142.6503305 7.00947E?33 5.87125E?31 Ccr2 0.502477166 9.897669405 142.4515995 7.74707E?33 6.45563E?31 Cox5b ?0.342361485 10.0435119 142.0600531 9.43518E?33 7.82201E?31 Atp5l ?0.258434484 10.47768281 141.8235363 1.06284E?32 8.76623E?31 Crot 0.556863942 9.397231084 141.2860124 1.39316E?32 1.14324E?30 Batf ?0.546937194 9.653590189 140.6727645 1.89713E?32 1.54894E?30 Prelid1 ?0.441857874 9.693857441 140.6149759 1.95315E?32 1.58053E?30 Tmem243 0.522419335 9.382999777 140.6127047 1.95538E?32 1.58053E?30 Tnfsf8 ?0.746667051 10.01800671 139.9167141 2.77604E?32 2.23271E?30 Hnrnpa3 ?0.33187099 10.15611501 139.2100176 3.96249E?32 3.17117E?30 Cd7 ?0.955133649 9.49407751 138.7709549 4.94294E?32 3.93634E?30 Dtx4 0.588912666 9.260819691 138.0520211 7.09925E?32 5.62581E?30 H2-Q4 0.389274444 9.753654107 136.5636584 1.5022E?31 1.18461E?29 Cd53 0.267838459 10.54705558 136.2510731 1.75831E?31 1.37984E?29 Cirbp 0.372879235 9.821591303 136.0340404 1.96139E?31 1.53178E?29 Vcpkmt 0.490218515 9.468573275 135.7031786 2.31703E?31 1.80082E?29 Ms4a6b ?0.363533853 10.19483269 135.0862488 3.16134E?31 2.44527E?29 Rps23 0.136676892 12.485355 134.6595977 3.91917E?31 3.01701E?29 Tnfrsf18 0.363350646 10.06784669 134.0909261 5.21897E?31 3.99858E?29 Erh ?0.424916553 9.741395893 134.0299115 5.38185E?31 4.10392E?29 Ran ?0.43677254 9.801466447 132.078733 1.43801E?30 1.09141E?28 Pnrc1 0.279551131 10.57763129 131.7585909 1.68966E?30 1.27641E?28 Tox2 ?0.494429465 9.191330625 130.5732514 3.06992E?30 2.30829E?28 Rpl23a-ps3 0.275124423 10.72027491 130.4319429 3.29643E?30 2.46713E?28 Cytip 0.305917579 10.18851993 130.0553827 3.98502E?30 2.96875E?28 Eomes ?0.808402797 9.215475259 129.9784094 4.14259E?30 3.07198E?28 Gnb1 ?0.441806484 9.703176458 129.6601205 4.86309E?30 3.5898E?28 Calm2 0.281457442 10.41344741 129.5654599 5.10063E?30 3.74803E?28 Cdk6 ?0.652717771 9.323625219 128.9918874 6.80961E?30 4.98119E?28 Plscr1 0.538048062 9.521580156 128.9205551 7.05879E?30 5.1402E?28 Ldha ?0.30771685 10.3562952 128.8545946 7.29731E?30 5.29006E?28 Btg2 0.325367246 10.53756271 128.1980853 1.01582E?29 7.3311E?28 Lmnb1 0.417613687 9.781595274 127.9843878 1.13129E?29 8.12822E?28 Rgcc 0.688439061 9.563499202 127.9722539 1.13823E?29 8.14188E?28 mt-Co2 ?0.195884131 11.38674194 127.8524506 1.20905E?29 8.61038E?28 Rpl37 0.14371841 12.07306348 127.7719313 1.25911E?29 8.92756E?28 Tpt1 0.157950068 11.78349556 127.3775638 1.5359E?29 1.08425E?27 Gramd3 0.412706804 10.20636682 127.0334653 1.82667E?29 1.28391E?27 Gpx4 0.323281731 10.07618977 126.6694303 2.19444E?29 1.53573E?27 Cdca3 ?0.472652508 9.196810536 126.3015826 2.64133E?29 1.84051E?27 Ccr5 0.540398603 9.51436215 125.9629608 3.13276E?29 2.17357E?27 Xist 0.750105813 9.888938449 125.3127903 4.34727E?29 3.00333E?27 Amz2 0.525949285 9.343188021 125.1580219 4.6999E?29 3.23313E?27 St8sia4 0.546224409 9.30811702 125.1322589 4.76131E?29 3.2615E?27 Zfp36 ?0.811141834 9.294562058 124.0351838 8.2763E?29 5.64534E?27 Gltp ?0.507531701 9.448093847 122.3124798 1.972E?28 1.33947E?26 Rps29 0.16387477 12.24471453 121.9208529 2.40233E?28 1.61844E?26 mt-Cytb ?0.234943587 11.07879665 121.9205166 2.40274E?28 1.61844E?26 Igtp 0.504055964 9.509084729 121.2284811 3.40562E?28 2.28445E?26 Tbx21 0.557575631 9.277655891 120.9884633 3.84361E?28 2.56759E?26 Capn2 ?0.559140819 9.322209356 120.5648275 4.75861E?28 3.16575E?26 Tnfaip8 0.423063549 9.630282095 120.3926675 5.19002E?28 3.4386E?26 Cox6b1 ?0.278552491 10.15777506 118.9346766 1.08236E?27 7.1418E?26 Arpc4 ?0.35503697 9.810411465 118.1622595 1.59769E?27 1.04993E?25 Ncl 0.289826807 10.07288426 116.7834774 3.20182E?27 2.09557E?25 Anp32b ?0.444708978 9.652821361 116.7595092 3.24075E?27 2.1125E?25 2700094K13Rik ?0.564948118 9.385390715 116.5920387 3.52629E?27 2.2894E?25 Mfsd6 0.50695786 9.369441943 116.3646697 3.95464E?27 2.55723E?25 Tuba4a 0.505604749 9.389389134 116.122805 4.46758E?27 2.8774E?25 Psmb3 ?0.320343547 9.906091127 116.0098837 4.72934E?27 3.03391E?25 Gcnt2 0.569564724 9.21801522 115.8092096 5.23294E?27 3.3437E?25 Bcl2l1 0.52714474 9.376464751 115.7519424 5.38625E?27 3.42812E?25 Rpl23a 0.13563776 12.17564937 115.2767761 6.84457E?27 4.33919E?25 Rilpl2 ?0.546494215 9.398901147 115.0842673 7.54234E?27 4.74599E?25 Hcst 0.252834434 10.61089101 115.0835741 7.54497E?27 4.74599E?25 Ass1 ?0.51973323 9.534398406 114.7355685 8.99234E?27 5.6345E?25 Ubb 0.210452543 12.90465659 114.6470029 9.40307E?27 5.86911E?25 Rpl12 0.207576935 10.99249069 113.9508319 1.3358E?26 8.30559E?25 Ywhah ?0.3943071 9.722022338 113.8003544 1.44112E?26 8.92609E?25 Emp1 0.514205699 9.358540577 113.4343025 1.7333E?26 1.06949E?24 Hint1 ?0.296617099 10.08286375 113.2323232 1.91917E?26 1.17967E?24 Dkkl1 0.504724291 9.308686473 113.1616116 1.98885E?26 1.21787E?24 Tcp11l2 0.490513451 9.433883691 112.7141682 2.49235E?26 1.52043E?24 Xcl1 1.194998958 9.40506854 112.2843688 3.09567E?26 1.88137E?24 Rpl24 ?0.148371665 11.77231549 111.9741934 3.61992E?26 2.19174E?24 Antxr2 0.524111919 9.257858404 111.8224562 3.90784E?26 2.35725E?24 Tnfrsf25 ?0.601839819 9.258889969 111.8014874 3.94939E?26 2.37345E?24 Timp2 ?0.576983903 9.295775851 110.8832755 6.27592E?26 3.75765E?24 Amd1 0.506986556 9.33704939 110.5121875 7.56787E?26 4.51447E?24 Hsd11b1 ?0.573712404 9.289649192 109.2285995 1.44609E?25 8.59464E?24 Cyba ?0.255410775 10.4309546 108.8830417 1.7215E?25 1.01941E?23 Twf2 ?0.506092699 9.389135379 108.4415119 2.15105E?25 1.26912E?23 Cldnd1 0.437135874 9.795121381 108.1944154 2.43665E?25 1.4324E?23 H3f3b 0.176835587 12.3442743 107.9279532 2.78728E?25 1.63258E?23 Sub1 0.223420381 11.1488509 107.9028414 2.82282E?25 1.63562E?23 Nme1 ?0.410983186 9.653644082 107.9169334 2.80282E?25 1.63562E?23 Dbi ?0.503923317 9.46225676 107.9081308 2.8153E?25 1.63562E?23 Mat2a 0.442640021 9.501583097 107.6673044 3.17904E?25 1.82891E?23 Emb 0.3409222 10.25108753 107.6709239 3.17324E?25 1.82891E?23 Itga4 ?0.538393532 9.394382328 107.19807 4.02829E?25 2.30927E?23 Tpgs1 ?0.547232328 9.260754207 106.3574922 6.15642E?25 3.51678E?23 Eno1 ?0.340480149 9.942475304 106.210237 6.63132E?25 3.77472E?23 Sash3 ?0.558983887 9.280791065 105.5651388 9.18291E?25 5.2088E?23 Rpl21 0.141624442 11.76877751 105.5424416 9.2887E?25 5.25039E?23 Rpl18a 0.115781407 12.84271355 105.3725254 1.01203E?24 5.70054E?23 Bak1 ?0.530049389 9.291925002 104.9557381 1.24895E?24 7.01059E?23 Tmpo ?0.551234966 9.399332732 104.4649178 1.60001E?24 8.95012E?23 Fkbp1a ?0.359503623 9.733415831 104.2324114 1.79923E?24 1.00298E?22 Ndfip1 0.349750518 9.658014518 103.9167295 2.11E?24 1.17218E?22 Rgs1 0.371335135 11.08975907 103.6582181 2.40408E?24 1.33097E?22 Ech1 ?0.423155488 9.539595739 103.6369821 2.42999E?24 1.34072E?22 Nop56 0.424122186 9.44999363 103.4998715 2.60411E?24 1.43191E?22 Il22 ?1.546604232 9.482887499 103.4238643 2.70596E?24 1.48286E?22 Gnb2 ?0.326724769 9.816182555 102.9851985 3.37662E?24 1.84413E?22 Psma4 ?0.420490298 9.543577958 102.9024256 3.52068E?24 1.91634E?22 Coq10b 0.407565103 9.509829344 102.7580597 3.78682E?24 2.05429E?22 Kdm6b ?0.564998666 9.740092853 102.2484393 4.89775E?24 2.64806E?22 Def6 ?0.512941554 9.346043162 100.9911559 9.23951E?24 4.97886E?22 Rpl9-ps6 0.349639434 9.841114929 100.3147377 1.30006E?23 6.95919E?22 Gpr171 0.366635846 9.722718651 100.3157828 1.29937E?23 6.95919E?22 Rpl9 0.128286541 11.84230049 100.2331707 1.35472E?23 7.22783E?22 Rpl27-ps3 0.364109983 9.836595897 100.0840856 1.46062E?23 7.76726E?22 Srsf5 0.266057713 10.09087953 99.90009247 1.60282E?23 8.49546E?22 Mki67 ?0.465243552 9.203073676 99.69938332 1.77376E?23 9.37081E?22 Cisd3 ?0.525536963 9.289876433 99.52839188 1.93371E?23 1.01825E?21 Arid5a 0.364870228 9.656742664 99.48865318 1.9729E?23 1.03552E?21 Fau 0.117665937 12.30167106 99.0301156 2.48691E?23 1.30108E?21 Nr4a3 0.496623394 9.253599057 98.98547036 2.54361E?23 1.32645E?21 Klf6 ?0.463656693 9.896878744 98.88672106 2.67366E?23 1.38979E?21 Rpl23 0.143460142 11.70879327 98.81011908 2.77911E?23 1.43997E?21 Cdkn3 ?0.295491219 9.177389757 98.76406715 2.84449E?23 1.46914E?21 Taf10 ?0.439262723 9.515336126 98.5028028 3.24565E?23 1.67099E?21 Acp5 ?0.483724271 9.39691276 98.31170727 3.57446E?23 1.83444E?21 Alyref ?0.512386856 9.471617456 98.26781953 3.65457E?23 1.86961E?21 Mtch1 ?0.522764482 9.286913269 97.80966112 4.60595E?23 2.34889E?21 Malat1 0.220170852 14.6684552 97.38689353 5.70222E?23 2.89881E?21 Rps14 0.110659316 12.65498594 97.1959583 6.27947E?23 3.18225E?21 Tk1 ?0.352993071 9.186456549 97.00099196 6.92926E?23 3.50058E?21 Rpl36a 0.183239744 11.04535005 96.7894076 7.71075E?23 3.88324E?21 Icos 0.315321976 10.25650888 96.68836511 8.11447E?23 4.07387E?21 Serf2 ?0.187728813 10.7068503 96.04038582 1.12564E?22 5.63376E?21 Tnfsf11 0.557938441 9.547078237 95.67026522 1.35703E?22 6.77093E?21 Aprt ?0.395206011 9.637373978 95.66236935 1.36246E?22 6.77707E?21 Lamtor5 ?0.44478946 9.410023241 95.65457018 1.36784E?22 6.78295E?21 Sec62 0.310396292 9.756891332 95.09887676 1.81109E?22 8.95356E?21 Glul 0.464844545 9.375643512 94.1625981 2.90641E?22 1.43247E?20 Hmgn2 ?0.576602296 9.445404975 94.09059207 3.01408E?22 1.48102E?20 Grap2 0.454216031 9.308784996 94.05858529 3.06322E?22 1.50061E?20 Hspa5 0.244336232 10.97867799 94.03946443 3.09295E?22 1.51059E?20 Gm2a ?0.430040205 9.581841921 93.88699024 3.34063E?22 1.62664E?20 Izumo1r ?0.608712826 9.250980816 93.71023726 3.65267E?22 1.77324E?20 Adrb2 0.535741715 9.281420121 93.6761559 3.71611E?22 1.79864E?20 Traf1 0.282213829 10.10515014 92.36351394 7.21318E?22 3.48084E?20 Ptpn7 ?0.519506241 9.307713029 92.22828093 7.72331E?22 3.71593E?20 Crbn 0.358418487 9.708112889 92.04198204 8.48571E?22 4.07062E?20 Calm3 ?0.363800232 9.648589796 92.00946041 8.62631E?22 4.12583E?20 Snrpe ?0.308597904 9.827468486 91.71067545 1.00322E?21 4.7841E?20 Peli1 0.331773787 9.75612779 91.23737361 1.27431E?21 6.05895E?20 Cdkn2d ?0.507234255 9.369237934 91.08746139 1.3746E?21 6.51665E?20 1500009L16Rik ?0.548390626 9.247085147 91.06913756 1.38739E?21 6.55805E?20 Saraf 0.265182173 10.21648935 91.0409854 1.40727E?21 6.63262E?20 Me2 0.460112182 9.315619916 90.96509981 1.46229E?21 6.8719E?20 Tnfrsf9 0.580005635 9.402134791 90.77972333 1.60591E?21 7.52495E?20 Ccna2 ?0.400426756 9.19384283 90.75730099 1.62421E?21 7.58871E?20 Mrpl42 ?0.491601474 9.309100457 90.67135954 1.69631E?21 7.90275E?20 Socs1 0.473388021 9.398189402 89.78506933 2.6549E?21 1.23331E?19 Nusap1 ?0.513197969 9.207259227 89.5987643 2.91706E?21 1.35121E?19 Atp5f1 ?0.299068276 9.82227645 89.58192797 2.94199E?21 1.35886E?19 Dut ?0.525005434 9.370492812 89.35609919 3.29774E?21 1.51884E?19 Rpl22l1 ?0.210893716 10.87576972 89.25595861 3.46896E?21 1.59316E?19 Oat 0.438985505 9.329297018 89.15554471 3.64959E?21 1.67137E?19 Wtap ?0.440428643 9.407943162 89.1100865 3.73442E?21 1.70539E?19 Arpc5l ?0.465637304 9.354510705 88.86346776 4.23024E?21 1.92637E?19 Reep5 ?0.359793383 9.637232149 88.39947996 5.34849E?21 2.42875E?19 Rps18-ps3 0.402507463 9.485009861 88.29003132 5.65276E?21 2.55973E?19 Eif3f ?0.187506949 10.66456064 88.11582239 6.17319E?21 2.78759E?19 Anxa6 ?0.329415877 9.7471733 87.93028771 6.78025E?21 3.05319E?19 Rpl36-ps3 0.382762365 9.494055337 87.66475526 7.75439E?21 3.48215E?19 Tob1 0.4322116 9.42000657 87.56689353 8.14771E?21 3.64864E?19 Eif1ax ?0.447944725 9.373714585 87.11118469 1.02589E?20 4.58135E?19 Itpkb 0.388213113 9.50956752 86.97951369 1.09651E?20 4.88325E?19 Rps11 ?0.120222506 12.26312327 86.95742035 1.10883E?20 4.92454E?19 Ccr7 ?0.827352902 9.273177568 86.88147711 1.15223E?20 5.1033E?19 Rps13 0.118476361 11.9252863 86.86801277 1.16011E?20 5.12412E?19 Sytl3 0.385802963 9.504493169 85.81774359 1.97308E?20 8.69122E?19 Hnrnpf ?0.218975824 10.40312097 85.6906052 2.1041E?20 9.24318E?19 Relb 0.381710195 9.473542129 85.55433278 2.25422E?20 9.8758E?19 Prdx1 ?0.30210979 9.945243865 85.47656524 2.34464E?20 1.02442E?18 Hif1a 0.31517707 9.774227368 85.08751446 2.85447E?20 1.24381E?18 Cox5a ?0.258557899 10.08167074 84.9467374 3.06512E?20 1.33201E?18 Rasgrp2 ?0.489347096 9.377108103 84.74049136 3.40211E?20 1.47449E?18 Tob2 0.453132367 9.437008471 84.68313645 3.50225E?20 1.51383E?18 Asf1b ?0.504596732 9.223323692 84.66123288 3.54126E?20 1.52661E?18 Id2 0.312337499 10.64556525 84.33429136 4.17805E?20 1.79634E?18

    TABLE-US-00019 TABLE 3C LPL-2 vs. All GeneSymbol logFC logCPM LR PValue FDR Lgals1 1.107635326 11.62794788 1745.765645 0 0 Crip1 1.160964893 11.66677342 1329.701702 3.969E?291 3.2081E?287 S100a6 1.198020946 10.99644365 1210.536111 3.1298E?265 1.6865E?261 S100a10 0.711665053 10.94013071 1098.436026 7.2245E?241 2.9198E?237 Lgals3 1.396672722 10.20022841 1079.543841 9.2247E?237 2.9825E?233 S100a4 1.527217655 9.866777731 973.9490277 8.2582E?214 2.225E?210 Itgb1 1.751523134 9.299279016 928.1234969 7.5546E?204 1.7447E?200 Emp3 0.930153302 9.864694656 866.1214647 2.2739E?190 4.5949E?187 Actg1 0.557655647 12.09959146 800.9549005 3.3454E?176 6.0091E?173 Vim 0.882078214 10.4737473 792.3381022 2.4998E?174 4.0412E?171 Ifitm1 3.164079151 9.599747165 776.5403323 6.8031E?171 9.9982E?168 Rps27 ?0.387759423 13.23483519 632.9819097 1.1228E?139 1.5125E?136 Rps29 ?0.402671414 12.24470733 625.94336 3.8116E?138 4.7399E?135 Itgb7 0.728056874 9.956612648 623.3865772 1.3715E?137 1.5837E?134 Ms4a4b 0.643490527 10.75178795 622.8012833 1.8386E?137 1.9815E?134 Junb ?0.777993669 11.89087159 602.8382153 4.0408E?133 4.0827E?130 Pglyrp1 1.2119906 9.331208685 570.368253 4.6689E?126 4.4398E?123 Lsp1 0.607948171 10.3214748 559.4531755 1.1055E?123 9.9289E?121 Cd52 0.479542234 11.79358704 526.2289603 1.8679E?116 1.5893E?113 Klrd1 1.281868785 9.372635779 515.4102303 4.2181E?114 3.4095E?111 Got1 ?1.246704373 9.855927617 502.3476321 2.9321E?111 2.2571E?108 Odc1 ?0.999359158 10.45374948 480.1976985 1.9352E?106 1.422E?103 Nkg7 0.635156724 11.21006764 466.4812842 1.8684E?103 1.3133E?100 Cd48 0.801758485 9.721230863 465.5348676 3.0021E?103 2.0222E?100 Glipr2 0.840279767 9.484133594 428.4566632 3.52206E?95 2.2775E?92 Anxa1 1.198698478 9.278573422 424.2938572 2.83693E?94 1.76392E?91 Klf2 1.251446468 9.96061809 422.5102224 6.93538E?94 4.1525E?91 Pycard 0.821577501 9.577165063 416.4397023 1.45343E?92 8.3915E?90 Rps28 ?0.384870366 11.70752993 413.5454065 6.19998E?92 3.45617E?89 AA467197 0.966906994 9.471388865 399.1453036 8.45263E?89 4.55484E?86 Ramp3 ?1.423901616 9.937109715 376.5001514 7.19354E?84 3.75131E?81 Rps27rt ?0.541894598 11.16203814 374.50616 1.9547E?83 9.87488E?81 Fxyd5 0.374291229 10.88895574 373.588429 3.09665E?83 1.51698E?80 S1pr4 0.789331367 9.466032912 359.098318 4.4251E?80 2.10401E?77 Rgs1 ?0.786014575 11.08978155 352.5170907 1.19954E?78 5.54048E?76 Bin2 0.674444277 9.612834003 332.5449837 2.68221E?74 1.20446E?71 Zyx 0.871870874 9.311172942 332.0349778 3.46394E?74 1.51346E?71 Anxa2 0.694314803 9.842643949 325.6200897 8.64484E?73 3.67769E?70 Tnfrsf4 ?0.770960782 10.62243251 323.315614 2.746E?72 1.13825E?69 Ifitm2 0.899150526 10.68445772 319.4990272 1.86219E?71 7.52605E?69 Ctla4 ?0.717492 10.15306486 313.1390335 4.52291E?70 1.78335E?67 Malat1 ?0.429232236 14.66848179 310.0933732 2.08393E?69 8.02116E?67 Crem ?0.936462251 10.06717199 309.4765776 2.83955E?69 1.06754E?66 Ifitm3 1.07385109 9.717589617 305.0557418 2.60811E?68 9.58243E?66 Myl6 0.319639864 10.93131338 295.8728592 2.6119E?66 9.38311E?64 Gna15 0.723530518 9.413846926 293.4396749 8.85314E?66 3.1113E?63 Reep5 0.576970257 9.637214739 287.0003799 2.23954E?64 7.70305E?62 Rpl12 ?0.361118726 10.9924655 286.9340944 2.31527E?64 7.79763E?62 S1pr1 0.88219731 9.290345556 285.4522276 4.86969E?64 1.6066E?61 Arhgdib 0.369730687 10.73181656 282.2713569 2.40234E?63 7.76726E?61 Rpl37a ?0.230463204 12.61563546 281.1880744 4.1371E?63 1.31138E?60 S100a13 0.477912226 9.89789302 277.2675542 2.95838E?62 9.19714E?60 Sh3bgrl3 0.316794291 11.24486223 275.9719088 5.66773E?62 1.72877E?59 Rpl36a ?0.336268091 11.04533644 275.3234377 7.84748E?62 2.3493E?59 Hspe1 ?0.734968089 10.27537472 273.5809707 1.88136E?61 5.52982E?59 Cd47 0.409603749 10.23585118 273.0362546 2.47277E?61 7.13837E?59 Ly6c2 1.596385353 9.266014145 270.6111246 8.3506E?61 2.36835E?58 Rac2 0.302952162 11.09602966 268.3984579 2.53491E?60 7.0654E?58 Rps16 ?0.212403538 12.35142328 267.4464731 4.08742E?60 1.11995E?57 Klrc1 0.869453849 9.658428758 264.6488216 1.66425E?59 4.48404E?57 Tspo 0.452765846 9.918102726 261.1004221 9.87762E?59 2.61773E?56 Ptma ?0.368146026 11.28837461 260.25122 1.51271E?58 3.94427E?56 Klrk1 0.967738565 9.564428224 260.2132923 1.54178E?58 3.95627E?56 Ubb ?0.340558743 12.90467053 253.8842203 3.69547E?57 9.33454E?55 Rps15a ?0.209512678 12.40382894 252.2257436 8.49603E?57 2.11303E?54 Selplg 0.412758765 10.21362445 248.0654969 6.85781E?56 1.67975E?53 Coro1a 0.365510663 10.77320156 247.1536687 1.08388E?55 2.61521E?53 Rasgrp2 0.746165592 9.377101403 245.1227903 3.00439E?55 7.1425E?53 Rplp2 ?0.239346191 11.91018134 243.9392817 5.44245E?55 1.27511E?52 Ggt1 0.845090141 9.203353657 240.5208096 3.02793E?54 6.9928E?52 Ctsd 0.558572919 9.641720936 239.4727209 5.12479E?54 1.16687E?51 Hsp90ab1 ?0.478995578 11.19701824 238.7640474 7.31478E?54 1.64237E?51 Prr13 0.385685076 10.23778924 236.1715783 2.68844E?53 5.9536E?51 Klhl6 0.724094678 9.316899465 233.3735902 1.09557E?52 2.39338E?50 Rps20 ?0.30849135 11.06878098 226.7801872 3.00297E?51 6.4728E?49 Anxa6 0.477668152 9.747152467 226.6718002 3.17095E?51 6.74495E?49 Ms4a6b 0.431526867 10.19485172 224.1053813 1.15062E?50 2.4157E?48 Epsti1 0.481889636 9.946002487 222.8372549 2.17532E?50 4.50849E?48 Tnfsf11 ?0.995325248 9.547066191 222.1985428 2.99803E?50 6.13496E?48 Ccl5 0.805026235 13.31088043 221.9811923 3.34383E?50 6.75704E?48 Vps37b ?0.498283973 10.60463013 221.6741013 3.90145E?50 7.78651E?48 Arl6ip5 0.446676163 9.776818831 218.2461026 2.18253E?49 4.30278E?47 Asb2 ?0.823122831 9.480734994 211.5725771 6.23419E?48 1.21424E?45 Tagln2 0.425196214 10.29885571 211.0250542 8.20787E?48 1.57962E?45 Fth1 ?0.300407416 11.58475892 209.3862439 1.8697E?47 3.55594E?45 Rplp1 ?0.235120996 11.70338212 208.9022913 2.38428E?47 4.4819E?45 Prkca ?0.804901317 9.47273378 207.833874 4.07816E?47 7.57788E?45 Gadd45b ?0.794871222 9.727248868 207.396577 5.08014E?47 9.33244E?45 Dusp1 ?0.761030155 9.939132795 205.1520683 1.56893E?46 2.84982E?44 Rps24 ?0.211580124 12.0059312 198.8559219 3.71107E?45 6.6659E?43 Rpl29 0.231642848 11.21438856 194.4462645 3.40302E?44 6.04542E?42 Hsp90aa1 ?0.610066784 10.76858556 190.5798156 2.37559E?43 4.17432E?41 Gzma 1.156987494 10.72602929 190.2449752 2.81098E?43 4.88628E?41 Socs3 ?0.775105706 9.492203988 183.9508242 6.65037E?42 1.14372E?39 Gngt2 ?0.76920447 9.363427733 183.8492044 6.99892E?42 1.19099E?39 Ahnak 0.497917205 9.6486335 183.5158121 8.27591E?42 1.39363E?39 Isg15 ?0.919606683 9.495169961 182.7671755 1.20575E?41 2.00951E?39 Eif1 ?0.215075871 11.85890479 181.8854963 1.87824E?41 3.09833E?39 Arpc1b 0.279591712 10.55364386 181.858684 1.90373E?41 3.10866E?39 Usmg5 ?0.411662014 10.06859105 179.6012963 5.92208E?41 9.57363E?39 Arpc5 0.357914994 10.09992322 178.1056272 1.25618E?40 2.01063E?38 Pfn1 0.266033705 12.14558689 176.9357799 2.26201E?40 3.58507E?38 Rps27a ?0.185752928 11.80983865 173.8717911 1.0558E?39 1.6571E?37 Ncf4 0.616931601 9.322576992 173.4282403 1.31961E?39 2.05124E?37 Izumo1r ?0.833944275 9.250979762 173.23288 1.45583E?39 2.24143E?37 Ddx5 ?0.273154117 11.19917209 171.9221905 2.8142E?39 4.29191E?37 Tob2 ?0.749576508 9.437017288 170.2866433 6.40562E?39 9.67787E?37 Nrp1 0.475718816 9.166737051 169.9443495 7.60889E?39 1.13894E?36 Il21r ?0.505264995 10.19620078 168.9413091 1.26008E?38 1.86885E?36 Fosl2 ?0.703183417 9.531613662 167.1288651 3.13532E?38 4.60778E?36 Cnbp ?0.336972315 10.25780833 165.3131087 7.8147E?38 1.13813E?35 Slc25a5 0.31094711 10.3940621 164.7439998 1.04048E?37 1.50182E?35 Cyba 0.29682531 10.43094576 164.7129212 1.05687E?37 1.51198E?35 Rgs2 ?0.683188002 10.05998032 161.9432033 4.25694E?37 6.03664E?35 Abracl 0.369184781 9.935327557 160.800472 7.5641E?37 1.06332E?34 Fus ?0.414749315 9.899258939 159.1748408 1.71371E?36 2.38827E?34 Rps21 ?0.275761051 10.92385795 157.8355226 3.36186E?36 4.64512E?34 Cnn2 0.399519194 9.90288659 157.5798679 3.82334E?36 5.23797E?34 Dgat1 ?0.627039178 9.778835893 157.0134201 5.08414E?36 6.90674E?34 AB124611 0.538688322 9.180449702 156.1726476 7.7614E?36 1.04559E?33 Ctsw 0.407627769 9.94349627 154.5480574 1.75775E?35 2.34842E?33 Rom1 0.565412526 9.185573671 153.2571454 3.36569E?35 4.45982E?33 Wdr89 ?0.438648459 10.42635108 151.6029863 7.73744E?35 1.01694E?32 Fos ?1.040226793 9.517179661 151.265106 9.1716E?35 1.19571E?32 1500009L16Rik 0.743494969 9.247062972 151.0129633 1.04125E?34 1.34663E?32 Rasa3 0.62108061 9.237628541 150.0581948 1.6836E?34 2.16009E?32 Serpinb6b 0.578341369 9.622263112 148.5069318 3.67553E?34 4.65689E?32 S100a11 0.301724985 10.60261496 148.500602 3.68725E?34 4.65689E?32 Dusp10 ?0.723669213 9.475537805 148.3230479 4.03195E?34 5.05275E?32 Furin ?0.608670033 10.38118207 147.4418599 6.2826E?34 7.81265E?32 Rpl38 ?0.196298052 11.67459296 147.2648676 6.868E?34 8.47542E?32 Lfng 0.600318631 9.38679975 146.3855751 1.06918E?33 1.30942E?31 Cdkn1a ?0.694573024 9.693100492 143.1294135 5.50726E?33 6.69401E?31 Flna 0.610624204 9.27107707 141.7573801 1.09883E?32 1.32565E?30 Ube2s ?0.407475264 10.00303894 140.9661991 1.63657E?32 1.95976E?30 Msn 0.333987136 9.894256294 140.9427275 1.65602E?32 1.96847E?30 Rps9 ?0.160448533 11.99541117 140.6491255 1.91985E?32 2.26542E?30 Rps8 ?0.188998621 11.59272654 140.2001816 2.40679E?32 2.81944E?30 Tuba1b ?0.648609572 9.730329249 139.675338 3.1348E?32 3.64584E?30 Hspa8 ?0.295280678 12.33066824 139.3532611 3.68674E?32 4.25713E?30 Slc25a4 0.446208668 9.597123846 136.8862867 1.27692E?31 1.45371E?29 mt-Co1 0.180371584 12.21548846 136.8986462 1.269E?31 1.45371E?29 BC021614 0.604666583 9.270921447 135.1654782 3.03767E?31 3.43406E?29 Trib2 ?0.68443991 9.363798856 134.4595166 4.3347E?31 4.86631E?29 Sdf4 ?0.390564968 9.917420235 133.745527 6.21069E?31 6.92427E?29 Adgre5 0.508601548 9.38877853 132.9968145 9.0557E?31 1.0027E?28 Rpl23a ?0.155302608 12.17563324 132.7561574 1.02227E?30 1.11663E?28 Hsph1 ?0.728156382 9.472375617 132.7619407 1.0193E?30 1.11663E?28 Saraf ?0.355176401 10.21648742 131.5242654 1.90136E?30 2.06291E?28 Arhgap31 ?0.552171788 9.654221563 131.071069 2.38898E?30 2.57469E?28 Hspd1 ?0.558182167 9.781137532 130.015877 4.06513E?30 4.35211E?28 Hmha1 0.381765719 9.750126154 129.5912318 5.03483E?30 5.35481E?28 Atp1b3 0.486515092 9.413034296 129.2689007 5.92258E?30 6.25781E?28 Cd27 ?0.803947605 9.342803037 126.3516604 2.57551E?29 2.70362E?27 Tnfsf8 ?0.737355758 10.01797843 126.0626608 2.97926E?29 3.10727E?27 Il22 ?1.756753656 9.482889609 126.0406633 3.01247E?29 3.12177E?27 Ubald2 ?0.351497132 10.62004401 124.5294437 6.45147E?29 6.64296E?27 Rpl36 ?0.164380166 11.87412221 124.1971999 7.62739E?29 7.80407E?27 Ifi27l2a ?0.68890883 9.81720141 123.5990198 1.0311E?28 1.04835E?26 Rpl23a-ps3 ?0.295698901 10.72022914 123.4369527 1.11886E?28 1.13046E?26 Gas7 0.571971199 9.194248976 121.9870221 2.32353E?28 2.33305E?26 Nccrp1 0.393930301 9.164828209 121.8725845 2.46149E?28 2.45633E?26 Gpx4 ?0.351438364 10.07617554 121.6178872 2.79867E?28 2.77567E?26 Rps23 ?0.138447821 12.48534445 121.4722896 3.01179E?28 2.96882E?26 Gramd3 0.418596938 10.20637838 121.4465525 3.05111E?28 2.98935E?26 Rps15 ?0.172864084 11.49080729 120.486991 4.94903E?28 4.81964E?26 Gzmm 0.434802686 9.16991855 118.6914094 1.22358E?27 1.18446E?25 Icos ?0.390581255 10.25649242 118.6538485 1.24697E?27 1.19992E?25 Dnaja1 ?0.411629472 10.76360037 118.4506794 1.38147E?27 1.32147E?25 Plp2 0.532759958 9.268337634 117.7246556 1.99209E?27 1.89436E?25 Cdc42 0.23089803 10.40482074 117.6820088 2.03538E?27 1.92421E?25 Tppp3 0.695346253 9.186033366 117.5848399 2.13758E?27 2.00908E?25 Tnfrsf1b ?0.53842263 9.452770816 117.4706506 2.26426E?27 2.11584E?25 Capn2 0.485018692 9.322203269 114.5742255 9.75458E?27 9.06279E?25 Eif3f 0.203096883 10.66455686 114.1050524 1.23585E?26 1.14164E?24 Lcp1 0.287302962 10.29112703 113.717244 1.5028E?26 1.38036E?24 Stat1 ?0.513852248 9.580220981 113.5655779 1.62226E?26 1.48167E?24 Jun ?0.94325618 9.603506659 113.0395558 2.11513E?26 1.92096E?24 Tmsb4x 0.144182849 14.24924733 112.5416481 2.71893E?26 2.45554E?24 Clic1 0.268803753 10.32562522 112.5094932 2.76339E?26 2.48183E?24 Vasp 0.287636612 10.04115431 112.1944017 3.23938E?26 2.89325E?24 Sema4a 0.512251592 9.198626437 112.0481305 3.4874E?26 3.09766E?24 Btf3 0.187828928 10.71559571 111.2147299 5.30965E?26 4.69048E?24 Esyt1 0.475445557 9.338053167 110.1227206 9.21083E?26 8.09251E?24 Arpc3 ?0.254844539 10.54018788 108.5503449 2.03612E?25 1.77924E?23 Hsd11b1 0.527808948 9.289647124 107.9739699 2.72331E?25 2.36694E?23 Rps25 ?0.179054311 11.11875547 107.5235213 3.41824E?25 2.95505E?23 Areg ?1.179794443 9.38613304 107.4853962 3.48464E?25 2.99642E?23 Rap1b 0.265092354 10.1124176 107.3677512 3.69775E?25 3.16285E?23 Tpt1 ?0.15517681 11.7834661 107.2473914 3.92927E?25 3.34319E?23 Actr3 0.261765133 10.23426606 107.0671408 4.3034E?25 3.64235E?23 Tox ?0.523743046 9.202083903 104.462925 1.60162E?24 1.34853E?22 Cd7 0.758734546 9.494093275 104.186839 1.84109E?24 1.54213E?22 Rpl23 ?0.156527601 11.70875625 103.6246787 2.44512E?24 2.03752E?22 Supt4a 0.284417019 9.962767148 103.560841 2.52519E?24 2.09345E?22 Gm11808 ?0.317351685 10.17411983 101.4055452 7.49537E?24 6.18215E?22 Rpl39 ?0.154446809 11.7773745 101.3066649 7.87902E?24 6.4656E?22 Gna13 ?0.357361906 9.985128145 100.8831794 9.75716E?24 7.96638E?22 Phf11b 0.486488786 9.311766492 100.510537 1.17769E?23 9.56709E?22 Eef1a1 ?0.130787248 12.38191171 99.99485692 1.52793E?23 1.23503E?21 Hspa1a ?1.119432968 11.00098792 99.97583829 1.54268E?23 1.24074E?21 Ccnd3 0.409152136 9.527402171 99.62411953 1.84247E?23 1.47452E?21 Adam8 0.511454079 9.247167125 99.41606727 2.04655E?23 1.62978E?21 Fosb ?0.690931948 9.410758224 99.12867187 2.36618E?23 1.87508E?21 Prss16 0.453141756 9.187154617 99.03879299 2.47604E?23 1.95257E?21 Fut7 0.243038107 9.160603564 98.82820564 2.75384E?23 2.1611E?21 Capzb 0.252231093 10.1589729 98.61753077 3.06296E?23 2.39207E?21 2810001G20Rik 0.514611056 9.235596474 98.50063828 3.2492E?23 2.52532E?21 Tra2b ?0.360766994 9.814709276 98.41122462 3.39927E?23 2.62931E?21 Maf ?0.499169931 9.56864775 98.38318927 3.44774E?23 2.6541E?21 Dnajc15 0.302461752 9.893147259 98.27310767 3.64482E?23 2.79252E?21 Rpl9 ?0.13362575 11.84228944 96.87312552 7.39152E?23 5.63638E?21 Dnajb1 ?0.701565277 10.3172835 96.68446985 8.13045E?23 6.17074E?21 Sla ?0.448798408 9.546198944 96.60348318 8.46991E?23 6.39835E?21 Ptprcap 0.315090568 10.04014467 96.37240421 9.51847E?23 7.157E?21 Nr4a2 ?0.567778459 9.521228879 96.12073243 1.08087E?22 8.08951E?21 Gm9843 ?0.294369077 10.49166455 95.54204333 1.44784E?22 1.0786E?20 Laptm5 0.208711783 10.49799071 94.88345685 2.0193E?22 1.49743E?20 Snrpg ?0.264157695 10.10181353 94.14112586 2.93811E?22 2.16883E?20 Ass1 0.437532946 9.53437863 92.9075629 5.47947E?22 4.02642E?20 ler5l ?0.591031741 9.223274756 92.85145529 5.63704E?22 4.12345E?20 Birc5 ?0.774093032 9.251668784 92.70648319 6.06546E?22 4.41685E?20 Rpl21 ?0.141074021 11.76876712 92.34010486 7.29901E?22 5.29129E?20 Lmnb1 ?0.395473345 9.781576618 92.00566036 8.64289E?22 6.23754E?20 Qrfp 0.327357379 9.165807799 91.69725749 1.01005E?21 7.25708E?20 Eno1 0.29946273 9.942452612 91.61301618 1.05397E?21 7.53918E?20 Ppp1ca 0.233359723 10.29808235 91.22780891 1.28048E?21 9.11905E?20 Gm10073 ?0.394855462 9.699374848 90.63658937 1.72638E?21 1.22407E?19 Itpkb ?0.452002805 9.509585234 90.53161196 1.82045E?21 1.28513E?19 Tmem176a ?0.709693164 9.404482276 90.2402785 2.10924E?21 1.48252E?19 Mpnd 0.436149431 9.307880167 90.19537586 2.15766E?21 1.50999E?19 Rab8a 0.368294453 9.516531936 89.88306722 2.5266E?21 1.76056E?19 Mt1 0.685595236 9.253327294 89.15305586 3.65418E?21 2.53534E?19 Capg 0.383533992 9.809408711 88.6700908 4.66465E?21 3.2226E?19 Ikzf2 ?0.697619136 9.29885187 88.40616184 5.33045E?21 3.6669E?19 Hrh4 0.220443917 9.160771464 88.04349384 6.40309E?21 4.38612E?19 Eif5 ?0.335801311 9.823445443 87.78758948 7.28748E?21 4.97086E?19 Rpl41 ?0.105943424 12.79526034 87.62321264 7.91898E?21 5.37892E?19 Degs1 0.387396398 9.418897111 87.48336602 8.49916E?21 5.74884E?19 Ccna2 ?0.40044653 9.193824398 87.40535243 8.84109E?21 5.95521E?19 Il4ra ?0.451028003 9.499550436 86.23410607 1.59847E?20 1.07223E?18 Kcnab2 0.447184668 9.290281332 85.60058808 2.2021E?20 1.47104E?18 Cdkn2d 0.465467752 9.369239164 85.53454873 2.27688E?20 1.51474E?18 Rps12-ps3 ?0.339355757 9.91463743 85.02653826 2.94387E?20 1.95044E?18 Dok2 0.39150937 9.437395362 84.64612001 3.56843E?20 2.35458E?18 Ecm1 ?0.527046667 9.213869135 84.63123432 3.5954E?20 2.36273E?18 Srsf7 ?0.369743626 9.589293129 84.41319337 4.0146E?20 2.62753E?18 Gnai2 0.258354443 10.17425826 84.02128898 4.89475E?20 3.19067E?18 Atp5l 0.187626855 10.47767657 82.95184884 8.40767E?20 5.45857E?18 2810474O19Rik 0.414915888 9.518034833 82.51633462 1.048E?19 6.77682E?18 Tmem176b ?0.636118826 9.448063427 82.22323647 1.21552E?19 7.82875E?18 Cenpa ?0.530464482 9.394708498 80.8065773 2.48928E?19 1.59689E?17 Rpl6l ?0.255942445 10.20631876 80.66181687 2.67848E?19 1.70474E?17 Rplp0 0.119720189 12.38788281 80.66592463 2.67292E?19 1.70474E?17 Srsf2 ?0.318215702 9.857765406 80.54991993 2.83453E?19 1.79698E?17 Il1r2 ?0.709588642 9.25672179 80.41166541 3.03995E?19 1.91968E?17 Cox4i1 0.165502192 10.68635697 79.34468754 5.21663E?19 3.2814E?17 Sp100 0.35419291 9.553598448 79.04472727 6.07196E?19 3.80462E?17 Coq10b ?0.402784111 9.509847044 78.97265199 6.29757E?19 3.93075E?17 Lcn4 0.452058809 9.193732712 78.58412421 7.6663E?19 4.76667E?17 Penk ?0.97476906 9.250330203 78.56769485 7.73033E?19 4.78807E?17 Rps17 ?0.207724729 10.61521551 77.30519082 1.46481E?18 9.03819E?17 Npc2 0.258897774 9.848502166 77.27191156 1.4897E?18 9.15682E?17 Kpna1 ?0.465763262 9.374034121 77.23584317 1.51715E?18 9.29025E?17 Klrc2 0.494282599 9.283377565 77.02917358 1.68451E?18 1.02762E?16 1810058124Rik 0.350718585 9.463204041 76.79034685 1.90105E?18 1.15535E?16 Tubb5 ?0.402918211 10.00329454 76.77948586 1.91153E?18 1.15737E?16 Runx2 0.418744898 9.311867377 76.7116709 1.97831E?18 1.19333E?16 Hspa1b ?0.811543031 9.330502334 76.31282443 2.42106E?18 1.45498E?16 Pld3 0.396449863 9.363194614 76.05243089 2.76232E?18 1.65391E?16 2810417H13Rik ?1.011187289 9.337691412 75.408969 3.82648E?18 2.28261E?16 Hist1h1c 0.520548203 9.543347573 75.2055756 4.24168E?18 2.52099E?16 Abi3 ?0.513763069 9.334628841 74.69953195 5.48091E?18 3.24558E?16 Maff ?0.542704954 9.305194699 74.66275934 5.58396E?18 3.29453E?16 Eprs ?0.467694903 9.384361092 74.62296026 5.69767E?18 3.3494E?16 Plec 0.418445279 9.207830137 74.5132662 6.02322E?18 3.52795E?16 Ctsa 0.36742707 9.447076929 74.12724047 7.32407E?18 4.2744E?16 Uba52 ?0.247091632 10.23997211 73.81613397 8.57429E?18 4.98604E?16 Xist ?0.668090773 9.888840859 73.76865447 8.78303E?18 5.08912E?16 Stmn1 ?0.902189526 9.430632462 73.4820959 1.01553E?17 5.86324E?16 Tmsb10 0.127806456 12.94248487 73.30106466 1.11308E?17 6.40357E?16 Rps13 ?0.114822052 11.92527065 72.93365805 1.34082E?17 7.68641E?16 Hmgn1 ?0.472844497 9.24964203 72.65748184 1.54221E?17 8.80968E?16 Top2a ?0.571920918 9.285394761 72.45227309 1.71121E?17 9.74063E?16 Spc24 ?0.4090324 9.204180171 72.24512376 1.9006E?17 1.07807E?15 Ppp1r15a ?0.411070109 9.595245048 72.1100221 2.03527E?17 1.15043E?15 Eomes ?0.680093092 9.215483506 71.67702638 2.53467E?17 1.42771E?15 Swap70 0.410801492 9.194641096 71.595587 2.64147E?17 1.48271E?15 Itga4 0.403875994 9.394391702 71.57584864 2.66802E?17 1.49243E?15 Anp32e ?0.379405088 9.516990745 70.78954069 3.97439E?17 2.21551E?15 Arl2bp 0.321268348 9.473272776 70.77467715 4.00444E?17 2.2246E?15 Sike1 0.404053142 9.285336783 70.63030965 4.30847E?17 2.3853E?15 Myo1f 0.413029505 9.304626444 70.51398558 4.57015E?17 2.52154E?15 Fxyd4 0.216164291 9.161845803 70.34300404 4.98393E?17 2.74048E?15 Insig1 ?0.468471973 9.373382406 70.3189397 5.0451E?17 2.76471E?15 Anxa5 0.335340423 9.456501432 70.29264776 5.11279E?17 2.79234E?15 Rps12 ?0.189372327 10.77087646 69.76259892 6.68892E?17 3.64085E?15 Arpc2 0.155543095 10.79500611 69.53607194 7.50297E?17 4.07024E?15 Pnrc1 ?0.22302859 10.57767668 69.46707965 7.77006E?17 4.20103E?15 Ppib 0.233842294 9.881020252 69.34980439 8.24608E?17 4.44354E?15 Gm9493 ?0.228613016 10.33361801 69.2113078 8.84594E?17 4.75095E?15 Dpcd 0.422954441 9.248387156 69.18710349 8.95517E?17 4.79369E?15 Rpl24 0.115597877 11.77230384 69.10660292 9.32825E?17 4.97692E?15 Pkp3 0.322991067 9.70969078 69.06988323 9.50356E?17 5.05377E?15 Crip2 0.493033563 9.219720142 68.71993548 1.13488E?16 6.01523E?15 Rps6 ?0.104903549 12.20844385 68.69896404 1.14701E?16 6.05967E?15 Cox5a 0.222688552 10.08163797 68.41076629 1.32751E?16 6.99039E?15 Kdm6b ?0.473433547 9.740181133 68.2056575 1.47303E?16 7.73147E?15 Rbm3 0.190550874 10.73115847 67.86636293 1.74961E?16 9.15344E?15 Rpl6 ?0.112569061 11.76088309 67.73571974 1.86946E?16 9.74893E?15 Arpc4 0.248366607 9.810389381 67.10469229 2.57465E?16 1.33832E?14 Rpl13 ?0.102585652 12.63773605 66.84961241 2.9303E?16 1.51346E?14 D8Ertd738e ?0.24018408 10.02747279 66.85109585 2.92809E?16 1.51346E?14 Hmgn2 ?0.499593273 9.445371749 66.69834967 3.164E?16 1.62896E?14 Atox1 0.27625198 9.640004593 66.58567045 3.35013E?16 1.71931E?14 Eef2 0.127179582 11.29644286 66.52871607 3.44833E?16 1.76411E?14 Nr4a3 ?0.449594613 9.253600396 66.40569813 3.6704E?16 1.87179E?14 H2afx ?0.484140494 9.351631242 66.38946902 3.70074E?16 1.88133E?14 Rcbtb2 ?0.478710507 9.398952659 66.37266476 3.73242E?16 1.89149E?14 Il17a ?0.932121997 9.237217593 66.09431516 4.29854E?16 2.17157E?14 Tuba4a ?0.427821736 9.389392328 66.08179574 4.32593E?16 2.1786E?14 Fau ?0.101663836 12.30166869 65.56169951 5.63228E?16 2.82768E?14 Paxbp1 ?0.443740412 9.251233688 65.53032342 5.72266E?16 2.85533E?14 Rpl5 ?0.176646222 10.56771244 65.53343568 5.71363E?16 2.85533E?14 Rrm2 ?0.60210116 9.247674435 65.35593265 6.25214E?16 3.10991E?14 Abcb1a ?0.448389508 9.300396921 65.34292109 6.29356E?16 3.12091E?14 Pim3 ?0.482845753 9.328422325 65.07244979 7.21944E?16 3.5691E?14 Spef2 0.337654887 9.175320605 65.03415325 7.36111E?16 3.62804E?14 Car5b 0.345768026 9.17782806 64.90035524 7.87829E?16 3.87114E?14 Xrn2 0.37261421 9.343045417 64.8757557 7.97726E?16 3.90789E?14 Ech1 0.305307325 9.539590664 64.52484105 9.5323E?16 4.65556E?14 Rap1gap2 0.247182525 9.165395658 64.43601206 9.97188E?16 4.85558E?14 Tox2 ?0.366384133 9.191330824 64.11910587 1.1712E?15 5.68578E?14 Tnfaip8l2 0.393193127 9.325796745 63.9932113 1.24849E?15 6.04283E?14 Nt5c 0.321207331 9.46177492 63.91994481 1.29579E?15 6.25306E?14 Rasgrp1 ?0.390344872 9.487650699 63.86570537 1.33196E?15 6.40848E?14 Prelid1 0.277620155 9.693827343 63.70800001 1.44297E?15 6.92199E?14 Rpl13a 0.093506977 13.1315227 63.41756016 1.67221E?15 7.9979E?14 Cks1b ?0.54776796 9.261766706 63.35897481 1.72269E?15 8.21503E?14 Mmd ?0.493783446 9.302850291 63.28725567 1.78656E?15 8.49459E?14 Serpini1 0.297936677 9.172144254 63.1533642 1.91223E?15 9.06541E?14 Rps18-ps3 ?0.383942395 9.484983983 63.13228605 1.9328E?15 9.13615E?14 Atp8b4 0.282378055 9.170105411 62.70317375 2.40328E?15 1.13269E?13 Chchd2 ?0.185649555 10.44214805 62.67240577 2.44112E?15 1.14718E?13 Rpl22 ?0.161149578 10.60718396 62.52082164 2.63643E?15 1.23538E?13 Madd 0.355724386 9.387289733 62.16934741 3.15155E?15 1.47249E?13 Spc25 ?0.265138721 9.180366242 62.11597042 3.23815E?15 1.50858E?13 Apobec3 0.340744453 9.503283445 61.75805314 3.8836E?15 1.80409E?13 Nmrk1 ?0.43682095 9.470654245 61.62438468 4.15639E?15 1.92528E?13 Ltb 0.299299727 10.15492701 61.50031252 4.42673E?15 2.04464E?13 Itgb2 0.302934438 9.575070658 61.4814308 4.46938E?15 2.05846E?13 Rgs19 0.371295223 9.28716881 61.40647112 4.64282E?15 2.13227E?13 Chchd10 ?0.473427777 9.239735277 61.29318067 4.91781E?15 2.25216E?13 Arhgap15 0.327112956 9.436551627 60.90418079 5.99215E?15 2.73641E?13 5430427O19Rik 0.372356642 9.195518327 60.83083196 6.21962E?15 2.83229E?13 1110008F13Rik 0.315751896 9.430011424 60.72906256 6.5496E?15 2.97418E?13 Adora2a ?0.392567249 9.426697678 60.21879694 8.48778E?15 3.84351E?13 Cbx3 ?0.405488348 9.517985802 60.17684028 8.67064E?15 3.91535E?13 Snx10 0.373362566 9.204288337 60.06212372 9.19101E?15 4.13877E?13 Ccr4 ?0.421655714 9.227421818 59.72211968 1.09242E?14 4.90556E?13 Cxcl10 ?0.664443182 9.358371286 59.64847266 1.13407E?14 5.07851E?13 Cfl1 0.149724783 11.11290366 59.32651689 1.33565E?14 5.96252E?13 Fam65b 0.396364559 9.256723776 59.32179213 1.33886E?14 5.96252E?13 Kxd1 0.3361848 9.397333347 59.2482617 1.38983E?14 6.17253E?13 Nusap1 ?0.426549788 9.207238975 59.13228173 1.47421E?14 6.52933E?13 P2ry14 0.347177821 9.17900749 59.03492232 1.54898E?14 6.84177E?13 Oat ?0.395947403 9.329291217 58.93175541 1.63236E?14 7.19041E?13 Flt3l 0.35959273 9.333363234 58.9039048 1.65563E?14 7.27309E?13 Fmnl1 0.350065739 9.349669898 58.68899791 1.84671E?14 8.0905E?13 Morf412 ?0.364938214 9.397534901 58.42868198 2.10795E?14 9.21005E?13 Slc25a24 0.377308788 9.218974536 58.36398837 2.17842E?14 9.49228E?13 Rpl14 ?0.107475124 11.87708218 58.29747299 2.25333E?14 9.79231E?13 Faah 0.370597532 9.275976683 58.27112054 2.28372E?14 9.89775E?13 Cotl1 0.197250984 10.46134647 58.24188048 2.31792E?14 9.99238E?13 Tmem71 0.38204988 9.273813725 58.24380723 2.31565E?14 9.99238E?13 Plek 0.43842105 9.215818477 57.95124621 2.68695E?14 1.15525E?12 Fam110a ?0.37843848 9.494240477 57.91214141 2.7409E?14 1.17532E?12 Calm2 ?0.204357886 10.41345274 57.66217283 3.11231E?14 1.33105E?12 Cdc20 ?0.352635513 9.190015265 57.57131431 3.25945E?14 1.3903E?12 Rilpl2 0.353546322 9.398891472 57.47613338 3.42105E?14 1.45539E?12 Nucks1 ?0.385021534 9.378610594 57.24063171 3.85622E?14 1.63621E?12 Traf4 ?0.412707476 9.35979853 57.1752643 3.98654E?14 1.68708E?12 Myo1g 0.326411976 9.439455324 56.91402368 4.55288E?14 1.92172E?12 PISD ?0.424075103 9.326147814 56.80816092 4.80468E?14 2.02272E?12 Bbc3 0.390523027 9.210384865 56.78266578 4.86738E?14 2.04379E?12 Mki67 ?0.367343453 9.203057109 56.75183508 4.94429E?14 2.07071E?12 1700025G04Rik 0.355444841 9.18123029 56.74235589 4.96818E?14 2.07534E?12 Phlda1 ?0.491778784 9.440764624 56.55498898 5.46486E?14 2.27693E?12 Tmem160 0.265315817 9.59150512 56.52865987 5.53852E?14 2.30169E?12 Arf5 0.198635135 9.981768048 56.30803437 6.19617E?14 2.56839E?12 Trpv2 0.372377047 9.250925444 56.10050974 6.88593E?14 2.847E?12 Usp3 0.355354175 9.292631844 56.06888598 6.99758E?14 2.88579E?12 Pqlc3 0.362365955 9.234748342 56.01745486 7.18305E?14 2.95474E?12 Rpl9-ps6 ?0.290907311 9.841070067 55.92224168 7.53948E?14 3.09348E?12 Gabpb1 ?0.386813549 9.478096364 55.7462451 8.24556E?14 3.37463E?12 Rpl37 ?0.100831831 12.07305382 55.51209471 9.28858E?14 3.7919E?12 Ptprc 0.203113685 10.11524395 55.28566724 1.04226E?13 4.24412E?12 Tmem234 0.252630089 9.671898221 55.08446668 1.1546E?13 4.68976E?12 Tesc ?0.34262081 9.483468613 55.07619352 1.15947E?13 4.69773E?12 Xcl1 ?0.961147086 9.405065931 55.04662835 1.17704E?13 4.75701E?12 Lag3 ?0.642931722 9.272156156 55.01140439 1.19832E?13 4.83095E?12 Uqcrfs1 0.229745717 9.714864078 54.99578919 1.20788E?13 4.85737E?12 Tktl1 0.186029244 9.161740461 54.91081279 1.26125E?13 5.0594E?12 Edf1 0.203844061 9.905022216 54.87068451 1.28727E?13 5.15099E?12 Cirbp ?0.263662128 9.821626437 54.83975146 1.30769E?13 5.21978E?12 Ska1 ?0.153998658 9.167697937 54.81765797 1.32247E?13 5.26578E?12 Cdc42se1 0.329661747 9.377124053 54.67523687 1.42187E?13 5.64764E?12 Asf1b ?0.438345195 9.223299882 54.65077324 1.43968E?13 5.70437E?12 Hmgb1 ?0.219889837 10.29714889 54.58969676 1.48512E?13 5.87005E?12 Hic1 ?0.432264919 9.270363669 54.4810714 1.56952E?13 6.18852E?12 Sept11 0.356045397 9.343747121 54.27766493 1.74069E?13 6.84672E?12 Tprgl 0.251967719 9.655126678 54.16606559 1.84241E?13 7.22924E?12 Nfatc2 ?0.402648226 9.26546375 54.15455217 1.85324E?13 7.25411E?12 Gyg 0.370089737 9.256694676 54.09174115 1.91344E?13 7.47165E?12 H2-K1 ?0.13757215 11.61002041 53.98001915 2.02539E?13 7.88974E?12 Isy1 ?0.370234123 9.388840432 53.94586091 2.06091E?13 8.0088E?12 Cenpe ?0.220150784 9.175332099 53.84735181 2.16687E?13 8.38029E?12 Fryl ?0.393078983 9.288378553 53.84761229 2.16658E?13 8.38029E?12 Tacc3 ?0.302069013 9.190084756 53.74794908 2.27932E?13 8.79415E?12 Dusp4 ?0.416920504 9.244696816 53.55668266 2.51238E?13 9.67028E?12 Tpm4 0.30198206 9.580032755 53.4530001 2.64854E?13 1.01701E?11 Ccdc12 0.24770037 9.642269047 53.43241053 2.67645E?13 1.02529E?11 Stk11 ?0.342997764 9.400849509 53.3637069 2.77171E?13 1.05928E?11 Acp5 0.327797466 9.39691335 53.27003737 2.90707E?13 1.10839E?11 Serf2 0.134205382 10.706856 53.12999948 3.12188E?13 1.18749E?11 Nr3c1 ?0.376848168 9.448729303 52.68065901 3.92437E?13 1.48923E?11 Cdca8 ?0.387769623 9.207959893 52.53102797 4.23504E?13 1.60337E?11 Srrm2 ?0.257041817 9.807993986 52.48496978 4.33554E?13 1.63758E?11 Prkcq 0.358224651 9.276198391 52.33872288 4.67073E?13 1.76007E?11 Ccl4 ?1.176767063 9.567226392 52.26773318 4.84267E?13 1.82062E?11 Smc2 ?0.437413231 9.240676881 52.25511877 4.87387E?13 1.8281E?11 Kcnn4 0.360084555 9.328517363 52.18835536 5.04243E?13 1.88694E?11 Icam1 0.396186315 9.404345015 51.59667848 6.81568E?13 2.54463E?11 Tpgs1 0.358707501 9.260754154 51.49756628 7.16859E?13 2.67022E?11 Lck 0.169753726 10.31649673 51.26743412 8.06017E?13 2.99542E?11 Riok1 ?0.390179495 9.379968099 51.08907685 8.82681E?13 3.25786E?11 Mapkapk3 0.323418904 9.378101749 51.09610669 8.79526E?13 3.25786E?11 Dnajb2 ?0.356805427 9.204584167 51.09030293 8.8213E?13 3.25786E?11 Rrm1 ?0.36213335 9.219702428 51.03600203 9.06873E?13 3.33952E?11 Ckb ?0.422149772 9.335719986 50.72744307 1.06125E?12 3.89914E?11 Rpl13-ps3 ?0.279124517 9.66187407 50.69891137 1.07679E?12 3.94726E?11 Lin54 ?0.392624993 9.319364611 50.60318457 1.13061E?12 4.13518E?11 Aurkb ?0.208001106 9.176325027 50.50706228 1.18737E?12 4.33295E?11 Fam71b 0.31531926 9.185043177 50.47467455 1.20713E?12 4.39513E?11 Fam188a 0.352368275 9.234514724 50.44674626 1.22443E?12 4.44811E?11 Cyb5r4 0.316676256 9.336417497 50.28053448 1.33265E?12 4.8304E?11 Rnf138 0.269807224 9.608877256 50.16919159 1.41045E?12 5.10097E?11 H2-Q4 ?0.265803125 9.753674988 50.11945341 1.44666E?12 5.22024E?11 Gpr171 0.266612793 9.722723261 50.08308592 1.47372E?12 5.30604E?11 mt-Nd1 ?0.157466526 11.14928249 49.66729327 1.82157E?12 6.5439E?11 Arhgap30 0.318944329 9.36964608 49.49433071 1.98946E?12 7.13117E?11 Ranbp1 ?0.295883166 9.626989183 49.47831386 2.00577E?12 7.17194E?11 Ube2d3 0.142474457 10.46165668 49.47446563 2.00971E?12 7.17194E?11 Gng2 0.272653394 9.504051907 49.4405448 2.04476E?12 7.28096E?11 Gm7676 0.177214754 9.1626667 49.12506242 2.40152E?12 8.53253E?11 Rps18 ?0.093749751 12.47336152 49.06724846 2.47336E?12 8.76848E?11 Atp5c1 0.195509129 9.901795293 48.70713718 2.97183E?12 1.05126E?10 Rpl31 ?0.139099182 10.87169602 48.69410038 2.99165E?12 1.05596E?10 Tnfaip3 ?0.241621431 10.12478557 48.62414786 3.10028E?12 1.09192E?10 Mrpl52 ?0.256915947 9.675785023 48.59779994 3.14222E?12 1.10428E?10 Csrnp1 ?0.361872414 9.467384752 48.40889259 3.45996E?12 1.21331E?10 Nudc ?0.299772679 9.486198177 48.36831434 3.5323E?12 1.236E?10 Gdi2 ?0.219013875 9.887687816 48.28408552 3.68733E?12 1.28468E?10 Hnrnpab ?0.306971441 9.483082447 48.28732967 3.68123E?12 1.28468E?10 H2afz ?0.227597078 10.76601923 48.17724714 3.8938E?12 1.3537E?10 Lef1 0.357453344 9.289398985 48.07662452 4.09884E?12 1.42193E?10 Sgip1 ?0.382056564 9.193478703 47.83666323 4.63248E?12 1.60361E?10 Wnk1 ?0.291417518 9.627909802 47.80634854 4.70466E?12 1.62512E?10 Aldoa 0.180711042 10.23632336 47.80033381 4.71912E?12 1.62664E?10 Dusp 14 ?0.452661472 9.24162358 47.66873348 5.04677E?12 1.73587E?10 Rpl27-ps3 ?0.279625551 9.836541137 47.62586986 5.15833E?12 1.77048E?10 Sema4d 0.313025469 9.35787998 47.5753698 5.29293E?12 1.81283E?10 Nfkbid ?0.465977677 9.347258824 47.55442849 5.34978E?12 1.82842E?10 Ccr7 ?0.653811338 9.273164068 47.46702965 5.59369E?12 1.90775E?10 Napsa 0.299633138 9.173963637 47.45450146 5.62955E?12 1.91594E?10 Mt2 0.405205255 9.179003522 47.44257025 5.66392E?12 1.92359E?10 Impdh2 ?0.328858199 9.377823225 47.41545958 5.7428E?12 1.94629E?10 Tpx2 ?0.235310258 9.180975529 47.31848587 6.03405E?12 2.04072E?10 D930028M14Rik 0.221228249 9.165073917 47.30826359 6.0656E?12 2.04711E?10 Shcbp1 ?0.186670641 9.173032321 47.12435823 6.66226E?12 2.24379E?10 Snx5 0.285118196 9.443629607 46.87702366 7.55837E?12 2.5403E?10 Rnf13 0.334006595 9.270089812 46.83603919 7.7181E?12 2.5886E?10 Zfp36l1 ?0.354382619 9.536461336 46.67959216 8.3595E?12 2.79792E?10 Mad2l1 ?0.336041583 9.208096533 46.66245921 8.43291E?12 2.81666E?10 Gm8369 0.245202324 9.924470839 46.62050658 8.61539E?12 2.87168E?10 Itgb1bp1 0.312257232 9.308749164 46.50417327 9.14235E?12 3.04106E?10 Npm3 0.254196025 9.590225344 46.44713082 9.41241E?12 3.11805E?10 Slamf7 0.355858539 9.281091881 46.4475631 9.41033E?12 3.11805E?10 Nop10 ?0.247091186 9.680893727 46.36563341 9.81215E?12 3.24383E?10 IlZrb 0.250143282 9.646387369 46.35369914 9.8721E?12 3.25699E?10 St13 ?0.295016503 9.483628577 46.29117192 1.01922E?11 3.35575E?10 Lamb3 0.352261752 9.282524225 46.10335197 1.12176E?11 3.68586E?10 4930503L19Rik ?0.366113571 9.217222488 46.0856953 1.13192E?11 3.71168E?10 Psmb3 0.188881553 9.906083726 46.05925169 1.1473E?11 3.75451E?10 Itm2c ?0.297908775 9.518082662 45.91218367 1.23674E?11 4.03903E?10 Dynll2 ?0.337577901 9.353846602 45.64014248 1.42099E?11 4.63141E?10 Ppp3ca 0.310612578 9.326663671 45.56895099 1.47359E?11 4.79317E?10 Pdcd10 0.238398558 9.559474431 45.50441543 1.52295E?11 4.94378E?10 Hnrnpa1 ?0.26197532 9.626210649 45.43016426 1.58179E?11 5.12451E?10 Cxcr6 0.246872073 10.38993842 45.24422742 1.73932E?11 5.62358E?10 Ckap2l ?0.110672662 9.164094745 45.23933167 1.74368E?11 5.62641E?10 Ndufa5 ?0.282769786 9.479890673 44.84834027 2.12901E?11 6.8561E?10 Pbk ?0.121046883 9.166098176 44.70325909 2.29275E?11 7.36872E?10 Slc3a2 ?0.220945351 10.08964541 44.59582917 2.42207E?11 7.76889E?10 Rbms1 0.285512041 9.408009945 44.5829661 2.43804E?11 7.80461E?10 Tbc1d10c 0.280613085 9.522585953 44.55291444 2.47575E?11 7.90967E?10 Tiparp ?0.383475799 9.253515787 44.52403539 2.51254E?11 8.01137E?10 Ablim1 0.286261251 9.407304211 44.49848449 2.54554E?11 8.10064E?10 Ccnb1 ?0.246088895 9.183063921 44.26867125 2.86261E?11 9.09174E?10 Fyb ?0.19056904 10.08185682 44.23904901 2.90626E?11 9.21226E?10 Smco4 ?0.348268101 9.324729592 44.19116783 2.97822E?11 9.4219E?10 Nhp2l1 ?0.22781492 9.714965176 43.83830396 3.56656E?11 1.12611E?09 Ncl ?0.191524875 10.07286917 43.70541544 3.81714E?11 1.20288E?09 Cldnd1 ?0.308788378 9.795081241 43.55524172 4.12159E?11 1.2963E?09 Marcksl1 ?0.412529974 9.352502046 43.54726008 4.13843E?11 1.29907E?09 Hist1h2ap ?0.268260711 9.186664241 43.4233744 4.4089E?11 1.38128E?09 Avl9 ?0.326052978 9.389562788 43.36184802 4.54973E?11 1.42265E?09 Itgav ?0.360644343 9.245488736 43.33825691 4.60492E?11 1.43712E?09 Hk2 ?0.407653809 9.291524998 43.16055459 5.04271E?11 1.57072E?09 AW011738 ?0.339602901 9.202092298 43.07369562 5.27163E?11 1.63887E?09 Ppp1cc ?0.199608403 10.14033253 42.81442413 6.01867E?11 1.86752E?09 Bpnt1 ?0.336240301 9.20504925 42.69801734 6.3877E?11 1.97823E?09 Mvb12a 0.294858646 9.323824234 42.65192056 6.54002E?11 2.02153E?09 Eif3h 0.142723574 10.29701565 42.48500485 7.12262E?11 2.19741E?09 Psmb1 0.150510975 10.1666932 42.38821715 7.48396E?11 2.30449E?09 Acot7 0.241728025 9.577204572 42.3784288 7.5215E?11 2.31165E?09 Bak1 0.314497757 9.291916907 42.22934344 8.11729E?11 2.49002E?09 Grap 0.253931168 9.547624225 42.1727058 8.35581E?11 2.55833E?09 Tpst2 0.257626354 9.502673289 42.15008125 8.45304E?11 2.58321E?09 Nuf2 ?0.124493218 9.166373674 42.01178275 9.07251E?11 2.76729E?09 Card19 0.31293595 9.298133437 42.00070748 9.12404E?11 2.77776E?09 Nop56 ?0.297251616 9.449988788 41.996255 9.14484E?11 2.77886E?09 Pdlim1 0.34171296 9.286551213 41.96937305 9.27143E?11 2.81204E?09 St3gal4 0.317411314 9.222969771 41.85826443 9.81351E?11 2.97088E?09 Fcgrt 0.184065277 9.164513649 41.8039417 1.009E?10 3.04887E?09 Msrb1 0.314774706 9.280628983 41.77610517 1.02347E?10 3.08682E?09 Rasgrp4 ?0.295228004 9.196046455 41.7685978 1.0274E?10 3.09292E?09 AI467606 0.324438402 9.267747664 41.73680495 1.04425E?10 3.13779E?09 Cdc37 0.203897376 9.718870186 41.71248815 1.05731E?10 3.17116E?09 Casc5 ?0.148113275 9.168214058 41.66042957 1.08585E?10 3.2507E?09 Plk1 ?0.149116992 9.169178309 41.61760036 1.1099E?10 3.31656E?09 Tspan13 ?0.27748507 9.546665786 41.59956108 1.12018E?10 3.34112E?09 Lrrfip1 0.242872199 9.612103437 41.52173694 1.16568E?10 3.47041E?09 Phpt1 ?0.340431832 9.254999299 41.51672903 1.16867E?10 3.47291E?09 Neurl3 ?0.286535533 9.619611619 41.47993197 1.19087E?10 3.53241E?09 Samsn1 ?0.284615787 9.795489494 41.41464949 1.23131E?10 3.64568E?09 Zfand2b 0.305793679 9.278292325 41.37076738 1.25927E?10 3.72162E?09 Myl12a 0.136720366 10.6785009 41.28722683 1.31425E?10 3.87703E?09 Abhd17c ?0.333647132 9.339492108 41.13540964 1.4204E?10 4.18254E?09 H1f0 0.390304588 9.42979381 41.10570101 1.44215E?10 4.23887E?09 Eif4e3 0.324534257 9.248327932 41.0449197 1.4877E?10 4.36474E?09 Glmp 0.274250566 9.373701727 41.04141669 1.49037E?10 4.36474E?09 Rps3a1 ?0.090667436 11.67400244 40.92375183 1.58286E?10 4.62721E?09 Gm15518 0.228681393 9.168202192 40.85271619 1.64145E?10 4.78983E?09 Rpl15 ?0.128287104 10.73595635 40.74537027 1.73414E?10 5.05118E?09 AI662270 0.246465493 9.519765054 40.71742886 1.75911E?10 5.11471E?09 Mettl23 0.24517514 9.492427646 40.62567419 1.84368E?10 5.35098E?09 Klhdc2 0.319366014 9.222186834 40.59634857 1.87156E?10 5.42216E?09 Mina 0.323015776 9.23713881 40.58692412 1.88061E?10 5.43863E?09 Tspan17 0.219617857 9.166558893 40.57116773 1.89584E?10 5.47287E?09 Mast4 ?0.268505285 9.181693356 40.49239029 1.97383E?10 5.68788E?09 Nrros 0.326643367 9.212274046 40.45712311 2.00978E?10 5.78117E?09 Rpl35a ?0.091306405 11.72350894 40.31639133 2.15989E?10 6.16905E?09 Tecpr1 0.291847632 9.413080476 40.31802823 2.15808E?10 6.16905E?09 Tnfaip8 ?0.272987616 9.630271166 40.31930658 2.15667E?10 6.16905E?09 Iqgap2 0.31845389 9.250835755 40.32196987 2.15373E?10 6.16905E?09 Nacc2 0.113924114 9.158821816 40.16272262 2.33665E?10 6.66212E?09 Sdc4 ?0.319690858 9.184319545 40.14933305 2.35272E?10 6.69613E?09 Cox5b 0.173428491 10.04348938 40.0573221 2.46619E?10 7.00674E?09 Clec12a 0.347851947 9.187024502 39.98950738 2.55331E?10 7.24154E?09 Gadd45a ?0.316811725 9.199789132 39.9749406 2.57242E?10 7.28297E?09 Osbpl9 ?0.347920433 9.306529663 39.95290108 2.60161E?10 7.35273E?09 Fabp5 ?0.345368512 9.261083113 39.92194667 2.64317E?10 7.45714E?09 Skil ?0.300077713 9.558668519 39.91051627 2.65868E?10 7.48784E?09 Wdr95 0.256187953 9.168701519 39.61982647 3.08535E?10 8.6744E?09 Plac8 0.315422604 10.56912296 39.54916829 3.19903E?10 8.97838E?09 Gzmb 0.462504549 10.35039813 39.53373005 3.22442E?10 9.03395E?09 Uqcrh 0.128854127 10.54582243 39.49939278 3.28161E?10 9.1783E?09 Uqcrc2 0.243771762 9.469343526 39.41541302 3.42582E?10 9.56508E?09 Cdk1 ?0.282404204 9.197337951 39.40808657 3.4387E?10 9.58449E?09 Gm10263 ?0.356543926 9.257269073 39.30048844 3.6335E?10 1.011E?08 Jak2 ?0.339854318 9.275558522 39.22581003 3.77517E?10 1.04861E?08 Tff1 ?0.343877655 9.186730263 39.16799524 3.88863E?10 1.07828E?08 Lypla1 0.281543012 9.34948844 39.03404604 4.16479E?10 1.15288E?08 H2afv ?0.270944916 9.565009799 38.95620237 4.33421E?10 1.19772E?08 Cmtm7 0.271258758 9.51328408 38.81166005 4.66732E?10 1.28757E?08 Zdhhc20 0.287294355 9.3491135 38.69079567 4.96545E?10 1.36293E?08 Sla2 0.304926143 9.310517201 38.69603223 4.95215E?10 1.36293E?08 Kif4 ?0.083959125 9.162292079 38.69067267 4.96576E?10 1.36293E?08 Ythdc1 ?0.304345812 9.376355755 38.65093522 5.0679E?10 1.3886E?08 Nek2 ?0.092225985 9.163012699 38.61679108 5.15733E?10 1.41072E?08 Rad51 ?0.174396222 9.174504007 38.53074142 5.3898E?10 1.47182E?08 Serp2 0.23272394 9.169810674 38.36728567 5.86067E?10 1.5977E?08 Dstn 0.315401763 9.262001726 38.26911479 6.16304E?10 1.6773E?08 Stk17b 0.177968741 10.0837855 38.26279885 6.18302E?10 1.67991E?08 Rps7 ?0.087706789 11.94320961 38.23534949 6.27061E?10 1.70085E?08 Rad51ap1 ?0.140603093 9.168896905 38.1844517 6.43632E?10 1.74287E?08 1700097N02Rik 0.369642879 9.22738468 38.17693316 6.46117E?10 1.74668E?08 Gbp9 ?0.314504429 9.2142636 38.1724911 6.4759E?10 1.74774E?08 Ppdpf 0.258511912 9.446285275 38.05634714 6.87308E?10 1.85184E?08 Klra3 0.226113548 9.163693648 38.03066405 6.96415E?10 1.87325E?08 Ipmk ?0.359137989 9.271383503 38.01288193 7.02791E?10 1.88726E?08 Ebi3 ?0.24348842 9.178706953 37.89078919 7.48176E?10 2.00581E?08 Lig1 ?0.326558724 9.221381095 37.80398986 7.82216E?10 2.09359E?08 Ndc80 ?0.199325077 9.175316165 37.55760968 8.87525E?10 2.36761E?08 Cphx3 0.057112739 9.157760229 37.56039337 8.86259E?10 2.36761E?08 Fam64a ?0.106025888 9.164136557 37.51593717 9.06691E?10 2.41476E?08 Bcl2l1 ?0.336680952 9.376460922 37.44850717 9.38585E?10 2.49149E?08 Stat4 ?0.279257694 9.506546424 37.45009794 9.3782E?10 2.49149E?08

    TABLE-US-00020 TABLE 3D LPL?3 vs. All GeneSymbol logFC logCPM LR PValue FDR Ccl5 ?3.484093569 13.31083469 2049.126973 0 0 Nkg7 ?2.068053995 11.21003636 2880.823851 0 0 Plac8 ?2.112200427 10.56917796 1107.936846 6.221E?243 3.3523E?239 Tmem176a 1.889821585 9.404480898 1048.337873 5.5924E?230 2.2602E?226 Ifitm2 ?2.051929407 10.68450167 928.579589 6.0127E?204 1.944E?200 Tmem176b 1.68947291 9.448057145 897.7209976 3.0708E?197 8.2737E?194 Gzmb ?2.848731127 10.35041419 861.179545 2.6985E?189 6.2321E?186 Gzma ?3.564634629 10.72609336 855.0832065 5.7078E?188 1.1534E?184 Lgals3 ?1.660989425 10.20024122 735.8113412 4.8816E?162 8.7685E?159 Ctsw ?1.058583981 9.943492884 639.5495471 4.187E?141 6.7688E?138 Trib2 1.252838144 9.363791422 630.2041805 4.5125E?139 6.6317E?136 Fgl2 ?1.622816533 9.496139008 629.1073924 7.8155E?139 1.0529E?135 Ccr5 ?1.619827421 9.514363816 614.231888 1.3437E?135 1.671E?132 mt-Co3 0.389203125 12.09929332 564.6764741 8.0786E?125 9.3285E?122 Rgs1 ?1.059866606 11.08976227 547.5976498 4.1937E?121 4.5197E?118 Rpl24 0.322646952 11.77231383 525.051429 3.3694E?116 3.4043E?113 Ifitm3 ?1.878179626 9.717619666 520.6260984 3.0926E?115 2.9409E?112 Rps27a 0.315480197 11.80985986 518.9505848 7.1591E?115 6.4296E?112 Rpl35 0.438027821 11.18862718 511.4426173 3.0785E?113 2.6193E?110 mt-Atp6 0.346407175 12.47118005 484.3733011 2.3885E?107 1.9307E?104 Il17re 1.006347022 9.176312021 478.786329 3.925E?106 3.0215E?103 Emb 0.723801071 10.25108396 461.5739746 2.1846E?102 1.6053E?99 Rps3a1 0.298969367 11.67402431 449.1348284 1.1128E?99 7.82125E?97 AW112010 ?0.654555404 11.38311024 444.3256362 1.23889E?98 8.34493E?96 mt-Co1 0.333063388 12.21547389 441.1231167 6.16614E?98 3.98727E?95 Rps7 0.296343917 11.94322764 440.2941583 9.3417E?98 5.80838E?95 Tcf7 0.970709967 9.419632902 430.9726984 9.98116E?96 5.97613E?93 Serpinb1a 1.594483756 9.512634337 428.3674149 3.68317E?95 2.1265E?92 Rplp0 0.280821674 12.38790648 420.5795835 1.82513E?93 1.01741E?90 Rps19 0.311069961 12.57927057 409.2190817 5.42142E?91 2.92142E?88 Rpl31 0.392600539 10.8717304 403.7205395 8.53158E?90 4.44908E?87 Fasl ?1.073589983 9.594179124 401.7278324 2.31638E?89 1.1702E?86 Ifng ?1.773900792 9.68657816 393.9867729 1.12192E?87 5.49606E?85 mt-Nd1 0.433097056 11.1492421 392.3866971 2.50204E?87 1.18965E?84 Tnfrsf25 1.035091499 9.258890182 381.807873 5.02761E?85 2.32218E?82 Rps29 0.309768839 12.24471351 380.2129007 1.11843E?84 5.02238E?82 Satb1 0.803900794 9.757124872 378.0954162 3.23312E?84 1.41261E?81 Slamf6 1.078369968 9.319064798 371.7261222 7.8771E?83 3.35108E?80 Rpl4 0.268392668 11.68907178 368.4591631 4.05214E?82 1.67966E?79 1110034G24Rik 1.031636667 9.229074688 368.1006541 4.85002E?82 1.96014E?79 Rpl10 0.330381836 11.48679578 365.7282838 1.59329E?81 6.28221E?79 Klrk1 ?1.466071219 9.564416625 363.1277724 5.86852E?81 2.25882E?78 Rps8 0.298612024 11.59275565 354.4180219 4.62455E?79 1.73862E?76 Rps18 0.253195601 12.47336872 353.1207929 8.8624E?79 3.25613E?76 Rpl11 0.254557202 11.70912388 351.9326937 1.60795E?78 5.77646E?76 Ramp3 1.163483877 9.937171094 350.6122351 3.11758E?78 1.09562E?75 Litaf ?1.200479411 9.445010559 345.721109 3.62197E?77 1.2458E?74 Rpl6 0.253049825 11.76090091 341.3669788 3.21491E?76 1.08275E?73 Rpl32 0.241752504 12.44743739 338.9149259 1.09947E?75 3.56635E?73 Hspa8 ?0.492721587 12.33067832 338.9084539 1.10304E?75 3.56635E?73 Rpl18 0.257294066 11.80695531 335.2274387 6.98668E?75 2.21464E?72 Rpl17 0.235452932 12.29667899 334.8509986 8.43833E?75 2.62335E?72 Rps11 0.243194098 12.26312142 333.0602877 2.07139E?74 6.31813E?72 Ccl4 ?2.829589103 9.567161703 332.3003568 3.0323E?74 9.0778E?72 Dnajb1 ?1.447456963 10.31718294 330.6483343 6.94352E?74 2.04089E?71 Nebl 0.947797864 9.313896931 326.9696736 4.39345E?73 1.26829E?70 mt-Co2 0.314373224 11.38674425 320.6458124 1.04768E?71 2.97138E?69 Gzmk ?1.551161338 9.363616364 319.3540035 2.00269E?71 5.58198E?69 Ctla2a ?0.96000106 10.33574783 318.1231264 3.71303E?71 1.01737E?68 mt-Nd4 0.424844629 10.50325528 313.2764014 4.22177E?70 1.13749E?67 AA467197 ?1.116233892 9.471396917 303.1631618 6.73964E?68 1.78612E?65 Ccr6 0.698205543 9.169603333 297.721111 1.03341E?66 2.69452E?64 mt-Cytb 0.368527173 11.07880159 295.4669217 3.20185E?66 8.21605E?64 Tox2 0.915454575 9.191330653 295.0827827 3.88237E?66 9.80661E?64 Sh3bgrl3 ?0.377804436 11.24487265 294.6544492 4.81306E?66 1.19705E?63 Rpl13a 0.205282595 13.13152313 285.2357853 5.42831E?64 1.32961E?61 Klrd1 ?1.254419995 9.372630202 281.7142906 3.17707E?63 7.66574E?61 Naca 0.316236433 10.80148809 280.0481025 7.33017E?63 1.74264E?60 Rps14 0.200329253 12.65498588 275.9777944 5.65102E?62 1.32398E?59 Cdkn1a ?1.052199877 9.693085153 274.133611 1.42571E?61 3.29258E?59 Rpl13 0.20968469 12.63773823 272.0638942 4.02809E?61 9.17155E?59 Rpl21 0.243080459 11.76877603 271.3049896 5.89515E?61 1.32363E?58 Epsti1 ?0.650432645 9.945996659 268.5614751 2.33578E?60 5.17264E?58 Rpl8 0.242856061 11.65231323 268.265358 2.71001E?60 5.92028E?58 Rps9 0.221652232 11.99541867 264.7442415 1.58643E?59 3.41949E?57 Nav2 0.696878506 9.1720222 262.7499097 4.31632E?59 9.18126E?57 Rpl26 0.240002472 11.57434921 260.0823989 1.64648E?58 3.45674E?56 Ms4a4b ?0.505784178 10.7517777 255.3500466 1.77064E?57 3.66976E?55 Rpl35a 0.231823918 11.72352561 254.4117161 2.83582E?57 5.80302E?55 KIf2 1.050914377 9.96058395 253.5496162 4.37132E?57 8.83335E?55 Dnaja1 ?0.649029266 10.76357472 252.0606719 9.23E?57 1.84213E?54 Dapk2 ?0.98929305 9.267215042 251.000474 1.57155E?56 3.09826E?54 Rps6 0.203360892 12.20845582 250.6981996 1.82905E?56 3.56247E?54 Ccnd2 ?0.72559072 9.824522402 248.9497462 4.39953E?56 8.467E?54 Rpl15 0.315788404 10.73598071 247.5305633 8.97036E?56 1.70606E?53 Rps28 0.291807857 11.70754918 244.5326764 4.04034E?55 7.59489E?53 Ccr2 ?0.829690745 9.897671261 243.2619236 7.64681E?55 1.4209E?52 Il12rb2 ?0.988980941 9.345961023 240.1135399 3.71491E?54 6.82447E?52 Tnfsf8 0.919482593 10.01800267 236.6741879 2.08882E?53 3.79415E?51 1700003C15Rik 0.760033251 9.171905958 236.1461485 2.72298E?53 4.89108E?51 Rpl34 0.203480775 11.98010645 235.5343091 3.70223E?53 6.57694E?51 Il1r1 0.593316052 9.16767934 234.6804095 5.68417E?53 9.98807E?51 Zfp3611 0.736388217 9.5364341 234.5048916 6.20785E?53 1.0791E?50 Amica1 ?1.075213054 9.335190274 234.4351252 6.42917E?53 1.10568E?50 Id2 ?0.621714646 10.64556657 232.0313476 2.14955E?52 3.65786E?50 Serpina3g ?0.944522464 9.674077113 230.2129487 5.35676E?52 9.02056E?50 Pim1 ?0.589343531 10.82520099 229.9043517 6.25463E?52 1.0424E?49 Rps4x 0.212878973 11.84808117 229.3253412 8.36518E?52 1.37991E?49 Rpl10a 0.271453577 11.14239123 227.5823075 2.0073E?51 3.27778E?49 Rplp1 0.244800173 11.70340699 226.3395342 3.74676E?51 6.05702E?49 Rps25 0.258258722 11.11877073 223.8649551 1.29829E?50 2.07803E?48 Rps20 0.300464014 11.06882543 221.3182323 4.66495E?50 7.39349E?48 H2-D1 ?0.231313769 12.28194321 220.6330101 6.58126E?50 1.03294E?47 Sgip1 0.972538832 9.193478982 220.2322415 8.0487E?50 1.25111E?47 Bhlhe40 ?0.446071264 10.72333649 218.3308818 2.09154E?49 3.22018E?47 Hspa1a ?1.839599971 11.00088949 218.2514974 2.17662E?49 3.31956E?47 Lysmd2 0.793775935 9.24333495 213.2812689 2.64248E?48 3.99237E?46 Rpl18a 0.178127329 12.84271416 213.0268771 3.00268E?48 4.49457E?46 1700012B07Rik 0.635632788 9.170176807 211.5320497 6.36241E?48 9.43621E?46 Znrf1 0.677706008 9.400584211 210.8496366 8.96398E?48 1.31738E?45 Rps5 0.196579458 12.08892933 208.586472 2.79423E?47 4.06951E?45 Rpl14 0.206279565 11.87709072 208.0441994 3.66923E?47 5.29615E?45 Rps23 0.183689361 12.48535349 207.3464825 5.20961E?47 7.45297E?45 Serpinb9 ?0.869185379 9.8583095 205.8671083 1.09544E?46 1.55341E?44 Rps27 0.222000489 13.23482494 204.3505846 2.34686E?46 3.29907E?44 Cmtm7 ?0.738958546 9.513298908 203.6105545 3.40379E?46 4.74359E?44 Pde5a 0.594157393 9.168289214 203.3978824 3.78764E?46 5.23341E?44 Ubb ?0.320988013 12.90465858 202.2363742 6.78919E?46 9.3012E?44 Smco4 0.707891435 9.324733933 202.1246558 7.18119E?46 9.75556E?44 Hilpda ?0.79271988 9.667584429 195.5064907 1.99743E?44 2.69087E?42 Gadd45b ?0.824371717 9.727231622 195.3857517 2.12237E?44 2.83556E?42 Rcbtb2 ?0.897551208 9.398945286 194.1830275 3.88434E?44 5.14707E?42 Slamf7 ?0.863101363 9.281089293 193.3260324 5.97533E?44 7.85344E?42 Anxa2 ?0.662567838 9.842688336 192.9337152 7.27762E?44 9.48791E?42 Rpl19 0.175722974 12.1175247 192.3267078 9.87363E?44 1.27694E?41 Rpl22l1 0.315937439 10.87576896 192.041405 1.13959E?43 1.46211E?41 Tuba1b ?0.817728304 9.730396626 189.0237562 5.1931E?43 6.61037E?41 Ifitm1 ?2.386356518 9.599763038 188.2845877 7.52969E?43 9.50977E?41 Icos 0.472569335 10.25650654 188.1996714 7.85803E?43 9.84751E?41 Rora 0.507992709 9.982330628 187.9097328 9.09084E?43 1.13048E?40 Rps24 0.205699287 12.0059475 184.8181341 4.30032E?42 5.30679E?40 Smim3 ?0.828729834 9.350028927 184.7835494 4.37574E?42 5.35895E?40 Klrc1 ?0.911521288 9.658426162 183.5897616 7.97391E?42 9.6922E?40 Il1r2 1.118729196 9.256730933 183.3064645 9.19434E?42 1.10922E?39 Xcl1 ?1.732920533 9.405068169 182.9886277 1.07872E?41 1.29175E?39 Il22 1.870572455 9.482887799 182.8520365 1.1554E?41 1.37339E?39 Plek ?0.751460525 9.215817596 182.2332023 1.57702E?41 1.86089E?39 Rps2 0.235163135 11.63594659 180.5370278 3.6997E?41 4.33401E?39 Fosb ?1.0044227 9.410738732 179.1890367 7.28599E?41 8.47377E?39 Lilr4b ?0.647414806 9.778128629 177.1360399 2.04534E?40 2.36179E?38 Rpl12 0.278475812 10.9924871 176.0772239 3.48315E?40 3.99352E?38 Rassf3 0.683581715 9.199068087 176.0013684 3.61857E?40 4.11956E?38 Rps16 0.174627684 12.35142977 175.5750544 4.48364E?40 5.06871E?38 Cldnd1 ?0.684362495 9.795115659 175.4406393 4.79715E?40 5.38546E?38 Ctsd ?0.594814309 9.64172066 172.9552202 1.67397E?39 1.86631E?37 Rpl23 0.203421469 11.70878799 170.7965908 4.95662E?39 5.48827E?37 Rgs10 0.539364334 9.631678923 169.9400775 7.62525E?39 8.3857E?37 S1pr1 0.756906257 9.290346876 168.9861794 1.23197E?38 1.34567E?36 Dusp5 ?0.50010877 9.994364417 168.5445148 1.53839E?38 1.6691E?36 Sptssa 0.530775409 9.597728351 168.3290064 1.7145E?38 1.84778E?36 Lsp1 0.371113465 10.32147684 167.8015721 2.23534E?38 2.39314E?36 Tmsb4x ?0.190326855 14.24925577 166.3632964 4.60795E?38 4.9008E?36 Icam1 ?0.836752343 9.404341293 166.161961 5.09903E?38 5.38764E?36 Rps26 0.255375413 10.99418168 166.0950448 5.27357E?38 5.53588E?36 Socs2 ?0.893608998 9.351698274 165.9933737 5.55026E?38 5.78874E?36 Rpa2 ?0.768064662 9.392655105 164.4327646 1.21681E?37 1.26096E?35 Rps3 0.163431739 11.96715944 163.6126366 1.83816E?37 1.89272E?35 Rpl41 0.148484636 12.79527095 163.2689082 2.18512E?37 2.23574E?35 Tspan13 0.526355965 9.546671007 162.7547983 2.83002E?37 2.87736E?35 Cd69 ?0.700203337 9.886218478 161.6594313 4.91014E?37 4.96108E?35 Odc1 0.530928101 10.453789 160.6935792 7.982E?37 8.01472E?35 Bcl2l1 ?0.778019491 9.376464206 159.4570551 1.48688E?36 1.48376E?34 Mrps5 0.67574663 9.263071627 158.1039542 2.93715E?36 2.91301E?34 Hey1 0.339150364 9.161115987 157.942378 3.1859E?36 3.14044E?34 Glrx ?0.646284655 9.565877632 157.1553176 4.73381E?36 4.63799E?34 Abi3 ?0.803877473 9.334617896 156.9668392 5.2047E?36 5.06863E?34 H2afy ?0.435862619 9.9300789 156.0855564 8.10908E?36 7.84978E?34 Samsn1 ?0.607961392 9.795508071 156.0048309 8.44524E?36 8.12653E?34 Rps15 0.19771985 11.49082426 154.2349025 2.05775E?35 1.96838E?33 Rpl29 0.219501544 11.21441306 152.8746442 4.08009E?35 3.87992E?33 Gmfg 0.332354389 10.21757862 152.1259771 5.94693E?35 5.62211E?33 Limd2 0.389855996 10.089006 150.8366734 1.13785E?34 1.06945E?32 Rpl23a 0.168220353 12.17564707 150.4212869 1.40242E?34 1.31049E?32 Rpl28 0.263182468 10.72582102 149.6866768 2.02976E?34 1.88581E?32 Lilrb4a ?0.653757891 9.646924972 148.6586133 3.40536E?34 3.14578E?32 Ftl1 0.286104977 10.82038569 148.5083679 3.67287E?34 3.37361E?32 Cd3g ?0.263497128 11.10927275 148.2266944 4.23231E?34 3.86551E?32 Arhgap31 0.539802079 9.654196025 146.6272891 9.46691E?34 8.59787E?32 Serpinb6b ?0.694956176 9.622268614 145.5103981 1.66103E?33 1.50012E?31 Tbx21 ?0.741006971 9.277656746 144.9687718 2.18167E?33 1.95938E?31 Tmem64 0.7402499 9.248102293 143.79394 3.94133E?33 3.5202E?31 Gnb2l1 0.257536167 10.54032337 143.4136363 4.77301E?33 4.23959E?31 Tm6sf1 ?0.614151136 9.205991409 141.0728903 1.55097E?32 1.37011E?30 Gpr171 ?0.527919467 9.722719309 140.898755 1.69309E?32 1.48753E?30 Ass1 0.557775131 9.534395587 140.432394 2.14121E?32 1.87107E?30 Hsp90aa1 ?0.551436005 10.7686095 140.4135022 2.16168E?32 1.8788E?30 Nsg2 0.457632765 9.167222657 139.9230257 2.76724E?32 2.39225E?30 Rpl22 0.24172144 10.60720364 139.3472402 3.69794E?32 3.17983E?30 Krtcap2 ?0.356333163 10.06414216 139.1868613 4.00896E?32 3.42904E?30 Stk24 0.468770685 9.608428218 138.9674266 4.47733E?32 3.79489E?30 Rgcc ?0.900503044 9.563503156 138.9646335 4.48364E?32 3.79489E?30 Gpr34 ?0.757646242 9.25651743 138.0295522 7.18003E?32 6.04544E?30 St6galnac1 0.564245409 9.173614926 137.6712982 8.59957E?32 7.20314E?30 Pkp4 0.568152144 9.180314385 136.6038442 1.4721E?31 1.2267E?29 Slpi 0.486549059 9.166637373 135.5644851 2.48466E?31 2.05985E?29 Cxcr3 0.531979192 9.551340066 134.7179405 3.80568E?31 3.13891E?29 Lmna ?0.825151176 9.713615726 133.8629815 5.85392E?31 4.80378E?29 Rpl7 0.189257523 11.21210542 133.217726 8.10208E?31 6.61506E?29 2810417H13Rik ?1.285204722 9.337765738 132.6784218 1.0631E?30 8.63619E?29 S100a4 0.670964086 9.866831921 132.345813 1.257E?30 1.01603E?28 Ifi27l2a 0.667189776 9.81722567 132.2788965 1.30009E?30 1.04564E?28 Tubb5 ?0.571247104 10.00333821 131.589452 1.83994E?30 1.4725E?28 Birc5 ?0.886968249 9.251705243 131.3715948 2.05336E?30 1.6352E?28 Txn1 ?0.38477823 10.00228125 130.9094939 2.59157E?30 2.04367E?28 Dtx1 0.710488782 9.250196625 130.9121903 2.58805E?30 2.04367E?28 Mast4 0.551969332 9.181692037 129.6748765 4.82707E?30 3.78808E?28 Cd38 ?0.722178037 9.272404605 129.2849214 5.87497E?30 4.58815E?28 Iltifb 0.466521316 9.164994613 128.6602113 8.04814E?30 6.25511E?28 Plcb4 0.396482666 9.163609867 128.5931213 8.32484E?30 6.4392E?28 Eef1a1 0.151323644 12.38193961 127.3339193 1.57005E?29 1.20864E?27 Gbp2 ?0.762105085 9.365780295 126.7822278 2.07319E?29 1.5884E?27 Rpl3 0.150394133 12.09257424 126.6318569 2.23638E?29 1.70535E?27 Ccr7 1.097629633 9.273175644 125.9374899 3.17323E?29 2.40838E?27 Nr4a2 ?0.69869436 9.521215332 125.4110146 4.13733E?29 3.12542E?27 Rplp2 0.17351654 11.91020443 124.8852816 5.39237E?29 4.05456E?27 Rps10 0.188460525 11.22201226 123.7513581 9.549E?29 7.14672E?27 Eif3f 0.224777999 10.6645601 123.6885264 9.85622E?29 7.34265E?27 Klrg1 ?0.619319207 9.202815326 123.5187912 1.07365E?28 7.96173E?27 Ppia ?0.201559198 11.56548656 122.9632193 1.42058E?28 1.04863E?26 mt-Nd2 0.348333644 9.930964526 122.1357147 2.15576E?28 1.58409E?26 Cxcr6 ?0.460498452 10.38993977 122.1090465 2.18493E?28 1.59826E?26 Stmn1 ?1.215251954 9.430719181 120.6930632 4.46074E?28 3.2483E?26 Hspa1b ?1.061056122 9.330476915 120.3110025 5.40813E?28 3.92053E?26 Plscr1 ?0.642118473 9.521580006 119.2788005 9.09973E?28 6.56724E?26 Ccnd3 ?0.536704025 9.527398394 118.8178614 1.14801E?27 8.24835E?26 Izumo1r 0.73550348 9.250980666 118.2124259 1.55778E?27 1.1143E?25 Cdk5r1 0.576455527 9.178698472 117.6513688 2.06707E?27 1.47208E?25 Eef1b2 0.295763405 10.0755718 117.2418803 2.54109E?27 1.80172E?25 Camk2n1 ?0.685364499 9.340459445 117.1854268 2.61445E?27 1.84564E?25 Nfkbia ?0.443575026 10.83336515 117.0602753 2.78475E?27 1.95731E?25 2010111l01Rik ?0.58976034 9.402743483 116.5749773 3.55676E?27 2.48911E?25 Rps17 0.255513344 10.61526354 115.2722497 6.86021E?27 4.77841E?25 Mxd1 ?0.561117916 9.600457879 115.2644894 6.88711E?27 4.77841E?25 Gngt2 ?0.645521342 9.363421412 114.291152 1.12514E?26 7.73998E?25 Eif3e 0.276298263 10.13949795 114.293671 1.12371E?26 7.73998E?25 Rpl9 0.148253371 11.84229891 113.9941505 1.30693E?26 8.9525E?25 Ccr4 0.593390397 9.227425335 113.5628703 1.62448E?26 1.10807E?24 Txk 0.567145719 9.335340173 113.2795033 1.87405E?26 1.27293E?24 Aqp3 0.501331766 9.177291322 112.4084827 2.90782E?26 1.96685E?24 S100a11 ?0.300484266 10.60261953 112.3500062 2.99486E?26 2.01729E?24 Pecam1 0.57408471 9.257221083 111.8795665 3.79688E?26 2.5469E?24 Avpi1 0.587850586 9.200072787 111.4995665 4.59906E?26 3.07225E?24 Ly6c2 ?1.077631275 9.266017563 111.3836024 4.8761E?26 3.24391E?24 Rpl36a 0.210891627 11.04534811 109.1644599 1.49364E?25 9.896E?24 Tnfrsf26 0.569766024 9.206961652 107.6619109 3.1877E?25 2.10336E?23 Rbpj ?0.56851782 9.385158504 107.1608345 4.10469E?25 2.69741E?23 Smpdl3a 0.418240822 9.556683298 106.5726921 5.5229E?25 3.61471E?23 Fau 0.133036285 12.30167072 106.2430132 6.52254E?25 4.25175E?23 Slbp 0.483341551 9.609796597 106.0970615 7.02107E?25 4.55834E?23 Efhd2 ?0.507188907 9.465456867 105.6326427 8.87536E?25 5.73916E?23 Actn1 0.575522456 9.187194301 105.6017048 9.01501E?25 5.80624E?23 Itga1 ?0.481159298 9.197482484 104.95344 1.2504E?24 8.0214E?23 Junb ?0.334624697 11.89080177 104.8572636 1.31259E?24 8.38706E?23 Tspo 0.314378756 9.918101619 104.6270095 1.47433E?24 9.38349E?23 Dusp10 0.58029624 9.475539651 104.0297313 1.99303E?24 1.2635E?22 Rpl30 0.19389992 10.96422059 103.0676934 3.2389E?24 2.04531E?22 Lztfl1 ?0.623767739 9.420902283 102.5746732 4.1541E?24 2.61304E?22 Dennd4a ?0.578405941 9.353169382 102.5290984 4.25078E?24 2.66349E?22 5430421N21Rik 0.646852187 9.214329084 102.1476476 5.1534E?24 3.2166E?22 Ldha 0.277341313 10.35628782 101.9060758 5.82177E?24 3.6198E?22 Eomes ?0.779813416 9.215476434 101.3944563 7.53744E?24 4.66859E?22 Ppp1cc 0.303541918 10.14034874 99.89229099 1.60914E?23 9.92879E?22 Malat1 ?0.254811632 14.66845899 99.87543084 1.6229E?23 9.97559E?22 Gpr18 ?0.656361909 9.406528173 99.35693704 2.10858E?23 1.29119E?21 H2-K1 0.198523334 11.61002829 98.90320569 2.6515E?23 1.61751E?21 Runx3 ?0.471586573 9.557610794 97.59444435 5.13478E?23 3.12063E?21 Tmsb10 0.154827346 12.94248991 97.16784513 6.36926E?23 3.85639E?21 Lag3 ?0.863184819 9.272147436 97.12994873 6.49234E?23 3.91624E?21 Cpm 0.566098049 9.24931383 97.09275961 6.61544E?23 3.97566E?21 Ms4a6b ?0.333588841 10.1948354 96.00750204 1.14449E?22 6.85253E?21 H2-Q7 ?0.264138572 10.62105384 95.84377435 1.24316E?22 7.41586E?21 Rpl27a 0.13805365 11.7398871 94.43658567 2.53071E?22 1.5041E?20 Gas7 ?0.461230762 9.194247453 94.25268389 2.7771E?22 1.64449E?20 Tecpr1 0.465177325 9.413068687 93.95828779 3.22244E?22 1.90124E?20 Tsc22d1 0.514971286 9.170828337 93.63509947 3.794E?22 2.23032E?20 Rorc 0.340741054 9.165458039 92.99485602 5.24304E?22 3.07098E?20 Ptrh1 0.416669722 9.177194315 92.97032326 5.30844E?22 3.09806E?20 Dhrs3 0.469692706 9.174233573 92.76398048 5.89178E?22 3.42613E?20 Nfkbiz ?0.472625752 9.633382235 92.64171855 6.26723E?22 3.6314E?20 Gnas ?0.249759348 10.37740546 92.59947857 6.40243E?22 3.69649E?20 Il2ra ?0.594584914 9.266141063 91.94031851 8.93303E?22 5.1392E?20 Slc9a3r1 ?0.397597403 9.651360086 91.91314639 9.05654E?22 5.19177E?20 Smoc2 0.217368642 9.159952973 91.81873843 9.49907E?22 5.42622E?20 Asb2 ?0.566764352 9.480727364 91.47295697 1.13128E?21 6.43952E?20 Ccnb2 ?0.574479423 9.212362432 91.21075062 1.29157E?21 7.32613E?20 Chst12 ?0.591913388 9.307931014 91.00443213 1.43351E?21 8.10282E?20 Dusp2 ?0.651560783 9.446121177 90.7507899 1.62956E?21 9.17892E?20 Rexo2 0.41801584 9.465243005 89.60388759 2.90952E?21 1.63317E?19 Hsph1 ?0.62803205 9.472358293 88.22977687 5.8276E?21 3.25983E?19 Arf6 ?0.341525694 9.853237401 87.74031434 7.46375E?21 4.16066E?19 Cd84 0.465838199 9.34855222 87.58985183 8.05368E?21 4.47408E?19 Gbp3 ?0.575087315 9.305894756 86.67276617 1.28048E?20 7.08912E?19 Cyb5a 0.418826942 9.520944338 86.4705939 1.41831E?20 7.82537E?19 Traf4 ?0.547865622 9.359798586 85.45465565 2.37076E?20 1.3036E?18 Prkcb 0.470193718 9.208819069 84.45661779 3.92738E?20 2.15221E?18 Lrrc25 0.258088384 9.161329097 84.44163993 3.95725E?20 2.16125E?18 Sh2d2a ?0.380576774 9.846351053 84.3959534 4.04976E?20 2.20432E?18 Hmgn2 ?0.601700458 9.445400237 83.92876523 5.12928E?20 2.78255E?18 Rhoc ?0.562347362 9.244274494 83.85510055 5.32401E?20 2.87852E?18 Acsbg1 0.47503696 9.314382446 83.81601429 5.43031E?20 2.92622E?18 Dkkl1 ?0.529480805 9.308686946 83.51509157 6.32314E?20 3.39601E?18 Hcst ?0.252513111 10.61089653 83.25678198 7.20579E?20 3.85724E?18 Acad ?0.497894127 9.426499963 83.21766254 7.34981E?20 3.92135E?18 Asap1 0.515125763 9.22985191 82.67182493 9.68723E?20 5.15144E?18 Cox7a21 0.245914858 10.13150038 82.17709101 1.24424E?19 6.59486E?18 Ap3s1 0.392394745 9.478733316 82.12212471 1.27932E?19 6.75868E?18 Shisa5 0.193645712 11.05064206 82.01459451 1.35085E?19 7.11333E?18 Ltb 0.362820009 10.15488605 81.87811624 1.44743E?19 7.59713E?18 Ccna2 ?0.403785662 9.193840202 81.36484801 1.87666E?19 9.81817E?18 Mns1 ?0.536056376 9.250789284 81.30652077 1.93288E?19 1.00796E?17 Csf1 ?0.510822609 9.192100854 81.19288199 2.04728E?19 1.06419E?17 Ramp1 0.361595708 9.166176693 80.89429173 2.38121E?19 1.2338E?17 Cyba ?0.238796652 10.43095334 80.73209482 2.5849E?19 1.33506E?17 Ptms ?0.527438745 9.287856152 80.5814284 2.78969E?19 1.43625E?17 Ccl3 ?0.910093878 9.220257049 80.47423238 2.94521E?19 1.5115E?17 Ppm1j ?0.509834666 9.231926591 80.0920149 3.57374E?19 1.82826E?17 Asf1b ?0.539633023 9.223320297 80.00113282 3.74195E?19 1.90828E?17 Rpl39 0.140509529 11.77739482 79.99106699 3.76106E?19 1.91199E?17 Eif3h 0.207162722 10.29703651 79.51031985 4.79713E?19 2.43105E?17 Itm2b ?0.202508228 10.97659374 79.05171761 6.05051E?19 3.05664E?17 Rpl5 0.195642628 10.56774531 78.40370728 8.39944E?19 4.23007E?17 Mt1 ?0.681149163 9.25333207 78.01199452 1.02417E?18 5.14183E?17 Slc2a3 ?0.535215118 9.267489223 77.88899828 1.08997E?18 5.45524E?17 Jund ?0.291126203 11.83355423 77.37694158 1.41255E?18 7.04791E?17 Vcam1 0.41406013 9.169856475 77.29191905 1.47468E?18 7.33529E?17 Cxcl3 0.555799907 9.168367119 77.24424832 1.51071E?18 7.49144E?17 Ralgps2 0.447656391 9.202191153 77.21516413 1.53312E?18 7.57933E?17 Atf3 ?0.680296415 9.293174358 76.62548982 2.06655E?18 1.01853E?16 Osgin1 ?0.593267168 9.241885952 76.07875288 2.72574E?18 1.33934E?16 Ctla2b ?0.522490544 9.270070138 76.04275853 2.77588E?18 1.35985E?16 Faah 0.44588788 9.275977389 75.14662319 4.37024E?18 2.13442E?16 Prr7 ?0.393644523 9.824437204 75.07309927 4.53605E?18 2.20873E?16 Tnfrsf18 ?0.323439954 10.06784361 74.91937037 4.90336E?18 2.38041E?16 Fam101b 0.44395883 9.174664735 74.87849381 5.00593E?18 2.42293E?16 Sla 0.378547652 9.546204364 74.52405875 5.99038E?18 2.89076E?16 Cdca3 ?0.416722054 9.196808089 73.81078112 8.59757E?18 4.13656E?16 Lgals1 ?0.288816159 11.62800987 73.67765585 9.19741E?18 4.41203E?16 Stk32c ?0.48699157 9.236288863 73.53762236 9.87362E?18 4.72239E?16 Gm9493 0.236255264 10.33364392 73.33101042 1.09632E?17 5.22805E?16 Rrm2 ?0.656260613 9.247707962 73.06368613 1.25533E?17 5.96873E?16 Gm8730 0.223093492 10.44488374 72.87273433 1.38285E?17 6.55579E?16 Serpina3f ?0.661617841 9.259699948 72.26884197 1.87789E?17 8.8766E?16 Il14ra ?0.441442073 9.499543146 71.80778832 2.37214E?17 1.11802E?15 Ckb 0.483538637 9.335721648 71.61412486 2.61677E?17 1.22973E?15 Acp5 0.397423986 9.396912844 71.56913307 2.67712E?17 1.25185E?15 Rcn1 ?0.444001155 9.211899643 71.5675056 2.67933E?17 1.25185E?15 Spc24 ?0.443249395 9.204195345 70.62308424 4.32427E?17 2.01459E?15 Rps12 0.192586529 10.77092803 70.24630421 5.23433E?17 2.43155E?15 Clta ?0.284608639 9.8733927 70.18241162 5.40664E?17 2.5044E?15 Skil ?0.428945944 9.558639486 69.82061796 6.49504E?17 2.99997E?15 Cdkn2c ?0.492927169 9.239141777 69.80701627 6.53998E?17 3.01212E?15 2310001H17Rik 0.45313487 9.290442993 69.72339182 6.82321E?17 3.13364E?15 Egln3 0.460826066 9.20786883 69.16184134 9.07061E?17 4.15398E?15 Ncor1 0.309981143 9.664996809 69.00893228 9.80185E?17 4.47618E?15 Tnfrsf9 ?0.607969904 9.402131727 68.99666734 9.863E?17 4.49141E?15 Prelid2 0.424695126 9.192055381 68.68295117 1.15636E?16 5.25106E?15 Padi2 ?0.447711328 9.215639868 67.88323124 1.7347E?16 7.85524E?15 Ndufa4 0.305255781 9.735529358 67.70371654 1.90005E?16 8.57995E?15 Gbp7 ?0.476561834 9.290910914 67.67068329 1.93215E?16 8.7006E?15 Ube2c ?0.631545281 9.233527278 67.5201665 2.08543E?16 9.36474E?15 Ifrd1 ?0.336527284 10.02583543 67.17457762 2.48498E?16 1.1128E?14 Cdk1 ?0.39769185 9.19735213 67.15632591 2.50809E?16 1.12005E?14 Tuba4a ?0.464387774 9.389389589 67.02800208 2.67678E?16 1.19209E?14 Neurl3 ?0.393731218 9.619600065 66.75753682 3.07041E?16 1.36363E?14 Cnn3 0.198623534 9.160462978 66.70096425 3.1598E?16 1.39949E?14 Cd47 ?0.236561159 10.2358714 66.62087045 3.29083E?16 1.45354E?14 Pelo ?0.459502434 9.234978423 66.57690441 3.36506E?16 1.48228E?14 Ubc ?0.246876595 11.04983306 66.51122535 3.47907E?16 1.52833E?14 Ptma ?0.194475287 11.28840747 66.30598276 3.86085E?16 1.69145E?14 Itgb1 ?0.6429514 9.29928184 66.26452004 3.94292E?16 1.72274E?14 Rpl37a 0.114612104 12.61563941 66.16203022 4.15337E?16 1.80979E?14 Ptger4 ?0.503230593 9.34461786 66.11246381 4.25914E?16 1.85089E?14 Rps15a 0.109891473 12.40383431 66.08931246 4.30946E?16 1.86774E?14 Ccl1 ?1.01837332 9.258139682 65.45285896 5.95208E?16 2.57276E?14 Tcp11l2 0.407869719 9.433884628 65.28344021 6.48641E?16 2.79625E?14 Eif3k 0.209698805 10.09230815 65.11697117 7.05816E?16 3.03463E?14

    TABLE-US-00021 TABLE 3E LPL?4 vs. All GeneSymbol logFC logCPM LR PValue FDR Jun 2.590143686 9.603439503 1533.659276 0 0 Klf6 1.545036169 9.89686973 1361.417237 5.089E?298 4.1134E?294 Dusp1 1.611063957 9.939042764 1258.200347 1.3708E?275 7.387E?272 Fos 2.334554203 9.517129944 1248.343188 1.9017E?273 7.6858E?270 Ubb 0.716874178 12.90465449 1126.424498 5.9667E?247 1.9291E?243 Rgs1 1.270826473 11.08975568 1112.879546 5.2433E?244 1.4127E?240 Hspa1a 2.826179586 11.00085583 1078.202577 1.805E?236 4.1685E?233 Ubc 0.914435003 11.0498222 1066.356992 6.778E?234 1.3697E?230 Dnajb1 1.892963828 10.31714857 948.4998693 2.8108E?208 5.0489E?205 Cd69 1.363050626 9.886202315 884.9866185 1.8013E?194 2.9119E?191 Zfp36 1.848813098 9.294559476 835.0942821 1.2651E?183 1.8593E?180 Hspa1b 2.15174286 9.330468231 793.0459723 1.7539E?174 2.3628E?171 Hspa8 0.696470563 12.33068176 751.3892978 2.0013E?165 2.4887E?162 Nfkbia 0.985907956 10.83334808 699.2477201 4.3581E?154 5.0323E?151 Gadd45b 1.286294082 9.727225725 674.2268837 1.2033E?148 1.2969E?145 H2afz ?1.07018428 10.76614048 664.4674558 1.5951E?146 1.6116E?143 Junb 0.793003216 11.89077788 658.8329868 2.68E?145 2.5485E?142 Ppp1r15a 1.114516956 9.595202536 607.3150774 4.2927E?134 3.8553E?131 Ifngr1 ?0.797175635 11.1130316 606.1095339 7.8512E?134 6.6802E?131 Tnfaip3 0.803794065 10.12471168 549.5002817 1.617E?121 1.307E?118 Tagap 1.261551553 9.424665079 531.4945681 1.336E?117 1.0284E?114 Phlda1 1.400498169 9.440744496 524.7965068 3.8283E?116 2.8131E?113 Gramd3 1.16036844 10.20636507 497.1879766 3.8888E?110 2.7333E?107 Hsp90aa1 0.935956122 10.76861769 471.3892672 1.5976E?104 1.0761E?101 Fosb 1.329877314 9.41073207 435.298814 1.14187E?96 7.38381E?94 ler5 0.885845247 9.710298508 407.4325977 1.32736E?90 8.25311E?88 Tsc22d3 0.984645148 9.704342129 404.9225279 4.67066E?90 2.79652E?87 Hsp90ab1 0.633814222 11.19704142 400.9346148 3.44732E?89 1.99033E?86 Emb ?0.904301807 10.2510913 391.702411 3.52584E?87 1.96547E?84 Serpinb9 ?1.366273321 9.858316986 378.3861841 2.79458E?84 1.50591E?81 Asb2 1.034237011 9.480724756 375.4102947 1.2423E?83 6.47842E?81 Ramp3 ?1.695838734 9.93719207 371.2181081 1.01619E?82 5.13367E?80 Bag3 1.280714683 9.20292133 370.6579391 1.34568E?82 6.59218E?80 Ostf1 ?0.757739549 10.18398253 354.6784426 4.05846E?79 1.92968E?76 Ifng 1.390059422 9.686573599 352.8816351 9.99148E?79 4.61492E?76 Hsph1 1.120114423 9.472352373 351.0872604 2.45683E?78 1.10325E?75 Csrnp1 0.935572167 9.467362177 341.0348346 3.79755E?76 1.65922E?73 Ppp1cc ?0.712400694 10.14035428 333.4083474 1.73963E?74 7.40074E?72 Satb1 ?1.050886834 9.757129414 330.9907931 5.8478E?74 2.42399E?71 Sub1 ?0.498310969 11.14885309 313.5062323 3.76209E?70 1.52045E?67 Atf3 1.255366092 9.293173328 311.0704066 1.27657E?69 5.03343E?67 Tnfrsf4 ?0.886369845 10.622478 308.5109707 4.60895E?69 1.77401E?66 Dgat1 ?1.090343512 9.778876472 305.9824441 1.63848E?68 6.15991E?66 Odc1 ?0.912868376 10.45380252 294.6839137 4.74244E?66 1.74241E?63 Dnaja1 0.660328779 10.76356594 292.0198727 1.80488E?65 6.48395E?63 Hmgb2 ?0.68462046 10.71173142 285.2036862 5.51645E?64 1.93867E?61 Tnfrsf9 ?1.386299016 9.402138025 270.8266947 7.49438E?61 2.57775E?58 Abi3 0.939528469 9.334614155 254.4801334 2.74009E?57 9.22838E?55 Icos ?0.694823726 10.25651136 252.956149 5.88827E?57 1.94265E?54 Lmnb1 ?0.796445565 9.781598082 235.4925917 3.78059E?53 1.22234E?50 Tpm4 ?0.870737305 9.58004696 232.0124485 2.17005E?52 6.87863E?50 Gabpb1 ?1.01277835 9.478116622 231.3253372 3.06417E?52 9.52602E?50 Il21r ?0.709656805 10.19619458 230.7497394 4.09108E?52 1.24786E?49 Actg1 ?0.385352565 12.09967582 227.9718392 1.65067E?51 4.9416E?49 Nfkb2 ?0.872840303 9.521887809 227.4662535 2.12776E?51 6.25408E?49 Tra2b 0.566603683 9.814659783 225.7459621 5.04794E?51 1.45723E?48 Nr4a1 0.760017624 9.629880779 225.0326612 7.22249E?51 2.0484E?48 Actb ?0.686498084 13.40455375 224.189125 1.10323E?50 3.07497E?48 Malat1 0.384658746 14.66845119 222.1869687 3.01551E?50 8.26249E?48 Crem ?0.929344412 10.06723454 221.6786464 3.89255E?50 1.04878E?47 Irf1 0.800988362 9.430944526 220.5435406 6.88374E?50 1.8243E?47 S100a4 ?1.124176336 9.866850446 220.2298465 8.05839E?50 2.10116E?47 Dnajb4 0.898452918 9.252159229 218.0567114 2.40034E?49 6.15935E?47 Eif4a2 0.587188346 9.723691704 215.5267639 8.55372E?49 2.16062E?46 Lgals1 ?0.544772962 11.62803108 210.6664274 9.82814E?48 2.44433E?45 Vps37b ?0.567998001 10.60462455 208.2553343 3.29997E?47 8.08292E?45 Arpc2 ?0.339096705 10.79502771 198.9781559 3.48999E?45 8.42077E?43 Ldha ?0.477227524 10.356303 198.1191431 5.37386E?45 1.27756E?42 Slc38a2 0.6945798 9.471310328 196.4081687 1.26965E?44 2.97467E?42 Rhoh 0.680272061 9.50146616 195.902854 1.63669E?44 3.77982E?42 Kcnk5 0.865065562 9.212048811 195.5640523 1.94048E?44 4.41827E?42 Cd47 ?0.469147919 10.23587831 193.5887493 5.23627E?44 1.17569E?41 Cd28 0.462328972 10.37935338 193.379503 5.8169E?44 1.28817E?41 Hspe1 0.62125485 10.275394 192.4921794 9.08574E?44 1.98487E?41 Tnfrsf18 ?0.597638271 10.06784994 192.2396956 1.0315E?43 2.22336E?41 Gadd45g 1.091498475 9.253008237 191.6702361 1.37329E?43 2.92114E?41 Sh2d2a ?0.665095634 9.846350864 191.0225578 1.90166E?43 3.99249E?41 Cd2 ?0.492480832 10.31976175 186.0579796 2.30587E?42 4.77907E?40 Ccdc117 0.815294707 9.229125118 181.8435023 1.91832E?41 3.9255E?39 mt-Nd1 ?0.358612694 11.14922829 179.4352069 6.43782E?41 1.30092E?38 Prelid1 ?0.628281747 9.693861972 176.724491 2.51555E?40 5.02053E?38 Ptp4a2 ?0.517215133 9.957507214 175.4580103 4.75543E?40 9.37515E?38 Btg2 0.440636277 10.53755263 170.6805646 5.25444E?39 1.02341E?36 Rplp0 ?0.21033764 12.38791457 169.8702747 7.89769E?39 1.51993E?36 Rora ?0.613089505 9.982326095 165.5083791 7.08364E?38 1.34723E?35 Cytip ?0.464571312 10.18852324 164.5920026 1.12315E?37 2.11126E?35 Ywhae ?0.599038836 9.677391704 163.9902312 1.52018E?37 2.82474E?35 Dusp2 0.836057215 9.446119208 163.7671751 1.70068E?37 3.12424E?35 Gm8797 0.673519794 9.41752959 163.683435 1.77385E?37 3.22203E?35 Txnip 0.67807196 9.461611552 163.1794609 2.28568E?37 4.06048E?35 Crip1 ?0.565568902 11.66680939 163.1805573 2.28442E?37 4.06048E?35 Zeb1 ?0.876726155 9.368997506 162.7540564 2.83107E?37 4.97469E?35 Xbp1 ?0.711218017 9.544485173 161.4373091 5.49063E?37 9.54425E?35 Orai1 ?0.579250032 9.884591795 160.2159281 1.01501E?36 1.7456E?34 Kdm6b ?0.863501587 9.740079571 155.8597275 9.0849E?36 1.54596E?33 Serpinb6b ?0.806046844 9.622270494 153.802115 2.55844E?35 4.3083E?33 Rps27l ?0.691596722 9.542736211 153.7031579 2.68906E?35 4.48159E?33 S100a6 ?0.604109019 10.99650705 153.6377922 2.77898E?35 4.58419E?33 Rbm3 ?0.359226464 10.73120229 152.3012466 5.44486E?35 8.89107E?33 Pnrc1 0.353791235 10.57762445 151.8347313 6.88568E?35 1.11314E?32 Osgin1 0.824202552 9.241883295 149.9615518 1.76752E?34 2.82908E?32 Ppp1r16b ?0.763243765 9.488059972 148.3650029 3.9477E?34 6.25671E?32 Jund 0.404038488 11.83352068 147.7973495 5.25327E?34 8.24508E?32 Dnajb6 ?0.461679658 10.02357702 146.7975356 8.68943E?34 1.3507E?31 Mns1 0.755135013 9.25079002 146.6385192 9.41355E?34 1.44933E?31 Rhob 0.74975205 9.186759187 145.176197 1.96535E?33 2.99735E?31 Rps26 ?0.284540248 10.99419139 142.8574902 6.31524E?33 9.54133E?31 Amica1 0.785928661 9.335185757 138.7221207 5.066E?32 7.58305E?30 Cd3g 0.261967409 11.10926437 138.1653066 6.70559E?32 9.94519E?30 Maff 0.743744556 9.305178125 136.9026641 1.26643E?31 1.8612E?29 Bcl2a1d ?0.556400874 9.947971478 135.9736136 2.022E?31 2.92191E?29 Cxcl10 1.022791565 9.358380139 135.9713164 2.02434E?31 2.92191E?29 mt-Co2 ?0.245307237 11.3867395 134.1830298 4.9824E?31 7.12791E?29 Ndufa4 ?0.533333906 9.735537154 132.5007031 1.16265E?30 1.64873E?28 Got1 ?0.718746583 9.85597876 130.9493044 2.54011E?30 3.57073E?28 mt-Co1 ?0.214636506 12.2154689 130.618136 3.00128E?30 4.18265E?28 Gch1 ?0.741103157 9.459479195 128.8681559 7.24762E?30 9.96255E?28 Stmn1 ?1.367904009 9.430748828 128.8615105 7.27193E?30 9.96255E?28 Serpinb1a ?1.211789733 9.512634009 128.4498585 8.94794E?30 1.21557E?27 Zfp3612 0.548721708 9.813907288 127.2191653 1.6635E?29 2.24102E?27 Samsn1 ?0.60534197 9.795514419 124.3876645 6.9293E?29 9.25777E?27 Cacybp 0.534106834 9.501045641 123.654719 1.00256E?28 1.32847E?26 Bcl11b 0.557187574 9.518363932 123.2267919 1.24387E?28 1.63483E?26 Nab1 ?0.638659495 9.481607755 122.2066184 2.08007E?28 2.71181E?26 Eif4a1 ?0.326967555 10.43982044 119.198664 9.47487E?28 1.22537E?25 Ctsw 0.420268747 9.943491723 118.6678023 1.23823E?27 1.58867E?25 Manf ?0.503781652 9.719597578 116.9764749 2.90493E?27 3.69772E?25 Sit1 0.594504365 9.400129387 116.683346 3.36762E?27 4.2532E?25 Ahr 0.665620939 9.32837131 116.5385822 3.62263E?27 4.5398E?25 Dnaja4 0.702154245 9.306294868 116.2943522 4.09737E?27 5.09524E?25 Rasgrp1 0.54719873 9.4876411 115.5982599 5.82026E?27 7.18247E?25 Rpl28 ?0.277273945 10.72583795 114.4206894 1.05399E?26 1.29081E?24 Tnf 0.657378601 9.19510683 113.7154721 1.50415E?26 1.82828E?24 Map2k3 ?0.639195811 9.403893144 112.180806 3.26167E?26 3.93493E?24 Bcl2a1b ?0.401042562 10.39223313 111.0495442 5.77103E?26 6.9107E?24 mt-Co3 ?0.206451547 12.09928666 110.9099873 6.19193E?26 7.3602E?24 Ddit3 0.600713605 9.375996145 110.3339779 8.27972E?26 9.77007E?24 Arpc5 ?0.375095913 10.09994462 110.1520132 9.07572E?26 1.06317E?23 Anxa2 ?0.551214664 9.842703511 109.8227857 1.07155E?25 1.24623E?23 Tbx21 0.633815107 9.277654988 107.7502756 3.0487E?25 3.52038E?23 Hspa5 ?0.331253095 10.97868219 106.0074139 7.34599E?25 8.42235E?23 Gm26740 ?0.5631075 9.658905522 105.6525046 8.78684E?25 1.00034E?22 Hspd1 0.522874198 9.781160578 105.5573721 9.21897E?25 1.0422E?22 Egr1 0.693243113 9.204622648 105.294982 1.05242E?24 1.18149E?22 Arpc3 ?0.300445815 10.54021802 104.3124691 1.72798E?24 1.92652E?22 Slc25a5 ?0.317657126 10.39410861 102.9141475 3.49991E?24 3.87531E?22 Slc25a19 ?0.671198564 9.304164557 102.4999831 4.31371E?24 4.74391E?22 Arf5 ?0.355950623 9.981776324 102.4262272 4.47735E?24 4.89059E?22 P2ry10 ?0.542627996 9.588148813 100.0926173 1.45435E?23 1.57792E?21 Tiparp 0.622859048 9.253508946 99.43211855 2.03003E?23 2.18784E?21 Dapk2 0.629735843 9.267212724 99.37047465 2.09422E?23 2.24206E?21 Srgn ?0.248081982 11.37107818 98.58322616 3.11648E?23 3.31454E?21 S1pr4 ?0.599660571 9.466039302 98.42214907 3.38057E?23 3.57191E?21 Prdx1 ?0.402768256 9.945248275 98.10603607 3.96568E?23 4.16294E?21 Mif4gd ?0.554622287 9.488410444 97.43644609 5.56129E?23 5.80025E?21 Pyhin1 0.625926041 9.241802634 97.31544236 5.91175E?23 6.12624E?21 Atp2b1 ?0.577740061 9.529038489 96.38102805 9.4771E?23 9.75839E?21 Klf4 0.785414982 9.240042515 95.6473965 1.3728E?22 1.4046E?20 Kdm2b ?0.590418174 9.446725658 95.06884645 1.83878E?22 1.86954E?20 Gpr34 0.643868069 9.256515481 94.58899127 2.34318E?22 2.36749E?20 Ddx5 0.222201788 11.19915484 94.33581499 2.66288E?22 2.6738E?20 Dedd2 0.548833108 9.289954935 93.22117023 4.67652E?22 4.66671E?20 Gngt2 0.563130652 9.363419251 92.71645706 6.03496E?22 5.98535E?20 Ptger4 0.593740113 9.344615159 92.63473731 6.28938E?22 6.19964E?20 Rap1b ?0.323870206 10.11242022 92.0761552 8.34043E?22 8.1716E?20 Ndfip1 ?0.453916191 9.658016099 91.91248652 9.05956E?22 8.8227E?20 Pmaip1 0.569597424 9.419279032 91.40457314 1.17106E?21 1.13361E?19 Ass1 ?0.570778569 9.534401383 91.02169791 1.42105E?21 1.36742E?19 mt-Nd4 ?0.283267739 10.50324563 89.83638465 2.58693E?21 2.47457E?19 Stat4 ?0.539139242 9.506546131 89.82057516 2.60768E?21 2.47975E?19 Zfand2a 0.571863902 9.203483651 89.75384762 2.69713E?21 2.54982E?19 Peak1 0.543559655 9.307893678 89.44490698 3.15298E?21 2.96343E?19 Ube2c ?0.73303176 9.233537011 89.11225779 3.73032E?21 3.4858E?19 Klc1 ?0.689120968 9.658425271 89.02069137 3.90705E?21 3.62996E?19 Ccnb2 ?0.590326734 9.212369085 88.83145927 4.29924E?21 3.97152E?19 Kras ?0.549993886 9.430506668 88.81040425 4.34525E?21 3.99121E?19 Atf4 0.472417228 9.430489091 88.68127167 4.63836E?21 4.23637E?19 Tbc1d10c 0.461521425 9.522565087 88.25782723 5.74554E?21 5.21812E?19 S1pr1 ?0.676389037 9.290347327 87.8844838 6.93909E?21 6.26689E?19 Oaz1 ?0.179343623 11.23129158 87.66043355 7.77135E?21 6.97954E?19 Mkrn1 ?0.435496851 9.625707011 86.99298233 1.08907E?20 9.72701E?19 Mpc1 ?0.482130101 9.498929683 86.81722357 1.19028E?20 1.05726E?18 Cwc15 ?0.440746307 9.591066965 86.59722366 1.33034E?20 1.1752E?18 Yeats4 ?0.576896023 9.335828716 86.0310623 1.77131E?20 1.55625E?18 Zc3hav1 ?0.453828247 9.665187247 85.82752191 1.96335E?20 1.71565E?18 Mxi1 ?0.615229665 9.308272849 85.48875372 2.33023E?20 2.0253E?18 Gna13 ?0.394257142 9.985132901 85.39771314 2.44003E?20 2.10938E?18 Eno1 ?0.376092563 9.94247872 85.37363547 2.46992E?20 2.12387E?18 Metap2 ?0.532246668 9.437215686 84.64093112 3.57781E?20 3.06026E?18 Cd53 ?0.276565437 10.54705579 84.11975064 4.65695E?20 3.96233E?18 H3f3a ?0.262916696 10.34162816 84.03680502 4.85649E?20 4.11047E?18 Chmp4b ?0.386119126 9.755857713 83.79332771 5.49299E?20 4.62498E?18 Rgcc 0.655205768 9.563495027 82.72779326 9.41678E?20 7.88765E?18 Fam189b 0.494624586 9.381139083 82.68518295 9.62198E?20 8.01799E?18 Srp9 ?0.371205013 9.749456535 82.04588879 1.32963E?19 1.1023E?17 Myl12a ?0.241036233 10.67854662 81.89353345 1.43618E?19 1.18456E?17 Ube2d2a ?0.380758113 9.705617285 81.87867272 1.44702E?19 1.18744E?17 Rcbtb2 0.554113844 9.398942766 81.83643178 1.47828E?19 1.20697E?17 C1d ?0.55506624 9.33962429 81.52340884 1.73198E?19 1.40699E?17 Cenpa ?0.644600095 9.394732697 81.06499933 2.18414E?19 1.76544E?17 Rps2 ?0.182975709 11.63596206 80.5615055 2.81796E?19 2.26642E?17 Rab2a ?0.405486929 9.638428497 80.08770238 3.58155E?19 2.8663E?17 Rps17 ?0.253525207 10.61527996 79.99091046 3.76136E?19 2.99538E?17 Crbn ?0.45331621 9.708110897 79.55964126 4.67886E?19 3.70777E?17 Evl 0.449484781 9.48202136 79.48943941 4.8481E?19 3.82314E?17 Atp1b3 ?0.525675487 9.413041736 79.31700201 5.29025E?19 4.15156E?17 Birc5 ?0.803153176 9.251717708 78.81955099 6.80503E?19 5.3145E?17 Pelo 0.534389282 9.234977676 78.7693748 6.98008E?19 5.425E?17 Ube2b ?0.340873439 9.912296976 78.67640507 7.31642E?19 5.6592E?17 Slc25a3 ?0.335596538 9.94973675 78.52605368 7.89501E?19 6.07765E?17 Gimap9 0.414105757 9.580964503 77.89866942 1.08464E?18 8.31012E?17 Gbp8 0.519003936 9.225073835 77.70588153 1.19585E?18 9.1189E?17 Sash3 0.526717574 9.280790532 76.92431049 1.77637E?18 1.34821E?16 Nfkb1 ?0.482750495 9.537095283 76.9019338 1.79661E?18 1.3572E?16 Tgfb1 ?0.436908782 9.751104871 76.52399621 2.17553E?18 1.6358E?16 Gm19585 ?0.589333363 9.333697403 76.49300801 2.20994E?18 1.65398E?16 2810417H13Rik ?1.137160497 9.337791148 76.28397891 2.45669E?18 1.83018E?16 Erh ?0.391194693 9.741401362 75.75485582 3.2116E?18 2.3816E?16 Nabp1 ?0.474933711 9.632410427 75.07324761 4.53571E?18 3.34814E?16 H3f3b ?0.183055632 12.3442719 75.06348853 4.55818E?18 3.34944E?16 Tra2a 0.437013456 9.420550179 74.87618174 5.0118E?18 3.6661E?16 Rpl4 ?0.145002236 11.68907687 74.81745426 5.16312E?18 3.75978E?16 Reep5 ?0.410263139 9.63723477 74.70029247 5.4788E?18 3.97176E?16 ler2 0.372614919 9.828501111 74.64201981 5.64293E?18 4.07248E?16 Abcb1b ?0.617002181 9.297095714 74.45737621 6.19617E?18 4.45188E?16 Atp5a1 ?0.343731345 9.817876037 74.34844531 6.54768E?18 4.68362E?16 Pfn1 ?0.208967825 12.14558871 74.16052907 7.20159E?18 5.12868E?16 Madd ?0.529984212 9.387287048 74.00633058 7.78669E?18 5.52104E?16 Tomm20 ?0.285577806 10.023749 73.94492556 8.03272E?18 5.67061E?16 Cmas ?0.523719597 9.365634653 73.92293145 8.12272E?18 5.70921E?16 Cdca3 ?0.440059827 9.19681312 73.80929833 8.60403E?18 6.02133E?16 Cd226 0.541531319 9.268561012 73.70228655 9.08336E?18 6.32938E?16 Stk4 ?0.531488797 9.393563986 73.65355009 9.31042E?18 6.45976E?16 Cript ?0.418219478 9.556480747 73.60266337 9.55357E?18 6.60013E?16 Lztfl1 0.516188841 9.420902233 73.17831763 1.1845E?17 8.14834E?16 Cox5b ?0.29984058 10.04351529 72.98093175 1.30909E?17 8.96723E?16 Snrpe ?0.339808137 9.827473175 72.71911464 1.49479E?17 1.01961E?15 Rps3a1 ?0.144846919 11.67403179 72.62804541 1.56539E?17 1.06328E?15 Gpx4 ?0.322618499 10.07619191 71.72461952 2.47426E?17 1.67359E?15 Lcp1 0.267873223 10.29111652 70.77546944 4.00283E?17 2.69624E?15 Gramd1a 0.428949158 9.45882935 70.50743203 4.58536E?17 3.0758E?15 Rpl22l1 ?0.227855341 10.87577052 70.42828761 4.77306E?17 3.18848E?15 Carnmt1 ?0.533340181 9.382599136 70.14896737 5.49908E?17 3.65836E?15 Fam78a 0.483182295 9.208922936 69.96525619 6.03583E?17 3.99898E?15 Itk ?0.384569882 9.814381707 69.34499645 8.26621E?17 5.45435E?15 Sirt7 0.451348242 9.346429512 69.25139271 8.66797E?17 5.6962E?15 Lpar6 0.50184775 9.25603568 69.13687452 9.18617E?17 6.01229E?15 Podnl1 0.465684375 9.399826176 69.07032239 9.50144E?17 6.19356E?15 Cd27 ?0.693527396 9.342790688 69.00506198 9.8211E?17 6.37622E?15 Il1r2 ?0.769598989 9.256734057 68.4351569 1.31119E?16 8.47868E?15 Rpl31 ?0.198288808 10.87174216 68.22727856 1.45696E?16 9.38377E?15 Ube2a ?0.430232394 9.476224302 68.15744891 1.50948E?16 9.68345E?15 Il2rg 0.284318296 10.13321138 68.10803166 1.54779E?16 9.88995E?15 Btf3 ?0.188936964 10.71562669 67.84995712 1.76422E?16 1.12285E?14 Flna ?0.543132079 9.271089863 67.71229144 1.89181E?16 1.19933E?14 Ostc ?0.417712022 9.507638046 67.39567345 2.22136E?16 1.40275E?14 Nap1l1 ?0.446817289 9.497843766 67.25802126 2.382E?16 1.49834E?14 Gm26532 0.539119111 9.298825204 67.17554702 2.48376E?16 1.5563E?14 Rassf5 0.40289647 9.456960458 67.14089843 2.5278E?16 1.57598E?14 Psmd6 ?0.511849794 9.309065396 67.13554255 2.53467E?16 1.57598E?14 Slc39a1 ?0.517971835 9.215123658 66.93618839 2.80439E?16 1.737E?14 Sipa1 0.445171877 9.377580607 66.78277931 3.03135E?16 1.87041E?14 Rpl24 ?0.138569497 11.77231724 66.27823268 3.91559E?16 2.40682E?14 Plk3 0.492663873 9.37620264 66.21240355 4.04857E?16 2.47913E?14 1500009L16Rik ?0.568387028 9.247088485 65.79956575 4.99192E?16 3.04526E?14 Arf4 ?0.322744466 9.97486799 65.76286864 5.08574E?16 3.09083E?14 Ccr7 ?0.852512495 9.2731796 65.71215821 5.2183E?16 3.15507E?14 Hmgb1 ?0.289258843 10.29717658 65.70756036 5.23048E?16 3.15507E?14 Psmb5 ?0.408420536 9.522708713 65.65722349 5.36579E?16 3.22466E?14 Zfp3611 0.437347092 9.536424792 65.53388802 5.71232E?16 3.4202E?14 Rsrp1 0.294708181 10.00255998 65.36956236 6.20905E?16 3.70389E?14 Ccnd3 0.392403552 9.527397103 64.82584356 8.1819E?16 4.86282E?14 Etf1 ?0.44463723 9.430618507 64.09079524 1.18815E?15 7.03578E?14 Rpl37a 0.122987072 12.61564076 63.93640264 1.28501E?15 7.58157E?14 Gapdh ?0.237914704 10.5624293 63.49863181 1.60478E?15 9.43379E?14 St3gal6 0.467788849 9.290007328 63.39446236 1.69193E?15 9.91005E?14 Stat3 ?0.427360634 9.627931004 63.34309522 1.73663E?15 1.01352E?13 Capza2 ?0.336100212 9.686699536 63.08839131 1.97635E?15 1.14927E?13 Aim1 ?0.518130757 9.317849014 62.96031012 2.10914E?15 1.22209E?13 4930503L19Rik 0.477664395 9.217221064 62.90849567 2.16536E?15 1.25019E?13 Ptpn22 ?0.320448302 10.0931864 62.87594088 2.20145E?15 1.2665E?13 Isy1 ?0.489261775 9.388853979 62.86177423 2.21734E?15 1.27112E?13 Dcun1d5 ?0.394885964 9.525965055 62.63746655 2.48481E?15 1.41942E?13 Sys1 ?0.391713519 9.549646283 62.46696151 2.70952E?15 1.54233E?13 Cox6a1 ?0.247773288 10.15026993 62.43173845 2.75842E?15 1.56465E?13 Hif1a ?0.36303621 9.774226901 62.23603398 3.04662E?15 1.72209E?13 Dennd4a ?0.506038575 9.353170513 61.80891426 3.78457E?15 2.13176E?13 Ermn ?0.670779521 9.304666665 61.78992983 3.82124E?15 2.14493E?13 Pglyrp1 ?0.581505876 9.331204063 61.76551296 3.86891E?15 2.16418E?13 Smad7 0.432811456 9.374760348 61.6967973 4.00631E?15 2.23331E?13 Emp3 ?0.353830378 9.864716413 61.4528883 4.53465E?15 2.51914E?13 Mif ?0.336814609 9.843573442 61.40913837 4.63654E?15 2.56693E?13 Ncl ?0.277240909 10.07288653 61.28557928 4.93683E?15 2.72385E?13 Tax1bp1 ?0.346224474 9.700820891 61.18575971 5.19358E?15 2.85576E?13 Gm11808 0.267683291 10.17414513 61.10326802 5.41582E?15 2.96787E?13 Tnip1 ?0.466236205 9.396423421 61.03989719 5.59298E?15 3.0546E?13 Il2rb ?0.377545771 9.646395321 60.97710191 5.77425E?15 3.14298E?13 Selk ?0.25836491 10.04778191 60.88064076 6.06423E?15 3.28974E?13 mt-Atp6 ?0.143668358 12.47117091 60.56120241 7.1326E?15 3.85638E?13 Rpl32 ?0.118637876 12.44744241 60.38463939 7.80194E?15 4.20421E?13 Uap1 ?0.479451457 9.373416437 60.17826839 8.66436E?15 4.65342E?13 B2m 0.104190832 12.79985088 60.16460126 8.72473E?15 4.67033E?13 Ubl3 ?0.402699619 9.565973366 59.28291636 1.36557E?14 7.28574E?13 Cd160 0.664206821 9.334737973 59.26672523 1.37685E?14 7.32177E?13 Nfkbid 0.548241659 9.347248926 59.24549012 1.39179E?14 7.37694E?13 Sdhb ?0.373471788 9.57477766 59.140164 1.46831E?14 7.75712E?13 Cd40lg 0.434709702 9.469009802 59.079041 1.51464E?14 7.97579E?13 Ccl4 1.216184948 9.567139597 59.07002117 1.5216E?14 7.98642E?13 Ifi203 0.397729022 9.466695884 59.02071419 1.56021E?14 8.16257E?13 Hsp90b1 ?0.360458376 9.704110499 58.95054865 1.61685E?14 8.4316E?13 Atp5f1 ?0.298472638 9.82228089 58.8189421 1.72869E?14 8.98585E?13 Ms4a6b 0.26638962 10.19482982 58.69772529 1.83854E?14 9.52623E?13 Ell2 ?0.499117657 9.233861253 58.59765846 1.93447E?14 9.99124E?13 Rps27 0.130528567 13.23482143 58.50543285 2.0273E?14 1.04374E?12 Pin1 ?0.459464991 9.345121381 58.32632468 2.22053E?14 1.13959E?12 Nmrk1 ?0.50895163 9.47064308 58.21551447 2.34919E?14 1.2018E?12 Ccna2 ?0.39001523 9.193845605 58.12778027 2.45633E?14 1.25265E?12 Ube2j2 ?0.376431055 9.513342518 58.03685007 2.57253E?14 1.30779E?12 Rpl38 0.138662549 11.67460466 58.0220768 2.59193E?14 1.31351E?12 Uqcrfs1 ?0.314965169 9.7148766 57.9988405 2.62272E?14 1.32497E?12 Rasgrp4 0.436494297 9.196048428 57.85877003 2.81629E?14 1.41832E?12 Gm4955 0.499775199 9.225196819 57.61657645 3.1853E?14 1.59918E?12 Pik3r1 ?0.45075266 9.484798888 57.58402923 3.23844E?14 1.62083E?12 Tuba4a 0.431200046 9.389388654 56.87585494 4.64211E?14 2.31618E?12 Smarce1 ?0.408252588 9.44121571 56.75737258 4.93039E?14 2.45245E?12 Rac1 ?0.27734301 9.864108042 56.73130979 4.99617E?14 2.47755E?12 Nfkbiz 0.364141505 9.633378704 56.64467691 5.2212E?14 2.58122E?12 Rpl7 ?0.145513172 11.2121183 56.47267357 5.69848E?14 2.80859E?12 Tm2d2 ?0.487628577 9.29650158 56.43314473 5.8142E?14 2.84825E?12 Prkar1a ?0.244526548 10.1098473 56.43460194 5.80989E?14 2.84825E?12 Hn1 ?0.290730748 9.912834007 56.21069494 6.51064E?14 3.17979E?12 Vimp ?0.385693308 9.528415566 56.17137881 6.64214E?14 3.23424E?12 Il12rb1 0.457617355 9.249603528 56.07279355 6.98368E?14 3.39034E?12 Sar1a ?0.38919719 9.487454256 55.83677354 7.87447E?14 3.81134E?12 Rgs3 0.445767105 9.212312097 55.42399885 9.71432E?14 4.68781E?12 H2afx ?0.53405617 9.351667018 55.39133439 9.87709E?14 4.75217E?12 Fam46a ?0.593104785 9.504386119 54.85249022 1.29924E?13 6.2325E?12 Unc50 ?0.463482394 9.291047169 54.8152367 1.3241E?13 6.33297E?12 Psmb6 ?0.315898886 9.664543895 54.5840988 1.48936E?13 7.10235E?12 Relb ?0.416261884 9.473543412 54.39215697 1.64217E?13 7.80803E?12 Areg ?0.981677364 9.386135347 54.37400443 1.65741E?13 7.85739E?12 Nusap1 ?0.478892551 9.207262276 54.2609206 1.75559E?13 8.29849E?12 Dnajb11 ?0.399861357 9.443671568 54.13350774 1.8732E?13 8.82859E?12 Rpl8 ?0.128862907 11.65232029 54.1236023 1.88266E?13 8.84742E?12 Psmb4 ?0.368425685 9.512666637 54.07411222 1.93068E?13 9.04679E?12 Pfdn5 0.183243053 10.55366333 53.80238941 2.21703E?13 1.03585E?11 Pdia6 ?0.405605687 9.493421923 53.74006008 2.28849E?13 1.06616E?11 Tdg ?0.465092218 9.267189123 53.56871386 2.49704E?13 1.15998E?11 Rasgrp2 ?0.474109476 9.377109112 53.28818106 2.88034E?13 1.3342E?11 Chordc1 0.43790998 9.243519132 53.22033495 2.98156E?13 1.37714E?11 Eomes ?0.676427393 9.215474018 52.88113851 3.54356E?13 1.63206E?11 Riok1 ?0.482947013 9.379980367 52.86480692 3.57315E?13 1.64101E?11 Mrpl43 ?0.430748788 9.347336785 52.85289924 3.59488E?13 1.64631E?11 B930036N10Rik 0.476518913 9.189748854 52.78752614 3.71654E?13 1.69722E?11 Snrpd1 ?0.387511242 9.480040942 52.74552695 3.79687E?13 1.72902E?11 Rps27rt 0.21726945 11.16206124 52.6596686 3.96653E?13 1.80121E?11 Tnfrsf25 ?0.507674416 9.258889745 52.54427375 4.20657E?13 1.90486E?11 Capzb ?0.237573376 10.15899344 52.46292909 4.38447E?13 1.97987E?11 Cks1b ?0.578941254 9.261808188 52.11841755 5.22525E?13 2.34643E?11 Eif1 ?0.13433723 11.85889558 52.12359736 5.21149E?13 2.34643E?11 Psmb2 ?0.31086955 9.69395085 52.03727219 5.44571E?13 2.43865E?11 Fnta ?0.448658046 9.225372599 51.97384086 5.6245E?13 2.51176E?11 Cisd2 ?0.391653223 9.458300452 51.95684696 5.67339E?13 2.52661E?11 Cirbp ?0.312038116 9.821586015 51.83115822 6.04843E?13 2.68623E?11 Cdc25b ?0.45061542 9.220519401 51.78564824 6.19026E?13 2.74169E?11 Ndufb9 ?0.334018339 9.600272915 51.60840143 6.7751E?13 2.99252E?11 Rps8 ?0.135138035 11.5927656 51.58476284 6.85717E?13 3.02052E?11 Tmem165 ?0.454708653 9.262410636 51.47792094 7.24068E?13 3.18079E?11 Acot9 ?0.455587461 9.289681303 51.33930244 7.77043E?13 3.40425E?11 Gna15 ?0.42915867 9.413846476 51.31381614 7.87197E?13 3.43941E?11 Batf ?0.397304061 9.653588452 51.22533009 8.23491E?13 3.58829E?11 Marcksl1 ?0.536219973 9.352514486 51.11147635 8.72666E?13 3.79234E?11 Cd4 0.302355981 9.643165705 51.0304068 9.09462E?13 3.94165E?11 Fosl2 ?0.454425467 9.531626337 50.9750422 9.35479E?13 4.04357E?11 Bcl211 ?0.502971673 9.333332611 50.85441484 9.94773E?13 4.2884E?11 mt-Cytb ?0.182059117 11.07879142 50.36934489 1.27368E?12 5.47616E?11

    TABLE-US-00022 TABLE 3F LPL?5 vs. All GeneSymbol logFC logCPM LR PValue FDR Tnfrsf4 1.093522489 10.62226106 635.4400281 3.2785E?140 5.3E?136 Tgfb1 0.975322652 9.751061303 520.2631269 3.7093E?115 2.9982E?111 Bcl2a1b 0.780135087 10.39216426 514.3928564 7.022E?114 3.7839E?110 Bcl2a1d 0.89577233 9.947939732 466.5419171 1.8125E?103 7.3252E?100 Rpl13a ?0.326086663 13.13152047 458.393353 1.0753E?101 3.47664E?98 Furin 1.083121158 10.3814011 438.3306291 2.49901E?97 6.73315E?94 Fam110a 1.071979962 9.494271745 431.7915513 6.62154E?96 1.38439E?92 Srgn 0.499629456 11.37085449 431.7236111 6.85087E?96 1.38439E?92 Re 1.088827341 9.441983899 426.4493209 9.63164E?95 1.73006E?91 Ctla4 0.839377678 10.15303035 392.4986426 2.36551E?87 3.82408E?84 Id2 0.802587697 10.64561455 386.6248147 4.49435E?86 6.60507E?83 Mmd 1.251992193 9.302839885 381.7863212 5.08222E?85 6.8466E?82 Cxcr6 0.819984404 10.3899312 377.6613434 4.01909E?84 4.99789E?81 Tnfrsf9 1.354848987 9.402019905 371.2362656 1.00698E?82 1.16278E?79 Rplp0 ?0.336949142 12.38776356 370.2741409 1.63119E?82 1.75799E?79 Areg 2.120364333 9.386124375 352.1899639 1.41334E?78 1.42801E?75 Rps18 ?0.319352603 12.47332519 347.6549277 1.37346E?77 1.30608E?74 Lag3 1.647526397 9.272200366 346.4561421 2.50539E?77 2.25012E?74 Sdf4 0.666738475 9.917375756 342.4166661 1.89919E?76 1.61591E?73 Hspa5 0.561489025 10.97852902 331.228038 5.19183E?74 4.19656E?71 Rpl32 ?0.302417146 12.44734872 330.2768468 8.36546E?74 6.43981E?71 Ehd1 0.91198395 9.471470346 322.9608951 3.28068E?72 2.4107E?69 Bhlhe40 0.560219792 10.72354665 318.8827651 2.53665E?71 1.78293E?68 Penk 2.37977032 9.250280046 318.735219 2.73149E?71 1.83989E?68 Gadd 45b 1.002640146 9.727336037 316.7675708 7.32834E?71 4.73879E?68 Il21r 0.742031608 10.19622389 314.7885445 1.97741E?70 1.2295E?67 Stat3 0.825967681 9.627915766 310.4807593 1.71591E?69 1.02739E?66 Dusp14 1.311493662 9.241607784 302.6348425 8.78489E?68 5.07202E?65 Actb ?0.868840136 13.40497483 291.6698206 2.1514E?65 1.19929E?62 Nmrk1 0.997099834 9.470696344 289.2668478 7.18297E?65 3.87066E?62 Plscr1 0.963349071 9.521574474 285.8877732 3.91377E?64 2.04097E?61 Rps19 ?0.329912744 12.57926811 282.5048755 2.13673E?63 1.07945E?60 Rora 0.701354189 9.982410898 271.7577505 4.69699E?61 2.30096E?58 Klf2 ?1.613268488 9.960790759 267.4297392 4.12189E?60 1.95984E?57 Capg 0.78217281 9.809382216 267.1893548 4.65038E?60 2.14795E?57 Rpl29 ?0.371532652 11.21426477 265.936218 8.72202E?60 3.91667E?57 Junb 0.563013782 11.89122367 260.4847643 1.34539E?58 5.87828E?56 Odc1 0.760576176 10.45354943 252.8701509 6.14801E?57 2.61549E?54 Tnfrsf18 0.61336575 10.06773107 249.7951843 2.878E?56 1.19297E?53 Rps5 ?0.27022034 12.08886363 247.3691807 9.72734E?56 3.9313E?53 Stx11 0.844497 9.44438744 243.9575398 5.3928E?55 2.12634E?52 H2-D1 0.267762308 12.28190082 240.4816947 3.08798E?54 1.18858E?51 Ostf1 0.551472516 10.1838504 238.6389317 7.78902E?54 2.92831E?51 Ermn 1.23629042 9.304608573 238.0447323 1.04966E?53 3.85654E?51 Rpl18 ?0.274617166 11.80689186 230.9705444 3.66172E?52 1.31545E?49 Rpl18a ?0.230919204 12.8427361 230.9237523 3.74877E?52 1.31745E?49 Ece1 0.949006386 9.199067932 228.403278 1.32913E?51 4.57163E?49 Gem 1.164414567 9.368386927 225.2504315 6.47426E?51 2.18048E?48 Rpl13 ?0.237763931 12.637725 222.4024543 2.7062E?50 8.92825E?48 Fam46a 1.075761036 9.504325402 218.6210206 1.80792E?49 5.84536E?47 Rps11 ?0.249263758 12.26305424 217.0901119 3.90053E?49 1.23639E?46 Cd82 0.515694291 10.12752586 216.2520302 5.94214E?49 1.84732E?46 Ccl20 1.571767244 9.175986718 215.708926 7.8058E?49 2.38092E?46 Rps6 ?0.236751525 12.20838346 214.0506452 1.79543E?48 5.37499E?46 Tnfsf11 1.000729109 9.5470138 208.7598636 2.56113E?47 7.52787E?45 Rpl10a ?0.334028709 11.1421834 206.6183549 7.51057E?47 2.16814E?44 Rps4x ?0.25351799 11.84794571 203.2452547 4.08952E?46 1.15985E?43 H2-K1 0.310569301 11.6099805 199.5324875 2.64152E?45 7.36256E?43 Gramd3 ?0.754266192 10.20642813 194.9036165 2.70425E?44 7.40965E?42 Vgll4 0.685758581 9.732056241 192.3735559 9.64387E?44 2.59838E?41 Rps10 ?0.298690801 11.22180355 192.3216417 9.8988E?44 2.62334E?41 Zeb2 1.004261208 9.266619145 189.0385742 5.15457E?43 1.34401E?40 Rps7 ?0.249396851 11.94311863 188.1593636 8.01885E?43 2.05766E?40 Rpl14 ?0.247313373 11.87703907 187.7451879 9.87468E?43 2.49428E?40 Rps16 ?0.223372261 12.35139052 184.4010715 5.30335E?42 1.31898E?39 B2m 0.192848994 12.79982102 184.2318403 5.77425E?42 1.41434E?39 Rps3 ?0.216536407 11.96705851 183.2730085 9.35028E?42 2.25607E?39 Rpl8 ?0.253480179 11.65218841 179.8911834 5.11893E?41 1.21695E?38 Foxp3 0.625482423 9.163304427 179.8254281 5.29099E?41 1.23962E?38 H3f3b 0.284663226 12.34435911 173.7735014 1.1093E?39 2.56184E?37 Timp2 0.802832395 9.295781647 172.1120915 2.55788E?39 5.82405E?37 Ikzf2 1.073873069 9.298841109 170.9085501 4.68525E?39 1.05197E?36 Ddx5 0.316171351 11.19923668 169.5222404 9.40838E?39 2.0835E?36 Ly6e 0.358526245 10.76648585 169.4937633 9.54409E?39 2.085E?36 Cdkn1a 0.806219522 9.693178201 169.0570774 1.18881E?38 2.56245E?36 Trps1 0.845530208 9.247854818 163.5175317 1.92824E?37 4.10156E?35 Orai1 0.526678565 9.884604613 162.1675472 3.80264E?37 7.98356E?35 Tmsb10 ?0.244760928 12.94245948 160.4130676 9.19176E?37 1.90505E?34 Rpsa ?0.258005375 11.60010538 160.3539494 9.46924E?37 1.93772E?34 Zfp36l2 ?0.788376864 9.814128538 159.4437221 1.49689E?36 3.02484E?34 Klf3 ?0.990105413 9.422133449 159.1328844 1.75027E?36 3.4932E?34 Itm2b 0.315828579 10.97659894 158.3293848 2.62222E?36 5.16961E?34 Marcksl1 0.883574181 9.352455125 155.3767044 1.15844E?35 2.2563E?33 Ndfip1 0.526351822 9.657958285 154.7210113 1.61125E?35 3.10088E?33 Rps28 ?0.295632581 11.7074328 154.5592024 1.74792E?35 3.32434E?33 Tnfsf8 0.870087777 10.01785574 153.9305856 2.39827E?35 4.5082E?33 Rpl35 ?0.315995326 11.18856979 153.1436099 3.56359E?35 6.62172E?33 Nfkb1 0.606837763 9.537083442 152.6546593 4.55771E?35 8.37273E?33 Rbpj 0.680460617 9.38517504 152.5848125 4.72076E?35 8.57482E?33 Tubb5 ?0.744906297 10.00307441 152.0091079 6.30718E?35 1.13291E?32 S1pr1 ?0.952521601 9.290338881 150.4433721 1.38692E?34 2.46383E?32 Il2rb 0.537577161 9.646357284 148.867921 3.06486E?34 5.3855E?32 Litaf 0.754556108 9.445062895 147.9067642 4.97178E?34 8.64235E?32 Cd3g 0.286935653 11.10942082 145.2921461 1.85392E?33 3.18835E?31 Rplp1 ?0.248269602 11.7032567 144.8967265 2.26224E?33 3.84962E?31 Slc15a3 0.801237735 9.227334772 144.1671838 3.26617E?33 5.50009E?31 Stk24 0.558224742 9.608522084 144.136344 3.31727E?33 5.52856E?31 Il1r2 1.188001348 9.256675468 142.1821627 8.87259E?33 1.46362E?30 Ccr1 0.904615136 9.184947429 142.1482447 9.02541E?33 1.47379E?30 Jund 0.428678506 11.83414679 141.6222609 1.17619E?32 1.90143E?30 Traf1 0.437567505 10.10521315 141.2746865 1.40113E?32 2.24264E?30 Lilrb4a 0.639236426 9.646913438 141.0375314 1.57883E?32 2.50229E?30 Rpl41 ?0.169568893 12.79520696 140.2066552 2.39896E?32 3.7652E?30 Rpl19 ?0.186575538 12.11746352 138.3592406 6.08169E?32 9.45352E?30 Uhrf2 0.663533091 9.554448493 137.618841 8.82976E?32 1.35945E?29 Nfkbiz 0.589490901 9.633444859 137.3518839 1.01003E?31 1.54039E?29 Gm8730 ?0.391879071 10.44464909 137.2040135 1.08811E?31 1.64397E?29 Eif1 0.221160233 11.85893927 136.6927236 1.40766E?31 2.10706E?29 Sdc4 0.864197912 9.184332418 136.104023 1.89346E?31 2.80823E?29 Nrgn 0.79593449 9.169490694 134.3836196 4.50361E?31 6.61867E?29 Ikzf3 0.758912682 9.310513762 134.3025958 4.6912E?31 6.83225E?29 Gpr65 0.721922552 9.365534671 133.4092603 7.35695E?31 1.0619E?28 ler5l 0.917735422 9.22331753 132.9741944 9.15947E?31 1.31037E?28 Sla 0.573929064 9.546171489 132.091611 1.42872E?30 2.02602E?28 Ptms 0.706758953 9.287837433 131.8631613 1.60296E?30 2.25335E?28 Epsti1 ?0.531779216 9.946031824 129.0243258 6.69923E?30 9.33618E?28 Samsn1 0.565617595 9.795395326 127.6319862 1.3511E?29 1.86683E?27 Btg1 0.316118724 12.25005454 126.0369939 3.01804E?29 4.13472E?27 Rpl4 ?0.200905454 11.68898179 125.9194397 3.20222E?29 4.35018E?27 Rpl22l1 ?0.325682762 10.87574132 122.9210326 1.45111E?28 1.95489E?26 Rps24 ?0.209984223 12.00584899 122.8780161 1.48291E?28 1.98122E?26 Il2ra 0.732900379 9.266099444 122.2199043 2.06619E?28 2.73787E?26 Cd74 1.042070273 9.434236978 120.8762601 4.06726E?28 5.34563E?26 Rabgap1l 0.625903862 9.328937377 120.4547377 5.03015E?28 6.55785E?26 Bcl211 0.671196005 9.376444233 119.2060708 9.43956E?28 1.21377E?25 Rps27 ?0.20992776 13.23488676 119.2017178 9.4603E?28 1.21377E?25 Fas 0.720279276 9.354790431 119.0791946 1.00631E?27 1.28094E?25 Rps23 ?0.172279837 12.48529882 117.8778644 1.844E?27 2.32892E?25 Rpl17 ?0.175623878 12.29663229 116.7248327 3.29791E?27 4.13287E?25 Rab11fip1 0.683102221 9.24534037 116.0444077 4.64772E?27 5.77962E?25 Ctsb 0.491115464 9.553686158 115.6909048 5.55461E?27 6.85464E?25 Csf1 0.893917069 9.192117276 114.1779361 1.19125E?26 1.45892E?24 Batf 0.556500291 9.653651878 113.1282182 2.02263E?26 2.45848E?24 Camk2n1 0.677140769 9.340531404 112.320738 3.0394E?26 3.66679E?24 Lmnb1 0.496811846 9.781495667 112.1642896 3.28895E?26 3.93846E?24 Prr7 0.506933212 9.824433563 112.1237154 3.35695E?26 3.99033E?24 Wisp1 0.57314674 9.168186557 110.4669626 7.74251E?26 9.13616E?24 Rps29 ?0.210381637 12.2446762 109.1261756 1.52277E?25 1.78385E?23 Rps3a1 ?0.189505791 11.67389213 109.0426157 1.58834E?25 1.84727E?23 Rpl12 ?0.280198685 10.99235633 108.860878 1.74086E?25 2.01019E?23 Plk2 0.750446155 9.17838771 108.6038869 1.98186E?25 2.27225E?23 Kdm2b 0.56499929 9.446703124 108.5076284 2.08048E?25 2.36852E?23 Wnk1 0.492798635 9.627957555 108.2227911 2.40202E?25 2.71545E?23 Cd83 0.807532146 9.178407827 106.7863598 4.95842E?25 5.56651E?23 Ifng 0.886646176 9.686658841 106.6990667 5.18171E?25 5.77707E?23 Rps27a ?0.184418544 11.80973167 106.5796788 5.50347E?25 6.09377E?23 Cytip 0.350491758 10.18840246 106.0027935 7.36313E?25 8.09744E?23 Lilr4b 0.511360258 9.778154625 105.7520711 8.35625E?25 9.12751E?23 Nfkbib 0.504241566 9.487223272 105.680851 8.66204E?25 9.39802E?23 Scn1b 0.509524106 9.169087199 105.5628385 9.19358E?25 9.90822E?23 Rps15 ?0.203059364 11.4907216 102.7590505 3.78493E?24 4.05213E?22 Il17a 1.935391149 9.237168765 102.4199032 4.49166E?24 4.77712E?22 Ucp2 0.363772503 10.01286384 101.8832566 5.88922E?24 6.22256E?22 St6galnac3 0.675416095 9.261096607 101.3057309 7.88274E?24 8.27483E?22 Rpl37a ?0.172845664 12.61561552 100.6238399 1.11221E?23 1.16E?21 Cd6 0.418108973 9.931698154 100.1180091 1.43582E?23 1.48104E?21 Rpl36 ?0.186839018 11.87411391 100.1145234 1.43835E?23 1.48104E?21 Rpl9 ?0.172551122 11.84224161 99.8545999 1.64006E?23 1.67805E?21 Rps13 ?0.169190789 11.9252029 97.97494346 4.2371E?23 4.30799E?21 Ctla2a ?0.609825116 10.33555104 96.53343799 8.77493E?23 8.86597E?21 Stat4 0.501673088 9.506547453 95.6224894 1.39018E?22 1.39588E?20 Nr4a1 0.550612812 9.629989419 95.20303248 1.71827E?22 1.71466E?20 Il7r ?0.558749116 9.75347996 95.17603619 1.74186E?22 1.72754E?20 Rpl26 ?0.184107869 11.57423644 94.93673751 1.96568E?22 1.93763E?20 Rps14 ?0.146333995 12.65498378 94.80316287 2.10289E?22 2.06033E?20 Rasgrp2 ?0.687938938 9.37707238 94.64490756 2.27792E?22 2.21836E?20 Dnajc15 ?0.415379881 9.893121495 94.12385202 2.96386E?22 2.86909E?20 Gzmk ?1.043301711 9.363674736 94.00786796 3.14272E?22 3.02412E?20 Rpl35a ?0.177783341 11.72342483 93.76286064 3.55684E?22 3.40236E?20 Rpl37 ?0.16620817 12.07301201 93.58838916 3.8846E?22 3.69402E?20 Emb 0.407065297 10.25095358 93.57139524 3.91809E?22 3.70409E?20 Gch1 0.570152772 9.459450391 93.03068278 5.14899E?22 4.83945E?20 D16Ertd472e 0.453585869 9.624017665 92.73130439 5.98986E?22 5.59723E?20 Dgat1 0.530352135 9.77868262 92.53634073 6.60998E?22 6.1412E?20 Nfkbia 0.423596882 10.83366717 92.43061048 6.97272E?22 6.4412E?20 Ly6c2 ?1.111488738 9.265996796 91.81855201 9.49997E?22 8.72593E?20 Rpl3 ?0.158339089 12.09253162 91.51920698 1.10514E?21 1.00936E?19 Zc3h12a 0.484764166 9.536813666 90.15458744 2.2026E?21 2.00041E?19 Rps9 ?0.162455931 11.99537323 90.08851031 2.2774E?21 2.05679E?19 Tnfrsf1b 0.516562473 9.452782192 89.6453515 2.84917E?21 2.55888E?19 Rpl27a ?0.166874022 11.73983306 89.41629258 3.19891E?21 2.85711E?19 Pdcd1 0.790619463 9.244434269 89.09231595 3.76812E?21 3.347E?19 Myl12a 0.247801136 10.67832871 89.02278242 3.90292E?21 3.44779E?19 Pim3 0.642188756 9.328476745 88.91325482 4.1251E?21 3.62426E?19 Rpl23 ?0.182988453 11.70859607 88.24623254 5.77932E?21 5.05019E?19 Il22 1.587785436 9.48289887 88.01465782 6.49712E?21 5.64691E?19 S100a11 0.291981912 10.60259181 87.37637479 8.97158E?21 7.75586E?19 Tgif1 0.448665946 9.72028063 87.1158878 1.02345E?20 8.80059E?19 Rpl39 ?0.181027763 11.77727203 86.79123751 1.20603E?20 1.03157E?18 Sytl3 0.484538559 9.50441997 86.48786684 1.40597E?20 1.19626E?18 Mir155hg 0.675607589 9.203846162 86.09119012 1.71827E?20 1.45432E?18 Hif1a 0.401934609 9.774243864 86.00779175 1.79228E?20 1.50906E?18 Itgb1 ?0.867290308 9.299264735 85.97505545 1.8222E?20 1.5263E?18 Smim3 0.576452859 9.350052324 85.96468815 1.83178E?20 1.52642E?18 Rpl6 ?0.160525203 11.76079317 84.93181841 3.08833E?20 2.56031E?18 Rps20 ?0.237673584 11.06855654 84.75338603 3.38E?20 2.78781E?18 Bcl2a1a 0.64471644 9.252650209 84.52563174 3.79266E?20 3.11229E?18 Ccl1 1.624101666 9.258098088 83.86340919 5.30168E?20 4.30688E?18 Tmem176b 0.721063124 9.448095178 83.87163544 5.27966E?20 4.30688E?18 Cox17 0.352580634 9.818116404 83.64777925 5.91266E?20 4.77921E?18 Rpl21 ?0.169864625 11.76872215 83.24580779 7.2459E?20 5.82772E?18 Hmgb2 ?0.387568788 10.71130337 82.84554995 8.87218E?20 7.10038E?18 Commd8 ?0.54296912 9.438213878 82.57656026 1.01655E?19 8.09538E?18 Uap1 0.520815246 9.373356657 82.55889475 1.02568E?19 8.12801E?18 Eef2 ?0.185290498 11.29631996 80.9150407 2.35633E?19 1.85817E?17 Mmp9 0.58263451 9.175261184 80.89442021 2.38105E?19 1.86855E?17 Emp3 ?0.437281554 9.864612689 80.86112424 2.42151E?19 1.89112E?17 Crem 0.520771771 10.06693577 80.83319269 2.45598E?19 1.90881E?17 Tmem176a 0.756251292 9.404489195 80.19433366 3.39339E?19 2.62476E?17 Itm2c 0.438982008 9.518096519 79.53250521 4.74357E?19 3.65164E?17 Itk 0.389293322 9.814325519 79.31793277 5.28776E?19 4.05127E?17 Crlf2 0.486705303 9.388760459 79.07850293 5.96903E?19 4.55167E?17 Ms4a6b ?0.359447432 10.19493409 78.10427151 9.77424E?19 7.41832E?17 Arf6 0.343694888 9.853374067 78.01575022 1.02222E?18 7.72208E?17 Eea1 0.570647144 9.220110798 77.7632572 1.16161E?18 8.73423E?17 Tmem158 0.422938332 9.165141433 77.63465939 1.23975E?18 9.27864E?17 Fth1 0.215979972 11.58471842 77.57335302 1.27884E?18 9.52705E?17 Prkar1a 0.274347844 10.10979937 76.99987246 1.70969E?18 1.26784E?16 Rpl11 ?0.151171628 11.70903164 76.76522996 1.92538E?18 1.42126E?16 Stat5a 0.552298427 9.260743354 76.06349512 2.74689E?18 2.01846E?16 Rpl23a ?0.147657414 12.17556349 75.49517478 3.66301E?18 2.67947E?16 Cd28 ?0.347012261 10.37952986 75.2579058 4.13073E?18 3.00799E?16 Rps2 ?0.18944846 11.63567309 74.93771616 4.858E?18 3.52173E?16 Havcr2 0.539582937 9.180313486 73.34910354 1.08631E?17 7.83989E?16 Nfkbid 0.644113236 9.347296213 72.72063103 1.49364E?17 1.07317E?15 Cbx3 ?0.581747509 9.518039516 72.62422047 1.56842E?17 1.12191E?15 Rpl24 ?0.15447822 11.77225336 72.39600541 1.7607E?17 1.2539E?15 Sh2d2a 0.376644419 9.846354303 71.99999673 2.15198E?17 1.52583E?15 Lef1 ?0.609615782 9.289425739 71.88108079 2.28565E?17 1.61353E?15 Gm27166 0.407317455 9.163327075 71.56233274 2.68636E?17 1.88816E?15 AW112010 0.282452628 11.38322545 71.2150772 3.20331E?17 2.24176E?15 Serpina3g 0.534098778 9.674243135 70.42584586 4.77897E?17 3.33003E?15 Ifitm1 ?1.804896002 9.599666975 69.60975443 7.22786E?17 5.01483E?15 Cish 0.464190484 9.408302432 69.50815718 7.60991E?17 5.25734E?15 Myl12b 0.261240272 10.14192399 69.43717684 7.88876E?17 5.4268E?15 Hccs 0.494564115 9.354685384 69.31445298 8.39521E?17 5.75072E?15 Ubald2 0.304205172 10.62012763 69.07611792 9.47356E?17 6.46201E?15 Ppp1r14c 0.355051825 9.162055719 68.72964003 1.12931E?16 7.67075E?15 Ubl3 0.399042618 9.565981005 67.66623714 1.93651E?16 1.30986E?14 Rplp2 ?0.157925517 11.91006486 67.41326155 2.20163E?16 1.48298E?14 Rpl30 ?0.196263195 10.96407438 66.75449795 3.07515E?16 2.06277E?14 Rpl36a ?0.20636157 11.04527747 65.99089756 4.5301E?16 3.02618E?14 Ifitm3 ?0.741460054 9.717437467 65.84393111 4.88081E?16 3.24704E?14 Pycard ?0.484732372 9.57708276 65.33967505 6.30393E?16 4.17661E?14 Ptp4a2 0.290548225 9.957583537 65.07030211 7.22731E?16 4.76884E?14 Ccl5 ?0.614177482 13.31111049 65.02719932 7.38714E?16 4.85449E?14 H2-Q7 0.238928118 10.62098954 64.16806184 1.14246E?15 7.47732E?14 Nfil3 0.543821195 9.279162762 64.01922369 1.23211E?15 8.03157E?14 Gnb2l1 ?0.219333271 10.54007349 63.52463448 1.58374E?15 1.02822E?13 Tmsb4x 0.134395465 14.24920488 63.32329405 1.75418E?15 1.13432E?13 Srxn1 0.443413556 9.179960772 62.81840721 2.2667E?15 1.4599E?13 Dusp4 0.542015029 9.244687523 62.16159044 3.16399E?15 2.02973E?13 Ifi27 0.364029871 9.579454659 61.73449754 3.93034E?15 2.51138E?13 Dennd5a 0.486880142 9.227017994 61.55510006 4.30525E?15 2.74011E?13 Ube2l6 0.494919463 9.197355951 61.47362964 4.48713E?15 2.84466E?13 Nrip1 0.453730601 9.582617594 61.30329582 4.89261E?15 3.0896E?13 Rnf19b 0.466509748 9.379266424 60.94088293 5.88147E?15 3.6996E?13 Dad1 0.255140794 10.03535203 60.85328081 6.14909E?15 3.85296E?13 Cd81 0.489308098 9.170580291 60.72356256 6.56793E?15 4.0995E?13 Adora2a 0.449099604 9.426691213 60.60452645 6.97734E?15 4.33829E?13 Glipr2 ?0.475835778 9.484107632 60.27095878 8.2658E?15 5.11973E?13 2810417H13Rik ?1.104938967 9.337315681 60.12562098 8.89924E?15 5.49103E?13 Rpl28 ?0.211074368 10.72552157 59.95350725 9.71248E?15 5.97003E?13 Cxcr3 ?0.481054249 9.551371405 59.90276731 9.96612E?15 6.10274E?13 Hk2 0.558083103 9.291512241 59.86859259 1.01407E?14 6.1862E?13 Ckb 0.537418423 9.335711504 59.82713032 1.03566E?14 6.29415E?13 Pqlc1 0.536550639 9.21423837 59.77158922 1.0653E?14 6.45006E?13 Ubl5 0.227393519 10.27393085 59.43006853 1.26718E?14 7.64375E?13 Hlf 0.469359308 9.183131189 59.07360438 1.51883E?14 9.12766E?13 Ggt1 ?0.482757461 9.203324774 58.96486419 1.60513E?14 9.61055E?13 Eef1g ?0.232791111 10.38514948 58.86655143 1.68736E?14 1.00657E?12 Tff1 0.800550053 9.186702666 58.58119672 1.95072E?14 1.15939E?12 Asb2 0.474910444 9.480773625 58.26906703 2.28611E?14 1.35374E?12 Rpl15 ?0.196567365 10.73583328 58.16857192 2.40592E?14 1.41949E?12 Pdcd4 ?0.433321184 9.736958579 57.54915517 3.29637E?14 1.93779E?12 Gm26740 0.385787547 9.658978649 57.29699619 3.74727E?14 2.19487E?12 Arf4 0.289627395 9.97479051 56.75239941 4.94287E?14 2.88471E?12 Kit 0.361389295 9.167862474 56.47666634 5.68692E?14 3.30701E?12 Stmn1 ?0.996361487 9.43019399 56.43186032 5.818E?14 3.3711E?12 Btg2 0.279901817 10.53791954 56.13951487 6.75066E?14 3.89754E?12 Esm1 ?0.770430889 9.307911702 56.02164157 7.16777E?14 4.12363E?12 Jun ?0.827066689 9.603760111 55.34047173 1.0136E?13 5.81059E?12 Rps8 ?0.149468965 11.59257976 55.20418787 1.08637E?13 6.20575E?12 Rps27rt ?0.255171721 11.16195099 55.0140882 1.19669E?13 6.81186E?12 Cd44 0.362141582 9.560095995 54.61856376 1.46347E?13 8.30119E?12 Myo1g 0.396341726 9.439415321 54.50805268 1.54812E?13 8.75068E?12 Calr 0.281098495 10.02078334 54.09506061 1.91021E?13 1.07597E?11 Crbn 0.353059697 9.708183401 53.96723433 2.03861E?13 1.14431E?11 Cd3e 0.233574904 10.3749064 53.67655956 2.36367E?13 1.32218E?11 Nr3c1 0.435805045 9.448742099 53.64404633 2.40311E?13 1.33961E?11 Sp100 ?0.41585345 9.553686189 53.59274678 2.46668E?13 1.36563E?11 Klhl6 ?0.508204735 9.316905875 53.59681118 2.46159E?13 1.36563E?11 Rps12 ?0.210582225 10.77061599 53.54559432 2.5266E?13 1.39403E?11 S1pr4 ?0.454655152 9.466008758 52.71694568 3.85253E?13 2.11837E?11 Aplp1 0.432674667 9.212555161 52.59179415 4.10601E?13 2.25009E?11 Gimap4 ?0.240367235 10.52502448 52.52162603 4.25537E?13 2.32406E?11 Plk3 0.478782538 9.376309307 52.27013392 4.83675E?13 2.63269E?11 Nfkb2 0.369018011 9.521818169 52.2111144 4.98432E?13 2.70391E?11 Herpud1 0.372438068 9.555345247 52.01800557 5.4994E?13 2.97336E?11 Cotl1 ?0.247357975 10.46113625 51.80498811 6.12959E?13 3.30303E?11 Rpl27 ?0.143507587 11.47263607 51.4272134 7.43014E?13 3.99055E?11 Cdkn1b ?0.502025248 9.417453754 51.41112286 7.49129E?13 4.01007E?11 Slc25a3 0.260721523 9.949542602 51.20807313 8.30763E?13 4.43238E?11 1500009L16Rik ?0.542177966 9.246966845 51.17448647 8.45099E?13 4.49404E?11 Tbc1d10c ?0.420702224 9.522664674 51.06091305 8.95437E?13 4.74611E?11 Zap70 0.337335162 9.555404972 50.97047958 9.37656E?13 4.94794E?11 Csf2 0.79245829 9.183961698 50.96633727 9.39637E?13 4.94794E?11 Nabp1 0.36892163 9.632417698 50.79434236 1.02569E?12 5.38354E?11 Serpinb1a 0.721125754 9.512639892 50.70625213 1.07277E?12 5.61244E?11 Rpl34 ?0.118076419 11.98010888 50.63819169 1.11063E?12 5.79174E?11 Rpl7a ?0.185997252 10.71264639 50.5255593 1.17623E?12 6.11412E?11 Atp1b3 ?0.43409369 9.41300625 50.42513044 1.23799E?12 6.41452E?11 Ramp3 0.557408857 9.936798851 50.34255136 1.29119E?12 6.66882E?11 Tmbim6 0.218312849 10.08427218 49.92911906 1.59401E?12 8.20663E?11 Csnk1a1 0.284142186 9.708202059 49.80980859 1.69395E?12 8.69346E?11 Rpl38 ?0.14321935 11.67454895 49.67673704 1.81283E?12 9.2741E?11 Ubb 0.178674236 12.9047306 49.33933111 2.15302E?12 1.09797E?10 Itgav 0.460676285 9.245494327 49.23555497 2.26999E?12 1.15398E?10 Dnajb1 ?0.621384827 10.31779183 49.17154489 2.34528E?12 1.18852E?10 Slamf6 ?0.548414682 9.319043642 49.08519847 2.45083E?12 1.23813E?10 Tmem123 0.308551986 9.654226375 48.55589077 3.21009E?12 1.61664E?10 Cxcr4 0.458227755 9.20350922 47.73294408 4.88415E?12 2.45209E?10 Vamp8 0.288954516 9.668612941 47.46653284 5.59511E?12 2.79168E?10 Psme2 0.231125589 10.07701741 47.47010135 5.58493E?12 2.79168E?10 Dusp5 0.282745296 9.994462064 47.30156077 6.08637E?12 3.02746E?10 Tubb6 0.311404816 9.16596651 47.00909462 7.06581E?12 3.50386E?10 Xbp1 0.346296453 9.544395327 46.81439795 7.8038E?12 3.84513E?10 Gabpb1 0.407342294 9.478019755 46.80899053 7.82536E?12 3.84513E?10 Gimap6 ?0.250117271 10.46581517 46.81130486 7.81612E?12 3.84513E?10 Tcf7 ?0.458371226 9.419705743 46.79725798 7.87235E?12 3.8565E?10 Il21 0.334899575 9.167189925 46.65641679 8.45895E?12 4.13134E?10 Ppp1r11 0.315315515 9.56745842 46.63219242 8.56417E?12 4.17013E?10 Serpina3f 0.611380344 9.259717975 46.43170786 9.48679E?12 4.60551E?10 C2cd4b 0.305709635 9.163047524 45.77620863 1.32564E?11 6.41625E?10 Ccnd2 0.321927763 9.824613466 45.72543169 1.36045E?11 6.56508E?10 Pdlim1 ?0.473620534 9.286476238 45.16874379 1.80767E?11 8.69727E?10 Ttc39c 0.403933345 9.318650364 44.88156534 2.09319E?11 1.00411E?09 Ciapin1 0.392937977 9.338637993 44.67693901 2.32378E?11 1.11143E?09 Smox 0.466037737 9.201962775 44.63380471 2.37554E?11 1.13283E?09 Itpr1 0.395519874 9.29809745 44.54267134 2.48873E?11 1.18332E?09 Csrnp1 0.398371772 9.467469906 44.4996176 2.54407E?11 1.20608E?09 Eef1b2 ?0.234877371 10.07539868 44.48805958 2.55913E?11 1.20968E?09 Coro1a ?0.210386427 10.77304014 44.28150328 2.84391E?11 1.34037E?09 Ly6g5b 0.453449596 9.223291205 44.27562159 2.85246E?11 1.34049E?09 Hmgn2 ?0.516427634 9.445227782 44.18024862 2.99488E?11 1.40334E?09 Arpc3 0.193568182 10.54007412 44.16091507 3.02461E?11 1.41317E?09 Itgb8 0.150825817 9.157971212 44.02687611 3.23898E?11 1.50897E?09 Rasa3 ?0.456532606 9.237633903 43.88549931 3.48159E?11 1.61734E?09 4833407H14Rik 0.432971571 9.210586484 43.61892105 3.98963E?11 1.84803E?09 Srsf5 0.224610507 10.09105297 42.90253888 5.75359E?11 2.64993E?09 Tnfrsf26 ?0.421012345 9.206974678 42.90779839 5.73815E?11 2.64993E?09 Uba52 ?0.238263321 10.23996246 42.68346594 6.43539E?11 2.95553E?09 Tg 0.21283359 9.163083285 42.49207931 7.0969E?11 3.2501E?09 Eef1a1 ?0.107002554 12.38177109 42.46218858 7.20619E?11 3.29083E?09 2700094K13Rik ?0.438643961 9.385257191 42.44288494 7.27767E?11 3.31411E?09 Cdca3 ?0.392634098 9.196718956 42.4258423 7.34136E?11 3.33372E?09 Ptpn 18 ?0.226744978 10.2346755 42.2886025 7.87502E?11 3.56604E?09 Il10 0.594261639 9.174516082 42.24369134 8.05795E?11 3.63868E?09 Rheb 0.295652408 9.556041475 42.10431461 8.65321E?11 3.89659E?09 Ebi3 0.367076397 9.178699077 41.85523589 9.82872E?11 4.41364E?09 Birc5 ?0.679292998 9.251484435 41.7880138 1.01725E?10 4.55537E?09 Traf4 0.397393716 9.359798204 41.65359192 1.08965E?10 4.85815E?09 Naca ?0.15683386 10.80133383 41.65139444 1.09088E?10 4.85815E?09 Xcl1 0.951964559 9.405054453 41.31879274 1.2932E?10 5.74335E?09 Pdia6 0.340678053 9.493316871 41.26199076 1.33133E?10 5.8965E?09 Mki67 ?0.402680653 9.20298528 41.2101277 1.36712E?10 6.0385E?09 Cks1b ?0.56316805 9.261610399 41.09631286 1.44909E?10 6.38312E?09 Klrb1b 0.402897716 9.168673107 41.05896621 1.47705E?10 6.48858E?09 Cd4 0.28495697 9.643227058 40.87227781 1.6251E?10 7.11962E?09 Maf 0.361126024 9.568694911 40.76659514 1.7154E?10 7.49493E?09 Ube2c ?0.603273399 9.233354826 40.64117095 1.82912E?10 7.97022E?09 Ifrd1 0.287187244 10.02592468 40.57737019 1.88983E?10 8.21262E?09 Rpl31 ?0.16139966 10.87152232 40.55059192 1.9159E?10 8.30362E?09 Dusp10 ?0.470357283 9.475528346 40.43935976 2.02814E?10 8.74317E?09 Rbm3 ?0.193760967 10.73099358 40.43969521 2.02779E?10 8.74317E?09 Tacc3 ?0.331766486 9.190029393 40.29368335 2.18514E?10 9.39495E?09

    TABLE-US-00023 TABLE 3G LPL-6 vs. All GeneSymbol logFC logCPM LR PValue FDR Ccl5 ?2.119299251 13.31114939 553.6615868 2.0112E?122 3.2513E?118 Actb ?1.037279996 13.40503113 371.7898077 7.62957E?83 6.16698E?79 Malat1 ?0.585159603 14.66861581 331.2421667 5.15517E?74 2.77795E?70 Tmsb4x 0.298469035 14.2491977 309.5886424 2.68433E?69 1.08487E?65 Jund ?0.708702846 11.83423061 291.9011257 1.91568E?65 6.19377E?62 Kdm6b ?1.224505023 9.740630281 265.2542981 1.22814E?59 3.30902E?56 Pim1 ?0.747674341 10.82590639 254.0062819 3.47585E?57 8.02723E?54 Klf6 ?0.974714591 9.897242743 244.207249 4.7574E?55 9.61352E?52 Icos 0.600295791 10.25640856 233.1244444 1.24157E?52 2.23014E?49 Dnajb1 ?1.387544483 10.31787822 204.9269834 1.75678E?46 2.84001E?43 Tnfrsf4 0.656744874 10.62223191 193.5807006 5.25749E?44 7.7266E?41 Jun ?1.611103318 9.603803257 192.9520131 7.211E?44 9.71443E?41 Klf2 ?1.352858036 9.960820117 190.3008952 2.73308E?43 3.39869E?40 Junb ?0.53873041 11.89128335 178.4624427 1.04988E?40 1.21231E?37 Klrk1 ?1.134540447 9.564496772 163.4242247 2.0209E?37 2.17799E?34 Klrc1 ?1.002669535 9.658443855 158.9563459 1.91284E?36 1.93269E?33 Rps11 0.194712205 12.26304473 156.1743432 7.75479E?36 7.37435E?33 Fos ?1.298192946 9.517399295 144.8988051 2.25988E?33 2.02962E?30 Actg1 0.308629396 12.09922083 140.7810921 1.79643E?32 1.52848E?29 Psme2 0.36279445 10.07701332 140.1516077 2.46638E?32 1.99358E?29 Cd52 0.319567834 11.79358582 139.3304579 3.72932E?32 2.87087E?29 Ifi27l2a 0.787112867 9.817057964 136.8601041 1.29387E?31 9.50759E?29 Cbx3 ?0.769736489 9.518048716 136.1258701 1.87275E?31 1.3163E?28 Satb1 0.570904875 9.757032638 135.046907 3.2246E?31 2.17204E?28 Nr4a1 ?0.731187746 9.630004042 133.3325151 7.64691E?31 4.9448E?28 Nkg7 ?0.477227983 11.21025218 127.7495144 1.27342E?29 7.73982E?27 Arpc2 0.244788106 10.79491082 127.7197104 1.29268E?29 7.73982E?27 Tmsb10 0.208835701 12.94245518 126.3656535 2.55741E?29 1.47654E?26 Rac2 0.253915556 11.09605368 126.0748863 2.96096E?29 1.65058E?26 Dusp1 ?0.734404833 9.939529983 121.3508566 3.20189E?28 1.72539E?25 Sh3bgrl3 0.259050953 11.24480074 121.1440221 3.55374E?28 1.85322E?25 Pdcd4 ?0.608087104 9.736997086 120.6294586 4.60607E?28 2.32693E?25 Ccl4 ?2.269830956 9.567609898 120.086778 6.0553E?28 2.96636E?25 Tra2b ?0.476194641 9.814927917 118.9336673 1.08291E?27 5.14892E?25 Fosb ?0.934865905 9.410873748 117.0575887 2.78852E?27 1.28798E?24 Tubb5 ?0.629055114 10.0030371 114.7348946 8.9954E?27 4.03943E?24 Eef2 0.193903782 11.29629909 111.5670215 4.44521E?26 1.9422E?23 Rpl29 0.210961309 11.21424374 111.1928464 5.36859E?26 2.28391E?23 Coro1a 0.300729816 10.77301274 109.4044536 1.32332E?25 5.48533E?23 Zfp36 ?0.929098819 9.294666471 107.2992323 3.82783E?25 1.54702E?22 Cotl1 0.313916071 10.46110054 105.4791704 9.59007E?25 3.7813E?22 Btg1 ?0.31432151 12.25010724 103.5727856 2.51001E?24 9.66116E?22 Rplp0 0.166102954 12.38774335 103.4192727 2.71223E?24 1.01967E?21 Crip1 ?0.502107257 11.66661525 103.2854441 2.90177E?24 1.06614E?21 Cox4i1 0.21654735 10.68632092 101.9225287 5.77362E?24 2.07414E?21 Ptpn22 ?0.418069094 10.09356864 101.6750761 6.54183E?24 2.29903E?21 Myl6 0.224771123 10.93118441 98.12750402 3.92292E?23 1.34932E?20 Tuba1b ?0.669934532 9.729931155 95.76193385 1.29563E?22 4.36358E?20 Rgcc ?0.874994054 9.563667858 94.81868148 2.08647E?22 6.88366E?20 Cdkn1b ?0.635174622 9.417482747 93.7734478 3.53786E?22 1.14386E?19 Neat1 ?0.596555269 9.477111072 92.32207019 7.36583E?22 2.33482E?19 Csrnp1 ?0.610932033 9.467484395 91.63024448 1.04484E?21 3.24824E?19 Naca 0.203875855 10.80131195 90.9215054 1.49486E?21 4.55961E?19 Gem ?0.865598263 9.368397194 89.87230954 2.54038E?21 7.46686E?19 Abhd2 ?0.664957436 9.292318122 89.87963305 2.53099E?21 7.46686E?19 Rpl41 0.127967691 12.79519793 89.67974193 2.80008E?21 8.08322E?19 Pfn1 0.239223472 12.14557892 89.50160675 3.0639E?21 8.68964E?19 Btf3 0.194596928 10.71545921 88.29955513 5.62561E?21 1.56799E?18 Ier2 ?0.464679761 9.828717858 88.24976501 5.76901E?21 1.58071E?18 Rpgrip1 ?0.620409035 9.229072115 87.48124452 8.50828E?21 2.29241E?18 Hspa1a ?1.404194987 11.00156878 87.25336404 9.54728E?21 2.53018E?18 Rpl32 0.144936887 12.44733618 86.78944154 1.20712E?20 3.14747E?18 Epsti1 0.367584515 9.946036789 86.67117338 1.28151E?20 3.2884E?18 Rpl7a 0.213884318 10.71261113 86.19936713 1.6268E?20 4.10919E?18 Atp5e 0.230435333 10.27341219 86.16667568 1.65391E?20 4.11341E?18 Clta 0.31374906 9.873288523 85.62610594 2.17386E?20 5.32465E?18 Klrd1 ?0.780902756 9.372668746 85.1636242 2.74669E?20 6.6273E?18 Ppp1ca 0.265838001 10.29794445 85.06970008 2.88031E?20 6.84751E?18 Rps27 ?0.178481761 13.23489548 83.42957086 6.60269E?20 1.54694E?17 Eomes ?0.782994701 9.215525466 83.32009501 6.97866E?20 1.61167E?17 Btg2 ?0.361177255 10.53796877 82.29599985 1.17159E?19 2.66759E?17 Arhgdib 0.246995265 10.73176252 81.72143316 1.56685E?19 3.51801E?17 Srsf2 ?0.38575707 9.857793962 81.57579594 1.68667E?19 3.73517E?17 Ifng ?0.925453687 9.686670275 81.19858443 2.04138E?19 4.45959E?17 Rpl18 0.147120477 11.80688286 80.88213076 2.3959E?19 5.16429E?17 B2m 0.127460393 12.79981702 80.45008985 2.98141E?19 6.34177E?17 Rps6 0.132843484 12.20837322 79.63837783 4.49607E?19 9.43941E?17 Gzmk ?0.915585703 9.363683032 78.08817128 9.85423E?19 2.04235E?16 Tsc22d3 ?0.554100907 9.704520503 77.67486703 1.21477E?18 2.48582E?16 Atp5l 0.208815411 10.47764488 76.5962148 2.09741E?18 4.23835E?16 Klrc2 ?0.638997942 9.283451384 75.72542726 3.25983E?18 6.42663E?16 Atp5h 0.204975402 10.35716243 75.73020212 3.25195E?18 6.42663E?16 Myl12a 0.216154026 10.67829946 74.71071179 5.44996E?18 1.06149E?15 Cldnd1 0.455613978 9.794877348 74.25249729 6.87378E?18 1.32288E?15 Rpl24 0.143523244 11.77224479 74.13572633 7.29265E?18 1.38698E?15 Tnfaip3 ?0.365730976 10.12511135 73.48927117 1.01185E?17 1.90204E?15 Igtp 0.489020478 9.509011969 72.98604439 1.3057E?17 2.4262E?15 Zeb2 ?0.683047486 9.266621361 72.37282587 1.7815E?17 3.2727E?15 Hspa1b ?0.982648588 9.33065317 71.96673669 2.18856E?17 3.9753E?15 Gbp2 0.578294327 9.365760865 71.84703864 2.32542E?17 4.17698E?15 Limd2 0.306608864 10.08910343 70.73863745 4.07827E?17 7.24497E?15 Nr4a2 ?0.594424353 9.521309096 70.3636035 4.93216E?17 8.66666E?15 Podnl1 0.474592382 9.399899052 69.83512388 6.44745E?17 1.12075E?14 Ubb ?0.227426973 12.90474075 69.5319117 7.51881E?17 1.29308E?14 Ctla4 0.371383943 10.15302447 68.7764088 1.10284E?16 1.87669E?14 Ier5 ?0.446282214 9.710419 67.34884443 2.27475E?16 3.83059E?14 Cyba 0.228161069 10.43090095 67.27316027 2.36378E?16 3.93946E?14 Ly6a 0.344276567 10.37489399 66.83157909 2.95723E?16 4.87822E?14 Rpsa 0.151295131 11.60006986 65.95050999 4.62389E?16 7.55048E?14 Izumo1r 0.61967677 9.250974438 65.90232049 4.73833E?16 7.65999E?14 Ptpn18 0.246625147 10.23468686 65.53911194 5.6972E?16 9.11891E?14 Eef1a1 0.126330716 12.38174726 65.51205207 5.77597E?16 9.15434E?14 Cd47 0.243733981 10.23573149 65.08241585 7.18302E?16 1.12739E?13 Tnfrsf18 0.317256822 10.06771506 64.95225433 7.6735E?16 1.19279E?13 Rpl28 0.196367442 10.72547914 64.85165546 8.07542E?16 1.24331E?13 Dnaja1 ?0.382910023 10.76375183 64.28950963 1.07416E?15 1.6382E?13 Cdkn1a ?0.572722919 9.693191434 64.04001936 1.21917E?15 1.84198E?13 Pmaip1 ?0.551162792 9.419398949 63.93022725 1.28905E?15 1.92951E?13 Psmb10 0.346016435 9.566302759 63.15714108 1.90856E?15 2.83063E?13 Camk2n1 ?0.548998521 9.340541632 62.825393 2.25868E?15 3.31944E?13 Rpa2 ?0.513404915 9.392689651 62.62460404 2.50109E?15 3.64258E?13 Rbm39 ?0.201350849 10.68052293 62.46412644 2.71342E?15 3.91654E?13 Rgs16 ?0.549477284 9.19690865 62.21207359 3.08391E?15 4.41191E?13 Rpl7 0.144293297 11.21184535 62.08606475 3.2877E?15 4.66219E?13 Srgn 0.197435701 11.37082448 61.91810443 3.58043E?15 5.03314E?13 Gapdh 0.22553958 10.56198637 61.58565581 4.23896E?15 5.9075E?13 Rps2 0.160373372 11.63563438 61.3663959 4.73829E?15 6.54694E?13 Rgs2 ?0.521144086 10.0598516 60.74892465 6.48385E?15 8.88288E?13 Atp5c1 0.250321016 9.90168537 60.61894058 6.92643E?15 9.40947E?13 Gm26532 ?0.572078015 9.298938254 60.31224518 8.09423E?15 1.09043E?12 Ctss 0.407612199 9.35788439 59.39882781 1.28746E?14 1.72009E?12 Rpl36al 0.178394642 10.49579188 59.19840331 1.42549E?14 1.8889E?12 Psma5 0.353113416 9.439553675 58.52395081 2.00831E?14 2.63954E?12 Rpl3 0.117312584 12.09252558 58.41988325 2.1174E?14 2.75249E?12 Gimap4 0.227922697 10.52504419 58.40977973 2.1283E?14 2.75249E?12 Ppp1r16b ?0.456851556 9.488158562 58.18107506 2.39068E?14 3.06728E?12 Gbp3 0.466119067 9.305848055 57.61787477 3.1832E?14 4.05193E?12 Kmt2d ?0.509132586 9.2641734 57.50848455 3.36524E?14 4.21725E?12 Srrm2 ?0.320172857 9.808268375 57.51207828 3.3591E?14 4.21725E?12 Rora ?0.362384089 9.982422283 57.46868504 3.43403E?14 4.27035E?12 Plek ?0.517944688 9.215823682 57.14493073 4.0485E?14 4.96758E?12 Nfkbia ?0.369646528 10.83370997 57.14120793 4.05617E?14 4.96758E?12 Myeov2 0.282121028 9.682137922 57.06950421 4.20679E?14 5.1133E?12 Litaf ?0.519571904 9.445070319 56.35236309 6.05804E?14 7.30853E?12 Cfl1 0.175243041 11.11282374 56.04269339 7.09143E?14 8.49185E?12 Lmna ?0.624473963 9.713563886 55.98834182 7.2902E?14 8.66569E?12 Rpl31 0.170535302 10.87149283 55.72060327 8.35382E?14 9.8575E?12 Eif4a2 ?0.342532769 9.723875751 55.39883565 9.83947E?14 1.15264E?11 Klf4 ?0.641217216 9.240094172 54.83835195 1.30862E?13 1.52195E?11 Il22 ?1.523067898 9.482900463 54.56924671 1.50066E?13 1.73283E?11 H3f3b ?0.169982377 12.34437077 54.47679797 1.57294E?13 1.80342E?11 Psma2 0.235537521 9.873200775 54.25508068 1.76081E?13 2.0046E?11 Ubl5 0.20032877 10.27392635 53.90086965 2.10864E?13 2.3838E?11 Riok1 0.43384703 9.379913783 53.22660276 2.97206E?13 3.33656E?11 Odc1 0.372271092 10.4535154 53.12397078 3.13148E?13 3.49127E?11 Asb2 0.435113714 9.4807802 52.57892819 4.133E?13 4.54517E?11 Tomm20 0.208801999 10.02363568 52.582178 4.12617E?13 4.54517E?11 Sdf4 0.266427534 9.917368178 52.46598598 4.37765E?13 4.7817E?11 Glrx 0.371027895 9.565807787 52.40309399 4.52011E?13 4.87233E?11 Ptma ?0.20232451 11.28818093 52.40274773 4.52091E?13 4.87233E?11 Rps3 0.104436824 11.96704423 51.85522186 5.97476E?13 6.39655E?11 Pkp3 0.335067835 9.709713743 51.70638646 6.44528E?13 6.85489E?11 Ssr4 0.28033814 9.653692829 51.63120088 6.69688E?13 7.07593E?11 Rps10 0.137124331 11.22177397 51.58076967 6.87113E?13 7.2129E?11 Pomp 0.278699623 9.701368752 51.44364086 7.36823E?13 7.68482E?11 Ifitm2 0.480316373 10.68419752 51.28794721 7.97639E?13 8.25903E?11 Rgs10 0.343212205 9.631731346 51.27700924 8.02095E?13 8.25903E?11 Il2rg ?0.273364109 10.13353391 51.09215035 8.813E?13 9.01715E?11 Tbx21 ?0.476153418 9.277692364 50.63469984 1.1126E?12 1.13122E?10 Gcnt2 ?0.470647546 9.218058561 50.41597291 1.24378E?12 1.25668E?10 Tesc 0.35234916 9.483450902 49.94337593 1.58247E?12 1.58896E?10 Slc39a1 ?0.433417379 9.215153753 49.92774503 1.59513E?12 1.59178E?10 Tnfsf8 0.525733735 10.01783487 49.6323025 1.85435E?12 1.83911E?10 Rpl11 0.110213367 11.70901858 49.60546792 1.87989E?12 1.85307E?10 Tbca 0.241332603 9.75478561 49.50794918 1.9757E?12 1.9357E?10 Stk24 ?0.345711816 9.60853542 49.47575144 2.00839E?12 1.95588E?10 Gngt2 0.417816178 9.363465198 49.3565518 2.1342E?12 2.06596E?10 Ric1 ?0.453997651 9.254662379 49.34080833 2.1514E?12 2.07021E?10 Commd8 0.336386603 9.438214185 48.22616976 3.79786E?12 3.63291E?10 Eif3h 0.175401684 10.29689224 48.11637516 4.01658E?12 3.81953E?10 Sesn3 0.345251994 9.451624571 48.0760595 4.10002E?12 3.87608E?10 Tacc3 ?0.330180442 9.190019982 47.8217631 4.66782E?12 4.3872E?10 Lsm3 ?0.397355218 9.359397052 47.76572348 4.80317E?12 4.48832E?10 Acot7 0.29321749 9.577129276 47.63640279 5.13069E?12 4.76682E?10 Ccna2 ?0.368001411 9.19373092 47.55051727 5.36046E?12 4.95184E?10 Tuba1c ?0.469993277 9.281183564 46.81782197 7.79017E?12 7.15545E?10 Prelid1 0.27790907 9.693674656 46.79339374 7.88789E?12 7.20427E?10 Gdi2 0.236813278 9.887621903 46.18643907 1.07519E?11 9.76486E?10 Ldha 0.212909741 10.35598102 46.03661224 1.16064E?11 1.0482E?09 Cd74 ?0.739270074 9.434236295 46.00417217 1.18001E?11 1.05978E?09 Supt16 ?0.441561553 9.269927603 45.92148251 1.23089E?11 1.09937E?09 Got1 0.405705948 9.855701415 45.77574039 1.32596E?11 1.17777E?09 Fxyd5 0.163739145 10.88897458 45.59890503 1.45123E?11 1.282E?09 Sh2d2a 0.289479061 9.84635475 45.32644577 1.66782E?11 1.46532E?09 Zfp36l1 ?0.418870473 9.536622714 45.19149366 1.78679E?11 1.56137E?09 Phlda1 ?0.539847883 9.44085361 45.17023117 1.8063E?11 1.56993E?09 Notch2 ?0.425992475 9.219652512 45.03790208 1.93257E?11 1.6707E?09 Gpi1 0.23829591 9.778165149 44.92930737 2.04278E?11 1.74728E?09 Pdcd1 ?0.568864329 9.244437101 44.93462396 2.03724E?11 1.74728E?09 Pnrc1 ?0.217943097 10.57790653 44.82469758 2.15487E?11 1.83346E?09 Rpl10a 0.138336371 11.14215396 44.52377247 2.51287E?11 2.12686E?09 AW112010 0.227357928 11.38324175 44.21979772 2.93498E?11 2.47119E?09 Plekhf1 ?0.295061063 9.179229479 44.15833723 3.02859E?11 2.5368E?09 Gstm5 ?0.448209177 9.202000005 44.13230489 3.06914E?11 2.55751E?09 Tuba4a ?0.412258234 9.389408567 43.88249634 3.48693E?11 2.89076E?09 Ube2s ?0.268614956 10.0029558 43.69026594 3.8468E?11 3.15672E?09 Tagap ?0.466944977 9.424808628 43.69120062 3.84497E?11 3.15672E?09 Nt5e 0.416621625 9.297374279 43.63415359 3.9587E?11 3.23214E?09 Cd27 ?0.572422105 9.34285757 43.59576726 4.03711E?11 3.2796E?09 Hjurp ?0.393196909 9.227444004 43.52899827 4.17723E?11 3.37646E?09 Cdkn2d ?0.415706203 9.369245485 43.44303379 4.36483E?11 3.51054E?09 Itgb1 ?0.592025611 9.299262307 43.33380996 4.61539E?11 3.69369E?09 Cd160 ?0.650849788 9.334772106 43.31831197 4.65209E?11 3.70472E?09 Prdx2 0.285220158 9.529013404 43.19820628 4.9466E?11 3.91399E?09 Dnajc15 0.238508998 9.893117104 43.19161067 4.9633E?11 3.91399E?09 Cd69 ?0.413066046 9.886545576 43.00176598 5.46905E?11 4.29187E?09 Gnb2l1 0.158004594 10.54003804 42.81387557 6.02036E?11 4.67909E?09 Slamf6 0.449149176 9.319040639 42.81726381 6.00994E?11 4.67909E?09 Smc4 ?0.429041212 9.387774585 42.7743266 6.14331E?11 4.75181E?09 Insig1 ?0.434558342 9.37348859 42.70816037 6.35466E?11 4.89188E?09 Lag3 ?0.697350346 9.272207901 42.56198867 6.84773E?11 5.24646E?09 Ms4a4b 0.223679571 10.7518482 42.36461224 7.57483E?11 5.77616E?09 Pttg1 ?0.391336105 9.448089255 42.14887763 8.45825E?11 6.41953E?09 Stat1 0.341265519 9.58026255 42.13598362 8.5142E?11 6.4318E?09 Hsph1 ?0.497945951 9.472478285 42.07543816 8.78193E?11 6.6032E?09 Nrip1 ?0.403101209 9.582631136 41.82131157 1.00007E?10 7.48481E?09 Atp5j 0.205249314 9.978678584 41.68575303 1.07187E?10 7.9852E?09 Nucks1 ?0.385882183 9.378591222 41.51091348 1.17215E?10 8.69217E?09 Rps20 0.152105258 11.06851844 41.49249368 1.18324E?10 8.69469E?09 Luc7l2 ?0.277739676 9.665593924 41.49974923 1.17886E?10 8.69469E?09 Arpc1b 0.161633259 10.55363559 41.32194002 1.29112E?10 9.44442E?09 Ddx5 ?0.162093211 11.1992476 41.19466182 1.37798E?10 1.00345E?08 Nusap1 ?0.445345836 9.207136218 41.16536981 1.39879E?10 1.01403E?08 Slfn1 0.377286016 9.289471571 40.95793788 1.55541E?10 1.12253E?08 Cytip 0.210964863 10.1883862 40.8692185 1.62765E?10 1.16945E?08 Atf3 ?0.562020803 9.29319516 40.67024137 1.80211E?10 1.28907E?08 Ndufa13 0.175764796 10.09895175 40.4790137 1.98739E?10 1.41534E?08 Slfn2 0.241009028 10.08513049 40.44035 2.02711E?10 1.43729E?08 Amica1 ?0.49791256 9.335281825 40.34320419 2.13045E?10 1.50397E?08 Rsrp1 ?0.252392032 10.00279565 40.30324944 2.17447E?10 1.52837E?08 Eif3m 0.213365247 9.796143519 40.14217018 2.36136E?10 1.65254E?08 Inpp4a ?0.39180413 9.237585118 40.03084006 2.49985E?10 1.74192E?08 Bcl11b ?0.360053334 9.518587772 39.49937961 3.28164E?10 2.27686E?08 Id2 ?0.297282362 10.6456213 39.45801276 3.3519E?10 2.31567E?08 Rras2 0.375221763 9.260363101 39.37014601 3.50617E?10 2.41194E?08 Vmp1 ?0.333230189 9.490487697 39.25674927 3.71582E?10 2.54533E?08 Plac8 0.394314739 10.56879742 39.04923729 4.13251E?10 2.81882E?08 Iqgap1 ?0.285882286 9.634436107 38.96640363 4.31162E?10 2.90879E?08 Klf13 ?0.313082682 9.695558545 38.96654438 4.31131E?10 2.90879E?08 Cd226 ?0.412885191 9.268596107 38.96334564 4.31838E?10 2.90879E?08 Smdt1 0.229451251 9.710629839 38.94863378 4.35105E?10 2.91736E?08 Birc5 ?0.64959892 9.251453099 38.94139823 4.3672E?10 2.91736E?08 Ap2s1 0.279837623 9.49800778 38.89100224 4.48141E?10 2.98134E?08 Cenpe ?0.2171381 9.175299278 38.84242197 4.59434E?10 3.04394E?08 Cd7 ?0.654275535 9.494173391 38.78759993 4.7252E?10 3.11786E?08 Smc2 ?0.461435056 9.240564708 38.73553039 4.85294E?10 3.18913E?08 Psma6 0.26537951 9.550367808 38.67878428 4.9961E?10 3.26992E?08 Ly6c2 ?0.81589776 9.265993835 38.62656686 5.13157E?10 3.34504E?08 Erdr1 ?0.417244234 9.351156146 38.61788986 5.15443E?10 3.34645E?08 Rpl37 0.099363637 12.07300492 38.38701049 5.80173E?10 3.75163E?08 Ubl3 0.283805464 9.565982019 38.27260434 6.15203E?10 3.9623E?08 Psmb1 0.163974308 10.16664399 38.2135354 6.3411E?10 4.06787E?08 H2-DMa 0.355376414 9.273410275 37.58887051 8.73414E?10 5.58087E?08 Stmn1 ?0.820204514 9.430119458 37.47441949 9.26198E?10 5.89485E?08

    TABLE-US-00024 TABLE 3H LPL-7 vs. All GeneSymbol logFC logCPM LR PValue FDR Eomes 3.2798103 9.215511584 3251.147989 0 0 Gzmk 3.190153811 9.363664177 2419.333478 0 0 Cd27 2.373366823 9.342839542 1206.34871 2.5442E?264 1.371E?260 Furin ?3.348783874 10.38135368 1145.327777 4.6487E?251 1.8788E?247 Ifitm2 ?3.790176258 10.6842835 1115.433989 1.4602E?244 4.7212E?241 Cxcr6 ?2.192953647 10.38993282 898.5245923 2.0538E?197 5.5336E?194 Ccl5 1.940472599 13.31106087 868.7682803 6.0444E?191 1.3959E?187 Plac8 ?2.710532413 10.56890498 770.0228847 1.7774E?169 3.5916E?166 Esm1 2.269358847 9.307909321 724.0160454 1.7922E?159 3.2192E?156 Gm43291 1.497725884 9.168153577 705.4050464 1.9969E?155 3.2281E?152 Sh3bgrl3 ?0.862038487 11.24482102 648.2472167 5.3741E?143 7.898E?140 Tnfsf8 ?3.028860279 10.01788231 633.226239 9.9345E?140 1.3383E?136 Sh2d1a 1.383466761 9.507414541 592.0909227 8.7924E?131 1.0934E?127 Bend4 1.324976481 9.167728233 556.482621 4.8952E?123 5.6526E?120 Rgs16 1.955281568 9.196903871 517.915318 1.2025E?114 1.296E?111 Tmsb4x ?0.452472001 14.24921403 481.1750869 1.1859E?106 1.1982E?103 Ly6e ?0.861719259 10.76647189 465.704428 2.7576E?103 2.6223E?100 Tmsb10 ?0.499708274 12.94246496 462.9150501 1.1157E?102 1.002E?99 Rpa2 1.383564395 9.392679857 455.3472281 4.948E?101 4.20993E?98 Ifitm3 ?2.675579011 9.717470428 450.7042073 5.0683E?100 4.09669E?97 Nkg7 0.867977864 11.21019133 448.0411278 1.925E?99 1.48185E?96 Tox 1.504061266 9.202103104 416.0140164 1.79909E?92 1.322E?89 Cd52 ?0.719754738 11.79358625 408.008358 9.94623E?91 6.9909E?88 Emb ?1.227465129 10.25097718 388.8176348 1.4972E?86 1.00849E?83 Chchd10 1.514895153 9.239742304 388.0906979 2.15545E?86 1.3938E?83 Pim1 ?1.140164893 10.82570706 385.4996796 7.89981E?86 4.91186E?83 Lgals1 ?0.966904165 11.62770282 377.1045116 5.31326E?84 3.18126E?81 Vim ?1.164303346 10.47346981 371.6841636 8.04455E?83 4.64458E?80 Cldnd1 ?1.594626701 9.794944744 356.8336127 1.37741E?79 7.67836E?77 Rgs10 ?1.522269541 9.631716545 350.6347051 3.08265E?78 1.66114E?75 Actn2 ?1.902931209 9.563357125 347.3787198 1.57749E?77 8.22635E?75 Cxcr5 1.132676561 9.169334986 340.3476 5.36006E?76 2.70784E?73 Lgals3 ?1.631074577 10.20017765 340.2629549 5.59247E?76 2.73963E?73 Capg ?1.43890794 9.809387956 337.9741008 1.7623E?75 8.37921E?73 Rpl41 ?0.313152443 12.79521848 320.3014113 1.24522E?71 5.75151E?69 AA467197 ?1.792859182 9.471356876 313.3817233 4.00453E?70 1.79826E?67 Tapbpl 1.233104394 9.305800519 312.4747442 6.31139E?70 2.75757E?67 Ly6a ?1.060460377 10.374912 311.9103347 8.37674E?70 3.56364E?67 Il18r1 ?1.528906795 9.526772285 307.7518085 6.74503E?69 2.7959E?66 Saraf 0.698107441 10.21648074 302.7946342 8.10819E?68 3.27693E?65 Asb2 ?1.706305638 9.480765257 301.6467395 1.44213E?67 5.68623E?65 Itgb7 ?1.03195597 9.956571795 298.2957969 7.74575E?67 2.98137E?64 Rasgef1a 0.954832896 9.166122273 293.4389939 8.85616E?66 3.32951E?63 Klrg1 1.479355795 9.202811068 292.035209 1.79105E?65 6.58048E?63 Tmem176b ?1.947455291 9.448088308 283.3636793 1.3887E?63 4.98882E?61 Tnfsf11 ?1.871570551 9.547025163 282.4665441 2.17822E?63 7.65502E?61 Dcp1b 1.217734056 9.182915755 273.4090354 2.05089E?61 7.05418E?59 Rps27 0.343182787 13.23487563 268.9950753 1.87901E?60 6.32836E?58 Fxyd5 ?0.561431404 10.88896842 265.4526332 1.11178E?59 3.66797E?57 H2afy ?0.896629741 9.930098566 254.1059628 3.30622E?57 1.06897E?54 Txk 1.1165592 9.335401088 250.682348 1.84367E?56 5.84406E?54 Gm2a ?1.254112994 9.58187137 244.1366839 4.92896E?55 1.53234E?52 Cd2 0.602040611 10.31974063 234.8069914 5.33413E?53 1.62701E?50 Irf7 1.233359958 9.309194937 227.5376027 2.05288E?51 6.1457E?49 Lag3 1.648447237 9.27219078 227.0251467 2.65538E?51 7.80488E?49 Rpl29 ?0.426163608 11.21429155 226.6636948 3.18389E?51 9.1912E?49 S100a6 ?0.954302844 10.99625671 219.2973162 1.28724E?49 3.65078E?47 Ret 0.739017916 9.163901909 214.7890991 1.23901E?48 3.45342E?46 Tmem176a ?1.728150993 9.404487704 212.7090541 3.52245E?48 9.65151E?46 Ccr5 1.01474002 9.514413429 212.4623074 3.98726E?48 1.0743E?45 Klrk1 ?1.632071328 9.564474145 206.9732412 6.28407E?47 1.66538E?44 Wdr95 0.858966671 9.168703843 206.6330617 7.45528E?47 1.9439E?44 Pde4b ?1.037180552 9.658605719 206.3101232 8.76851E?47 2.25003E?44 Neurl3 ?1.11843401 9.61965738 204.6604978 2.00846E?46 5.07325E?44 Cd40lg ?1.325579191 9.46906787 203.2747273 4.02941E?46 1.00214E?43 H2-Q7 0.485660268 10.62100119 202.3256105 6.49151E?46 1.59003E?43 Dnajc15 ?0.810147548 9.893127081 201.7430432 8.69899E?46 2.09892E?43 Gzma ?2.279019802 10.72577583 199.2659566 3.02008E?45 7.17979E?43 Sub1 0.447317923 11.14878706 198.1250066 5.35805E?45 1.25534E?42 Tnfrsf4 ?0.896219752 10.62229818 189.4901987 4.10781E?43 9.4867E?41 Ramp3 ?1.526846449 9.936866207 184.7197481 4.51835E?42 1.02878E?39 Il10ra 0.940599026 9.177837324 184.0570113 6.30468E?42 1.41558E?39 Il12rb2 ?1.311113717 9.345966917 182.373313 1.46977E?41 3.25483E?39 Rpl3 ?0.276118955 12.09253931 182.2652047 1.55185E?41 3.39017E?39 Cd47 ?0.591482576 10.23577103 171.4400476 3.58636E?39 7.73027E?37 Nr4a2 0.94692531 9.521282587 169.5951037 9.06986E?39 1.92925E?36 Amica1 ?1.349724672 9.33525593 169.0337835 1.20282E?38 2.5253E?36 Sema4a 0.976179233 9.198632285 167.4717442 2.63868E?38 5.46883E?36 Il7r ?0.953618116 9.753450222 166.8045235 3.69087E?38 7.55273E?36 Ctsw ?0.77682414 9.943509554 166.4720465 4.36268E?38 8.81588E?36 Icos ?0.730239997 10.25643633 164.2679456 1.32199E?37 2.63843E?35 Actb ?0.746061335 13.40490306 163.2109404 2.24977E?37 4.43534E?35 Satb1 ?0.948024097 9.757058763 160.1639583 1.0419E?36 2.02932E?34 Tagln2 ?0.639877159 10.29867207 157.3789496 4.23005E?36 8.14082E?34 Rplp0 ?0.262641417 12.38778931 157.2206301 4.58078E?36 8.71211E?34 Gtf2i 0.882631296 9.381266311 156.9371115 5.28314E?36 9.93107E?34 Gpr18 0.970290866 9.406589754 155.8660296 9.05614E?36 1.68278E?33 Klrc1 ?1.245205556 9.658438919 154.722076 1.61038E?35 2.95835E?33 Sdcbp2 0.909955184 9.294064909 149.7774031 1.93916E?34 3.5223E?32 Socs2 ?1.266440957 9.351659082 148.7076923 3.32227E?34 5.96754E?32 mt-Co1 ?0.296844605 12.21554609 147.9872407 4.77442E?34 8.48167E?32 Ahr ?1.187489037 9.328418697 147.556191 5.93126E?34 1.04222E?31 Rora ?0.769975041 9.982396399 147.3734285 6.50277E?34 1.13036E?31 Ctla4 ?0.752514198 10.15303783 143.5610512 4.43161E?33 7.62142E?31 Gimap6 0.469906688 10.46581469 143.4578381 4.66797E?33 7.94341E?31 Srgn ?0.392519863 11.37089272 143.1641996 5.41165E?33 9.11299E?31 Ltb4r1 ?1.111665991 9.272000172 142.6946671 6.85474E?33 1.14241E?30 Fam46a ?1.314561947 9.504335784 141.6679882 1.14942E?32 1.89607E?30 Samd3 0.636378603 9.164604728 140.6602121 1.90916E?32 3.11753E?30 Hk2 ?1.16240928 9.291515007 139.523414 3.38402E?32 5.47061E?30 Itgae ?1.184859251 9.27549806 135.9237287 2.07344E?31 3.31873E?29 Fasl 0.707483582 9.594244101 135.8923984 2.10642E?31 3.33846E?29 Rbm47 0.718009897 9.170928286 135.5181016 2.54338E?31 3.99188E?29 Gpr34 ?1.061027039 9.256545758 134.3366515 4.61142E?31 7.1681E?29 Eif1 0.260507074 11.85893183 134.2575124 4.79894E?31 7.38855E?29 Gnas 0.39392693 10.37735049 133.5033298 7.01649E?31 1.07008E?28 Sp100 0.675383289 9.55366719 132.5975297 1.10731E?30 1.67297E?28 Tbxa2r 0.585759135 9.164267126 132.1983671 1.35391E?30 2.02661E?28 Nt5e ?1.088041733 9.297376625 132.0590116 1.45237E?30 2.15404E?28 Gxylt1 0.864574803 9.199924509 131.8738591 1.59435E?30 2.34311E?28 Asap1 0.888126055 9.229868598 130.5342162 3.13089E?30 4.55981E?28 Il2ra ?1.040299441 9.266106978 129.9752671 4.14915E?30 5.98886E?28 Rpl10 ?0.310792871 11.48660702 129.9264066 4.25256E?30 6.08379E?28 Fam110a ?0.964708157 9.494264974 129.6194418 4.96378E?30 7.03899E?28 Cbx4 0.781047544 9.354636358 128.9857168 6.83082E?30 9.60235E?28 Slc3a2 0.511278475 10.08968291 128.1171727 1.05808E?29 1.47457E?27 Itgad 0.535714085 9.161955942 126.8819115 1.97163E?29 2.72422E?27 Tnfaip8 ?0.821651414 9.630233952 126.0811572 2.95162E?29 4.04372E?27 Nebl ?1.069381966 9.313919832 124.5341642 6.43614E?29 8.74342E?27 Rpsa ?0.277280078 11.60015063 123.8483581 9.09342E?29 1.22503E?26 Epsti1 ?0.651296117 9.946025493 123.5305898 1.06728E?28 1.42592E?26 Cst7 0.771669339 9.361569648 123.2695875 1.21733E?28 1.61306E?26 H2-T22 0.511037144 9.836593368 122.1981069 2.08902E?28 2.74561E?26 Klf3 0.838002162 9.422127484 120.9469914 3.9248E?28 5.1168E?26 Cd96 ?0.884171126 9.446982611 120.5563123 4.77908E?28 6.18068E?26 Ifitm1 ?2.559027388 9.599684322 118.0524471 1.68863E?27 2.16654E?25 Cxcr4 0.877743485 9.203511935 117.4615351 2.27469E?27 2.89548E?25 Dnase1l3 0.522754123 9.161900584 117.0414103 2.81136E?27 3.55066E?25 Ddit3 0.779019377 9.376075281 116.2467391 4.19693E?27 5.25951E?25 Plscr1 ?0.95795568 9.521575487 115.5912639 5.84083E?27 7.26329E?25 Tspan3 0.784843484 9.325091853 114.3100538 1.11446E?26 1.3753E?24 Klrd1 ?1.164056439 9.372657862 113.7518146 1.47683E?26 1.80867E?24 Rps19 ?0.246604045 12.57926856 113.2192993 1.93182E?26 2.34811E?24 Btg2 ?0.527557012 10.53785684 112.9321685 2.23284E?26 2.69374E?24 Sat1 0.656951889 9.537032997 111.897264 3.76314E?26 4.50629E?24 Ngfrap1 0.646356558 9.495133067 111.7125177 4.13066E?26 4.91002E?24 S100a4 ?1.018352282 9.866562997 111.1597843 5.45887E?26 6.44147E?24 Nfkbia ?0.597111959 10.83361265 105.0791749 1.17352E?24 1.37472E?22 Aprt ?0.701406151 9.637312921 104.6412923 1.46374E?24 1.70237E?22 Susd3 ?0.901261435 9.36994386 104.5375265 1.54244E?24 1.78108E?22 H1f0 ?1.071867051 9.429812238 104.4247351 1.63279E?24 1.87204E?22 Pfn1 ?0.317456871 12.14558154 102.6778946 3.9432E?24 4.48914E?22 H3f3b 0.257055136 12.34434425 102.3962134 4.5457E?24 5.13886E?22 A930011G23Rik 0.339865641 9.15868181 102.3174094 4.73017E?24 5.31027E?22 Gm8369 0.521666409 9.924627075 101.6077892 6.76786E?24 7.54547E?22 Dkkl1 ?0.896564378 9.308701044 100.1636514 1.40311E?23 1.55361E?21 Tm6sf1 0.797062802 9.205998818 99.8736915 1.62433E?23 1.78632E?21 Bhlhe40 ?0.43201621 10.72350871 99.34549809 2.12079E?23 2.31654E?21 Irf2bpl 0.749110924 9.293163503 98.99862068 2.52678E?23 2.74147E?21 Ccr2 0.622882557 9.897726382 98.98187498 2.54823E?23 2.74632E?21 Irf2 0.698581849 9.326143404 98.03421665 4.11215E?23 4.40245E?21 Atp5l ?0.352277104 10.47765534 97.58180026 5.16767E?23 5.49609E?21 2010111I01Rik 0.659221506 9.402781177 96.19904171 1.03895E?22 1.09776E?20 St8sia1 ?0.835504537 9.247015066 95.74994331 1.3035E?22 1.36834E?20 Pdcd1 0.966655751 9.244430667 95.28801588 1.64607E?22 1.71679E?20 Rps27rt 0.36584719 11.16196987 95.19935627 1.72146E?22 1.78392E?20 Krtcap2 ?0.449237684 10.06413459 95.17864624 1.73957E?22 1.7912E?20 H2-Q10 0.746706806 9.219532223 94.78298372 2.12444E?22 2.17365E?20 Smco4 ?0.864745743 9.324712373 94.70819526 2.20624E?22 2.24315E?20 Itm2b ?0.325043857 10.97659803 94.43754827 2.52948E?22 2.55573E?20 Trps1 0.807993435 9.24785037 94.38115316 2.60258E?22 2.61325E?20 Ehd1 ?0.785381669 9.471478828 94.29520457 2.71808E?22 2.71238E?20 Lcp1 ?0.445197114 10.29115797 93.45936544 4.14626E?22 4.11218E?20 Ccl4 1.798057092 9.567483078 93.36095469 4.35763E?22 4.29545E?20 Itgb2 0.557196956 9.575080932 93.16885995 4.80177E?22 4.70457E?20 Pttg1 0.665331536 9.448095727 93.09752183 4.978E?22 4.81883E?20 Fubp3 0.676573702 9.185256957 93.09812625 4.97648E?22 4.81883E?20 Ly6g5b ?0.772528223 9.223289292 92.75608537 5.91533E?22 5.69209E?20 Wipf3 0.26176696 9.158140644 92.24996768 7.63914E?22 7.30736E?20 AB124611 0.682659164 9.180450532 92.21780357 7.76431E?22 7.3834E?20 Asap2 0.462878352 9.163205905 92.17975453 7.91504E?22 7.48272E?20 Wbp5 0.710373707 9.336227139 92.08583153 8.29975E?22 7.8008E?20 Lax1 0.750516768 9.205901785 91.84961807 9.35199E?22 8.73898E?20 mt-Co3 ?0.242677521 12.09938987 91.67605628 1.02093E?21 9.48524E?20 Gm12840 ?0.842973953 10.16274436 91.32502726 1.21909E?21 1.12616E?19 Ostf1 ?0.48303019 10.18387303 91.04103711 1.40723E?21 1.29257E?19 Acot7 ?0.644244133 9.577154168 90.9245269 1.49258E?21 1.36322E?19 Timp2 ?0.865419253 9.295780623 90.80210372 1.58784E?21 1.44208E?19 Rexo2 ?0.732259687 9.465193175 90.57002666 1.78545E?21 1.61249E?19 Abhd17c ?0.839404611 9.339494063 89.96047193 2.42966E?21 2.18211E?19 Ubc 0.3685984 11.04999023 89.59143681 2.92789E?21 2.61504E?19 Hspe1 0.538143649 10.27531776 89.36763916 3.27856E?21 2.91215E?19 Ms4a6b 0.412280945 10.19491628 89.30355751 3.3865E?21 2.99159E?19 Klk8 ?0.677530964 9.559198221 88.48589784 5.11986E?21 4.49824E?19 Prkch 0.58070113 9.449515994 86.82690444 1.18447E?20 1.03504E?18 Syf2 0.443448656 9.733081568 86.7777254 1.21429E?20 1.05539E?18 Prdx6 ?0.457748392 10.19721197 86.54540808 1.36565E?20 1.1806E?18 Adam8 ?0.807293103 9.247155567 85.89615093 1.89638E?20 1.63068E?18 Ldlrad4 ?0.879974484 9.298455799 84.9562291 3.05044E?20 2.60917E?18 Rcbtb2 ?0.877505664 9.39898186 84.63477143 3.58898E?20 3.05365E?18 Gramd1a ?0.736031909 9.45889775 84.52414815 3.79551E?20 3.21247E?18 Socs3 0.669638314 9.492279241 84.41671087 4.00746E?20 3.3742E?18 Kremen2 0.614419032 9.177276538 83.90371615 5.19468E?20 4.35115E?18 Ftl1 0.30419987 10.82047194 83.72493817 5.68634E?20 4.73741E?18 Fyn 0.561444187 9.486733177 83.7151954 5.71443E?20 4.73741E?18 Npc2 0.410579927 9.848489901 83.70139601 5.75446E?20 4.74625E?18 Gcnt2 ?0.743016267 9.218046584 83.23349557 7.29117E?20 5.9832E?18 Rpl13 ?0.173445727 12.63772739 83.18432332 7.47482E?20 6.10292E?18 Cxcr3 0.586788812 9.551365757 83.01615013 8.13857E?20 6.61147E?18 Perp 0.636271306 9.176884673 81.52799393 1.72797E?19 1.39671E?17 Rps18 ?0.182969674 12.47333304 81.01252335 2.24292E?19 1.80393E?17 H3f3a ?0.343723722 10.34149301 80.77491166 2.52949E?19 2.02434E?17 Prr5 ?0.668175925 9.209950504 79.99053942 3.76207E?19 2.99594E?17 Maf 0.600777868 9.568684693 79.76182883 4.22374E?19 3.34711E?17 1700001O22Rik 0.372137118 9.160348241 79.58478248 4.6197E?19 3.64303E?17 Slco3a1 ?0.761871352 9.251168617 79.16254048 5.72045E?19 4.48916E?17 Rbm3 ?0.335572075 10.73102924 78.7953872 6.88877E?19 5.3799E?17 Cyb5a ?0.677604285 9.520917476 78.29568723 8.87153E?19 6.89506E?17 Anxa1 ?0.915818021 9.278561592 77.85704634 1.10774E?18 8.56831E?17 Gramd3 0.483169371 10.20641741 77.84616622 1.11386E?18 8.57461E?17 Cd44 ?0.628062155 9.560090954 77.66490234 1.22092E?18 9.35419E?17 Cd160 ?1.060008934 9.334762898 77.45982745 1.3545E?18 1.03287E?16 Gata3 ?0.861175492 9.445565238 77.30607749 1.46415E?18 1.11124E?16 Podnl1 ?0.768407408 9.399879407 76.93648778 1.76545E?18 1.33366E?16 Gpr55 ?0.713985194 9.217387159 76.83201579 1.86136E?18 1.39957E?16 Cd247 0.514152093 9.534122941 76.54776484 2.14951E?18 1.60875E?16 Rps2 ?0.231179288 11.63572242 75.92273731 2.94984E?18 2.19756E?16 Dapk2 ?0.812348541 9.267248742 75.61455589 3.4481E?18 2.55697E?16 Bcl2a1d ?0.536568274 9.947945196 74.71398893 5.44092E?18 4.01634E?16 Rpl35 ?0.266038037 11.18858014 74.15706214 7.21425E?18 5.30116E?16 Ormdl3 0.662349433 9.242329201 73.61447025 9.49659E?18 6.94669E?16 Rpl24 ?0.190402777 11.77226429 73.2218925 1.15863E?17 8.43716E?16 Tesc ?0.660354554 9.483456771 73.0535519 1.26179E?17 9.14715E?16 Cks2 ?0.777355745 9.525757792 72.98672918 1.30525E?17 9.41991E?16 Gm12216 0.680896072 9.227687607 72.7754164 1.45275E?17 1.04379E?15 Plek 0.751449862 9.215821963 72.38413926 1.77132E?17 1.26704E?15 Sh3glb1 0.450965438 9.599133015 72.35881311 1.7942E?17 1.27775E?15 Malat1 0.278672905 14.6685717 72.26960928 1.87716E?17 1.33097E?15 Rbpj ?0.711555719 9.385172047 71.94087461 2.21743E?17 1.56537E?15 Ppib ?0.424361083 9.880940736 71.9313067 2.22821E?17 1.56614E?15 mt-Atp6 ?0.201773503 12.47131233 71.76755318 2.42101E?17 1.69429E?15 Sh2d2a 0.447240574 9.846353728 71.46835454 2.81741E?17 1.9632E?15 Cish ?0.69379779 9.408299131 71.04548685 3.49083E?17 2.42201E?15 Hint1 ?0.384281305 10.08270698 70.72226399 4.11225E?17 2.84097E?15 Cd74 ?1.106243236 9.434237857 70.69797546 4.16319E?17 2.86392E?15 Lbh 0.579804787 9.408456529 70.37740415 4.89777E?17 3.35497E?15 Lpin1 0.632547096 9.197406237 69.60019426 7.26297E?17 4.95415E?15 Hsp90ab1 0.345884126 11.19694983 69.53672628 7.50048E?17 5.09466E?15 Ubb 0.242830128 12.90471764 69.26272166 8.61832E?17 5.82945E?15 Tm2d3 0.65663079 9.233563913 69.12669132 9.23372E?17 6.21968E?15 Clic1 ?0.354187575 10.3255658 68.54893155 1.23768E?16 8.30222E?15 Mxi1 0.61312214 9.308254267 68.4810021 1.28106E?16 8.55768E?15 Kcnip3 0.214050413 9.158157362 68.20905605 1.47049E?16 9.78268E?15 Rgs2 ?0.664820587 10.05989421 68.2006855 1.47674E?16 9.78403E?15 Cd69 ?0.645530905 9.886453138 68.1516296 1.51394E?16 9.98955E?15 Irf1 0.591854113 9.431031538 67.47468468 2.1341E?16 1.40243E?14 Gcg 0.648871754 9.162673096 67.15821837 2.50569E?16 1.63996E?14 Arpc3 ?0.314794705 10.54009876 67.07583725 2.61261E?16 1.70304E?14 Clint1 ?0.604253767 9.518647713 66.99244015 2.7255E?16 1.7695E?14 Myl6 ?0.256992464 10.93122698 66.77019019 3.05077E?16 1.97275E?14 Nfkbiz ?0.598905696 9.633433533 66.72696278 3.1184E?16 2.00845E?14 Reep5 ?0.520338628 9.637155571 66.49848676 3.50162E?16 2.24632E?14 Nme1 ?0.531092689 9.653532734 66.23423055 4.00398E?16 2.55843E?14 Nck1 0.612718075 9.252796487 66.02666346 4.44864E?16 2.83137E?14 Bcl2a1b ?0.398493382 10.39217608 65.1482998 6.94684E?16 4.40402E?14 Gng5 0.34112214 9.899707496 64.67244017 8.84433E?16 5.58506E?14 Cox5a ?0.369902109 10.08152668 64.56707148 9.33016E?16 5.86893E?14 D1Ertd622e 0.615527633 9.208393557 64.30341259 1.06661E?15 6.68325E?14 Ube2b 0.353641396 9.912283123 63.83320012 1.35412E?15 8.45202E?14 Pnrc1 0.298835463 10.57783069 63.57012017 1.54759E?15 9.62243E?14 Ier3 0.686673886 9.17570835 63.29753534 1.77727E?15 1.10082E?13 Cyb5r3 0.589129593 9.274984141 62.76482846 2.32921E?15 1.43718E?13 Sec62 0.390672881 9.756942892 62.73250459 2.36776E?15 1.4554E?13 P2rx7 ?0.686106279 9.260764108 62.71139686 2.39327E?15 1.46551E?13 Cd226 ?0.718795459 9.268586644 62.40322215 2.79865E?15 1.70728E?13 Maff ?0.785642781 9.305243703 62.11356649 3.2421E?15 1.97037E?13 Cir1 0.540883115 9.390079546 61.8636656 3.68079E?15 2.2286E?13 Mier1 ?0.56737739 9.536740084 61.39838388 4.66193E?15 2.81212E?13 Hvcn1 ?0.697052978 9.29925934 61.38224575 4.7003E?15 2.82472E?13 Leprotl1 0.387799851 9.724295192 61.16177005 5.25725E?15 3.14773E?13 Akap13 ?0.346613669 10.30878346 61.06204963 5.5304E?15 3.29906E?13 Cables1 0.58247393 9.182534864 60.94449572 5.87068E?15 3.48917E?13 Ubald2 0.334201988 10.62010958 60.89344557 6.02491E?15 3.56772E?13 Ass1 ?0.613406117 9.534311369 60.42124224 7.65821E?15 4.51834E?13 Fam104a 0.504996169 9.38496573 60.18580376 8.63125E?15 5.05913E?13 Atp5h ?0.278014591 10.35719028 60.18440409 8.63739E?15 5.05913E?13 Dusp10 ?0.717056732 9.475530411 60.11639783 8.94103E?15 5.21808E?13 6330403K07Rik 0.600891856 9.187821133 59.89795809 9.9905E?15 5.80959E?13 mt-Cytb ?0.259020182 11.07894922 59.78485862 1.05814E?14 6.13116E?13 Sepp1 ?0.723631668 9.293155529 59.50165472 1.22191E?14 7.0548E?13 Il1r2 ?0.903532683 9.256685507 59.46822742 1.24285E?14 7.15012E?13 Orai1 0.392968699 9.884602454 59.42944137 1.26758E?14 7.26658E?13 Crtam 0.457167582 9.163663097 59.2478005 1.39016E?14 7.94108E?13 Eif5 0.382500506 9.823460355 59.19925072 1.42488E?14 8.11078E?13 Actg1 ?0.24698467 12.09934301 59.02051658 1.56037E?14 8.85083E?13 Vmp1 0.480500703 9.490450465 58.65631384 1.87765E?14 1.06133E?12 Cd3g ?0.238281838 11.10939413 58.41952928 2.11778E?14 1.19289E?12 Lysmd2 ?0.676383806 9.243342087 58.30789378 2.24143E?14 1.25816E?12 Ccdc50 ?0.636888834 9.24053109 58.24392228 2.31551E?14 1.29524E?12 Coro1a ?0.294730343 10.77307504 58.19082122 2.37886E?14 1.32609E?12 Ctsd 0.432871133 9.641722001 58.04221936 2.56552E?14 1.42523E?12 Adam19 0.588396014 9.250767663 57.92386217 2.72462E?14 1.50843E?12 Gm9844 ?0.531404913 9.544148899 57.76929535 2.94735E?14 1.62064E?12 H2-Q6 0.39965633 9.740245985 57.7724562 2.94261E?14 1.62064E?12 Rnf149 ?0.678390076 9.332967884 57.76244641 2.95763E?14 1.62078E?12 Faim 0.553709883 9.309636125 57.6673891 3.10407E?14 1.69528E?12 Gstm5 ?0.595633706 9.20199523 57.63484148 3.15586E?14 1.71776E?12 Ssr4 ?0.462687492 9.653712425 57.61772544 3.18344E?14 1.72696E?12 Ppp1ca ?0.313444097 10.29798996 57.51174091 3.35968E?14 1.81647E?12 Man1a 0.591903753 9.262299772 57.36248846 3.62455E?14 1.94666E?12 Ak2 ?0.559791812 9.46480863 57.36453397 3.62078E?14 1.94666E?12 Hilpda ?0.610088711 9.667525426 57.29728897 3.74671E?14 2.00561E?12 Hspd1 0.490465034 9.781069436 57.21625898 3.9043E?14 2.08307E?12 Ifrd1 ?0.452953447 10.02590859 57.12858627 4.08229E?14 2.17086E?12 Sptssa ?0.528455842 9.597747238 57.11895346 4.10233E?14 2.17437E?12 Ero1l ?0.653981362 9.301167052 56.87647737 4.64064E?14 2.4453E?12 Znrf1 ?0.625877517 9.40064809 56.87516065 4.64374E?14 2.4453E?12 Slc15a3 ?0.645993624 9.22733484 56.72999974 4.9995E?14 2.62409E?12 Snrpd3 ?0.513107614 9.547220839 56.57419645 5.41174E?14 2.83127E?12 Nab1 0.476701688 9.481616428 56.13698376 6.75936E?14 3.5249E?12 Tmbim4 ?0.620175868 9.33363574 55.75215867 8.2208E?14 4.27323E?12 Ptpn6 ?0.655690323 9.338656784 55.65343816 8.64416E?14 4.47889E?12 Thap3 0.571712939 9.265378945 55.63069262 8.74476E?14 4.51654E?12 Son 0.380723151 9.69657111 55.47166754 9.48158E?14 4.8815E?12 Erp44 0.484253067 9.382705163 55.39965547 9.83537E?14 5.04757E?12 H2-Q4 0.389723252 9.753745914 55.06953171 1.1634E?13 5.95177E?12 Lmo1 0.219255613 9.158225061 55.00767127 1.2006E?13 6.1227E?12 Prf1 0.305417186 9.16134179 54.73770604 1.37738E?13 7.00212E?12 Sp110 0.488354994 9.437502438 54.636272 1.45034E?13 7.3499E?12 Eif3h ?0.277769071 10.296933 54.59602322 1.48035E?13 7.47854E?12 Itga1 ?0.499265851 9.19749427 54.25356867 1.76217E?13 8.87452E?12 Pde4d 0.552817694 9.266026673 54.1068785 1.89875E?13 9.53269E?12 Atf3 ?0.817587319 9.293189291 54.0557667 1.94879E?13 9.75362E?12 Ets1 0.28518737 10.24991887 53.90587312 2.10328E?13 1.04943E?11 Ubash3b 0.502003409 9.181348024 53.89976936 2.10982E?13 1.04946E?11 Clec12a ?0.430462755 9.187014324 53.88824045 2.12224E?13 1.0524E?11 Dgat1 ?0.55834131 9.778715844 53.80814124 2.21055E?13 1.09284E?11 Cdc42ep3 0.575632949 9.28694131 53.17349427 3.05351E?13 1.50497E?11 Hsp90aa1 0.420791665 10.76849068 53.14096424 3.1045E?13 1.52545E?11 Kdm6b ?0.638583048 9.740481683 53.04665018 3.2572E?13 1.59563E?11 Spcs2 ?0.360764471 9.914030831 52.97319432 3.38132E?13 1.65143E?11 H2afz ?0.360541992 10.76566171 52.78471826 3.72186E?13 1.81228E?11 Gm13546 ?0.513269881 9.199885349 52.69946318 3.88697E?13 1.88699E?11 Rhoh 0.473436285 9.501551957 52.55043386 4.1934E?13 2.02966E?11 Gm14718 ?0.588453419 9.20570763 52.38609479 4.55941E?13 2.19367E?11 Cd48 ?0.494282495 9.721189722 52.38800866 4.55497E?13 2.19367E?11 Traf1 ?0.367189394 10.10520209 52.10848359 5.25175E?13 2.51183E?11 Cd9 0.629962799 9.231253154 52.1093635 5.2494E?13 2.51183E?11 Armc7 0.550696024 9.197060421 52.04413059 5.42672E?13 2.58786E?11 Eef2 ?0.182985174 11.29634654 52.01630705 5.50416E?13 2.61707E?11 Hnrnpdl 0.406565088 9.556908077 51.93389098 5.74011E?13 2.72125E?11 Cox6b1 ?0.298181628 10.15773008 51.53029184 7.05009E?13 3.33251E?11 Anp32a ?0.368441055 9.87826882 51.36308833 7.67685E?13 3.61819E?11 Il10 0.872476336 9.17451578 51.1391009 8.60471E?13 4.04371E?11 Ndufs5 ?0.512031204 9.463767548 51.08750093 8.8339E?13 4.13939E?11 Fam3c ?0.605630051 9.322868853 51.02033744 9.14139E?13 4.27109E?11 Gna13 ?0.397146052 9.985113984 50.90425396 9.69832E?13 4.51185E?11 Cpd ?0.473218402 9.194132269 50.90138385 9.71251E?13 4.51185E?11 Gpr174 0.55340071 9.263821812 50.88606644 9.7886E?13 4.53417E?11 Osr2 0.528324536 9.161148525 50.41408333 1.24498E?12 5.75037E?11 Plxnc1 0.364392898 9.165511777 50.1943726 1.39247E?12 6.41328E?11 Gnai2 ?0.334762855 10.17428897 50.13923682 1.43215E?12 6.57729E?11 Cox4i1 ?0.221749475 10.68633283 50.06740638 1.48554E?12 6.80319E?11 H2-K1 0.188614934 11.60998915 50.02198623 1.52033E?12 6.94284E?11 Cytip ?0.328069424 10.18842314 50.00987741 1.52974E?12 6.94657E?11 Nrn1 0.483613566 9.165074057 50.01143543 1.52853E?12 6.94657E?11 Rab14 0.426761389 9.461449449 49.89200515 1.62445E?12 7.35599E?11 Gimap7 0.313625671 10.07498565 49.73569548 1.75916E?12 7.94374E?11 Yes1 ?0.604422292 9.221082612 49.55380987 1.93005E?12 8.69112E?11 Cxcl10 ?0.914697883 9.358345131 49.37721533 2.11184E?12 9.48335E?11 Gimap4 0.259745694 10.52499935 49.36824352 2.12152E?12 9.50043E?11 Rps26 ?0.21575601 10.99404089 49.26863753 2.23203E?12 9.96766E?11 Gabarapl2 ?0.350190949 9.899410329 48.56016717 3.20309E?12 1.42648E?10 Aldoa ?0.304682663 10.23625965 48.51986093 3.26961E?12 1.4521E?10 Mef2d 0.532711694 9.220655304 48.44143467 3.40301E?12 1.50721E?10 Tmbim6 0.267484208 10.08427654 48.41247816 3.45364E?12 1.52129E?10 Rnf145 0.529781681 9.217590475 48.41300404 3.45271E?12 1.52129E?10 Klk1b27 0.380972786 9.165727377 48.39798189 3.47926E?12 1.52689E?10 Ckb ?0.660760349 9.33571335 48.39461397 3.48524E?12 1.52689E?10 Rnf19b ?0.589896188 9.379257024 48.23892168 3.77324E?12 1.6486E?10 Pld3 0.485699376 9.363216876 48.13576818 3.97705E?12 1.73297E?10 Dennd5a ?0.564488698 9.227020583 47.77273449 4.78602E?12 2.07986E?10 Cd68 0.374640404 9.164093483 47.73200657 4.88649E?12 2.11783E?10 Ifng ?0.824643513 9.686644277 47.71134049 4.93827E?12 2.13455E?10 Nod1 0.399719281 9.170204215 47.68415533 5.00722E?12 2.15858E?10 Ndufa3 ?0.350060637 9.879747436 47.57998143 5.2805E?12 2.27033E?10 Pdlim1 ?0.602115592 9.286492478 47.41649323 5.73977E?12 2.46125E?10 Dnaja1 0.34905358 10.76370187 47.35226766 5.93095E?12 2.5365E?10 Pnrc2 0.469933719 9.363165739 47.30698162 6.06956E?12 2.58893E?10 Trpc1 0.383243845 9.166364579 47.20240867 6.40217E?12 2.72362E?10 Cd84 0.499531179 9.348586397 47.08726344 6.78955E?12 2.88083E?10 S100a13 ?0.354122862 9.897856812 46.79593256 7.87767E?12 3.33378E?10 Hsph1 0.561731891 9.47244434 46.69789632 8.28179E?12 3.49565E?10 Ccnd3 ?0.500150776 9.527417169 46.67505351 8.37889E?12 3.52742E?10 Slc25a51 ?0.575066526 9.32805566 46.52560617 9.0429E?12 3.79708E?10 Serpinb1a ?0.924931877 9.512638923 46.22319099 1.05521E?11 4.41929E?10 Fdx1 ?0.61661336 9.293651654 46.1565072 1.09174E?11 4.56047E?10 Fgl2 ?0.588978631 9.496125029 46.11929581 1.11267E?11 4.63594E?10 Calm2 0.260443806 10.41347078 45.85998996 1.27014E?11 5.27842E?10 Nrarp 0.497355543 9.184041384 45.77903133 1.32373E?11 5.48703E?10 Cfl1 ?0.209942284 11.11285008 45.74902911 1.34416E?11 5.55746E?10 Gm8730 ?0.272607384 10.44469147 45.58287839 1.46315E?11 6.034E?10 Rps9 ?0.140221794 11.99538144 45.57537937 1.46876E?11 6.04173E?10 Dctpp1 ?0.584823203 9.308258583 45.45062678 1.56535E?11 6.42272E?10 Myeov2 ?0.391999007 9.682148255 45.31640752 1.67639E?11 6.86088E?10 Lsp1 ?0.305708206 10.32146671 45.30229843 1.68851E?11 6.89304E?10 Ccl1 ?1.071553426 9.258105615 45.24994825 1.73425E?11 7.06194E?10 Ccna2 ?0.408457876 9.193761792 45.04913135 1.92152E?11 7.80487E?10 Klrc2 ?0.651905895 9.283426969 45.01296321 1.95734E?11 7.93043E?10 Zfp36l2 0.427884779 9.814090687 44.98399358 1.98652E?11 8.0285E?10 2310031A07Rik 0.362915586 9.165479785 44.90459464 2.06872E?11 8.33988E?10 Lamb3 0.532127003 9.282561154 44.76329977 2.22351E?11 8.94163E?10 Rpl10a ?0.187109705 11.1422209 44.63983869 2.36823E?11 9.49997E?10 Tmem33 0.477950768 9.3077973 44.5371315 2.49579E?11 9.98685E?10 Larp7 0.487803635 9.322608334 44.48668833 2.56093E?11 1.02222E?09 Laptm5 0.221475236 10.49800706 44.38990272 2.69071E?11 1.07138E?09 2810417H13Rik ?1.100112922 9.337396993 44.380798 2.70326E?11 1.07373E?09 Tnfaip8l2 ?0.584535976 9.325792226 44.31580305 2.79451E?11 1.10726E?09 Plekha2 0.500523877 9.289919496 44.30617094 2.8083E?11 1.11E?09 Ptma ?0.225883777 11.28824476 44.22970703 2.92016E?11 1.1514E?09 E130308A19Rik 0.31445378 9.162753622 44.16856614 3.01281E?11 1.18504E?09 Nsmaf 0.506430735 9.239663944 44.08781407 3.13969E?11 1.23195E?09 Eif4a2 0.360471487 9.72382619 43.94614377 3.37537E?11 1.32122E?09 Susd1 0.169765045 9.158248282 43.86105877 3.52534E?11 1.37658E?09 Il4ra ?0.514186967 9.499579295 43.78225573 3.67018E?11 1.42969E?09 Gas7 0.534018731 9.194255021 43.70792329 3.81225E?11 1.48146E?09 Ncl 0.278368496 10.07281784 43.57228777 4.08584E?11 1.58397E?09 H2-DMa ?0.576877869 9.273413107 43.48277925 4.27707E?11 1.65414E?09 Nfkb1 ?0.476422063 9.537085465 43.45398589 4.34047E?11 1.67167E?09 Klhl6 ?0.579490641 9.316904493 43.45280579 4.34308E?11 1.67167E?09 Rsu1 ?0.553456622 9.325990907 43.2691892 4.77036E?11 1.83177E?09 Zfp36l1 ?0.538126975 9.536569365 43.14567424 5.08121E?11 1.94651E?09 Myo1g ?0.502350092 9.439423987 42.90718154 5.73996E?11 2.19367E?09 Bcl11b 0.437395638 9.518527425 42.87577242 5.83286E?11 2.22391E?09 Camk2n1 0.51765763 9.340518386 42.78669427 6.1046E?11 2.32205E?09 Cox6c ?0.25524067 10.25790139 42.70764093 6.35635E?11 2.41213E?09 Xcl1 ?1.217474518 9.40505696 42.44448966 7.2717E?11 2.75303E?09 Ddx5 0.192028691 11.19922275 42.13065591 8.53743E?11 3.22467E?09 Hic1 ?0.58737025 9.270379257 42.04651106 8.91281E?11 3.35861E?09 Hspa8 0.2217404 12.33062837 41.87878413 9.71106E?11 3.65091E?09 Tmem64 ?0.615622886 9.248115386 41.48317304 1.1889E?10 4.45934E?09 Chpt1 0.429457135 9.179331566 41.39841629 1.24158E?10 4.64615E?09 Ube2c ?0.66752016 9.233385993 41.22575977 1.35623E?10 5.06348E?09 BC094916 0.462966748 9.179306194 41.13909389 1.41772E?10 5.28085E?09 Kmt2e 0.392340073 9.498176274 40.93206348 1.57614E?10 5.85744E?09 Rps13 0.126889713 11.92521755 40.88192763 1.6171E?10 5.99587E?09 Arhgdib ?0.23489064 10.73178038 40.82445287 1.66536E?10 6.16069E?09 Rps11 ?0.128635338 12.26306636 40.75299459 1.72739E?10 6.37555E?09 Nrip1 ?0.511508437 9.582600354 40.74521701 1.73427E?10 6.3864E?09 Map1lc3b 0.268218052 9.979640755 40.65040396 1.8205E?10 6.68867E?09 Spcs3 ?0.531192179 9.347697431 40.61133177 1.85726E?10 6.80829E?09 Cnbp 0.239051499 10.25781376 40.46190118 2.00488E?10 7.33276E?09 Gimap9 0.386062289 9.581018999 40.26864864 2.21332E?10 8.07689E?09 Siah2 0.494945204 9.298903622 40.20996507 2.28082E?10 8.30444E?09 Il22 ?1.480069678 9.482896849 40.13656655 2.36814E?10 8.60301E?09 Ermn ?0.714912853 9.304618523 39.83166035 2.76821E?10 1.00338E?08 Lrrk1 0.468677107 9.191477397 39.74374104 2.89567E?10 1.04724E?08 Gnb1 ?0.391064061 9.703237593 39.63283371 3.06487E?10 1.10595E?08 Gimap5 0.370228394 9.666351398 39.62670839 3.0745E?10 1.10696E?08 Phlda1 ?0.636144657 9.440824176 39.56734338 3.16939E?10 1.13859E?08 Mns1 ?0.550791808 9.250778634 39.43515476 3.39136E?10 1.21294E?08 Ugcg 0.492972956 9.205476436 39.43590289 3.39006E?10 1.21294E?08 Gngt2 ?0.558255736 9.363452811 39.36832194 3.50944E?10 1.2524E?08 Rpl28 ?0.209984435 10.72557562 39.30306294 3.62872E?10 1.29211E?08 Rasd2 0.252071753 9.160323378 39.25591272 3.71741E?10 1.32078E?08 Cdca3 ?0.432676987 9.196735064 38.86561366 4.54008E?10 1.60954E?08 Pyhin1 0.507982275 9.241830884 38.84662598 4.58446E?10 1.62171E?08 Gpr155 0.391019223 9.171320995 38.72724925 4.87358E?10 1.71855E?08 Fdps ?0.577186785 9.325334883 38.7248911 4.87947E?10 1.71855E?08 Pafah1b1 0.325223913 9.629847563 38.45459246 5.60425E?10 1.96953E?08 Ahcyl2 0.477977983 9.277929397 38.43033025 5.67436E?10 1.98984E?08 Tbca ?0.330314256 9.754797449 38.36938604 5.85436E?10 2.04852E?08 Sec61g ?0.241152419 10.28521272 38.33449562 5.95997E?10 2.08097E?08 Ggt1 ?0.481485267 9.203331028 38.18802532 6.42455E?10 2.23835E?08 Stmn1 ?0.969653028 9.430288892 38.12215366 6.64513E?10 2.31022E?08 Ms4a4b 0.250633898 10.75182838 38.11258677 6.6778E?10 2.31659E?08 Setbp1 0.254687577 9.158648722 38.06296275 6.84981E?10 2.37118E?08 Emp1 ?0.541943392 9.358546116 37.96775029 7.19237E?10 2.48444E?08 Itpk1 0.476912809 9.247476152 37.77295203 7.94761E?10 2.73423E?08 Smim3 ?0.541785751 9.350048092 37.77252938 7.94933E?10 2.73423E?08 Tap1 0.398451698 9.443533326 37.73515593 8.1031E?10 2.7812E?08 2010107E04Rik ?0.300004943 9.866343542 37.56919881 8.82267E?10 3.02177E?08 Gimap3 0.303898627 9.896326654 37.49661931 9.15716E?10 3.1297E?08

    TABLE-US-00025 TABLE 3I LPL-8 vs. All GeneSymbol logFC logCPM LR PValue FDR 2810417H13Rik 4.421635993 9.33967971 7636.915091 0 0 Hist1h2ap 2.09574419 9.186994176 1698.909855 0 0 Ccnb1 2.047353729 9.183341398 1613.079657 0 0 Hmgb2 2.042066843 10.71344588 4244.556365 0 0 Dut 2.014738394 9.371284608 1684.500852 0 0 Tk1 1.960291577 9.18674202 1653.526255 0 0 Tmpo 1.849269119 9.399807016 1521.174414 0 0 Malat1 ?1.842629645 14.66785796 1809.716204 0 0 Alyref 1.825896572 9.471862774 1532.732128 0 0 Tacc3 2.134080213 9.190377363 1956.52509 0 0 2700094K13Rik 1.744910584 9.385940771 1515.690781 0 0 Btg1 ?1.646278161 12.24806463 1559.814146 0 0 H2afz 1.610007538 10.76844958 1970.85919 0 0 Hmgb1 1.500577692 10.29770776 3186.436388 0 0 Anp32b 1.470164134 9.653444707 1632.790581 0 0 Rps27 ?1.218652996 13.23455517 2460.77123 0 0 Ptma 1.34946352 11.28926493 3489.188041 0 0 Ube2s 1.317791113 10.00342164 1614.321852 0 0 Erh 1.270303306 9.742194835 1517.556473 0 0 Ran 1.738531804 9.802858584 3198.770133 0 0 H2afx 2.183010877 9.352344222 1727.503557 0 0 Stmn1 4.321604337 9.432950351 6902.354621 0 0 Cdk1 2.239500798 9.197717135 1974.285437 0 0 Birc5 3.697269867 9.252643265 5794.46549 0 0 Ube2c 3.240090144 9.234259206 2977.10756 0 0 Rrm2 3.204542691 9.248571475 3515.307592 0 0 Cks1b 3.075180267 9.262592977 4175.962604 0 0 Nusap1 2.820830963 9.207702494 2838.147599 0 0 Ccnb2 2.788955405 9.212862629 2442.72995 0 0 Cdc20 2.234954113 9.190262317 1579.632094 0 0 Tuba1b 2.745376143 9.732138323 4450.514283 0 0 Asf1b 2.67891665 9.2238456 2993.556039 0 0 Ccna2 2.623409165 9.194246974 3128.32616 0 0 Cdca8 2.623040933 9.208417544 2645.789881 0 0 Top2a 2.621298744 9.286093445 2205.726859 0 0 Smc2 2.577662882 9.241183844 2533.553825 0 0 Hmgn2 2.509685643 9.446134814 2642.35048 0 0 Ppia 0.798577016 11.56625059 1783.957265 0 0 Spc24 2.479141858 9.204585668 2657.29096 0 0 Tyms 2.261136472 9.239440332 1821.034615 0 0 Mki67 2.362693927 9.203436617 2323.523705 0 0 Tubb5 2.46042399 10.00447555 3985.581762 0 0 Cdca3 2.476526339 9.197186463 2533.838424 0 0 Gmnn 1.936716643 9.252450911 1428.654999 0 0 Spc25 1.802840265 9.180565556 1423.731434 0 0 Aurkb 1.728322959 9.176515087 1422.512724 0 0 Rbm3 0.993484866 10.73203615 1418.078619 0 8.5198E?308 Tpx2 1.875133132 9.181174219 1402.012636 7.675E?307 2.5849E?304 Fbxo5 1.86163473 9.18189049 1400.863621 1.3638E?306 4.4995E?304 Rrm1 1.877528798 9.220046023 1360.531885 7.9254E?298 2.5624E?295 Rpl37a ?0.759463956 12.61574203 1355.666009 9.045E?297 2.8671E?294 H2afv 1.493806059 9.565358508 1347.992844 4.2058E?295 1.3075E?292 Ranbp1 1.404278127 9.627530072 1294.507322 1.7655E?283 5.385E?281 Fau ?0.627429509 12.30172216 1267.495359 1.3092E?277 3.9193E?275 Cdkn3 1.737691789 9.177555326 1258.830289 1.0002E?275 2.9399E?273 Rps14 ?0.606632061 12.65499309 1255.627678 4.9668E?275 1.4338E?272 Tipin 1.929151372 9.251510347 1251.62808 3.6751E?274 1.0423E?271 Anp32e 1.418380455 9.517546841 1249.901683 8.7187E?274 2.4301E?271 Rad51 1.568013575 9.174694718 1222.970551 6.2115E?268 1.702E?265 Ybx1 0.833180643 10.43974649 1218.225603 6.6741E?267 1.7982E?264 Mcm3 1.966718862 9.247410025 1217.41851 9.9952E?267 2.6489E?264 Rpl13a ?0.62938187 13.13153314 1206.09606 2.8871E?264 7.5278E?262 Cenpe 1.653275333 9.175480245 1197.730234 1.8993E?262 4.8735E?260 Racgap1 1.862785236 9.232911791 1182.243973 4.4076E?259 1.1133E?256 Kif22 1.608511734 9.177558442 1165.313674 2.1072E?255 5.2407E?253 Lig1 1.894174794 9.221722332 1152.147372 1.5317E?252 3.7519E?250 Mcm5 1.93647149 9.223522441 1145.109135 5.1862E?251 1.2513E?248 Dek 1.330339959 9.608297419 1108.987405 3.6773E?243 8.7423E?241 Lsm5 1.16498093 9.641405273 1067.935311 3.0765E?234 7.2079E?232 Rps27rt ?1.505651269 11.16249609 1067.058312 4.7717E?234 1.102E?231 Pmf1 1.64552413 9.215533941 1064.284361 1.9125E?233 4.3545E?231 Shcbp1 1.506527243 9.17318021 1057.136768 6.8412E?232 1.536E?229 Mcm7 1.747507535 9.230448074 1054.889735 2.1063E?231 4.6646E?229 Cenpf 1.666917175 9.175513788 1052.18582 8.1514E?231 1.7808E?228 Rpl34 ?0.574832472 11.98009302 1041.129553 2.0623E?228 4.4453E?226 Ska1 1.293432357 9.167812846 1022.411565 2.4146E?224 5.1362E?222 Hcst ?1.243433262 10.61003451 1008.706121 2.3008E?221 4.8305E?219 Rpl18a ?0.561627543 12.84261735 1008.01621 3.2497E?221 6.7351E?219 Gapdh 0.881759066 10.56398779 1002.98404 4.0331E?220 8.2531E?218 Esco2 1.327312143 9.168283663 1000.336843 1.5172E?219 3.0659E?217 Mad2l1 1.648573874 9.208311898 997.1899147 7.3296E?219 1.4628E?216 Ezh2 1.668172168 9.233421923 993.4658486 4.7267E?218 9.3185E?216 Smc4 1.616908446 9.388203106 991.8276439 1.0731E?217 2.0901E?215 Hint1 0.850720336 10.08364789 978.6553338 7.8321E?215 1.5073E?212 Hmmr 1.307226984 9.167659346 947.1292515 5.5818E?208 1.0616E?205 Cenpa 1.819799027 9.395189412 944.3750433 2.2155E?207 4.1646E?205 Anapc5 1.398347276 9.36340878 942.2143264 6.5338E?207 1.2141E?204 Rad51ap1 1.283404233 9.169013279 921.3676391 2.2224E?202 4.0826E?200 Snrpe 0.905699046 9.828152436 913.3257782 1.2445E?200 2.2604E?198 Plk1 1.326982021 9.169293368 908.8251646 1.184E?199 2.1267E?197 Uhrf1 1.454022969 9.180325757 906.7397897 3.3626E?199 5.9736E?197 Nuf2 1.191073084 9.166477547 896.459242 5.7748E?197 1.0147E?194 Pcna 1.440069441 9.444285329 882.2308741 7.1558E?194 1.2439E?191 Rpl36 ?0.620306689 11.87416485 879.5581675 2.727E?193 4.6899E?191 Pfdn5 ?0.85624987 10.55314292 864.7146686 4.5983E?190 7.8249E?188 Dbi 1.368833292 9.462823711 858.1134292 1.2523E?188 2.1088E?186 Nap1l1 1.185055027 9.498411667 850.4819 5.7122E?187 9.5199E?185 Dnajc9 1.378564642 9.367319875 848.3018439 1.7012E?186 2.8062E?184 Lgals1 1.19567371 11.62962461 845.9087386 5.6366E?186 9.2042E?184 Pfn1 0.80604367 12.14562436 840.3634126 9.0489E?185 1.4628E?182 Knstrn 1.473768485 9.18618408 839.6230027 1.3109E?184 2.0982E?182 Cenpm 1.329309763 9.175946219 827.6359859 5.2921E?182 8.3874E?180 Lsm2 1.380526709 9.294336576 823.0375001 5.2891E?181 8.3013E?179 Cenpw 1.490656497 9.256061112 817.7818314 7.3455E?180 1.1418E?177 Clspn 1.292669733 9.172837657 812.9828057 8.117E?179 1.2497E?176 Pbk 1.157650531 9.166198533 812.7880338 8.9483E?179 1.3647E?176 Hnrnpa3 0.835034638 10.15657482 797.3158283 2.0685E?175 3.1251E?173 Rps15a ?0.540860736 12.40397278 794.0829964 1.0436E?174 1.5621E?172 Ywhah 1.011739916 9.722350699 785.426649 7.9544E?173 1.1797E?170 Prc1 1.603165548 9.193597027 784.9083275 1.0311E?172 1.5153E?170 Kif11 1.323931035 9.173024115 770.7097078 1.2602E?169 1.8354E?167 Prdx1 0.952910094 9.945888311 770.5570053 1.3603E?169 1.9635E?167 Kif20a 1.187224656 9.167869132 764.7075308 2.5439E?168 3.6393E?166 Clic1 0.808262932 10.32602803 762.7488106 6.7824E?168 9.6179E?166 Hmgb3 1.455055923 9.208966791 761.6651289 1.1668E?167 1.6403E?165 Mcm6 1.533695009 9.312060518 761.2803647 1.4147E?167 1.9716E?165 H2-K1 ?0.78477459 11.61022938 757.7886343 8.1261E?167 1.1228E?164 Cfl1 0.657597691 11.11327051 745.6811454 3.4872E?164 4.7775E?162 Casc5 1.197590409 9.16829785 740.8335564 3.9494E?163 5.3652E?161 Ccdc34 1.447741361 9.198023808 739.5048275 7.6816E?163 1.0348E?160 Rfc4 1.371829427 9.206979896 738.7492504 1.1214E?162 1.4982E?160 Ncapg 1.232809113 9.171161894 738.4232469 1.3202E?162 1.7493E?160 Cdca5 1.073990128 9.165655149 727.7176521 2.8086E?160 3.6913E?158 Rps27l 1.151450566 9.54350515 726.2661243 5.8091E?160 7.5734E?158 Cdc45 1.123918696 9.168465132 721.1692978 7.4541E?159 9.6403E?157 Slc25a5 0.764127042 10.39499188 716.7972352 6.6542E?158 8.5375E?156 Incenp 1.47758554 9.217026236 712.9734373 4.5142E?157 5.7462E?155 Nucks1 1.286634546 9.378701122 709.2481525 2.9151E?156 3.6817E?154 Tcf19 1.38178144 9.189300183 700.8400864 1.9635E?154 2.4606E?152 Prim1 1.368970463 9.192585042 691.3929603 2.2252E?152 2.7672E?150 Slbp 1.125615982 9.610102043 684.7426234 6.2169E?151 7.6719E?149 Rpl38 ?0.602301624 11.67482758 672.1123304 3.4693E?148 4.2488E?146 Rfc5 1.29872706 9.203272872 669.8028531 1.1028E?147 1.3404E?145 Depdc1a 1.080566977 9.167299078 669.40795 1.3439E?147 1.6213E?145 Atp5b 0.684199477 10.2144056 667.0462036 4.385E?147 5.251E?145 Actb 1.341281009 13.40284709 666.0303963 7.2926E?147 8.6685E?145 Set 0.9980865 9.773450143 658.1483932 3.7758E?145 4.4555E?143 Fen1 1.346059401 9.228228642 652.6360738 5.9679E?144 6.991E?142 Rbbp7 1.176391939 9.398753469 651.1468968 1.258E?143 1.4631E?141 Mcm2 1.500969672 9.228064884 646.9215772 1.0438E?142 1.2053E?140 Rpl17 ?0.466460143 12.29687914 646.8673029 1.0725E?142 1.2297E?140 Mrpl18 1.089849217 9.412606938 646.1342942 1.5482E?142 1.7626E?140 Hist1h1b 1.090360538 9.168316754 640.2582007 2.9362E?141 3.3193E?139 Fam64a 0.975294834 9.164201841 640.020908 3.3067E?141 3.7122E?139 Sgol1 1.052089005 9.166666095 636.43391 1.993E?140 2.222E?138 Cdc6 0.978089655 9.16484216 635.7066496 2.8687E?140 3.1764E?138 Mybl2 0.99941864 9.165876554 633.8085966 7.4215E?140 8.1616E?138 Shisa5 ?0.780179318 11.05001528 633.6115951 8.191E?140 8.947E?138 Ddx39 1.198953115 9.33417475 630.1692678 4.5921E?139 4.9822E?137 Ndufa4 0.938937003 9.736118829 626.7178333 2.5862E?138 2.7873E?136 Hnrnpf 0.638042829 10.40327074 624.7187992 7.0379E?138 7.5347E?136 Banf1 1.165575172 9.354679405 619.6666195 8.8362E?137 9.3978E?135 Neil3 0.927084379 9.16396466 617.4284759 2.7105E?136 2.864E?134 Ncapd2 1.219901417 9.183814831 616.4156886 4.5013E?136 4.7252E?134 Cep55 1.064886567 9.16709682 610.2205471 1.0018E?134 1.0448E?132 Lockd 1.459848715 9.293704619 608.8913956 1.9493E?134 2.02E?132 H2-D1 ?0.53825284 12.28212341 606.8538604 5.4081E?134 5.5686E?132 Cit 1.144554276 9.172719925 604.7868245 1.5228E?133 1.558E?131 Nrm 1.336446732 9.221031657 603.5070411 2.8906E?133 2.939E?131 Cbx3 1.370284119 9.517713266 603.3545264 3.1201E?133 3.1525E?131 Vps37b ?1.31771025 10.60451234 603.0754448 3.5881E?133 3.6028E?131 Ckap2l 0.940613678 9.164154324 599.4326761 2.2243E?132 2.2196E?130 Siva1 1.268781533 9.267321464 597.7669302 5.1228E?132 5.0807E?130 Ddx5 ?0.748471247 11.19882055 596.8397774 8.1503E?132 8.034E?130 Cox5b 0.721979233 10.04400742 596.6538048 8.946E?132 8.7649E?130 Dhfr 1.14149443 9.174522367 594.1002916 3.214E?131 3.13E?129 Tagln2 0.894454006 10.30009936 591.5405549 1.1583E?130 1.1213E?128 Phgdh 1.224257094 9.327085258 589.7968759 2.7739E?130 2.6692E?128 Pnrc1 ?0.970278369 10.57662978 589.1253447 3.8829E?130 3.7143E?128 Hnrnpab 1.039331347 9.483542457 585.1329548 2.8679E?129 2.7272E?127 Orc6 1.275932538 9.234245434 582.8772248 8.8762E?129 8.3914E?127 Rpa3 1.251758221 9.261572437 579.603602 4.5741E?128 4.2991E?126 Bub1 0.865618965 9.163406287 565.9473494 4.2745E?125 3.9943E?123 Ywhae 0.856367486 9.677989159 564.7314682 7.8591E?125 7.3017E?123 Eif1 ?0.551908921 11.85871741 564.4588485 9.009E?125 8.3223E?123 Atpif1 0.97015635 9.536110894 564.2183893 1.0162E?124 9.3341E?123 Coro1a 0.724915443 10.77406128 561.0456488 4.9792E?124 4.5476E?122 Chaf1a 1.055816166 9.171628848 557.4474793 3.0191E?123 2.742E?121 Nudt21 0.915354374 9.525574065 556.9359865 3.9008E?123 3.5229E?121 Usp1 1.247336539 9.280558501 556.4284151 5.0299E?123 4.5174E?121 Kif2c 0.832711735 9.162579143 554.3565171 1.42E?122 1.2682E?120 Kifc1 1.023267071 9.168333886 552.2123696 4.1563E?122 3.6918E?120 Melk 0.932950445 9.165498099 551.2116811 6.8612E?122 6.0611E?120 Cenph 0.913153757 9.165027676 548.8637447 2.2242E?121 1.9541E?119 Dlgap5 1.093157682 9.173768452 546.4514966 7.4463E?121 6.5068E?119 Gins2 1.150040727 9.177204875 542.5356577 5.2943E?120 4.6015E?118 Rps17 0.641426861 10.61650637 541.2097388 1.0286E?119 8.8924E?118 Rpl37 ?0.446037144 12.07327741 536.8593604 9.0923E?119 7.8184E?117 Tpi1 1.264543892 9.324340119 533.6405003 4.5598E?118 3.9002E?116 E2f1 1.124053463 9.176359719 532.0684582 1.0022E?117 8.527E?116 Mxd3 0.855249103 9.163935023 525.4969701 2.6954E?116 2.2813E?114 Dtymk 1.209633615 9.241120176 524.6423187 4.1357E?116 3.4822E?114 Fignl1 1.011624926 9.16854214 524.1311225 5.3428E?116 4.4752E?114 Rpl19 ?0.3918592 12.11778681 523.3530167 7.8896E?116 6.5744E?114 Snrpd1 0.928277472 9.48039714 521.1514562 2.377E?115 1.9706E?113 2700029M09Rik 1.118173547 9.300983612 519.4396362 5.6035E?115 4.6217E?113 Ubb ?0.799096052 12.90434358 518.3005588 9.9147E?115 8.1361E?113 Btg2 ?1.147482427 10.53608889 515.3700463 4.3039E?114 3.514E?112 Rps16 ?0.424371382 12.35159808 514.640466 6.2028E?114 5.039E?112 Ncapg2 0.92687554 9.167047467 512.6513438 1.6802E?113 1.3581E?111 Trip13 0.861097481 9.164683183 504.775635 8.6876E?112 6.9872E?110 Hnrnpa2b1 0.646022506 10.12102555 501.1795627 5.2641E?111 4.2128E?109 Prelid1 0.84830737 9.694516794 499.9674286 9.6618E?111 7.6942E?109 Mis18bp1 0.989123396 9.167160156 499.953746 9.7282E?111 7.7092E?109 Kif23 1.213665525 9.183868072 499.4902839 1.2271E?110 9.6766E?109 Cenpk 0.977765263 9.169824327 499.0265271 1.548E?110 1.2148E?108 Cd53 ?0.807204644 10.54707895 498.8751605 1.67E?110 1.3042E?108 Rfc3 1.195377368 9.204736752 498.7666346 1.7633E?110 1.3705E?108 Nek2 0.822261208 9.163065177 498.6012871 1.9156E?110 1.4817E?108 Rbm39 ?0.637569471 10.67924352 496.9893908 4.2956E?110 3.3068E?108 Rps23 ?0.406286702 12.48558878 495.1050408 1.1041E?109 8.4595E?108 Kif4 0.767602407 9.162351714 493.2798993 2.7552E?109 2.1009E?107 Calm3 0.837078543 9.648791113 492.9071306 3.3209E?109 2.5205E?107 Mcm4 1.237704698 9.249504159 492.3921324 4.2985E?109 3.2472E?107 Lrr1 0.734760355 9.161832843 490.4959146 1.1115E?108 8.3574E?107 Tubg1 1.161123937 9.198088185 489.4483765 1.8786E?108 1.406E?106 Tcp11l2 ?1.634422416 9.433736844 488.1472401 3.6054E?108 2.6859E?106 Aurka 1.068308243 9.172368587 484.3164126 2.4576E?107 1.8225E?105 Ppp1ca 0.632645325 10.2987092 481.41766 1.0502E?106 7.7522E?105 Bub3 0.978303874 9.426163753 481.1590552 1.1955E?106 8.7845E?105 Gimap6 ?0.955890984 10.46579288 476.4855883 1.243E?105 9.0926E?104 Srsf3 0.779744858 9.795217966 474.5266694 3.317E?105 2.4154E?103 Pkm 0.696135927 10.16306624 472.559179 8.8895E?105 6.4443E?103 Dnmt1 1.166056603 9.204828421 470.7607517 2.1889E?104 1.5797E?102 Rpl27 ?0.473037067 11.47321822 470.6997649 2.2568E?104 1.6215E?102 Rad54l 0.7727084 9.162948533 470.3781788 2.6514E?104 1.8966E?102 Ckap2 0.975820995 9.166713898 468.4327904 7.0276E?104 5.0048E?102 Cox5a 0.656023439 10.08238974 466.6749309 1.6956E?103 1.2023E?101 Hdgf 0.972628235 9.445842742 464.44492 5.1833E?103 3.6591E?101 Gltp 0.950180258 9.448373052 463.8695222 6.9155E?103 4.8607E?101 Dpy30 1.023120178 9.328389705 461.7599758 1.9902E?102 1.3928E?100 1500009L16Rik 1.477260477 9.247571334 460.2967524 4.143E?102 2.8869E?100 Fth1 ?0.680771391 11.58497142 456.9938832 2.1681E?101 1.5043E?99 Actg1 0.643649634 12.10129241 456.1278088 3.3462E?101 2.3118E?99 Mtch1 1.10643288 9.287149805 453.1033746 1.5231E?100 1.04779E?98 Cbfb 1.032820636 9.370135648 452.9002844 1.6863E?100 1.15512E?98 Bub1b 0.959966682 9.170515641 452.1480922 2.4583E?100 1.67683E?98 Diaph3 0.970096611 9.171298634 449.7795334 8.0556E?100 5.47168E?98 Lsm3 0.997787164 9.359624215 448.7499742 1.3494E?99 9.1277E?98 Aunip 0.670434396 9.161326688 437.7231237 3.38833E?97 2.28232E?95 Mif 0.805872116 9.844056396 436.030808 7.91233E?97 5.3075E?95 Rpl23a ?0.403001699 12.17600595 433.3491727 3.03352E?96 2.02644E?94 Lbr 0.95205731 9.432005712 432.6024105 4.4104E?96 2.93409E?94 Apitd1 0.909142965 9.168446716 428.856621 2.88234E?95 1.90967E?93 Hprt 0.783237884 9.584874345 428.8234294 2.93069E?95 1.93377E?93 Gpr132 ?1.004205471 9.86576297 428.4891485 3.46518E?95 2.27716E?93 Txn1 0.701081293 10.00315511 427.6708888 5.22182E?95 3.41765E?93 Dctpp1 1.094803772 9.308632593 425.8304762 1.31339E?94 8.56142E?93 Lsm6 0.903925819 9.407177719 421.4776028 1.16367E?93 7.55498E?92 Rnaseh2b 1.068717641 9.200404519 421.2669066 1.29327E?93 8.36282E?92 Gltscr2 ?0.679984369 10.29702999 420.75614 1.67057E?93 1.07595E?91 Rabac1 ?0.958867451 9.787137327 420.4818867 1.91672E?93 1.22959E?91 Fkbp2 1.050724632 9.308168075 420.4200596 1.97704E?93 1.26327E?91 Cks2 1.338981401 9.526677109 419.9007985 2.56471E?93 1.63233E?91 Rps13 ?0.378713374 11.92563194 414.2002714 4.46526E?92 2.8308E?90 Ifngr1 ?0.847815544 11.1133823 413.3409323 6.86908E?92 4.33772E?90 B2m ?0.355443938 12.79997004 412.3439791 1.13216E?91 7.12156E?90 Rps9 ?0.383350015 11.99561226 412.0841273 1.28964E?91 8.08074E?90 Cdca2 0.821439849 9.166105864 411.4821296 1.74384E?91 1.08845E?89 Dtl 1.106896693 9.18924485 411.1634528 2.04585E?91 1.27205E?89 Atp5f1 0.643350443 9.822922483 409.6484511 4.37169E?91 2.70777E?89 Ptpn18 ?0.758941589 10.23424984 409.0895315 5.78512E?91 3.56955E?89 Cdk4 0.985774613 9.357013312 408.7739438 6.77655E?91 4.16539E?89 Sumo2 0.540187794 10.26363646 405.7481332 3.08788E?90 1.89086E?88 Tmsb4x 0.414119715 14.2494783 405.2692031 3.92567E?90 2.39481E?88 Ndc80 0.962619823 9.175406644 404.1370231 6.92418E?90 4.20813E?88 Nme1 0.836072856 9.654201349 402.2147578 1.81473E?89 1.09876E?87 Ypel3 ?1.161475289 9.689654982 401.7638557 2.27493E?89 1.37226E?87 Exosc8 0.957856248 9.341378608 400.5883908 4.10062E?89 2.46434E?87 Jund ?1.055752186 11.83099851 400.4895616 4.30887E?89 2.5799E?87 Metap2 0.915717569 9.437531426 399.7303403 6.30429E?89 3.76071E?87 Akap13 ?0.793215709 10.30793282 398.3535435 1.25704E?88 7.47107E?87 Sdf2l1 0.994414931 9.406656647 396.5991925 3.02869E?88 1.79348E?86 Sapcd2 0.764844708 9.163945742 395.3862743 5.56287E?88 3.2821E?86 Lsm4 0.755115667 9.643812444 395.3395144 5.6948E?88 3.34771E?86 Gm9843 ?0.915259848 10.49271816 392.3295433 2.57476E?87 1.5081E?85 Rps21 ?0.62326269 10.92456287 390.9949889 5.02652E?87 2.93353E?85 Kif15 0.84331882 9.168692803 390.6634871 5.9352E?87 3.45139E?85 Ccne1 0.880144523 9.170524832 388.3596153 1.88362E?86 1.09142E?84 Cbx5 1.024894498 9.19230852 384.5739452 1.25648E?85 7.2544E?84 Rpl28 0.498102261 10.72710227 383.8744651 1.78419E?85 1.02645E?83 Hnrnpk 0.53146514 10.15656035 383.3645686 2.30383E?85 1.3207E?83 Psmb2 0.681940819 9.694383479 379.5347498 1.57128E?84 8.97573E?83 Cmc2 1.041743071 9.281104329 379.2509403 1.81152E?84 1.03116E?82 Spag5 0.706452348 9.163496664 374.1589094 2.3264E?83 1.3196E?81 Psat1 1.006005575 9.197437084 372.7504146 4.71356E?83 2.66432E?81 Poc1a 0.77141726 9.16662515 371.2310014 1.00964E?82 5.68707E?81 Nans 0.88765801 9.365818631 368.675622 3.63541E?82 2.04063E?80 Snrpb 0.57851806 9.840444383 365.151612 2.12744E?81 1.19004E?79 Ppih 0.980938815 9.212614072 363.5653328 4.71252E?81 2.62699E?79 Orai1 ?1.016728243 9.884536331 362.5648516 7.78216E?81 4.32325E?79 Hnrnpa1 0.775375728 9.626739462 362.0919788 9.86428E?81 5.46116E?79 H2-Q7 ?0.697290381 10.62132196 361.8112175 1.13553E?80 6.26519E?79 Rpl9 ?0.352804756 11.84254424 361.6211449 1.24907E?80 6.86818E?79 Actr3 0.58213293 10.23457831 361.0728975 1.64424E?80 9.01042E?79 Paics 1.00190604 9.271004075 360.0098018 2.80188E?80 1.53024E?78 Pa2g4 0.925734895 9.357958 359.9198753 2.9311E?80 1.59543E?78 Rfc2 1.00323133 9.292032711 359.229939 4.1425E?80 2.24724E?78 Atp5a1 0.627339286 9.818566382 358.8898969 4.91255E?80 2.65606E?78 Psmd13 0.861321347 9.383420226 358.355887 6.42077E?80 3.45994E?78 Rpl27a ?0.355187932 11.74011835 356.7387685 1.4445E?79 7.75805E?78 Gpsm2 0.900753226 9.172278225 356.3796708 1.72946E?79 9.25778E?78 Dck 0.997033102 9.191785175 356.3011689 1.79889E?79 9.59766E?78 Ssr2 0.86771444 9.385650464 355.9665601 2.12749E?79 1.13135E?77 Cmtm7 0.934755685 9.513680523 355.7956012 2.3179E?79 1.22856E?77 Ssrp1 0.866024797 9.399511454 355.7340231 2.39058E?79 1.26295E?77 Atp5j 0.57633364 9.979028433 355.6056347 2.54953E?79 1.34253E?77 E2f8 0.654183684 9.162243958 354.7642703 3.88751E?79 2.04044E?77 Gnai2 0.652274503 10.17405449 353.6515535 6.79163E?79 3.55318E?77 Lilr4b ?1.271690435 9.778014426 353.5422247 7.17432E?79 3.74129E?77 Pkmyt1 0.925729349 9.188417389 353.5314431 7.21321E?79 3.74948E?77 Slc3a2 ?0.909174492 10.08938712 352.8096247 1.03588E?78 5.36734E?77 Raly 0.620771468 9.75257472 352.2901969 1.34407E?78 6.94192E?77 Plk4 1.012850484 9.204610036 351.2839875 2.22605E?78 1.14606E?76 Ywhaq 0.759607883 9.638348777 350.7916279 2.84939E?78 1.46233E?76 Nhp2 0.965616532 9.336771458 347.9230005 1.20071E?77 6.14264E?76 Prdx4 0.95685906 9.185355071 347.3384828 1.60964E?77 8.20866E?76 Ttk 0.594320893 9.161194325 346.9284717 1.97705E?77 1.00506E?75 Ubald2 ?0.910108518 10.61959322 346.3238081 2.67728E?77 1.35677E?75 Cox7a2 0.563324176 9.911912802 346.1469211 2.9256E?77 1.47798E?75 Nup62 1.005454222 9.206164865 346.0910614 3.00871E?77 1.51523E?75 Cdk2 0.981233292 9.192856049 345.9266664 3.26723E?77 1.64031E?75 Haus4 0.985440832 9.208147658 345.7031703 3.6547E?77 1.82916E?75 Hells 1.087821722 9.221371755 344.8659781 5.56121E?77 2.77477E?75 Rps24 ?0.405347353 12.00637056 344.8094632 5.72106E?77 2.84574E?75 Tuba1c 1.190293172 9.28147513 343.4777414 1.11556E?76 5.53193E?75 Ect2 0.731575748 9.165310866 343.2551281 1.2473E?76 6.16632E?75 Chaf1b 0.954765111 9.189533469 343.1341221 1.32533E?76 6.53209E?75 Cotl1 0.615218959 10.46246128 341.9240189 2.4314E?76 1.19471E?74 Rps26 0.445540671 10.99491833 341.6432091 2.79905E?76 1.3712E?74 Capzb 0.553581167 10.15938328 340.7800705 4.31505E?76 2.10746E?74 Mrpl42 0.937339318 9.309229813 340.6852723 4.52513E?76 2.20341E?74 Il2rg ?0.835336928 10.13208397 338.9763865 1.0661E?75 5.17553E?74 4930579G24Rik 0.94917606 9.180623293 338.8571651 1.13178E?75 5.47794E?74 Junb ?0.943261022 11.88898263 336.5520948 3.59562E?75 1.73513E?73 Ncaph2 0.911927157 9.286995177 336.4469465 3.79031E?75 1.82363E?73 Emp3 0.793797327 9.865128415 334.8325828 8.51662E?75 4.08545E?73 Tnfaip3 ?0.949263973 10.12331381 334.7605728 8.82979E?75 4.22315E?73 Gimap3 ?0.902235267 9.895535563 334.5883792 9.62615E?75 4.59045E?73 Pgam1 0.94467201 9.352897068 334.0316833 1.27262E?74 6.05091E?73 Cenpp 0.638773234 9.162492986 333.9931832 1.29743E?74 6.15078E?73 Vim 0.855008339 10.47562831 333.5659031 1.60746E?74 7.59832E?73 Vdac1 0.887345388 9.320038733 332.2835275 3.058E?74 1.44127E?72 Psma4 0.770905394 9.544071463 331.5369072 4.44682E?74 2.08975E?72 Cdkn2a 1.028553278 9.187324767 331.0716756 5.61534E?74 2.63123E?72 Ncaph 0.74820308 9.167317127 328.5739561 1.9651E?73 9.18143E?72 Traf1 ?0.842403186 10.10488831 328.4463672 2.09495E?73 9.75992E?72 Neurl3 ?1.151353941 9.619302411 327.1367677 4.04028E?73 1.87687E?71 Vdac3 0.834505977 9.365333685 325.806207 7.87442E?73 3.6475E?71 Impdh2 0.851176704 9.378159405 325.6656739 8.44944E?73 3.90268E?71 Saraf ?0.801725651 10.21652778 324.5600821 1.47109E?72 6.77538E?71 Smc1a 0.940917599 9.298422522 323.9352535 2.01249E?72 9.24259E?71 Fdps 1.173461658 9.32579499 323.4946271 2.5102E?72 1.14957E?70 Foxm1 0.630168945 9.162231863 323.3252654 2.73274E?72 1.24795E?70 Rpl18 ?0.347893772 11.80722476 320.9543542 8.97477E?72 4.07545E?70 Pold2 0.971125766 9.227590909 320.9547906 8.9728E?72 4.07545E?70 Ubc ?0.807279913 11.04900464 319.2561808 2.1034E?71 9.52481E?70 1700097N02Rik 1.145940071 9.227500037 317.3504743 5.47057E?71 2.47031E?69 Rnf26 0.918800269 9.202614329 315.8383443 1.16793E?70 5.25928E?69 Brip1 0.682303488 9.163572773 315.4570916 1.41406E?70 6.3499E?69 Cd3g ?0.510882198 11.10863423 313.5489424 3.68235E?70 1.649E?68 Anxa2 0.921408878 9.843831779 313.1314335 4.54019E?70 2.02753E?68 Got1 ?1.503058838 9.856934685 312.1931746 7.26878E?70 3.23711E?68 Il7r ?1.159630154 9.752616304 312.1595397 7.39245E?70 3.27415E?68 Syce2 0.973513782 9.186518067 312.1627233 7.38066E?70 3.27415E?68 Ccr2 ?1.363324439 9.897377867 310.7556679 1.49489E?69 6.60282E?68 Tubb4b 0.985482027 9.441615817 310.1736737 2.00166E?69 8.81714E?68 Bard1 0.7156241 9.16703328 309.8750016 2.32517E?69 1.02143E?67 Rps28 ?0.497840868 11.70804915 309.4766684 2.83942E?69 1.24396E?67 Zfp367 0.842713939 9.17481005 309.4573584 2.86705E?69 1.25267E?67 H2-Q4 ?0.898731428 9.753196254 307.5382342 7.50776E?69 3.27144E?67 E2f7 0.613202567 9.162536468 307.1197385 9.26146E?69 4.02475E?67 Hjurp 0.991807601 9.227531733 306.0744122 1.56461E?68 6.78108E?67 Hat1 0.94341255 9.268309904 306.0270499 1.60222E?68 6.92554E?67 Ndufc2 0.713850984 9.498050133 305.8636729 1.73906E?68 7.49698E?67 Tpt1 ?0.370821499 11.78414713 303.762904 4.98859E?68 2.14483E?66

    TABLE-US-00026 TABLE 3J LPL-9 vs. All GeneSymbol logFC logCPM LR PValue FDR Vps37b ?3.362309366 10.60466024 553.5415461 2.1358E?122 3.4528E?118 Ubald2 ?3.004928151 10.62016629 523.2616369 8.2591E?116 6.6758E?112 Junb ?2.255821875 11.89138657 469.9759664 3.2434E?104 1.7478E?100 H3f3b ?1.178871544 12.34439093 430.2412867 1.44003E?95 5.81989E?92 Ifngr1 ?1.844725191 11.11290817 395.5179928 5.20745E?88 1.68367E?84 Bhlhe40 ?2.046123117 10.72362795 388.2228925 2.01724E?86 5.43512E?83 AW112010 1.174769842 11.38326993 356.4332675 1.68361E?79 3.88817E?76 Cd52 0.932440577 11.79358549 322.7676071 3.61464E?72 7.30427E?69 Tnfrsf4 ?2.757825477 10.62218143 315.7136553 1.24331E?70 2.23326E?67 Eif1 ?0.893416996 11.85895519 311.8836544 8.4896E?70 1.37243E?66 Odc1 ?2.920870292 10.45345646 304.1215933 4.16711E?68 6.12414E?65 Btg1 ?1.28118989 12.25019835 303.6088436 5.38941E?68 7.26043E?65 Tmsb4x 0.581187345 14.2491853 302.157629 1.1161E?67 1.38791E?64 Gramd3 ?2.802981311 10.20645101 301.2956029 1.71991E?67 1.986E?64 Hspa5 ?1.550719809 10.97847279 281.551035 3.44828E?63 3.71632E?60 Ctla4 ?2.513468645 10.15301427 272.2227397 3.71946E?61 3.75805E?58 Jund ?1.558244203 11.83437558 255.6988809 1.48623E?57 1.41332E?54 Dusp5 ?2.250898553 9.994499887 254.2297622 3.10702E?57 2.79045E?54 Pnrc1 ?1.500131777 10.57796425 251.0077589 1.56582E?56 1.33226E?53 Ifrd1 ?2.375646739 10.02595917 249.5366907 3.27677E?56 2.64861E?53 Prr7 ?2.75505733 9.824432052 249.3588408 3.58277E?56 2.75805E?53 Nfkbia ?1.99916409 10.83378406 242.998769 8.72683E?55 6.41263E?52 Pim1 ?1.845131276 10.82605822 235.7608354 3.3042E?53 2.32242E?50 Tnfaip3 ?1.895396718 10.1251933 218.6736324 1.76077E?49 1.18602E?46 Bcl2a1b ?1.652180963 10.39213885 216.7889935 4.53742E?49 2.93408E?46 Tgif1 ?2.501012681 9.720337198 214.475046 1.45073E?48 9.02017E?46 Icos ?1.845684668 10.25638736 210.0099268 1.36678E?47 8.1835E?45 Orai1 ?2.063220862 9.884609199 204.7883085 1.88354E?46 1.08748E?43 Il21r ?1.962235376 10.19623449 203.4843995 3.62652E?46 2.0216E?43 Crem ?2.638056333 10.0668258 197.6552503 6.78459E?45 3.65599E?42 Cd160 2.206995649 9.33477913 182.0716813 1.71042E?41 8.91955E?39 Cytip ?1.413213899 10.18835805 178.9512357 8.2113E?41 4.14824E?38 Btg2 ?1.410335764 10.53805397 177.5543337 1.6574E?40 8.11927E?38 Rgs2 ?2.460498875 10.05981908 172.6649968 1.937E?39 9.20988E?37 Gna13 ?1.697172725 9.985101538 171.227445 3.99104E?39 1.8434E?36 Ramp3 ?3.194515909 9.93665422 169.8774295 7.86932E?39 3.53376E?36 Gpr132 ?1.680424877 9.866138363 162.2711639 3.6095E?37 1.57706E?34 Rsrp1 0.967312622 10.002844 155.2107284 1.25934E?35 5.3575E?33 Hspa8 ?0.8840235 12.33059378 150.107401 1.64242E?34 6.80805E?32 Kdm6b ?2.430981026 9.740743634 147.7492684 5.38196E?34 2.17512E?31 Dnaja1 ?1.426863641 10.76378984 144.5283367 2.7232E?33 1.07374E?30 Tbc1d10c 1.212453764 9.522701275 142.6216867 7.11128E?33 2.73717E?30 Traf1 ?1.340039639 10.10523686 141.5244384 1.23557E?32 4.64516E?30 Got1 ?2.192776394 9.85564432 140.3055035 2.28248E?32 8.38605E?30 Serpinb9 ?2.267244697 9.858124549 138.1940714 6.60916E?32 2.3743E?29 Tnfsf8 ?2.583712667 10.01779871 137.396967 9.87356E?32 3.46991E?29 Arf4 ?1.368873021 9.97476194 135.071322 3.18519E?31 1.09557E?28 Dgat1 ?2.031965751 9.778611253 134.2108859 4.91298E?31 1.65465E?28 Fosl2 ?2.219055063 9.531543255 133.6905648 6.38502E?31 2.10654E?28 Sub1 ?0.8321836 11.1487442 132.4885171 1.16981E?30 3.78224E?28 Lmnb1 ?1.713264533 9.781458041 132.1686548 1.37433E?30 4.35636E?28 Nr4a1 ?2.090701396 9.630029378 131.7109619 1.73069E?30 5.38046E?28 Pde4b ?1.764328126 9.658595001 130.8028443 2.73461E?30 8.34108E?28 Srgn ?0.731632739 11.37077253 128.7034672 7.87464E?30 2.35744E?27 Rora ?1.510772327 9.982441992 126.5708186 2.30623E?29 6.77865E?27 Nr4a2 ?2.221776331 9.521329297 124.4447829 6.73268E?29 1.94358E?26 Zc3h12a ?1.897723673 9.536850747 123.5261202 1.06969E?28 3.03379E?26 Ctsw 0.930564149 9.943520924 123.4280412 1.12389E?28 3.13256E?26 Cd48 1.086641614 9.721154005 122.8259103 1.52237E?28 4.1713E?26 Itm2b 0.58610183 10.97660085 122.7037866 1.61902E?28 4.36218E?26 Cd28 ?1.127738832 10.3795945 122.4420043 1.84737E?28 4.89584E?26 Nfkbiz ?1.840698584 9.633469169 122.3528469 1.93228E?28 5.03827E?26 Samsn1 ?1.744732813 9.795351469 121.9802503 2.33147E?28 5.98263E?26 Itgae 1.72002363 9.275517599 121.8280393 2.51738E?28 6.35875E?26 Rnf125 ?1.773543349 9.561296235 121.7912041 2.56456E?28 6.37825E?26 Hif1a ?1.505670523 9.774250056 119.7969403 7.00793E?28 1.71652E?25 Slc3a2 ?1.234943945 10.08971534 118.3977452 1.41883E?27 3.42341E?25 Cd7 1.838925955 9.494193586 117.2006182 2.59451E?27 6.16805E?25 Hilpda ?1.952428815 9.667484361 116.4590431 3.77087E?27 8.83476E?25 Gpr183 ?1.695171481 9.68048749 114.4391392 1.04422E?26 2.41156E?24 Hsp90aa1 ?1.439535496 10.76840824 113.1243036 2.02663E?26 4.61443E?24 Ubb ?0.634972292 12.9047583 113.0579016 2.09565E?26 4.70531E?24 Ptp4a1 ?1.480320602 9.696547191 111.6659421 4.22885E?26 9.36488E?24 Sash3 1.316630069 9.280817169 109.2523432 1.42887E?25 3.12149E?23 Coro1a 0.627749664 10.77296532 106.2309167 6.56248E?25 1.41452E?22 Actb 0.907502265 13.40512845 105.5259815 9.36618E?25 1.99228E?22 Ddx5 ?0.644534498 11.19926646 104.0441527 1.97857E?24 4.15398E?22 Cdkn1a ?1.967048903 9.693214366 103.6652262 2.39559E?24 4.96502E?22 Cnn2 0.823207984 9.902895339 100.8167278 1.00901E?23 2.06476E?21 Lmna ?2.182044064 9.713552635 99.72532929 1.75068E?23 3.53768E?21 Arhgap31 ?1.622267935 9.6544108 96.82563034 7.57097E?23 1.51102E?20 Xist ?2.484105042 9.888219824 96.72908307 7.9493E?23 1.56717E?20 Hspe1 ?1.341804559 10.27526821 96.08881383 1.09844E?22 2.13944E?20 Abi3 1.306134092 9.334710046 95.69364832 1.3411E?22 2.58098E?20 Rrad ?1.921524767 9.540636021 95.48107352 1.49312E?22 2.83974E?20 H2afz ?0.974226952 10.76535167 93.52885095 4.00322E?22 7.52513E?20 P2ry10 ?1.511318756 9.588153587 92.98229741 5.27642E?22 9.80443E?20 Mxd1 ?1.609829978 9.600690864 92.34661385 7.27504E?22 1.33646E?19 Bcl2a1d ?1.24869947 9.947927963 91.96777364 8.80995E?22 1.60024E?19 Prdx6 ?0.967912422 10.1972206 91.5415933 1.09271E?21 1.96275E?19 Lilr4b ?1.440483077 9.778164612 91.48947472 1.12187E?21 1.99299E?19 Fam110a ?1.679558179 9.494286279 90.86306193 1.53967E?21 2.70547E?19 Hsp90ab1 ?0.858760511 11.19689045 90.06409284 2.30568E?21 4.00792E?19 Coq10b ?1.53671868 9.509959599 88.75880416 4.46008E?21 7.67039E?19 Cd38 1.313844577 9.272488233 88.58034841 4.88114E?21 8.30616E?19 Neurl3 ?1.473553701 9.619697122 88.3936069 5.36439E?21 9.03341E?19 Fth1 ?0.567457067 11.58469958 86.84849168 1.17161E?20 1.95261E?18 Akap13 ?0.848619293 10.30887901 86.79463258 1.20396E?20 1.98604E?18 Il4ra ?1.582100662 9.499604335 86.17634412 1.64585E?20 2.68755E?18 Satb1 ?1.408753663 9.757012703 85.69752921 2.09675E?20 3.3896E?18 Dusp1 ?1.530840947 9.939629974 85.67286338 2.12307E?20 3.39817E?18 Srsf5 ?0.903198748 10.09111839 85.09898727 2.83796E?20 4.49789E?18 Cd3g 0.471720583 11.10947799 84.99935977 2.98462E?20 4.6844E?18 Ubc ?0.779495031 11.05009877 84.31851779 4.21152E?20 6.54648E?18 Rac2 0.462122743 11.09605968 84.20990673 4.44936E?20 6.85031E?18 Sh2d3c 1.218788569 9.19941797 83.84734452 5.34493E?20 8.15153E?18 Ppp1cc ?0.923264626 10.14021217 83.69132112 5.78386E?20 8.73849E?18 Ppp1r15a ?1.499647208 9.595479955 82.25975518 1.19327E?19 1.77601E?17 Emb ?1.047852737 10.25090288 82.25279597 1.19748E?19 1.77601E?17 Socs3 ?1.700674574 9.492344664 81.83481982 1.47949E?19 2.17431E?17 Tnfrsf18 ?1.027239187 10.0676873 81.19430596 2.04581E?19 2.9795E?17 Itk ?1.164677422 9.814304773 81.05650718 2.19355E?19 3.16615E?17 Gch1 ?1.625035979 9.459439724 80.85130967 2.43357E?19 3.48151E?17 Rgcc ?2.013100019 9.563703364 80.57143357 2.80384E?19 3.97604E?17 Sp100 0.923940711 9.553726962 80.47733171 2.94059E?19 4.1337E?17 Herpud1 ?1.409570605 9.555337805 80.10733411 3.54614E?19 4.94197E?17 1810041H14Rik 1.354825414 9.21120969 79.71596422 4.32294E?19 5.97304E?17 Susd3 1.085969427 9.369960996 79.55560648 4.68843E?19 6.42314E?17 Rinl 0.974544852 9.448193104 79.53459661 4.73855E?19 6.43726E?17 Ube2s ?0.993765017 10.00293497 78.4765122 8.09551E?19 1.0906E?16 Dusp10 ?1.717465499 9.475523882 78.16195183 9.49295E?19 1.26829E?16 Cd3e 0.58619296 10.374978 77.43783083 1.36966E?18 1.81492E?16 Furin ?1.321937592 10.38150283 77.13934464 1.59312E?18 2.07696E?16 Gadd45b ?1.537760322 9.727376493 77.14809203 1.58608E?18 2.07696E?16 Rnf157 ?1.556704338 9.351515537 75.91210474 2.96576E?18 3.83556E?16 Rel ?1.541336876 9.441996052 75.09801289 4.47917E?18 5.74684E?16 Fosb ?1.833251464 9.410902867 74.90950785 4.92791E?18 6.2728E?16 Nfkb2 ?1.351023559 9.521792478 74.24075671 6.91478E?18 8.73316E?16 Mbnl1 0.718281043 9.849977707 73.3013403 1.11292E?17 1.39469E?15 Csrnp1 ?1.52260673 9.467509493 72.98524101 1.30623E?17 1.62435E?15 Kdm2b ?1.451262627 9.446694828 72.83509919 1.40948E?17 1.73936E?15 Vgll4 ?1.268334583 9.732088334 72.19282088 1.95164E?17 2.39017E?15 Sqstm1 ?1.19547316 9.660274476 72.16222124 1.98214E?17 2.40927E?15 Ptpn7 1.086828727 9.307714169 70.44758814 4.72659E?17 5.70224E?15 Ptprcap 0.6964048 10.04011854 70.09358467 5.65566E?17 6.77255E?15 Fasl ?1.316167045 9.594289128 69.62504673 7.17204E?17 8.52523E?15 Gzma 1.647822529 10.7255561 69.16497394 9.05622E?17 1.06863E?14 Dnajb6 ?0.842670368 10.02350611 69.03232018 9.6863E?17 1.1347E?14 Ctsd 0.815625996 9.641722886 68.78729408 1.09677E?16 1.27557E?14 Twf2 0.959303046 9.389086426 68.65428397 1.1733E?16 1.35482E?14 Dnajb1 ?1.76825082 10.3180278 68.14703578 1.51747E?16 1.73982E?14 Arhgdib 0.495735889 10.73174892 67.9987325 1.63601E?16 1.86251E?14 D16Ertd472e ?1.176485153 9.623998584 67.7530717 1.85308E?16 2.09489E?14 Maff ?1.470538345 9.30528636 67.54649177 2.05777E?16 2.31013E?14 Arid5a ?1.145208968 9.656952379 67.29570725 2.3369E?16 2.6054E?14 Bcl11b 0.918496067 9.518633779 67.04751294 2.65042E?16 2.9347E?14 Lcp1 0.582999991 10.29118475 66.78424301 3.0291E?16 3.33118E?14 Gm12840 ?1.432116469 10.16273225 65.97236177 4.57291E?16 4.99497E?14 Ifnar1 ?1.245408007 9.536369908 65.79959531 4.99185E?16 5.41599E?14 Ccr9 1.552636581 9.278717469 65.07952837 7.19355E?16 7.75273E?14 Rbm39 ?0.54358267 10.68058111 64.55664829 9.37965E?16 1.00418E?13 Cfl1 0.413893348 11.1128037 64.18560915 1.13233E?15 1.20429E?13 Cd226 1.090319319 9.268603322 63.99459494 1.24761E?15 1.31823E?13 Nmrk1 ?1.462700729 9.470715907 63.44007075 1.65321E?15 1.73544E?13 Ptp4a2 ?0.807378816 9.957611547 61.91530565 3.58552E?15 3.73958E?13 Ppp1r18 0.785511357 9.553224076 60.76888267 6.41845E?15 6.65132E?13 Clk1 ?0.958741139 9.766510063 60.56036792 7.13563E?15 7.34742E?13 Peli1 1.000856627 9.756264686 60.39582424 7.75774E?15 7.93744E?13 Ndfip1 ?1.004103122 9.657936964 59.4305111 1.2669E?14 1.28809E?12 Atp5l 0.440049168 10.47763691 59.3617818 1.31192E?14 1.32553E?12 Tsc22d4 0.825276707 9.491104749 59.08944213 1.50665E?14 1.51283E?12 H2-Q7 ?0.595713074 10.6209645 59.05974548 1.52957E?14 1.52636E?12 Hmgb2 ?0.75986792 10.71114671 58.85699736 1.69558E?14 1.68164E?12 Tgif2 ?1.215191779 9.272991879 58.66690328 1.86757E?14 1.84092E?12 Ms4a4b 0.546195203 10.75186324 58.63792834 1.89527E?14 1.85691E?12 Dennd4a ?1.326848682 9.353141394 57.78339494 2.9263E?14 2.84979E?12 4930523C07Rik ?0.909932353 9.830309453 57.35236731 3.64325E?14 3.52675E?12 Med10 0.841244026 9.430585613 57.27171139 3.79576E?14 3.65251E?12 Nfkbie ?1.310554368 9.398336132 56.89961293 4.58636E?14 4.36616E?12 Gimap4 0.496815742 10.52507831 56.89744873 4.59141E?14 4.36616E?12 Ier2 ?0.975482231 9.828762331 56.8735566 4.64753E?14 4.39369E?12 Relb ?1.186985542 9.473479165 56.23204924 6.44031E?14 6.05315E?12 Nkg7 0.586133805 11.21029847 56.16392406 6.66737E?14 6.23033E?12 Gabpb1 ?1.283624775 9.477984036 55.60889581 8.84226E?14 8.21517E?12 Ninj1 ?1.261893918 9.366255933 54.08307596 1.9219E?13 1.77539E?11 Tpt1 ?0.325215434 11.78327961 53.9762298 2.0293E?13 1.86396E?11 Actn2 0.965714565 9.563403652 53.92498431 2.08292E?13 1.9024E?11 Lsp1 0.535349746 10.32145964 53.76099128 2.26424E?13 2.05639E?11 Rnf166 0.864754523 9.39636208 53.53747986 2.53706E?13 2.29129E?11 Tnfrsf1b ?1.199287429 9.452787431 53.05790689 3.23859E?13 2.90861E?11 Ptma ?0.475826165 11.28813239 52.50547005 4.29052E?13 3.83207E?11 Lck 0.468090608 10.31669256 51.95127581 5.68951E?13 5.02604E?11 Calm2 ?0.601880603 10.41348638 51.95191835 5.68765E?13 5.02604E?11 3830406C13Rik 0.90926778 9.301772413 51.17445011 8.45115E?13 7.42507E?11 Asb2 0.928426346 9.480791591 50.85879632 9.92555E?13 8.67332E?11 Hmha1 0.652669475 9.750300427 50.06435076 1.48786E?12 1.29316E?10 Hspd1 ?1.069494786 9.781010215 49.88364348 1.63139E?12 1.41032E?10 Areg ?1.923385968 9.386120367 49.80905363 1.6946E?12 1.45718E?10 Apol9b 0.886455736 9.167676629 49.50417242 1.9795E?12 1.69316E?10 Psmb8 0.434299989 10.43462791 49.35929888 2.13122E?12 1.81333E?10 Dok1 0.955105997 9.246169552 48.3539275 3.55831E?12 3.01171E?10 Tnfsf11 ?1.406891552 9.546989381 48.2925552 3.67143E?12 3.09127E?10 Traf4 ?1.236074371 9.35979803 48.17646755 3.89535E?12 3.26281E?10 Lilrb4a ?1.08433259 9.64690885 47.98172583 4.3021E?12 3.58494E?10 Ogt 0.704006931 9.590260945 47.88727385 4.51442E?12 3.74257E?10 Cks2 ?1.25825363 9.525654391 47.68150363 5.014E?12 4.13553E?10 Sh3bgrl3 0.360547616 11.2447853 47.53739765 5.39646E?12 4.40602E?10 Abracl 0.55270054 9.935287369 47.53825866 5.39409E?12 4.40602E?10 Tnfrsf9 ?1.42773064 9.401976428 47.34661806 5.94807E?12 4.83198E?10 Gm8369 ?0.832266542 9.924762802 47.22681655 6.32294E?12 5.11084E?10 Pelo 0.94676423 9.234996852 47.03540285 6.9716E?12 5.60711E?10 Cnbp ?0.563596949 10.25781838 46.92285364 7.38367E?12 5.90913E?10 Il2rg ?0.677940365 10.13360006 46.75705615 8.03551E?12 6.39912E?10 Ccl5 0.919582539 13.31121661 46.4956193 9.18235E?12 7.27656E?10 Tob1 ?1.175037157 9.420105584 46.44658961 9.41501E?12 7.42454E?10 Nrip1 ?1.112584475 9.582654591 46.21144382 1.06155E?11 8.3306E?10 Wdr1 0.693500318 9.566573023 45.91086687 1.23758E?11 9.66505E?10 Arhgap30 0.83146301 9.369684229 45.82771058 1.29124E?11 1.00357E?09 Ctsa 0.775835324 9.447143126 45.51061925 1.51814E?11 1.17427E?09 Cd2 ?0.606370172 10.31972667 45.00764771 1.96266E?11 1.51088E?09 Sh2d2a ?0.818274264 9.846355515 44.79805531 2.1844E?11 1.6736E?09 Cdc42 0.401636828 10.40470796 44.76997118 2.21595E?11 1.68977E?09 Pfn1 0.349264905 12.14557694 44.61396337 2.39974E?11 1.82132E?09 Batf ?0.991153728 9.653675216 44.57301579 2.45046E?11 1.85113E?09 Ptpn22 ?0.694250299 10.09364713 44.48055916 2.56896E?11 1.93162E?09 Nhp2l1 ?0.775628966 9.714941638 44.38193943 2.70168E?11 2.02201E?09 Uhrf2 ?1.094311266 9.55449696 44.32834676 2.77666E?11 2.06855E?09 Ets1 ?0.570424212 10.24999257 44.24122854 2.90302E?11 2.15276E?09 Snx18 ?1.132431204 9.331532268 43.86391069 3.5202E?11 2.59852E?09 Mfsd6 ?1.152082823 9.369452083 43.78578375 3.66357E?11 2.69205E?09 H2-D1 ?0.274687932 12.28188438 43.52350373 4.18898E?11 3.06421E?09 Kpna1 ?1.137981458 9.374079051 43.41627872 4.42492E?11 3.22222E?09 Marcksl1 ?1.285775771 9.352433315 43.24937144 4.81892E?11 3.4934E?09 Thy1 0.455287107 10.28931692 43.22676676 4.87492E?11 3.51821E?09 Adam19 0.923901938 9.250780528 43.19470424 4.95546E?11 3.56044E?09 Socs1 ?1.195444572 9.398296399 43.16486195 5.03162E?11 3.59917E?09 Lin54 ?1.157900026 9.319410902 43.10713832 5.18228E?11 3.69061E?09 Cd3d 0.395146119 10.55258599 42.83010569 5.97062E?11 4.23338E?09 Dbnl 0.782581322 9.387216148 42.72872524 6.28821E?11 4.43909E?09 Hsph1 ?1.264161017 9.472504163 42.69129717 6.40968E?11 4.50517E?09 Gm26917 0.710657091 9.523381771 42.21037434 8.19641E?11 5.73606E?09 Fam78a 0.879213037 9.208952851 42.13614851 8.51348E?11 5.93228E?09 Dtx1 1.008504624 9.250253022 41.95903475 9.32057E?11 6.4668E?09 Mxi1 ?1.116673492 9.308242179 41.93517845 9.43498E?11 6.5182E?09 Nfkbid ?1.315772495 9.347313622 41.7580944 1.03294E?10 7.10573E?09 Klrc1 ?1.210105703 9.658447581 41.54879294 1.14965E?10 7.8419E?09 Epsti1 0.569607008 9.946045371 41.54967136 1.14914E?10 7.8419E?09 Dnajb9 ?1.084099427 9.393349046 41.13548499 1.42034E?10 9.64758E?09 Il2rb ?0.831902894 9.64634325 41.07264289 1.46675E?10 9.92112E?09 Mob3a 0.890516107 9.226348924 40.98635141 1.53296E?10 1.03258E?08 H2-K1 ?0.346494479 11.60996193 40.85004492 1.64369E?10 1.10257E?08 Ifi47 0.925508886 9.281723133 40.83337968 1.65777E?10 1.10742E?08 Nr4a3 ?1.021483749 9.253608924 40.74894056 1.73097E?10 1.15156E?08 Wdr89 ?0.670857344 10.42583197 40.62234323 1.84683E?10 1.2236E?08 Cirbp ?0.732767081 9.8218496 40.59128835 1.87641E?10 1.23813E?08 Gm8797 ?1.072905955 9.417561025 40.31410487 2.16242E?10 1.42104E?08 Ier5 ?0.886024309 9.710443697 40.1094026 2.4013E?10 1.5558E?08 Slc38a2 ?1.010291571 9.471424004 40.10955303 2.40112E?10 1.5558E?08 Slc25a3 ?0.627950281 9.94947131 40.12853795 2.3779E?10 1.5558E?08 Frmd8 0.859836984 9.275205329 40.1056034 2.40598E?10 1.5558E?08 Eif5 ?0.72406162 9.823473225 40.07275715 2.44678E?10 1.57588E?08 Apol9a 0.608753389 9.161172914 39.95832528 2.59439E?10 1.66432E?08 Adora2a ?1.033716215 9.426688183 39.33091525 3.57732E?10 2.28581E?08 Cxcl10 ?1.475883536 9.358322387 39.21145346 3.80303E?10 2.42046E?08 Arhgef1 0.598116191 9.623554673 39.19793239 3.82946E?10 2.42772E?08 Gpx4 ?0.613696802 10.07608511 38.75438539 4.80629E?10 3.0351E?08 Ncl ?0.572951664 10.07277318 38.52684203 5.40058E?10 3.39711E?08 Lamtor4 0.793961983 9.330433333 38.50931949 5.44928E?10 3.41446E?08 Fus ?0.642585145 9.89936241 38.25000659 6.22369E?10 3.88464E?08 Plscr1 ?1.051442773 9.521572279 38.16059915 6.51549E?10 4.05113E?08 Tob2 ?1.094490521 9.437073308 38.07654006 6.80231E?10 4.21326E?08 Zeb1 ?1.072949092 9.369008588 37.96671919 7.19617E?10 4.4402E?08 Vcpkmt ?0.961449373 9.468530603 37.90218253 7.4382E?10 4.57209E?08

    TABLE-US-00027 TABLE 3K LPL-10 vs. All GeneSymbol logFC logCPM LR PValue FDR Rps19 1.281201651 12.57926737 1233.273109 3.5827E?270 5.7917E?266 Rpl13 0.956829763 12.63772111 932.1398479 1.0119E?204 8.1792E?201 Rps18 0.920425672 12.47331244 739.6396686 7.1801E?163 3.8691E?159 Rpl32 0.868196367 12.44732277 680.1448306 6.2148E?150 2.5117E?146 Rps5 0.864582146 12.08884438 644.630062 3.2883E?142 1.0632E?138 Rps6 0.816445317 12.20836226 632.6674576 1.3142E?139 3.541E?136 Rps7 0.842852102 11.94308668 536.7798374 9.4618E?119 2.1851E?115 Rpl18a 0.690080812 12.84274248 470.7611511 2.1885E?104 4.4223E?101 Rpl14 0.747724362 11.87702392 412.2337163 1.19648E?91 2.14915E?88 Rplp0 0.729699393 12.38772174 401.1684565 3.06604E?89 4.95655E?86 Rps24 0.773043225 12.00582011 392.5932715 2.25592E?87 3.31538E?84 Rps29 0.813133225 12.24466527 380.4817947 9.77388E?85 1.3167E?81 Rpl23a 0.692286262 12.17553899 378.2544662 2.98534E?84 3.71238E?81 Rps4x 0.707695218 11.84790603 373.5198856 3.20491E?83 3.70075E?80 Rpl17 0.660157187 12.2966186 372.0304773 6.76238E?83 7.28804E?80 Rpl36a 0.941421878 11.04525672 352.1534326 1.43947E?78 1.45441E?75 Rps23 0.623074475 12.4852828 341.6130126 2.84176E?76 2.70235E?73 Rps27 0.711451235 13.23490481 297.9212211 9.347E?67 8.39465E?64 Rpl8 0.670651545 11.65215182 292.7571918 1.24681E?65 1.06083E?62 Rplp1 0.718154214 11.70321268 282.5577797 2.08075E?63 1.68187E?60 Rpl12 0.895952737 10.99231792 280.8502016 4.90144E?63 3.77317E?60 Rps14 0.541088503 12.65498313 275.4661899 7.305E?62 5.36785E?59 Rps16 0.581596764 12.35137902 275.2382377 8.19027E?62 5.75669E?59 Rpl35 0.847849209 11.18855297 272.1039925 3.94784E?61 2.6592E?58 Rps28 0.805119029 11.70739869 270.4060205 9.25591E?61 5.98524E?58 Rpl21 0.642166954 11.76870634 267.6073941 3.7703E?60 2.34426E?57 Rps15a 0.579920698 12.40379231 264.5275077 1.76872E?59 1.05901E?56 Rpl39 0.66324467 11.77723605 263.6273811 2.77878E?59 1.60435E?56 Rps20 0.841150732 11.06847766 256.9273917 8.02207E?58 4.47189E?55 Rpl9 0.584342695 11.84222479 253.9094837 3.64891E?57 1.96627E?54 Rpl3 0.564967956 12.09251912 252.5140514 7.35131E?57 3.83359E?54 Ly6c1 1.974532568 9.165759038 248.5554636 5.36247E?56 2.70906E?53 Rps3 0.53410579 11.96702894 245.5972451 2.36763E?55 1.15985E?52 Rpl4 0.586800423 11.68895541 240.4754949 3.09761E?54 1.47282E?51 Ccr7 3.247817647 9.273084775 237.8112414 1.18022E?53 5.45125E?51 Rps9 0.555129117 11.99535989 227.9727216 1.64993E?51 7.40912E?49 Rpl26 0.591538476 11.57420337 217.9166055 2.57534E?49 1.12522E?46 Rps27a 0.556559308 11.8096941 212.0951987 4.79472E?48 2.03978E?45 Tmsb4x ?0.655091827 14.24919003 211.3022905 7.1408E?48 2.95995E?45 Rpl36 0.577559407 11.87411097 210.065659 1.32905E?47 5.37135E?45 Rplp2 0.596131806 11.91002396 208.3252794 3.18603E?47 1.25623E?44 S100a11 ?1.433669212 10.60258364 205.4071252 1.38023E?46 5.31259E?44 Rpl6 0.529407428 11.76076159 198.9458691 3.54707E?45 1.33353E?42 Rpl18 0.538143421 11.80687322 196.9817355 9.5172E?45 3.49671E?42 Rps2 0.652273398 11.63559296 194.8719464 2.74764E?44 9.87073E?42 Rpl10a 0.66732504 11.14212246 193.7961454 4.71798E?44 1.65806E?41 Rpl35a 0.546906986 11.7233953 192.9272701 7.30123E?44 2.51131E?41 Rps8 0.598624386 11.59252824 191.8021972 1.28517E?43 4.32834E?41 Rps13 0.504165936 11.92517909 186.704 1.66651E?42 5.49814E?40 Rpl29 0.634590575 11.21422123 182.0989711 1.68711E?41 5.45477E?39 Itm2b ?1.023345124 10.97660039 180.2597916 4.25302E?41 1.34812E?38 Furin ?2.579368689 10.38147822 173.642262 1.18497E?39 3.6839E?37 Rpl23 0.549575844 11.7085398 172.2636291 2.37021E?39 7.22957E?37 Igfbp4 1.65428633 9.162779494 171.5038314 3.47315E?39 1.03976E?36 Rpl37 0.48788775 12.07299733 169.5722666 9.17463E?39 2.69667E?36 Rps12 0.770181053 10.7705244 169.292508 1.05607E?38 3.04864E?36 Bcl2 1.810831323 9.436811299 163.9128841 1.58049E?37 4.4825E?35 Rpl37a 0.48494208 12.61560851 162.7899384 2.78043E?37 7.74973E?35 Rpl11 0.478674092 11.70900459 162.7464873 2.84187E?37 7.78673E?35 Rps15 0.534372575 11.49069149 155.5644172 1.05403E?35 2.83991E?33 Myl12a ?0.974884236 10.67826813 148.713865 3.31197E?34 8.77726E?32 Rpl19 0.420544487 12.11744557 144.6242094 2.59489E?33 6.76596E?31 Rpl27a 0.46078461 11.73981721 144.0432932 3.47637E?33 8.92046E?31 Cxcr6 ?1.698970736 10.38992851 137.7218948 8.38322E?32 2.11755E?29 Rps26 0.623715151 10.99395953 136.8502614 1.3003E?31 3.23394E?29 Rps3a1 0.456678197 11.6738534 132.4041137 1.22062E?30 2.98978E?28 S100a10 ?0.999677972 10.93991354 132.1604121 1.38005E?30 3.32983E?28 Rpl24 0.455232205 11.7722356 130.7827582 2.76242E?30 6.56725E?28 Eef1g 0.710194382 10.38511305 129.8469723 4.42619E?30 1.03701E?27 Malat1 ?0.868303233 14.66863653 121.7575723 2.6084E?28 6.02392E?26 Ubb ?0.762236847 12.90475161 121.6648746 2.73317E?28 6.22316E?26 Klf2 1.82007794 9.96085156 120.599792 4.67547E?28 1.04977E?25 Lmnb1 ?1.740434723 9.781467143 118.6227432 1.26668E?27 2.80509E?25 Rora ?1.598997856 9.982434473 118.1357505 1.61918E?27 3.53726E?25 Ly6c2 2.908662907 9.26599066 116.5377425 3.62416E?27 7.81176E?25 Rgs1 ?1.547472527 11.08991268 116.1402089 4.42854E?27 9.41997E?25 Lgals3 ?2.134870543 10.20014079 115.7963321 5.26703E?27 1.1058E?24 Rps11 0.40051847 12.26303456 114.4072626 1.06115E?26 2.19929E?24 Nkg7 ?1.20400333 11.21028082 113.5760073 1.61375E?26 3.30227E?24 Actg1 ?0.766856598 12.09916335 113.4831269 1.69114E?26 3.41738E?24 Rps21 0.618883175 10.92367777 112.720221 2.48475E?26 4.95908E?24 Rpl34 0.391798461 11.98010954 112.6674999 2.55171E?26 5.0306E?24 Hspa5 ?0.993664741 10.97848639 111.8802176 3.79563E?26 7.3928E?24 Rpl5 0.611265768 10.56748783 107.8963541 2.83208E?25 5.4504E?23 Ms4a4c 1.513771908 9.182808698 106.6293484 5.36724E?25 1.02079E?22 AW112010 ?0.988007877 11.38325918 105.2605754 1.07086E?24 2.01296E?22 Gm9493 0.730569756 10.33344069 103.3639123 2.78909E?24 5.18258E?22 Eef1b2 0.731249225 10.07534778 102.783618 3.73828E?24 6.86739E?22 Satb1 1.098437345 9.757020312 97.00843642 6.90326E?23 1.25391E?20 Bcl2a1b ?1.109097656 10.392145 96.86778072 7.4115E?23 1.33127E?20 H2-D1 ?0.456289267 12.28188836 94.13284731 2.95042E?22 5.24138E?20 Rpl15 0.533360835 10.73579 93.09133191 4.9936E?22 8.77462E?20 Id2 ?1.265718013 10.64562852 92.85856673 5.61682E?22 9.73731E?20 Rpsa 0.43236632 11.60003186 92.84273602 5.66193E?22 9.73731E?20 Actn2 ?2.0324523 9.563395975 91.91238307 9.06003E?22 1.54173E?19 Hmgb2 ?1.114787643 10.71118457 91.81149284 9.53391E?22 1.60547E?19 Sub1 ?0.737071501 11.14875127 89.22633202 3.52131E?21 5.8686E?19 Rps10 0.438097308 11.22174231 88.54528471 4.96844E?21 8.19589E?19 Npm1 0.597146323 10.46909627 86.76885919 1.21975E?20 1.99177E?18 Prr13 ?0.908211922 10.23791505 86.28709705 1.55621E?20 2.51576E?18 Fau 0.332341064 12.3016547 85.91336849 1.87994E?20 3.00901E?18 Rps25 0.439065454 11.11865132 83.92930223 5.12788E?20 8.12719E?18 H3f3b ?0.530510549 12.34438324 81.79231815 1.51165E?19 2.37256E?17 Gm8730 0.630359335 10.44458017 81.7380171 1.55376E?19 2.4152E?17 Hsp90aa1 ?1.362572556 10.76842184 81.57324402 1.68885E?19 2.60019E?17 Rpl38 0.406994752 11.67453348 81.35408494 1.88691E?19 2.87772E?17 Eef1a1 0.337289144 12.38172177 81.20495197 2.03481E?19 3.07428E?17 Gzma ?3.37552039 10.72559232 80.50608545 2.89811E?19 4.33804E?17 Asb2 ?1.791797421 9.480787244 79.5436343 4.71692E?19 6.99576E?17 Rpl13a 0.303669712 13.13151966 77.74308062 1.17354E?18 1.72467E?16 Srgn ?0.611233479 11.37079235 76.8364188 1.85721E?18 2.70483E?16 Cd3g ?0.586508979 11.10946418 76.75229222 1.93803E?18 2.79734E?16 Glrx ?1.532798827 9.565798465 76.67665283 2.0137E?18 2.88084E?16 Ehd1 ?1.565102367 9.471456532 75.11001307 4.45203E?18 6.31329E?16 Cldnd1 ?1.473759599 9.794845581 73.58230211 9.65263E?18 1.35691E?15 Lef1 1.198869799 9.289435172 73.37527093 1.07201E?17 1.49397E?15 Lsp1 ?0.866196977 10.32146081 73.35557179 1.08276E?17 1.49606E?15 S1pr1 1.292942181 9.290336532 73.11132504 1.22539E?17 1.67879E?15 Rpl41 0.279576202 12.79518827 72.94991104 1.32982E?17 1.80655E?15 Lgals1 ?0.901478041 11.62752559 72.79719209 1.43681E?17 1.93562E?15 Bcl2a1d ?1.192576834 9.947930815 72.58098997 1.60316E?17 2.14187E?15 Gnas ?0.711696987 10.37731863 72.1045167 2.04096E?17 2.70444E?15 Dnaja1 ?1.075977432 10.76377534 70.94687086 3.66975E?17 4.82319E?15 Cfl1 ?0.562064217 11.11281134 70.41556668 4.80393E?17 6.26294E?15 Lat ?0.633486956 10.61718655 69.93751294 6.12132E?17 7.91658E?15 Pfn1 ?0.565983596 12.1455777 69.90284732 6.22985E?17 7.99299E?15 Dusp10 1.197430185 9.475524966 67.83386892 1.77868E?16 2.2641E?14 Ppp1ca ?0.731462957 10.29792302 66.3498649 3.77585E?16 4.76878E?14 Sidt1 1.119553649 9.182427708 66.2912716 3.88977E?16 4.87458E?14 Stx11 ?1.479579129 9.444380704 63.84574775 1.34552E?15 1.67321E?13 Acot7 ?1.179868494 9.577117541 63.70742047 1.4434E?15 1.78122E?13 Gzmb ?2.305535859 10.35028864 63.25612494 1.81502E?15 2.22285E?13 Prkar1a ?0.733240671 10.10978596 61.63694877 4.12996E?15 5.01991E?13 Hsp90ab1 ?0.785617269 11.19690024 61.01970556 5.65064E?15 6.81703E?13 Arpc2 ?0.510019831 10.79489599 60.85255662 6.15136E?15 7.36614E?13 Lilr4b ?1.22658672 9.778162201 60.71605134 6.59304E?15 7.83699E?13 Atp11b 1.060573176 9.338510173 60.4715511 7.46496E?15 8.80865E?13 Rpl10 0.383923631 11.48649796 60.42271086 7.65249E?15 8.96451E?13 Rpl13-ps3 0.784182986 9.661827958 60.21552598 8.50189E?15 9.88788E?13 Ccl5 ?1.592460232 13.31119099 59.20789454 1.41864E?14 1.63812E?12 Gzmk ?1.83313636 9.363691919 58.79982239 1.74557E?14 2.00134E?12 Fam110a ?1.377632721 9.494282763 58.37016172 2.1716E?14 2.47226E?12 mt-Atp6 0.342233346 12.4713887 57.14770681 4.04279E?14 4.57033E?12 Cdkn1a ?1.510364992 9.693205615 56.90889505 4.56476E?14 5.12458E?12 B2m ?0.27669249 12.79981273 55.08980998 1.15146E?13 1.28376E?11 Ccr5 ?1.45838306 9.514442093 55.02519732 1.18994E?13 1.31758E?11 Cyba ?0.620409355 10.43089398 54.4652912 1.58218E?13 1.73996E?11 Shfm1 ?0.655842341 10.08130292 52.76367247 3.76195E?13 4.10917E?11 Rpl31 0.405514605 10.87146125 52.0602909 5.38224E?13 5.83955E?11 D16Ertd472e ?1.069168808 9.624003202 51.79827152 6.15059E?13 6.6287E?11 H2-K1 ?0.434001092 11.60996642 51.75940054 6.27357E?13 6.71646E?11 Ctla4 ?0.957465278 10.15301816 51.74174906 6.33023E?13 6.73253E?11 Odc1 ?1.055185894 10.45347895 51.72816846 6.37417E?13 6.73495E?11 Lztfl1 ?1.425717433 9.420903385 51.65487227 6.61662E?13 6.94574E?11 Pik3ip1 1.016427354 9.192060991 51.64159498 6.66152E?13 6.94775E?11 Hspa8 ?0.563966934 12.33059948 50.45462778 1.21952E?12 1.26377E?10 Rpl22 0.405100818 10.6070495 49.87592861 1.63782E?12 1.68643E?10 Ddx5 ?0.472190603 11.19925927 49.77420376 1.72497E?12 1.76493E?10 Tsc22d3 0.910948391 9.704543117 49.56953718 1.91464E?12 1.94667E?10 Gapdh ?0.589658183 10.56193028 49.41524912 2.07129E?12 2.09278E?10 Ubl5 ?0.591958802 10.27392154 49.13961783 2.38377E?12 2.39354E?10 Rpl23a-ps3 0.503304075 10.7199609 48.2436768 3.7641E?12 3.7562E?10 Cd6 ?0.869658646 9.931712402 47.92252282 4.43399E?12 4.39754E?10 Sh3bgrl3 ?0.457786105 11.24479119 47.90991163 4.4626E?12 4.39893E?10 Tceb2 ?0.592952025 10.20132116 47.42391532 5.71808E?12 5.60233E?10 Pde2a 0.987337446 9.177524209 47.36238186 5.90042E?12 5.71175E?10 Bhlhe40 ?0.629828205 10.72360829 47.36525297 5.89179E?12 5.71175E?10 Maf ?1.20235901 9.568711542 47.31232275 6.05305E?12 5.82462E?10 Rpl30 0.364473767 10.96403143 47.01596378 7.04109E?12 6.73528E?10 S100a4 ?1.45718699 9.866407172 46.84257616 7.69239E?12 7.31501E?10 Abracl ?0.751666052 9.935290448 46.8085049 7.8273E?12 7.39977E?10 Gnb2l1 0.413063836 10.54000009 46.77545408 7.96042E?12 7.48187E?10 Ifng ?1.860168053 9.686682514 46.5515956 8.92376E?12 8.33881E?10 Pkp3 ?0.992944373 9.709717317 45.7083226 1.37238E?11 1.27506E?09 Smim3 ?1.264653022 9.350059212 45.17112102 1.80548E?11 1.66785E?09 Gdi2 ?0.736720685 9.887611627 44.73070501 2.26084E?11 2.07663E?09 Oaz1 ?0.345126362 11.23125359 44.4427732 2.61902E?11 2.39204E?09 Il7r 0.762433294 9.753528328 44.19134887 2.97794E?11 2.70458E?09 Manf ?0.873653643 9.719335527 44.10873804 3.10631E?11 2.8054E?09 Lpxn ?0.856247558 9.719586419 43.85349118 3.53899E?11 3.17841E?09 Dynll1 ?0.677834564 10.05622605 43.12939789 5.12366E?11 4.57619E?09 Dph5 0.964698786 9.213978081 43.09901238 5.20385E?11 4.62228E?09 Cd82 ?0.685765836 10.1275368 42.58772697 6.75821E?11 5.97012E?09 Cd74 ?1.790229737 9.434235572 42.16081243 8.40678E?11 7.38609E?09 Hcls1 ?0.884940162 9.587943614 41.89048756 9.65311E?11 8.43525E?09 Arl6ip1 ?0.744621815 9.94432139 41.67387503 1.0784E?10 9.37284E?09 Sh3bp5 0.906477381 9.188376986 41.65015897 1.09157E?10 9.43649E?09 Tank ?1.122428469 9.370123349 41.51736594 1.16829E?10 1.0046E?08 Tmem176a ?1.561868972 9.404491611 41.45307093 1.20735E?10 1.0327E?08 Ermn ?1.384380136 9.30459238 41.37987416 1.25341E?10 1.06646E?08 Ikzf3 ?1.234027314 9.310526312 41.26331133 1.33043E?10 1.12606E?08 Clic1 ?0.576996189 10.32552274 41.07895162 1.46202E?10 1.23099E?08 Gm8369 0.656116673 9.924740414 40.88479166 1.61473E?10 1.35252E?08 Uap1 ?1.127448986 9.373339988 40.5920089 1.87572E?10 1.56304E?08 Ubald2 ?0.647705139 10.62015695 40.48582272 1.98048E?10 1.64187E?08 Cd5 ?0.942120559 9.629220038 40.26054766 2.22252E?10 1.83313E?08 Nr3c1 ?1.154618397 9.448746596 40.15577128 2.34498E?10 1.92431E?08 Anxa2 ?0.939195153 9.842340624 40.03380626 2.49605E?10 2.03794E?08 Tmem176b ?1.478158733 9.44810635 39.8238096 2.77936E?10 2.25785E?08 Ikzf2 ?1.348475271 9.298837321 39.71435404 2.93957E?10 2.36423E?08 AB124611 0.925207051 9.180451135 39.72365158 2.92561E?10 2.36423E?08 Serpinb1a ?1.843570985 9.512641434 39.59191023 3.12977E?10 2.50475E?08 Stk24 ?0.91383667 9.608549705 39.52447346 3.23974E?10 2.57998E?08 Efhd2 ?0.999146886 9.465521733 39.13275436 3.95945E?10 3.13767E?08 Ucp2 ?0.65915216 10.0128664 39.02218127 4.19018E?10 3.30431E?08 Calr ?0.677910097 10.0207225 38.16235309 6.50963E?10 5.10848E?08 Cdc42 ?0.468486577 10.40471662 38.14980497 6.55163E?10 5.1166E?08 Fam101b 0.953455397 9.174681163 38.04046828 6.92924E?10 5.38549E?08 Serpina3g ?1.177709452 9.674291957 38.02477696 6.98519E?10 5.403E?08 Socs3 0.876228257 9.49233387 37.92020104 7.36982E?10 5.67336E?08 Hsp90b1 ?0.822947909 9.703951568 37.82898625 7.72258E?10 5.91674E?08

    TABLE-US-00028 TABLE 3L LPL-11 vs. All GeneSymbol logFC logCPM LR PValue FDR Gata3 2.78725309 9.445536089 651.0499191 1.3206E?143 2.1349E?139 Ccl5 ?5.30741133 13.31117347 348.0391179 1.1328E?77 9.15641E?74 Tnfsf8 2.436704618 10.01782193 323.7980169 2.15589E?72 1.16174E?68 Rpl37a 0.622775272 12.61561004 294.538539 5.10124E?66 2.06167E?62 Il5 1.913428082 9.162955407 286.2336147 3.2903E?64 1.06382E?60 Socs2 2.183612465 9.351639381 270.9835186 6.92719E?61 1.86642E?57 Cldnd1 1.666913086 9.794858969 252.1526177 8.81368E?57 2.03546E?53 Gpx4 1.087119142 10.07609679 226.2535433 3.91211E?51 7.48478E?48 Sub1 0.883083724 11.1487561 226.1278761 4.16696E?51 7.48478E?48 AW112010 ?1.474129989 11.38325184 209.9972312 1.37553E?47 2.22368E?44 Ms4a4b ?1.446723816 10.75185359 195.3518584 2.15883E?44 3.1727E?41 Ramp3 2.145977545 9.936713117 192.8546395 7.57266E?44 1.02016E?40 Il4 2.011817772 9.174329336 191.3077471 1.64772E?43 2.049E?40 Itk 1.193676475 9.814313226 190.8271332 2.09791E?43 2.42249E?40 Samsn1 1.384203515 9.795369332 186.5931584 1.762E?42 1.89896E?39 Pfn1 ?0.962844016 12.14557821 185.1929867 3.56178E?42 3.59874E?39 Hilpda 1.535712444 9.667495774 172.5446413 2.05786E?39 1.9569E?36 Nkg7 ?1.499609631 11.21026875 166.4588249 4.39179E?38 3.94431E?35 Lgals7 2.061472613 9.201968358 164.5758087 1.13233E?37 9.63437E?35 Il1rl1 1.727815818 9.173799372 163.5329974 1.91329E?37 1.54652E?34 H2afz 1.030291278 10.7654377 151.5333042 8.01359E?35 6.16893E?32 Tnfrsf18 1.025507117 10.06770513 150.5249306 1.33114E?34 9.78146E?32 Rps9 0.436769402 11.99536279 149.9878754 1.74425E?34 1.22598E?31 Rpl23 0.492111858 11.70855206 147.5273126 6.0181E?34 4.05369E?31 Ptpn13 1.508179564 9.18673375 145.8278672 1.4157E?33 9.1545E?31 Fam213a 1.52409344 9.188402088 144.3827407 2.93029E?33 1.82197E?30 Fam46a 1.816227914 9.5043122 140.7033004 1.86819E?32 1.11856E?29 Actb ?1.645143094 13.40506597 136.9264382 1.25136E?31 7.22482E?29 Ms4a6b ?1.276285498 10.19495673 136.8462663 1.30292E?31 7.26309E?29 Dusp10 1.527437104 9.475525704 135.6542382 2.37485E?31 1.27972E?28 Crem 1.428290135 10.06687059 135.0047119 3.29386E?31 1.7177E?28 Gm8369 ?1.539746047 9.92472512 126.5999821 2.27259E?29 1.14808E?26 Ptgir 1.113446316 9.163290516 126.4785278 2.41602E?29 1.18356E?26 Rpl21 0.435636427 11.76870978 125.261045 4.46212E?29 2.12161E?26 Rps28 0.55761229 11.70740612 123.962248 8.58618E?29 3.96583E?26 Tpt1 0.441970525 11.78330363 122.7748436 1.56206E?28 7.01453E?26 Got1 1.376458958 9.855680992 121.8512873 2.48806E?28 1.08708E?25 Calca 3.14777933 9.213255376 121.6092469 2.81089E?28 1.19581E?25 Eef1a1 0.393660221 12.38173251 121.482608 2.99616E?28 1.24195E?25 Spcs3 1.235400868 9.34767364 119.8851623 6.70309E?28 2.70905E?25 Tnfrsf4 1.148431166 10.62221384 117.9370243 1.78981E?27 7.05711E?25 9230102004Rik 0.982375521 9.161433502 116.704018 3.3327E?27 1.28277E?24 Rps12-ps3 0.943779186 9.914308593 115.0032374 7.85691E?27 2.95383E?24 Frmd4b 1.36706003 9.262065137 114.9482961 8.07763E?27 2.9678E?24 Rps12 0.623247383 10.77054436 114.1870765 1.18577E?26 4.2598E?24 Wdr89 0.942765197 10.42589899 111.5161523 4.56074E?26 1.6028E?23 Rplp2 0.431571166 11.91003287 109.5583778 1.22445E?25 4.21158E?23 Arpc3 0.640798492 10.54004275 108.871016 1.73198E?25 5.83315E?23 Serpina3g ?2.073186267 9.674281316 107.2026936 4.0189E?25 1.32591E?22 Rps21 0.584104575 10.92368799 107.0529425 4.33434E?25 1.40138E?22 Rpl23a 0.377714752 12.17554432 106.7452237 5.06241E?25 1.60469E?22 Lcp1 ?0.975234565 10.29117732 105.6943068 8.60342E?25 2.67467E?22 Rps29 0.448556786 12.24466765 104.4778208 1.58963E?24 4.84867E?22 Epsti1 ?1.239773795 9.946039862 104.081923 1.94121E?24 5.81142E?22 Serinc3 1.130652275 9.437689744 103.9755135 2.04832E?24 5.91306E?22 Bcl2a1b 0.824160134 10.3921492 103.9953976 2.02787E?24 5.91306E?22 Rps24 0.413547684 12.0058264 103.6828838 2.37434E?24 6.73395E?22 Lsp1 ?0.985266793 10.32146161 103.541068 2.55052E?24 7.10892E?22 Tnfaip8 1.025889715 9.63021053 102.1887411 5.0476E?24 1.38304E?21 Arhgdib ?0.776390788 10.73175766 101.3554603 7.6873E?24 2.07122E?21 Gimap4 ?0.848082586 10.52505641 100.3208288 1.29607E?23 3.43479E?21 Rps20 0.532114639 11.06849484 100.0530592 1.48369E?23 3.86859E?21 Rpl35a 0.383212685 11.72340173 98.87799881 2.68546E?23 6.89098E?21 Rps7 0.381427202 11.94309364 98.49929886 3.2514E?23 8.21283E?21 Rpl26 0.386577119 11.57421057 96.7395076 7.90755E?23 1.96667E?20 Ltb ?1.399434777 10.15519086 96.12700077 1.07745E?22 2.63911E?20 Rpl30 0.473159497 10.96404079 94.5744842 2.36041E?22 5.69529E?20 Gramd3 ?1.361397858 10.20644171 91.6866376 1.01548E?21 2.41416E?19 Dgat1 1.136334074 9.778640319 91.23289682 1.27719E?21 2.99233E?19 Gzma ?3.702496857 10.72561706 90.72545605 1.65056E?21 3.81185E?19 Epas1 1.267743009 9.190648446 90.47197387 1.87616E?21 4.27182E?19 Fdx1 1.231395993 9.293641737 90.38007272 1.96536E?21 4.41277E?19 Cd48 ?1.406318811 9.721163919 90.22654102 2.12394E?21 4.7035E?19 Rps23 0.329029763 12.48528629 90.09886224 2.26552E?21 4.94924E?19 Rps15 0.390713377 11.49069805 87.8944932 6.90406E?21 1.48815E?18 Il17rb 0.719078081 9.159374823 85.61480456 2.18632E?20 4.65054E?18 Rpl9-ps6 0.874151789 9.840821559 85.0333623 2.93373E?20 6.15931E?18 Gpr18 ?1.78216716 9.406620641 84.12800323 4.63755E?20 9.61162E?18 Ipmk 1.273590944 9.271358545 83.86447633 5.29882E?20 1.08431E?17 Coro1a ?0.73247519 10.77299576 83.22874718 7.30871E?20 1.47691E?17 Abhd17c 1.101899836 9.339495287 82.97818141 8.29641E?20 1.6558E?17 Rpl9 0.330253784 11.84222846 82.11044546 1.28691E?19 2.53709E?17 Rps10 0.393627927 11.22175565 80.59909901 2.76486E?19 5.38514E?17 Gzmb ?2.701378123 10.35029484 80.36660647 3.11007E?19 5.9854E?17 Cd3e ?0.76840368 10.37494886 80.21369816 3.3603E?19 6.39089E?17 Gm9843 0.686156797 10.49140966 78.62252705 7.51871E?19 1.41334E?16 Ccr5 ?1.657767592 9.514438228 78.43448041 8.26961E?19 1.53663E?16 Cfl1 ?0.559969156 11.11281656 78.41189297 8.36471E?19 1.53663E?16 Rpl17 0.311214497 12.29662158 77.9954965 1.03276E?18 1.87591E?16 Il13 1.584467555 9.164846146 76.40414181 2.31166E?18 4.15225E?16 Rac2 ?0.536378869 11.09605583 75.73073771 3.25107E?18 5.77547E?16 Rpl36a 0.451614988 11.04526124 73.03434504 1.27413E?17 2.23887E?15 Rps3a1 0.326717425 11.67386184 72.76462129 1.46072E?17 2.53914E?15 Rpl38 0.370765232 11.67453685 72.51121348 1.66086E?17 2.85632E?15 Rps27rt 0.626079443 11.16192697 72.33582672 1.81522E?17 3.08893E?15 Rpl6l 0.60326212 10.20612343 72.15571984 1.98868E?17 3.34886E?15 Fosl2 1.091970828 9.531552388 71.34388687 3.00086E?17 5.00123E?15 Vps37b 0.724244734 10.60465641 71.30913819 3.05418E?17 5.01342E?15 Dnajc15 ?0.897639796 9.893114381 71.29881659 3.0702E?17 5.01342E?15 Cd7 ?2.214869992 9.494180616 70.61890677 4.33344E?17 7.00544E?15 Klf2 ?2.182862403 9.960838309 70.52757429 4.53878E?17 7.26474E?15 Rpl23a-ps3 0.582425672 10.71997612 70.42054103 4.79184E?17 7.59459E?15 Rpl13 0.292940011 12.63772195 69.15470278 9.1035E?17 1.42881E?14 Rpl6 0.305809539 11.76076847 69.07620569 9.47314E?17 1.47253E?14 Ell2 1.083692654 9.233842501 68.53144299 1.24871E?16 1.92253E?14 Cd200r1 1.056706352 9.188142445 68.15502474 1.51134E?16 2.28339E?14 Ctla2a 1.029049134 10.33550568 68.16832127 1.50118E?16 2.28339E?14 Nfkb1 0.863972112 9.53708087 68.04758287 1.59597E?16 2.38894E?14 Isy1 0.955123258 9.388775206 68.01603383 1.62171E?16 2.4052E?14 Cxcr3 ?1.31367325 9.55137858 67.18697187 2.46941E?16 3.62913E?14 Abracl ?0.827023382 9.935292552 66.38855383 3.70246E?16 5.39225E?14 Elovl5 1.000670868 9.322047714 66.29789289 3.87673E?16 5.59564E?14 Rplp1 0.354849578 11.70322227 64.41465545 1.00806E?15 1.44214E?13 Ubac2 ?1.232880489 9.42377083 64.35941478 1.03672E?15 1.47014E?13 Cyba ?0.621006408 10.43089692 64.18614099 1.13202E?15 1.59133E?13 Rpl10-ps3 0.822487389 9.578827067 64.11901202 1.17126E?15 1.63229E?13 Amica1 ?1.523510324 9.335288888 63.701196 1.44797E?15 2.00067E?13 Rpl12 0.445699316 10.99232629 63.59632141 1.52714E?15 2.09218E?13 Emb 0.74683201 10.25092353 63.34678603 1.73338E?15 2.35477E?13 Rps6 0.277808542 12.20836688 63.27756685 1.79537E?15 2.41867E?13 Rpl19 0.270133762 12.11744948 63.03407253 2.03162E?15 2.71431E?13 Rpa2 ?1.380531757 9.392692325 63.01445595 2.05195E?15 2.719E?13 Fau 0.274449368 12.3016555 62.71392745 2.39019E?15 3.14145E?13 Gnai2 ?0.748009519 10.17430832 62.26042219 3.00912E?15 3.83955E?13 Rps27a 0.301110145 11.80970228 62.2783555 2.98184E?15 3.83955E?13 Elf1 0.782440901 9.573205604 62.2557001 3.01635E?15 3.83955E?13 Btg1 ?0.611493 12.25013986 62.29398453 2.95827E?15 3.83955E?13 Limd2 ?0.821889253 10.08911092 62.02700461 3.38779E?15 4.27868E?13 Rpl7 0.334243439 11.21182536 61.69813298 4.0036E?15 5.01722E?13 Rpl27a 0.292308559 11.73982066 61.44017246 4.56403E?15 5.67554E?13 Rpl22 0.408207942 10.60705713 61.37209441 4.7246E?15 5.83037E?13 Ptprc ?0.713573469 10.11543823 61.24768507 5.03277E?15 6.16362E?13 Rps13 0.284620979 11.92518428 60.88657604 6.04597E?15 7.34881E?13 Rpl5 0.439923342 10.56750057 60.78676801 6.3604E?15 7.6733E?13 Slc25a3 0.594192956 9.949500334 60.65326175 6.80672E?15 8.15092E?13 Rpl8 0.310489568 11.65215979 60.46534585 7.48853E?15 8.90144E?13 Srgn 0.449658173 11.37080589 60.20798913 8.53451E?15 1.00707E?12 Rpl27-ps3 0.779626572 9.836237785 59.40764719 1.2817E?14 1.50145E?12 Rpl39 0.322065417 11.77724389 59.04445308 1.5415E?14 1.7928E?12 Rpl41 0.244533547 12.79519234 59.0064913 1.57153E?14 1.81466E?12 Gm9493 0.537190778 10.33345076 58.58099131 1.95092E?14 2.23678E?12 Rps4x 0.289254484 11.84791468 58.37963616 2.16116E?14 2.46038E?12 Gzmk ?1.778766406 9.363688173 58.22977163 2.33223E?14 2.63656E?12 Chrne 1.080079344 9.215523871 58.15710461 2.41999E?14 2.71677E?12 Zfp36l2 ?1.196447923 9.814176688 57.88375668 2.78074E?14 3.10024E?12 Rps5 0.281501081 12.08884857 57.86056343 2.81372E?14 3.11552E?12 Rps8 0.329920366 11.59253946 57.82162114 2.86998E?14 3.15619E?12 Ptprcap ?0.843038887 10.0401219 57.71648011 3.02756E?14 3.30699E?12 Hmha1 ?0.896320622 9.750277921 57.60875529 3.19799E?14 3.46971E?12 Smap2 ?1.082941862 9.515119635 57.58389709 3.23866E?14 3.49041E?12 Serp1 0.703010004 9.615297449 57.37262964 3.6059E?14 3.86047E?12 Lck ?0.584926841 10.3166673 57.19919538 3.93832E?14 4.18861E?12 Arpc1b ?0.514495687 10.55363485 56.87151403 4.65236E?14 4.91569E?12 Psmb8 ?0.547617393 10.43462296 56.15435567 6.6999E?14 7.03316E?12 Tbc1d10c ?1.109015086 9.522686372 56.04149687 7.09574E?14 7.40063E?12 Gm2000 0.754104213 9.643824227 55.94423 7.45562E?14 7.72613E?12 Rps25 0.341236461 11.11865723 55.73810371 8.27978E?14 8.52554E?12 Prr13 ?0.635092799 10.23790791 55.35597511 1.00564E?13 1.02893E?11 Arf4 0.613490192 9.974773579 55.29863988 1.0354E?13 1.05272E?11 Sp100 ?1.052989046 9.553710362 55.27939258 1.04559E?13 1.05644E?11 Rpl11 0.271060468 11.70901048 55.22698927 1.07384E?13 1.07824E?11 Alyref ?1.276590695 9.471546257 54.26812572 1.74916E?13 1.74549E?11 Tnfsf11 1.195675235 9.546999328 54.14786369 1.85956E?13 1.84427E?11 Hnrnpf ?0.542960485 10.40307656 54.04990147 1.95462E?13 1.92673E?11 Rasgrp1 0.867495082 9.487696794 53.8710296 2.14091E?13 2.09758E?11 Rps14 0.245646052 12.65498328 53.84935221 2.16466E?13 2.10807E?11 Cd160 ?1.612019875 9.334774618 53.43431062 2.67386E?13 2.58836E?11 Klrd1 ?1.530760278 9.372671712 53.33075396 2.81859E?13 2.71222E?11 Slfn2 ?0.780872487 10.08513601 53.26722348 2.91124E?13 2.7848E?11 Nt5e 0.983503956 9.297373639 52.50026078 4.30191E?13 4.09087E?11 Acbd7 0.727171497 9.16408021 52.47608183 4.3552E?13 4.11732E?11 Rpl36 0.291113805 11.87411161 52.39297427 4.54346E?13 4.27033E?11 Zrsr1 0.884462945 9.173204714 51.98113864 5.60363E?13 5.23632E?11 Ero1l 0.898463636 9.301152497 51.86195302 5.95431E?13 5.53203E?11 Rab4a 0.981396634 9.180878739 51.70674863 6.44409E?13 5.95286E?11 Rpl14 0.276260435 11.87702722 51.33644975 7.78173E?13 7.125E?11 Tnfrsf9 1.216186143 9.401994134 51.33156871 7.8011E?13 7.125E?11 Ccl1 2.8701985 9.258088506 51.06468191 8.93719E?13 8.11678E?11 Rpl10 0.340760182 11.48651267 51.00196212 9.22737E?13 8.3335E?11 Rps26-ps1 0.834947975 9.373764532 50.54920683 1.16214E?12 1.04373E?10 Rps27 0.313487317 13.23490088 50.2616202 1.34556E?12 1.20178E?10 Rps17 0.442764705 10.61490628 50.23389231 1.3647E?12 1.21219E?10 Gm11808 0.563530104 10.17399793 49.66892667 1.82006E?12 1.60782E?10 Eprs 0.923361989 9.384340903 49.48741908 1.99648E?12 1.75408E?10 Ccr4 1.037365927 9.227399089 49.14947696 2.37182E?12 2.07258E?10 Ptpn22 ?0.744716395 10.09359672 48.95338111 2.62119E?12 2.27818E?10 Actr3 ?0.58253223 10.23419091 48.85186728 2.76042E?12 2.38637E?10 Xist 1.36070209 9.88830013 48.50687321 3.29133E?12 2.8302E?10 Rpl28 0.392724036 10.72545285 48.30031575 3.65693E?12 3.12794E?10 Lgals3 ?1.232792314 10.20014577 47.74671945 4.84995E?12 4.12654E?10 Bcl2a1a 1.056620671 9.252638693 47.53163715 5.41234E?12 4.58093E?10 Eif2s3y ?1.186564598 9.297554666 47.39179745 5.81254E?12 4.89404E?10 Anxa2 ?0.978635221 9.842357829 47.37611672 5.85922E?12 4.90778E?10 Rpl18a 0.234079517 12.84274109 47.34965143 5.93887E?12 4.94885E?10 Fam49b ?0.709772908 9.757609288 47.31498589 6.04483E?12 5.01132E?10 Cd40lg 0.891889007 9.469095126 47.26266572 6.20835E?12 5.12062E?10 Grk6 ?1.023874648 9.451805892 47.22787925 6.31952E?12 5.18585E?10 Set ?0.828366713 9.773721763 47.01187204 7.0558E?12 5.76081E?10 S100a4 ?1.423147096 9.866428203 46.98623023 7.14872E?12 5.80735E?10 Arid5a ?0.881618443 9.656928977 46.45120687 9.39285E?12 7.59224E?10 Itgb2 ?0.907516358 9.57508737 46.39812896 9.65076E?12 7.7619E?10 Rpl27 0.289912917 11.47261069 46.31227214 1.0083E?11 8.06943E?10 Pycard ?1.017137077 9.577060094 46.08847696 1.13031E?11 9.0013E?10 Spty2d1 0.853051885 9.326966648 46.00769813 1.17789E?11 9.33422E?10 Rhoc 0.987511986 9.24424751 45.56307656 1.47802E?11 1.16554E?09 Chst12 ?1.147202534 9.307931568 45.51891285 1.51172E?11 1.18633E?09 Rps16 0.244105981 12.35138152 45.46537675 1.55361E?11 1.21332E?09 Tmem64 1.093268199 9.248121955 45.0264485 1.94391E?11 1.51083E?09 Irg1 1.166366825 9.171594961 45.00188351 1.96845E?11 1.52258E?09 Rps11 0.248211858 12.26303884 44.94510537 2.02636E?11 1.55991E?09 Klf6 ?1.036319624 9.897270148 44.77739178 2.20757E?11 1.68841E?09 Gm6133 0.585153871 9.885540209 44.77154418 2.21417E?11 1.68841E?09 Sik2 0.906902057 9.224898712 44.5694824 2.45488E?11 1.86318E?09 Txk ?1.156179358 9.335431681 44.50879221 2.53217E?11 1.91286E?09 Sarnp ?0.827594901 9.551872587 44.48372488 2.56481E?11 1.92849E?09 Itm2c 0.701342323 9.518100312 44.45278354 2.60566E?11 1.95015E?09 Rpsa 0.289184479 11.60004787 43.86706712 3.51453E?11 2.61824E?09 Rps3 0.225942304 11.96703538 43.69704055 3.83351E?11 2.84278E?09 Ssu72 ?0.929150446 9.444716001 43.50697036 4.22452E?11 3.10425E?09 Myo1f ?1.049004748 9.304637414 43.51237732 4.21286E?11 3.10425E?09 Gnb2l1 0.366860437 10.54001608 43.15062564 5.06837E?11 3.70748E?09 Pitpna ?0.910485352 9.510883804 43.13747045 5.10256E?11 3.71568E?09 Satb1 0.745579653 9.757025507 42.83945985 5.94214E?11 4.30765E?09 Gna13 0.591042418 9.985105007 42.61542934 6.66317E?11 4.80879E?09 Fth1 0.373781364 11.58470725 42.59490598 6.73345E?11 4.83791E?09 Gabpb1 0.835408177 9.477998587 42.55353038 6.8774E?11 4.91947E?09 Rpl15 0.344396098 10.73579943 42.1315169 8.53367E?11 6.07733E?09 Clic1 ?0.535683728 10.32552855 42.07634585 8.77786E?11 6.22381E?09 Ifitm2 0.977337784 10.68417408 42.03733753 8.95472E?11 6.32148E?09 Tgfb1 0.671608382 9.751051801 41.86242946 9.79263E?11 6.88294E?09 Dnajb6 0.49894243 10.02351389 41.74117381 1.04192E?10 7.2916E?09 Rpl32 0.23664982 12.44732842 41.59727176 1.1215E?10 7.8147E?09 Ifng ?1.717507241 9.686677357 41.44701983 1.21109E?10 8.40278E?09 Rpl7a-ps5 0.835650714 9.342537523 41.40691188 1.2362E?10 8.54031E?09 Ctsw ?0.729741102 9.943517783 41.35806506 1.26747E?10 8.6871E?09 Plcxd2 ?1.101786892 9.360411229 41.3569629 1.26819E?10 8.6871E?09 Ssr4 0.570246619 9.653687486 41.18546566 1.38448E?10 9.44369E?09 Ptp4a1 0.58771196 9.696533105 41.0105522 1.5141E?10 1.02844E?08 Cnn2 ?0.693314256 9.902894206 40.62768913 1.84178E?10 1.24578E?08 Bcl2a1d 0.63858231 9.947932761 40.61758242 1.85133E?10 1.24703E?08 Rps18 0.241335122 12.47331521 40.48050608 1.98588E?10 1.3321E?08 Mndal ?0.841737872 9.573225112 40.46492083 2.00178E?10 1.33722E?08 Eef1b2 0.442727395 10.07535887 40.41960733 2.04875E?10 1.36296E?08 Cbx3 ?1.070891558 9.518054426 40.379645 2.09108E?10 1.38543E?08 Capzb ?0.523447722 10.15887429 40.2640148 2.21858E?10 1.4639E?08 Nck2 0.781410509 9.181413604 40.15865483 2.34152E?10 1.53874E?08 Ywhah ?0.731211687 9.721925417 40.03745907 2.49139E?10 1.6306E?08 H2afy ?0.620358 9.930108471 39.94698726 2.6095E?10 1.70101E?08 Rab26os 0.808791054 9.199100322 39.7121166 2.94294E?10 1.91067E?08 Esm1 ?1.379695329 9.307914728 39.65850624 3.02484E?10 1.95598E?08 Rbm3 ?0.469825784 10.73094825 39.54036966 3.21347E?10 2.06968E?08 Stk4 0.758728411 9.393514541 39.37433961 3.49865E?10 2.24441E?08 Usmg5 0.4807315 10.06857914 39.35044395 3.54172E?10 2.26306E?08 Ppp1cc 0.49871973 10.14022773 39.20971704 3.80641E?10 2.42262E?08 Efhd2 ?0.874966943 9.465518512 39.00726633 4.22231E?10 2.67678E?08 1810058I24Rik ?0.854214534 9.463226674 38.99196176 4.25554E?10 2.68731E?08 Tarm1 0.349845066 9.158101881 38.98305009 4.27501E?10 2.6891E?08 Ifi203 ?0.937675411 9.466821262 38.51022019 5.44677E?10 3.41289E?08 Nfkbie 0.776225335 9.398337686 38.4527893 5.60944E?10 3.50124E?08 Sept7 ?0.781596305 9.59369479 38.35737928 5.89049E?10 3.66253E?08 Rpl37 0.232492992 12.07300053 38.08056479 6.78829E?10 4.20458E?08 Riok1 0.83556849 9.379908874 38.03508968 6.94837E?10 4.2873E?08 Bin2 ?0.817818919 9.612865616 37.72529296 8.14417E?10 5.00603E?08 Scamp3 ?0.845996416 9.450290953 37.57880894 8.77931E?10 5.376E?08 Cd69 ?1.012008029 9.886570775 37.5387415 8.96152E?10 5.46687E?08

    TABLE-US-00029 TABLE 3M LPL-0 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Hspala ?3.825403493 11.185063 645.7540972 1.8729E?142 1.5139E?138 Dnajb1 ?2.99161603 10.75617704 646.5297575 1.2701E?142 1.5139E?138 Ubb ?0.822066561 12.91815268 545.542542 1.174E?120 6.3264E?117 Hsp90aa1 ?1.66428051 10.89396783 533.0215097 6.2174E?118 2.5127E?114 Hsp90ab1 ?1.143395141 11.28555087 489.4360578 1.8903E?108 6.1116E?105 Malat1 ?0.834514356 15.05517862 480.5825476 1.5958E?106 4.2997E?103 Dnaja1 ?1.340678809 11.00180648 424.3156706 2.80608E?94 6.48045E?91 Hspa8 ?0.841935877 12.34011222 389.8667875 8.84867E?87 1.78809E?83 Hsph1 ?1.682363639 9.992887058 286.2067369 3.33497E?64 5.99036E?61 Hspe1 ?1.262621525 10.53897111 284.1409882 9.40213E?64 1.51995E?60 Jund ?0.757938516 12.16529797 274.712105 1.06649E?61 1.56736E?58 Hspa1b ?1.813713236 9.880656558 192.3062295 9.97577E?44 1.3439E?40 Rpl35 0.479975201 11.30628837 180.4188355 3.9262E?41 4.88238E?38 Hspd1 ?1.057296091 10.15136767 143.4046976 4.79454E?33 5.53632E?30 Fosb ?1.249403116 9.939486915 142.5770614 7.27286E?33 7.83821E?30 Rbm3 0.507343098 10.86474429 133.5193484 6.96011E?31 7.03232E?28 Rpl27-ps3 0.733939207 10.1630502 126.7813677 2.07409E?29 1.97234E?26 Eef2 0.365125682 11.39715697 125.7387136 3.50754E?29 3.15016E?26 Zfp36l2 0.861788833 10.24225162 118.3228897 1.4734E?27 1.25363E?24 Rpl9-ps6 0.665300057 10.19128936 115.4607797 6.23806E?27 5.04223E?24 Gm8730 0.501024919 10.67600704 115.0937451 7.50637E?27 5.77848E?24 Rpl22l1 0.470188136 11.02604766 114.7398327 8.97303E?27 6.59354E?24 Rpl32 0.276004844 12.43016279 112.5208191 2.74765E?26 1.93124E?23 Rpl29 0.373802656 11.30509047 110.5431633 7.45054E?26 5.01856E?23 Rpl6l 0.518002583 10.48321852 101.9448287 5.70898E?24 3.69166E?21 Junb ?0.466016075 12.18505258 98.00914384 4.16455E?23 2.58939E?20 Rplp0 0.249731984 12.38724467 96.03494503 1.12873E?22 6.75819E?20 Chchd2 ?0.452053053 10.66873479 94.44852779 2.51549E?22 1.45234E?19 Rgcc ?1.083204205 10.02460697 91.73836745 9.89281E?22 5.51473E?19 Rpl18 0.254662339 11.84337657 86.96767873 1.10309E?20 5.9442E?18 Ddx5 ?0.364346068 11.32206669 82.20282545 1.22814E?19 6.40456E?17 Cacybp ?0.759965312 9.974878831 81.02462915 2.22922E?19 1.12617E?16 Lmna ?0.896054608 10.10046144 77.25333728 1.50377E?18 7.36666E?16 Gm9843 0.424425093 10.7167237 76.61162997 2.0811E?18 9.89504E?16 Cdkn1a ?0.802900828 10.20349727 74.35181316 6.53652E?18 3.01913E?15 Rps18-ps3 0.682699869 9.936337431 73.30477018 1.11099E?17 4.98897E?15 Cd160 0.933946071 9.842212445 72.70824087 1.50305E?17 6.56712E?15 Gzma 1.209224468 10.74237183 70.50937153 4.58085E?17 1.94879E?14 Rpl13a 0.174478619 13.13700027 69.64459685 7.1013E?17 2.94358E?14 Odc1 ?0.554763585 10.71341295 69.11801272 9.27444E?17 3.74827E?14 Atf3 ?0.87943707 9.821862051 68.15164877 1.51393E?16 5.96931E?14 Hspa5 ?0.432882858 11.06371391 66.89489047 2.86376E?16 1.10228E?13 Gm9493 0.415290628 10.58239681 66.56840727 3.37959E?16 1.27057E?13 Epsti1 0.518154471 10.33595192 65.73125853 5.16797E?16 1.89876E?13 Eif3f 0.334919369 10.83491205 65.21112438 6.72886E?16 2.41731E?13 Kdm6b ?0.502890922 10.78968221 64.63386514 9.01918E?16 3.16965E?13 S100a4 0.92404098 10.00434996 63.64817399 1.48747E?15 5.11626E?13 Ccl5 0.726508356 13.19304376 63.37342879 1.71009E?15 5.75945E?13 Fam110a ?0.691881356 9.98944843 62.94516444 2.12542E?15 7.01216E?13 Ubald2 ?0.420100725 10.91847462 61.80199233 3.7979E?15 1.22794E?12 Rps11 0.206504838 12.2866429 60.53858145 7.21504E?15 2.28703E?12 Rpl3 0.207637882 12.17538078 59.964028 9.6607E?15 3.00336E?12 Limd2 0.46356712 10.41509448 58.64505882 1.88842E?14 5.76003E?12 Rpl36-ps3 0.600107604 9.956192534 58.34228896 2.20258E?14 6.47399E?12 Rpl10-ps3 0.588938103 10.00304739 58.37673424 2.16435E?14 6.47399E?12 Gm2000 0.552978434 10.04573455 58.2135153 2.35158E?14 6.78851E?12 Crem ?0.555480946 10.37476775 58.14841144 2.4307E?14 6.89382E?12 Satb1 0.611847835 10.18239119 57.22454132 3.88789E?14 1.08365E?11 H2-Q6 ?0.52349562 10.11218978 55.63954367 8.70547E?14 2.3853E?11 Rac2 0.278484799 11.27241752 55.32603535 1.02107E?13 2.75111E?11 Rpl24 0.215735106 11.83074602 55.08988222 1.15142E?13 3.05145E?11 H2-K1 ?0.242269234 11.67413497 54.76242772 1.36016E?13 3.54652E?11 Ifrd1 ?0.490058089 10.42505666 54.57837129 1.49371E?13 3.8329E?11 Eno1 0.480893285 10.2518593 54.42764048 1.61278E?13 4.07379E?11 Rgs10 0.584571469 10.06092484 53.57232916 2.49245E?13 6.19892E?11 Ptprcap 0.462562077 10.30191657 52.78189829 3.72721E?13 9.1294E?11 Rpl15 0.285131556 10.91329125 52.45039836 4.41253E?13 1.06467E?10 Fus ?0.436843347 10.31636377 51.74106738 6.33243E?13 1.50544E?10 Apobec3 0.580477188 9.941216731 51.13331646 8.6301E?13 2.02195E?10 Wdr89 0.360242636 10.60823124 51.02458523 9.12163E?13 2.10658E?10 Prr7 ?0.512955962 10.2326335 49.73875281 1.75642E?12 3.9992E?10 Cd52 0.261151609 11.82769179 49.55775305 1.92617E?12 4.32479E?10 Actg1 0.279020484 11.92138436 49.3310168 2.16217E?12 4.78816E?10 Fth1 ?0.254879504 11.68995556 49.06749956 2.47304E?12 5.40259E?10 Rpsa 0.221212609 11.63951649 48.74914351 2.90886E?12 6.26994E?10 Hmgb2 0.380619263 10.77568432 47.80559174 4.70648E?12 1.00112E?09 Gm10073 0.50591008 10.0938124 47.04184308 6.94873E?12 1.44648E?09 Ltb 0.46912106 10.47411608 47.03326566 6.9792E?12 1.44648E?09 Rpl7a-ps5 0.593867674 9.839399427 46.10042491 1.12344E?11 2.29893E?09 Bag3 ?0.676847869 9.761603714 45.80267572 1.30785E?11 2.64283E?09 Rgs2 ?0.602713321 10.33738405 45.56039753 1.48004E?11 2.95387E?09 mt-Nd1 ?0.27246384 11.38477942 44.99146781 1.97895E?11 3.90142E?09 Selplg 0.361247701 10.47107152 44.61343362 2.40039E?11 4.67527E?09 Rps12-ps3 0.429501896 10.24219127 44.54830901 2.48158E?11 4.77585E?09 Itpkb ?0.536976006 10.03354471 43.56508254 4.10091E?11 7.79945E?09 Lcp1 0.358521569 10.53990253 43.01457134 5.43337E?11 1.02135E?08 Rps10 0.229905401 11.28625925 42.82120188 5.99786E?11 1.1145E?08 Shisa5 0.253218689 11.20411978 42.66916005 6.48263E?11 1.19089E?08 Cd7 0.905512708 9.951566624 42.42624652 7.33984E?11 1.33321E?08 Btf3 0.265152023 10.86771989 42.36584762 7.57004E?11 1.35975E?08 Eif1 ?0.185728716 11.94746374 41.72703666 1.04948E?10 1.86438E?08 Gm10076 0.471465459 10.05875362 41.19742905 1.37603E?10 2.41793E?08 Arhgdib 0.291487089 10.83943531 41.11935386 1.43211E?10 2.48941E?08 Hmha1 0.438419112 10.13557056 40.84407814 1.64872E?10 2.83545E?08 Cnn2 0.404936534 10.25178545 40.75026013 1.7298E?10 2.94358E?08 Rps6 0.159056414 12.23920984 40.68855047 1.7853E?10 3.00637E?08 Itgae 0.677929929 9.8104067 40.59773584 1.87023E?10 3.11693E?08 Fam169b 0.616416705 9.830231324 40.37061673 2.10077E?10 3.46541E?08 Rps3 0.163758935 11.98064091 40.05254335 2.47223E?10 4.03697E?08 Slc25a5 0.318042836 10.56075782 39.92967324 2.63273E?10 4.25607E?08 B2m ?0.138337493 12.76834333 39.80722236 2.80307E?10 4.48657E?08 Cox4i1 0.260138703 10.88297738 39.75543771 2.87838E?10 4.56195E?08 Nr3c1 ?0.562192365 9.957485177 39.24465631 3.7389E?10 5.86826E?08 Dedd2 ?0.579408471 9.822902175 38.8738958 4.52086E?10 7.02733E?08 Ctla4 ?0.411701514 10.49036865 38.58391272 5.24495E?10 8.07522E?08 Eif4a1 ?0.320154261 10.60075837 38.51060462 5.4457E?10 8.3052E?08 Gltscr2 0.29072519 10.57741115 38.07787817 6.79765E?10 1.02702E?07 Il4ra ?0.505217024 10.00229239 37.82530316 7.73717E?10 1.15814E?07 Ctsw 0.38528809 10.29455423 37.78999709 7.87847E?10 1.16847E?07

    TABLE-US-00030 TABLE 3N LPL-1 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Gm9843 0.873546513 10.7197657 595.3267532 1.7389E?131 2.8111E?127 Rps27rt 0.66236952 11.52848942 503.5200918 1.6296E?111 1.3172E?107 Rpl27-ps3 1.093919351 10.0373069 498.0920313 2.4723E?110 1.3323E?106 Rpl23a-ps3 0.706965217 10.91927368 429.8668325 1.73729E?95 7.02125E?92 Gm8730 0.825757188 10.42923933 412.6161475 9.87786E?92 3.19371E?88 Wdr89 0.707321788 10.74901788 406.5956198 2.0192E?90 5.44041E?87 Rpl6l 0.823496109 10.31624825 405.0286107 4.4288E?90 1.0228E?86 Rpl9-ps6 0.947575445 10.03468303 373.6299221 3.0329E?83 6.12873E?80 Gm11808 0.822511826 10.38635863 367.3621485 7.02331E?82 1.26154E?78 Hsp90aa1 ?1.123206902 11.09080685 278.1373372 1.91209E?62 3.09108E?59 Hsp90ab1 ?0.798418537 11.45738705 277.329778 2.86743E?62 4.21409E?59 Gm9493 0.669365375 10.45191966 267.6617764 3.66879E?60 4.94247E?57 Ubb ?0.506909232 13.07324632 266.81113 5.62244E?60 6.99172E?57 Hspa8 ?0.727896974 12.56632486 263.6950407 2.68601E?59 3.10157E?56 Gm2000 0.978296872 9.727076162 255.8188211 1.3994E?57 1.50818E?54 Gm6133 0.812351209 10.01774141 251.4273837 1.26841E?56 1.28157E?53 Gm10073 0.884912534 9.850676041 242.7892061 9.69501E?55 9.21939E?52 Uba52 0.636432939 10.43662801 223.7341252 1.38646E?50 1.24519E?47 Rpl35 0.477127259 11.02808234 202.7745708 5.18058E?46 4.40786E?43 Dnajb1 ?1.547344284 10.51482327 202.0042358 7.6291E?46 6.1666E?43 Hspa1a ?2.383248273 10.75818044 185.9121194 2.48129E?42 1.91012E?39 Gm10076 0.89711374 9.682747299 184.0884505 6.20583E?42 4.56016E?39 Gm42418 1.003104559 9.481098691 164.784568 1.01946E?37 7.16548E?35 Rpl36-ps3 0.865876631 9.656996395 163.4954362 1.94979E?37 1.31335E?34 Lgals1 ?0.600108402 11.14033101 159.5092037 1.44838E?36 9.3658E?34 Tmsb4x ?0.269818422 14.02813382 157.946803 3.17881E?36 1.97649E?33 Rps18-ps3 0.841244657 9.655928496 157.4523302 4.07672E?36 2.4409E?33 Rpl13-ps3 0.736506126 9.797721135 150.5036043 1.3455E?34 7.76836E?32 Dnaja1 ?0.748586019 11.1271812 146.0105043 1.29135E?33 7.19862E?31 Chchd2 ?0.473494251 10.6318899 141.6095467 1.18374E?32 6.37879E?30 Hspe1 ?0.829543845 10.55971604 128.4300367 9.03775E?30 4.71304E?27 Rpl10-ps3 0.71087493 9.678396441 125.6681744 3.63446E?29 1.83609E?26 Gm10036 0.758004858 9.644830032 125.5491133 3.8592E?29 1.89054E?26 Fosb ?1.108477341 9.588519321 113.8078997 1.43564E?26 6.82607E?24 Rps12-ps3 0.548511272 10.07738295 110.8914873 6.24998E?26 2.88678E?23 Malat1 ?0.323252323 14.85278289 110.8000382 6.54504E?26 2.93909E?23 Lmna ?0.973775479 10.04980932 110.2750726 8.52945E?26 3.72668E?23 Zfp36l2 0.805436207 9.84848683 109.5140802 1.25212E?25 5.32678E?23 Bcl2a1a 0.944045562 9.35889223 108.9881407 1.6326E?25 6.76733E?23 Gm26917 0.725412379 9.615524653 105.7709173 8.27715E?25 3.34521E?22 Rps27 0.173150148 13.46009077 101.4527607 7.31882E?24 2.88576E?21 Gm10263 0.861643794 9.385525775 98.05106258 4.07732E?23 1.56938E?20 AY036118 0.845409107 9.416058201 95.63098079 1.38423E?22 5.20407E?20 Rps28 0.25062322 11.89396748 94.87741825 2.02547E?22 7.44177E?20 Cd160 1.023014317 9.339544002 94.02040194 3.12288E?22 1.12188E?19 Hsph1 ?0.968446806 9.627387402 89.34964071 3.30852E?21 1.16273E?18 Crip1 ?0.674587136 11.33426017 84.59617783 3.65972E?20 1.25879E?17 Rpl7a-ps5 0.725809858 9.475578047 82.78303389 9.15726E?20 3.08409E?17 Rgcc ?0.973619288 9.813843394 81.09113895 2.15544E?19 7.1112E?17 Hspa1b ?1.064974481 9.37693802 77.03025429 1.68359E?18 5.44338E?16 Gm10250 0.721261574 9.432548691 75.60196203 3.47017E?18 1.09997E?15 B2m ?0.163151274 12.84650271 72.80837186 1.4287E?17 4.44159E?15 Rps26-ps1 0.661606304 9.479500689 69.45313485 7.82519E?17 2.38683E?14 Jund ?0.386316433 11.96429312 68.4310993 1.31389E?16 3.9334E?14 Sh3bgrl3 ?0.284689974 11.2049149 67.6776059 1.92538E?16 5.65922E?14 Rpl15 0.290483657 10.7193633 66.70193998 3.15824E?16 9.11717E?14 H2-D1 ?0.168989587 12.4810284 65.49651581 5.82168E?16 1.65111E?13 Rpl27 0.192059664 11.58272697 62.42809188 2.76353E?15 7.70263E?13 Rpl38 0.175857657 11.85262055 59.68977327 1.11052E?14 3.04283E?12 Ly6a ?0.476835045 10.45808259 58.56441313 1.96743E?14 5.30091E?12 Gm8186 0.616545383 9.46968788 58.47837647 2.05538E?14 5.44708E?12 Eef2 0.221539535 11.27929437 57.33667929 3.67242E?14 9.57554E?12 Gzma 0.973652374 10.76243447 56.49530585 5.63327E?14 1.44551E?11 Hspa5 ?0.308894911 11.15772526 56.45869742 5.73913E?14 1.44967E?11 Cd7 1.070388028 9.401826218 56.08605501 6.93674E?14 1.72522E?11 Itgae 0.757627092 9.327390666 54.75135772 1.36785E?13 3.3504E?11 Eif3f 0.271500969 10.59751999 54.44295273 1.60027E?13 3.86118E?11 Gm9844 0.524290137 9.613183527 53.29612718 2.86872E?13 6.81995E?11 Calm1 ?0.263318971 10.92853481 52.42032047 4.48064E?13 1.04977E?10 Odc1 ?0.476042872 10.65279357 52.07968366 5.32935E?13 1.23077E?10 Ly6e ?0.272932191 10.89033101 51.71546392 6.41555E?13 1.46076E?10 Rps29 0.164848186 12.37594571 51.4604536 7.30539E?13 1.64026E?10 Btg2 0.336367777 10.74241813 51.38924928 7.57522E?13 1.67755E?10 Rgs2 ?0.487746639 10.60753305 50.89975769 9.72056E?13 2.12355E?10 Ccl5 0.536522565 13.43614334 49.52632899 1.95727E?12 4.21884E?10 Manf ?0.477853237 9.744077147 48.59281074 3.15022E?12 6.70085E?10 Cacybp ?0.581354688 9.602687269 48.49367478 3.31356E?12 6.95675E?10 Bcl2a1d 0.434412334 10.08987012 48.36666838 3.53526E?12 7.32706E?10 Gm42726 0.594380731 9.300818507 47.76332445 4.80905E?12 9.84089E?10 Sertad1 ?0.609477867 9.448224564 45.15697193 1.81857E?11 3.67488E?09 mt-Nd1 ?0.233531752 11.10794853 44.9507962 2.02048E?11 4.03248E?09 Hspd1 ?0.577954866 9.977292502 44.91936291 2.05318E?11 4.04776E?09 Ctla2a ?0.562767996 10.740003 44.73531038 2.25553E?11 4.39312E?09 Rpl32 0.141395026 12.38187309 44.34948815 2.74684E?11 5.28636E?09 Tubb4b ?0.503312119 9.606172658 42.96612383 5.5696E?11 1.05927E?08 Stk17b 0.337542743 10.09370635 42.23007718 8.11424E?11 1.52529E?08 Myl12a ?0.257568889 10.62761221 41.55518391 1.1459E?10 2.12927E?08 Apobec3 0.551355515 9.466440219 41.0441852 1.48826E?10 2.73401E?08 H2-K1 ?0.161175353 11.86466227 40.58872572 1.87888E?10 3.4128E?08 Actb ?0.289918864 11.94107968 39.18869365 3.84762E?10 6.91118E?08 Cfl1 ?0.207073499 10.90597825 38.85100187 4.57419E?10 8.12597E?08 Dynll1 ?0.347573679 10.0825626 37.98225887 7.13909E?10 1.25252E?07

    TABLE-US-00031 TABLE 3O LPL-2 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Dnajb1 2.544628253 9.957159242 547.4793005 4.4499E?121 7.1937E?117 Ubb ?0.719181201 12.62430285 513.9811277 8.6306E?114 6.9761E?110 Hspa1a ?4.265472016 10.29821772 492.9716733 3.2152E?109 1.7326E?105 Hsp90aa1 ?1.538726518 10.40571986 452.2223245 2.3685E?100 9.57241E?97 Hsp90ab1 ?1.044511532 10.87430694 427.8486026 4.77686E?95 1.54445E?91 Malat1 ?0.78769936 14.29544248 389.368725 1.13581E?86 3.06026E?83 Dnaja1 ?1.160967215 10.50668275 365.4817217 1.80293E?81 4.16374E?78 Lmna ?1.944600206 9.721553983 326.4307695 5.75683E?73 1.16331E?69 Hspa8 ?0.679127098 12.09728281 319.2408275 2.11966E?71 3.80738E?68 Gm8730 0.782167056 10.45597089 266.3217383 7.18771E?60 1.16196E?56 Rpl27-ps3 1.052879725 9.707945918 234.7431502 5.50789E?53 8.0946E?50 Rgcc ?1.710983657 9.519354512 214.546025 1.39991E?48 1.88592E?45 Jund ?0.675872249 11.72419218 198.2604689 5.00547E?45 6.22449E?42 Rpl35 0.509475196 11.16221273 190.7930532 2.13416E?43 2.46434E?40 Gm10076 1.043288877 9.547149104 169.9338009 7.64936E?39 8.24397E?36 Hspe1 ?0.935945148 9.917574254 149.4990174 2.23082E?34 2.25396E?31 Rbm3 0.521950766 10.83382101 146.4106829 1.05575E?33 1.00395E?30 Hspa1b ?1.576600791 9.179262147 137.5708581 9.04572E?32 8.12406E?29 Rpl6l 0.618995521 10.05911577 131.643752 1.79029E?30 1.52326E?27 Rpl9-ps6 0.729047513 9.70611516 124.801031 5.62624E?29 4.54769E?26 Plac8 1.004128708 10.71893409 122.0396335 2.26272E?28 1.74187E?25 Rpl10-ps3 0.891923046 9.473250861 119.5256446 8.03499E?28 5.90425E?25 Rplp0 0.287615554 12.48158976 116.701297 3.33728E?27 2.34567E?24 Gm2000 0.840498181 9.539843664 112.8076916 2.37752E?26 1.60146E?23 AY036118 1.145148849 9.18956426 110.8745505 6.30361E?26 3.91939E?23 Rps11 0.296289107 12.28172419 110.9391621 6.10147E?26 3.91939E?23 Gm9843 0.526758847 10.31729062 106.9052174 4.66978E?25 2.79599E?22 Crip1 ?0.542787363 12.45883867 104.3227143 1.71907E?24 9.92517E?22 Atf3 ?1.251293523 9.18931171 99.85032275 1.64361E?23 9.16225E?21 Fosb ?1.291370796 9.247423493 98.57840948 3.12407E?23 1.68346E?20 Ccl5 1.130393144 13.95145733 98.22916805 3.7266E?23 1.94336E?20 H2-D1 ?0.246378131 12.31206309 88.35060601 5.48228E?21 2.76958E?18 Gzma 1.72506778 11.40703532 87.10004234 1.03168E?20 5.054E?18 Capg ?0.678811855 9.911087478 86.82217942 1.18731E?20 5.64529E?18 Hsph1 ?1.043326409 9.286330507 85.92665756 1.86734E?20 8.625E?18 AW112010 0.444670626 11.45893149 85.76333436 2.02812E?20 9.10739E?18 Rps12-ps3 0.611260131 9.758073988 83.06417161 7.94324E?20 3.47055E?17 Rpl23a-ps3 0.404080492 10.53373269 82.08567098 1.30314E?19 5.51089E?17 Cd160 1.385266485 9.322490009 82.0461108 1.32949E?19 5.51089E?17 Fth1 ?0.334928954 11.36116368 81.30744771 1.93197E?19 7.80806E?17 Rpl32 0.226778788 12.46778482 77.92038215 1.07279E?18 4.22992E?16 Gm10073 0.679834085 9.542960393 77.36287093 1.42265E?18 5.47583E?16 Gimap4 0.436236853 10.55167371 76.30539368 2.43019E?18 9.13639E?16 Odc1 ?0.775525139 9.944056332 75.38533617 3.87255E?18 1.42281E?15 Klf4 ?0.945293516 9.141545035 75.21282828 4.22612E?18 1.51821E?15 Gm9493 0.455274074 10.19437568 74.04689103 7.62833E?18 2.68086E?15 Epsti1 0.517090643 10.10953489 72.18893093 1.9555E?17 6.72607E?15 Mat2a ?0.790901455 9.401350329 72.06029678 2.08721E?17 7.02956E?15 Chchd2 ?0.376545479 10.32178394 71.90568348 2.25733E?17 7.44734E?15 Zfp36l2 0.756650171 9.849977864 69.90504138 6.22292E?17 2.01199E?14 Eef2 0.256530401 11.37716606 67.65949201 1.94315E?16 6.1594E?14 Hspd1 ?0.730056082 9.56946388 67.51749258 2.08826E?16 6.36959E?14 Tnfsf11 ?1.017394461 9.286194377 67.54703486 2.0572E?16 6.36959E?14 Rpsa 0.270139325 11.60964793 67.07276037 2.61669E?16 7.8336E?14 Ubc ?0.40985659 10.95640452 66.95470801 2.77817E?16 8.1658E?14 Limd2 0.51944246 10.09311916 66.50384614 3.49212E?16 1.0081E?13 Ddx5 ?0.322175912 10.99872038 65.9875592 4.53778E?16 1.28698E?13 Slc25a5 0.364261547 10.54681028 65.80084048 4.9887E?16 1.3669E?13 Calm2 ?0.417904584 10.28145878 65.82454295 4.92906E?16 1.3669E?13 Coro1a 0.345777346 10.98317648 65.24019964 6.63031E?16 1.78643E?13 Rpl7a-ps5 0.793213904 9.266019733 64.91202919 7.83175E?16 2.07554E?13 Kdm6b ?0.838775113 9.554589167 64.82078504 8.20293E?16 2.13885E?13 Cd7 1.097172739 9.645081853 64.25147561 1.0951E?15 2.81006E?13 mt-Co1 0.234930964 12.34097755 61.19238243 5.17614E?15 1.30746E?12 Gm11808 0.460625687 10.00121146 59.55269141 1.19063E?14 2.96119E?12 Ptprcap 0.468262667 10.14636839 59.11286349 1.48883E?14 3.64673E?12 Rpl29 0.262184011 11.36451206 57.9475349 2.69203E?14 6.49542E?12 Fam110a ?0.789509164 9.363253333 57.76260767 2.95738E?14 7.03075E?12 Rpl39l ?0.660080135 9.110893413 56.68255512 5.12159E?14 1.19994E?11 H2-K1 ?0.262139741 11.50207541 55.74456131 8.25263E?14 1.90589E?11 Rpl15 0.305474683 10.64485513 55.5645479 9.044E?14 2.05923E?11 Rpl13-ps3 0.582154842 9.53708088 55.37789667 9.94484E?14 2.23289E?11 Rps6 0.187770999 12.12258817 54.28391249 1.73517E?13 3.84256E?11 Klrk1 ?0.696235891 9.782659238 52.57186427 4.14789E?13 9.06146E?11 Tnfsf8 ?0.869184457 9.70280662 52.09440691 5.28954E?13 1.13608E?10 Lrrc58 0.663763744 9.389936985 52.07540605 5.34097E?13 1.13608E?10 Wdr89 0.370232576 10.18931763 51.40555181 7.51258E?13 1.57725E?10 Gpr18 0.866864527 9.411218906 51.09750716 8.78898E?13 1.82157E?10 mt-Nd1 ?0.317004366 11.02202855 50.93349268 9.55492E?13 1.95525E?10 Cdkn1a ?0.798684946 9.458316973 50.86367711 9.9009E?13 2.00072E?10 Pycard 0.551987428 9.777016154 49.94745009 1.57919E?12 3.15175E?10 Rpl24 0.19603573 11.85276508 48.38011829 3.5111E?12 6.922E?10 Rps26-ps1 0.687496784 9.283697606 47.81217608 4.6907E?12 9.13612E?10 Lgals1 ?0.300166557 12.3861545 47.0816269 6.8091E?12 1.31043E?09 Rpl18 0.192896256 11.84986773 46.75524775 8.04293E?12 1.52967E?09 Tuba1b ?0.596743066 9.481069774 46.38393415 9.72093E?12 1.82731E?09 Anxa1 ?0.789378766 9.401284199 45.91901426 1.23244E?11 2.26405E?09 Eif3f 0.262138365 10.76341364 45.93327111 1.2235E?11 2.26405E?09 Arhgdib 0.264978392 10.93540557 45.35015521 1.64775E?11 2.99298E?09 S100a11 ?0.308609798 10.7547102 44.90204871 2.07141E?11 3.72071E?09 Gm10250 0.669139793 9.283272179 44.69993982 2.29664E?11 4.07995E?09 Actg1 0.251896211 12.51833862 44.01460144 3.25935E?11 5.72725E?09 Rgs10 0.575935498 9.586443461 43.44995322 4.34942E?11 7.56051E?09 Cox7a2l 0.343579985 10.15410532 42.93720549 5.65254E?11 9.72116E?09 Ctsw 0.398042723 10.07562032 42.7050428 6.3648E?11 1.07181E?08 Ifrd1 ?0.475489987 9.932972127 42.71437436 6.33451E?11 1.07181E?08 Ccr5 0.70355753 9.447217476 42.05131782 8.89093E?11 1.48176E?08 B2m ?0.150244995 12.75753363 41.50989787 1.17276E?10 1.93457E?08 Gm10020 0.682288929 9.228632115 41.38530306 1.24994E?10 2.04106E?08 Hspa5 ?0.33052293 10.94859063 41.32467722 1.28931E?10 2.0843E?08 Cd44 ?0.53145037 9.521890103 40.78049304 1.70325E?10 2.72621E?08 Id2 ?0.415453763 10.56572827 39.70676467 2.95102E?10 4.67707E?08 Shisa5 0.241620621 10.99844694 39.41549416 3.42568E?10 5.37665E?08 Srsf2 ?0.454044438 9.706632291 39.33527525 3.56934E?10 5.54827E?08 Itgae 0.822282028 9.255556378 39.14463452 3.93543E?10 6.05907E?08 H2-Q7 ?0.287318486 10.53297959 38.93031587 4.39207E?10 6.63571E?08 Nmrk1 ?0.649473302 9.332536123 38.93242527 4.38732E?10 6.63571E?08 Gm10036 0.542587512 9.419981674 38.78703884 4.72656E?10 7.07496E?08 Sh3bgrl3 ?0.213928684 11.44744765 38.64098235 5.09381E?10 7.55472E?08 Txn1 ?0.357580971 10.03413913 38.5266841 5.40102E?10 7.93753E?08 Ly6e ?0.295951849 10.68171292 37.98408352 7.13241E?10 1.03876E?07 Pim1 ?0.383839128 10.72396533 37.73340148 8.11039E?10 1.17065E?07 Rpl22l1 0.264217716 10.93780735 37.71481274 8.18804E?10 1.1714E?07

    TABLE-US-00032 TABLE 3P LPL-3 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Dnajb1 ?1.946456328 9.715188532 322.0257087 5.244E?72 8.47744E?68 Ubb ?0.556526755 12.64332085 264.5357982 1.76138E?59 1.42372E?55 Hsp90ab1 ?0.842446585 11.04093619 262.9635073 3.87754E?59 2.08948E?55 Malat1 ?0.657557225 14.44411562 252.3465366 7.99619E?57 3.23166E?53 Dnaja1 ?0.967904935 10.3986654 203.5095769 3.58093E?46 1.15779E?42 Hsp90aa1 ?1.016819062 10.47401553 201.0128142 1.2555E?45 3.38273E?42 Hspa8 ?0.556803701 11.95258518 176.2104498 3.25747E?40 7.5229E?37 Hspe1 ?0.95327844 10.18983826 153.0812553 3.67718E?35 7.43066E?32 Hspa1a ?2.406354924 9.949094707 132.4560077 1.18913E?30 2.13594E?27 Cxcr6 1.050964818 10.1716772 103.8800633 2.14941E?24 3.47474E?21 Rpl27-ps3 0.677854872 9.862951638 103.2885245 2.89727E?24 4.25793E?21 Hsph1 ?1.152569484 9.365951561 92.24800222 7.64673E?22 1.03014E?18 Rpl9-ps6 0.616176975 9.871909672 83.51828779 6.31293E?20 7.85037E?17 Fos ?1.398569273 9.446578559 82.92552785 8.52037E?20 9.83859E?17 Gm2000 0.661448135 9.750013041 74.89725018 4.9586E?18 5.34405E?15 Ifi27l2a ?0.89617847 10.07811554 73.7599711 8.82175E?18 8.91328E?15 Wdr89 0.433531407 10.46020145 71.56018478 2.68929E?17 2.55736E?14 Ddx5 ?0.359798857 11.12189179 71.1737819 3.27106E?17 2.93778E?14 Gm11808 0.492106141 10.18664186 69.85758986 6.37444E?17 5.42364E?14 Rpl6l 0.439579948 10.33047525 69.08823159 9.41555E?17 7.61059E?14 Ubald2 ?0.531794105 10.58366091 67.3611776 2.26057E?16 1.74021E?13 Jund ?0.444613048 11.60111081 67.18787324 2.46828E?16 1.7956E?13 Ccr2 0.982615192 9.627366071 67.12005026 2.55467E?16 1.7956E?13 Rps27 ?0.22528728 13.41431811 64.64008117 8.99077E?16 6.05604E?13 Eno1 0.56244217 9.973825903 64.44188359 9.94221E?16 6.42903E?13 Hspd1 ?0.744360435 9.701312261 61.89149549 3.62914E?15 2.25648E?12 Gm9843 0.399626408 10.54065217 61.2458297 5.03752E?15 3.01617E?12 Gm8730 0.384178175 10.58492916 59.65981313 1.12756E?14 6.51003E?12 Lgals1 0.584476207 11.42883276 59.05998416 1.52938E?14 8.5255E?12 Gm10263 0.879988604 9.287197141 58.8792496 1.67651E?14 9.03415E?12 S100a6 0.619339818 11.111098 55.07558334 1.15983E?13 6.04832E?11 mt-Nd1 ?0.314291725 11.43254364 52.46700175 4.37539E?13 2.21039E?10 Actn1 ?0.958369048 9.243454407 51.82637721 6.06318E?13 2.97022E?10 mt-Nd2 ?0.461351834 10.07866988 51.42464038 7.43989E?13 3.53745E?10 Cacybp ?0.705432725 9.458629507 51.23131446 8.20985E?13 3.68668E?10 Arhgdib 0.320566828 10.84726184 51.2464166 8.14693E?13 3.68668E?10 Maff ?0.931067074 9.283544725 50.87231383 9.85743E?13 4.3069E?10 H1f0 1.005362161 9.473187573 47.65841621 5.0734E?12 2.15833E?09 Rpl7a-ps5 0.757646926 9.352518925 46.86769121 7.59444E?12 3.1156E?09 Gm10036 0.598995698 9.558547095 46.83834526 7.70902E?12 3.1156E?09 Fas ?0.830210368 9.383693055 46.49515393 9.18453E?12 3.62139E?09 Bcl2 ?0.898899663 9.49783969 44.78359536 2.20059E?11 8.47016E?09 Vim 0.568575859 10.37415144 43.88211639 3.48761E?11 1.31118E?08 Chchd2 ?0.336926527 10.38091917 43.82067836 3.59883E?11 1.32224E?08 Gm6133 0.42291287 9.939660004 43.76172027 3.70889E?11 1.3324E?08 Rpl10-ps3 0.525088242 9.670588182 42.35366951 7.61733E?11 2.67699E?08 mt-Cytb ?0.260378871 11.31880065 42.11921612 8.58752E?11 2.95374E?08 Gm10073 0.499465706 9.768923335 41.91880226 9.51433E?11 3.20435E?08 Eif1 ?0.204726216 11.87265834 41.54646968 1.15102E?10 3.79743E?08 Ass1 0.620830747 9.695025993 41.49478969 1.18185E?10 3.82117E?08 Pfn1 0.254506795 12.11137348 41.2735189 1.3235E?10 4.19523E?08 Fus ?0.445839928 9.904223746 40.96169319 1.55242E?10 4.82625E?08 mt-Nd4 ?0.299211404 10.74171325 40.51332524 1.9528E?10 5.89125E?08 Rpl13-ps3 0.498225143 9.711443418 40.49829211 1.96788E?10 5.89125E?08 Rbm3 0.313163413 10.72414562 40.41601225 2.05252E?10 6.03292E?08 Ltb4r1 0.861214833 9.337334137 39.74620311 2.89202E?10 8.33608E?08 Tmem176b 0.651358918 9.889767452 39.71457834 2.93923E?10 8.33608E?08 Gm9844 0.538387087 9.610551657 39.1486532 3.92734E?10 1.09464E?07 S100a4 0.676788049 10.14521787 39.10503468 4.01607E?10 1.1004E?07 Furin 0.614555215 10.39788225 38.37338333 5.84238E?10 1.57413E?07

    TABLE-US-00033 TABLE 3Q LPL-4 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Hsp90ab1 ?1.377781478 11.67647139 543.8892971 2.6874E?120 4.3444E?116 Dnajb1 ?2.622537269 11.47483313 463.2873417 9.2579E?103 7.4832E?99 Hspa8 ?1.036886848 12.90024104 448.3195067 1.6743E?99 9.02236E?96 Hsp90aa1 ?1.69852051 11.40941515 442.452405 3.16746E?98 1.28013E?94 Hspa1a ?2.91446732 12.86010883 434.4143608 1.77875E?96 5.75104E?93 Ubb ?0.8105054 13.50178123 308.2413372 5.27644E?69 1.42165E?65 Dnaja1 ?1.298882131 11.23915542 290.2673755 4.34808E?65 1.00416E?61 Hspa1b ?1.994309739 9.932282948 251.5650814 1.1837E?56 2.39196E?53 Hspe1 ?1.211796243 10.68337716 228.4069201 1.3267E?51 2.38304E?48 Hsph1 ?1.515688729 9.910103763 186.9056674 1.50586E?42 2.43438E?39 Malat1 ?0.537789313 15.00626926 185.1910359 3.56528E?42 5.23966E?39 Chchd2 ?0.665375364 10.5846311 154.6624546 1.65943E?35 2.23553E?32 Cd160 1.665261637 9.620048846 144.2761916 3.09176E?33 3.84473E?30 Phlda1 ?1.715829384 9.936081564 132.4571128 1.18847E?30 1.37234E?27 Zfp36l2 1.020511228 10.14841765 130.7330703 2.83244E?30 3.05262E?27 Hspd1 ?1.116030522 10.09787646 130.1171232 3.86298E?30 3.90306E?27 Gm8730 0.618593594 10.48391426 128.1570741 1.03702E?29 9.86148E?27 Gm9843 0.551372502 10.68584472 121.7644479 2.59938E?28 2.33453E?25 Itgae 1.320358 9.521589264 120.7193127 4.4021E?28 3.74549E?25 Jund ?0.618823521 12.17587894 118.5549329 1.31073E?27 1.05947E?24 Ccl5 1.166637714 13.51206478 116.9541133 2.93787E?27 2.2616E?24 Ifrd1 ?0.930802696 10.22453595 115.1395806 7.33487E?27 5.38979E?24 Rpl27-ps3 0.70516159 10.03539112 113.640381 1.5622E?26 1.09803E?23 Rpl35 0.424975548 11.14942572 104.8025375 1.34934E?24 9.08896E?22 Rpl23a-ps3 0.445117614 10.91295157 102.8250721 3.66087E?24 2.36726E?21 Cacybp ?0.880317879 9.788879867 98.96384198 2.57154E?23 1.59891E?20 Gzma 1.764487784 10.77239663 96.82803577 7.56178E?23 4.52754E?20 Rbm3 0.492723959 10.60453397 95.7412032 1.30927E?22 7.55916E?20 Cdkn1a ?1.206995923 9.907033741 95.52859803 1.4577E?22 8.12594E?20 Fosb ?1.066099038 9.880605281 90.88771259 1.52061E?21 8.19406E?19 Rpl9-ps6 0.616227778 10.05860333 90.30945314 2.03677E?21 1.06214E?18 Ubc ?0.604139188 11.71014404 87.02480623 1.07169E?20 5.41402E?18 Odc1 ?0.946502247 10.10880077 85.58700716 2.21728E?20 1.0862E?17 Tsc22d3 0.824896603 10.1820943 79.58469358 4.61991E?19 2.19663E?16 Gm11808 0.505052668 10.40238007 79.36117782 5.17327E?19 2.38946E?16 Wdr89 0.474528645 10.61488511 75.52093649 3.61553E?18 1.62357E?15 Rpl6l 0.488489759 10.34341037 74.33251242 6.60074E?18 2.88399E?15 Atf3 ?1.301093577 9.677121904 73.33073331 1.09647E?17 4.66462E?15 Bag3 ?1.266132157 9.521354891 71.1109823 3.37685E?17 1.39975E?14 Cd7 1.383948283 9.71052912 66.63099706 3.27397E?16 1.32318E?13 Ubald2 ?0.606943142 10.60239164 66.41228036 3.65816E?16 1.44239E?13 Gm10073 0.60015302 9.897815633 65.33692218 6.31275E?16 2.42981E?13 Dnaja4 ?1.047867988 9.592869946 64.97318745 7.59241E?16 2.85439E?13 Rps27rt 0.349506577 11.36556647 63.84509364 1.34597E?15 4.94522E?13 Lmna ?1.039644505 9.877771656 63.70335194 1.44638E?15 5.19605E?13 Eif3f 0.348188622 10.67657857 59.9250672 9.85384E?15 3.46298E?12 Gm6133 0.493613949 10.06524373 59.86826662 1.01424E?14 3.48854E?12 Mat2a ?0.836955253 9.660876437 59.67147505 1.12089E?14 3.77508E?12 Gm9493 0.435772602 10.45868098 59.06053171 1.52895E?14 5.0443E?12 Tbc1d10c 0.639902903 9.791392088 58.49880807 2.03414E?14 6.57679E?12 Rps18-ps3 0.669636452 9.686630364 58.08106981 2.51535E?14 7.97317E?12 Rpl32 0.21253747 12.37847718 57.65394918 3.12535E?14 9.71623E?12 Gm2000 0.618749327 9.800115886 57.56436456 3.27098E?14 9.97712E?12 H2-D1 ?0.216020929 12.2809488 55.65589398 8.63337E?14 2.58458E?11 Rpl3 0.212911971 12.08878792 55.29303986 1.03836E?13 3.05201E?11 Rpl13-ps3 0.557976851 9.854426518 54.57484183 1.49639E?13 4.30711E?11 B2m ?0.176603891 12.90330204 54.54582092 1.51865E?13 4.30711E?11 Rpl13a 0.170081845 13.15924144 53.72717786 2.30355E?13 6.42054E?11 Gm10036 0.640849878 9.721300594 53.68577585 2.3526E?13 6.44613E?11 Rgs1 0.534698556 11.99808529 53.54098127 2.53254E?13 6.82352E?11 Gm10076 0.596717543 9.779957709 53.44108257 2.66466E?13 7.06178E?11 Gm10263 0.780604259 9.452513074 53.10791718 3.15717E?13 8.23208E?11 Lcp1 0.396498657 10.52059347 52.01643536 5.5038E?13 1.41229E?10 Hist1h1c 0.957764201 9.701111152 51.90723574 5.81856E?13 1.46973E?10 Ctla4 ?0.615817979 10.22784566 51.72555071 6.38267E?13 1.58742E?10 Coq10b ?0.664020777 9.717601992 49.10934376 2.42084E?12 5.9296E?10 Crem ?0.709446614 9.842415377 48.75660354 2.89781E?12 6.99195E?10 Klf4 ?1.112826275 9.519315737 46.8956894 7.48672E?12 1.77986E?09 mt-Nd1 ?0.32338555 10.96639023 46.25136642 1.04014E?11 2.43694E?09 Ccdc117 ?0.779915449 9.506449603 44.82943889 2.14966E?11 4.96449E?09 Rpl36-ps3 0.580626548 9.694858712 44.65567952 2.34915E?11 5.34879E?09 Rgcc ?1.007094973 9.901750839 44.37211507 2.71527E?11 6.09654E?09 Rpl10-ps3 0.562706811 9.75031317 44.05381348 3.19471E?11 7.07475E?09 Rpl29 0.254087583 11.17785599 43.66475261 3.89728E?11 8.51398E?09 1810041H14Rik 0.786738522 9.425523912 42.88865415 5.79457E?11 1.249E?08 Eif2s3y 0.700036231 9.470445177 41.39992401 1.24062E?10 2.6305E?08 Rgs10 0.559350389 9.800303566 41.38062899 1.25293E?10 2.6305E?08 Cxcr6 0.490736441 10.46808826 41.26892433 1.32661E?10 2.74949E?08 Cxcl10 ?1.054785352 9.738782804 41.18958781 1.38157E?10 2.82714E?08 Hspa5 ?0.366763461 10.83492414 39.82661265 2.77538E?10 5.60834E?08 Apobec3 0.575215862 9.721277042 39.53476829 3.2227E?10 6.43188E?08 Slfn2 0.468248293 10.13448256 39.34340969 3.55451E?10 7.00758E?08 Dedd2 ?0.668986564 9.545498301 38.99006944 4.25967E?10 8.2966E?08 Fth1 ?0.247812637 11.54524749 38.79281379 4.7126E?10 9.0695E?08 Ptprcap 0.436049079 10.09758212 38.75789964 4.79765E?10 9.12456E?08 H2-K1 ?0.215473813 11.62297555 38.21117955 6.34876E?10 1.19342E?07

    TABLE-US-00034 TABLE 3R LPL-5 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Ubb ?0.667747794 13.05670984 265.7156028 9.74321E?60 1.57509E?55 Hsp90aa1 ?1.390021311 10.77771699 236.9250263 1.84164E?53 1.4886E?49 Hsp90ab1 ?0.877553386 11.22553208 214.086737 1.76318E?48 9.50116E?45 Dnajb1 ?2.034720283 10.05660873 212.4063054 4.10102E?48 1.65743E?44 Gm8730 0.851933726 10.24578436 206.9946236 6.21693E?47 2.01006E?43 Hspa1a ?3.201994123 10.61491682 204.4379641 2.24606E?46 6.05162E?43 Hspa8 ?0.790773697 12.33316572 185.8795749 2.52221E?42 5.82487E?39 Dnaja1 ?1.115058706 10.84366253 184.3752183 5.37272E?42 1.08569E?38 Rpl35 0.583624905 10.97458616 157.7700054 3.47453E?36 6.24103E?33 Hspe1 ?1.122714984 10.26957624 131.5655283 1.86225E?30 3.01051E?27 Malat1 ?0.529186268 14.79984657 126.899325 1.95441E?29 2.87227E?26 Gm9843 0.631738591 10.43647932 122.2523516 2.03268E?28 2.73835E?25 Rpl9-ps6 0.809660987 9.759551999 106.7457447 5.06108E?25 6.29365E?22 Rpl6l 0.633388877 10.12675606 100.075177 1.46721E?23 1.69421E?20 Gm9493 0.571951632 10.23323023 85.51740481 2.29671E?20 2.47524E?17 Rpl27-ps3 0.729614246 9.781981089 84.53046761 3.78339E?20 3.82265E?17 Rpl23a-ps3 0.473928723 10.60530193 83.90585402 5.18906E?20 4.9345E?17 Hsph1 ?1.177413258 9.464086511 74.92950145 4.87826E?18 4.38122E?15 Gm11808 0.601111889 10.07554584 72.80397873 1.43188E?17 1.2183E?14 Gm2000 0.802070822 9.596573833 70.33377085 5.00731E?17 4.04741E?14 Hspd1 ?0.890332867 9.826990882 67.99041097 1.64293E?16 1.26474E?13 Rpl32 0.263487778 12.19599702 64.29385621 1.07179E?15 7.87574E?13 Satb1 0.819131319 9.737592769 63.08567762 1.97908E?15 1.39103E?12 Rplp0 0.258058129 12.11340747 60.06163932 9.19327E?15 6.19244E?12 Ddx5 ?0.338656579 11.43119638 58.94745616 1.61939E?14 1.04716E?11 Rpl24 0.266833972 11.64961557 58.38416317 2.1562E?14 1.34066E?11 Fosb ?1.074649073 9.490138093 57.46868713 3.43403E?14 2.05609E?11 Rps12-ps3 0.587568991 9.824084704 55.69125561 8.47946E?14 4.89568E?11 Rbm3 0.389737471 10.63055567 55.06584393 1.16559E?13 6.49756E?11 Rpl10-ps3 0.711450504 9.547172531 54.99892102 1.20596E?13 6.49852E?11 Gm10073 0.644880368 9.623688778 52.69248962 3.9008E?13 2.0342E?10 Jund ?0.397700454 12.17425697 52.22636503 4.94576E?13 2.49854E?10 Prr7 ?0.639601864 10.04331603 52.06546063 5.36809E?13 2.62971E?10 Itgae 1.123657217 9.319838841 51.56974696 6.90982E?13 3.28542E?10 Eef2 0.29305387 11.17127454 50.2993106 1.31996E?12 6.05646E?10 Hspa1b ?1.112341319 9.284322097 50.25702435 1.34871E?12 6.05646E?10 Wdr89 0.439221506 10.3352908 49.53293438 1.95069E?12 8.52295E?10 Gm6133 0.523936873 9.843311357 47.94692977 4.37913E?12 1.86298E?09 Gm10263 0.852181403 9.264949602 47.75742561 4.82354E?12 1.99942E?09 Chchd2 ?0.36297706 10.50692552 47.31500857 6.04476E?12 2.44299E?09 Cd160 1.185837125 9.397166234 45.0097638 1.96054E?11 7.73028E?09 AY036118 0.801085044 9.298633911 44.02645037 3.23968E?11 1.24697E?08 Rpl29 0.291653565 10.96053826 43.6349489 3.95709E?11 1.48768E?08 Rpsa 0.268788369 11.41599406 43.26500152 4.78058E?11 1.75643E?08 Rps18-ps3 0.697609539 9.437736028 42.05344044 8.88128E?11 3.19055E?08 Rpl13-ps3 0.566952616 9.614334098 40.26690495 2.2153E?10 7.78534E?08 Gm10076 0.592960428 9.574070265 39.75217493 2.88319E?10 9.91696E?08 Uba52 0.418146824 10.13486888 39.60024883 3.11644E?10 1.04959E?07 Rps27rt 0.320302058 10.99650998 39.32759785 3.58341E?10 1.18223E?07 Rps26-ps1 0.70530421 9.384930749 38.94602666 4.35686E?10 1.38104E?07 Rpl15 0.323801677 10.62581306 38.96325972 4.31857E?10 1.38104E?07 mt-Co1 0.23982267 12.12069306 38.69051414 4.96617E?10 1.5439E?07 Rps11 0.186996755 12.06257295 37.34887398 9.87779E?10 3.01291E?07

    TABLE-US-00035 TABLE 3S LPL-6 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Rpl27-ps3 1.000892179 9.677930454 232.0702931 2.10792E?52 3.40767E?48 Hsp90aa1 ?1.210351983 10.47955889 202.9526524 4.73718E?46 3.60335E?42 Gm8730 0.756647108 10.38713922 202.2665877 6.68691E?46 3.60335E?42 Hspa1a ?3.243435226 9.933983278 198.1462725 5.3011E?45 2.14244E?41 Ubb ?0.574565023 12.67292372 180.0597604 4.70297E?41 1.52056E?37 Dnajb1 ?1.702734682 9.424438564 179.4808902 6.29164E?41 1.69518E?37 Wdr89 0.640598855 10.29329469 176.5192226 2.78904E?40 6.4411E?37 Gm9843 0.665821745 10.37262602 158.7124543 2.16256E?36 4.37E?33 Rpl9-ps6 0.849063028 9.614175562 142.8508334 6.33644E?33 1.13817E?29 Rpl6l 0.667371325 10.05028615 139.6822252 3.12395E?32 5.05018E?29 Dnaja1 ?0.936847633 10.37482583 137.9055231 7.64278E?32 1.12321E?28 Rpl35 0.474243562 11.1600212 133.1346392 8.44835E?31 1.13813E?27 Gm2000 0.900801116 9.411532299 131.3566669 2.06886E?30 2.5727E?27 Hsp90ab1 ?0.638919781 11.00174478 119.0868662 1.00242E?27 1.15751E?24 Malat1 ?0.541217017 14.12310599 110.177485 8.95985E?26 9.65633E?23 Rpl23a-ps3 0.532413845 10.61742407 109.6556439 1.16582E?25 1.17791E?22 Gm11808 0.647313204 9.982489755 106.0637432 7.14011E?25 6.78983E?22 Rpl10-ps3 0.93087986 9.304624268 102.2688908 4.84745E?24 4.35355E?21 Gm9493 0.557945752 10.19580436 100.6832828 1.07933E?23 9.18337E?21 Gm10073 0.803166764 9.440142111 94.98063058 1.92257E?22 1.55402E?19 Hspe1 ?0.787573629 10.02870964 81.44687154 1.80037E?19 1.38594E?16 Rps18-ps3 0.874430698 9.141091849 81.14090097 2.10185E?19 1.54447E?16 Gm6133 0.609584976 9.693751155 79.56643779 4.66279E?19 3.27734E?16 Gm10076 0.78780773 9.320701955 76.68494977 2.00526E?18 1.35071E?15 Gm10036 0.810805014 9.213962076 74.61076882 5.73296E?18 3.70716E?15 Rpl7a-ps5 0.908100854 9.003418976 71.62566534 2.60151E?17 1.61754E?14 Gm9844 0.795707711 9.253843776 70.30676693 5.07633E?17 3.0394E?14 Rpl36-ps3 0.826670812 9.144263881 68.68823221 1.15327E?16 6.65849E?14 AY036118 1.000399497 8.8526315 58.45878653 2.07594E?14 1.11866E?11 Lrrc58 0.828432135 9.10202243 58.49410236 2.03901E?14 1.11866E?11 Gm10250 0.841380514 8.998216795 56.86543552 4.66677E?14 2.43364E?11 Rpl15 0.321012912 10.70053263 55.03639559 1.18318E?13 5.9773E?11 Lmna ?1.033273941 9.199192092 53.22605295 2.9729E?13 1.45636E?10 Rps12-ps3 0.511506106 9.706346193 53.00742095 3.32291E?13 1.57994E?10 Uba52 0.452683276 10.01489978 51.85402704 5.97839E?13 2.76133E?10 Rpl13-ps3 0.621729495 9.346679461 48.71691561 2.95705E?12 1.32788E?09 Rpl29 0.258694868 11.28929882 46.03406713 1.16214E?11 5.07763E?09 Jund ?0.427242629 11.18646997 44.56718827 2.45776E?11 1.04558E?08 Junb ?0.438372159 11.38076207 43.97788044 3.32108E?11 1.37663E?08 Gm42418 0.725684143 8.981321303 42.89367766 5.77971E?11 2.33587E?08 Rps27rt 0.353162983 10.92491058 39.91812858 2.64834E?10 1.04422E?07 Chchd2 ?0.311772562 10.31406676 39.44480899 3.37464E?10 1.29891E?07 Rbm3 0.32207408 10.71438018 38.81533478 4.65854E?10 1.71628E?07 Rps26-ps1 0.718056862 9.019003364 38.80999724 4.67129E?10 1.71628E?07 Ddx5 ?0.278755543 10.97294105 37.85862663 7.60613E?10 2.73246E?07 Cdkn1a ?0.79324254 9.191708702 37.79083713 7.87508E?10 2.76758E?07

    TABLE-US-00036 TABLE 3T LPL-7 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Gm9843 0.679076895 10.68936848 85.64667834 2.15137E?20 2.46863E?16 Wdr89 0.741913181 10.65124957 84.95385849 3.0541E?20 2.46863E?16 Hspa8 ?0.660530188 12.56155791 81.61422367 1.65419E?19 8.9139E?16 Dnajb1 ?1.649042898 10.57015052 80.42659398 3.01707E?19 1.12709E?15 Hsp90ab1 ?0.784877451 11.53679216 80.14113929 3.48598E?19 1.12709E?15 Rpl27-ps3 0.886089505 10.09707719 79.75671931 4.23468E?19 1.14096E?15 Ubb ?0.498645077 13.14137294 79.18808927 5.64695E?19 1.30412E?15 Hsp90aa1 ?1.001997476 11.1674382 72.06971016 2.07728E?17 4.19766E?14 Rps27rt 0.538171151 11.50969557 70.70374503 4.15104E?17 7.45619E?14 Dnaja1 ?0.843376752 11.10860762 62.44563998 2.73902E?15 4.42789E?12 Rpl35 0.489450987 11.11111461 58.91362524 1.64747E?14 2.42119E?11 Malat1 ?0.461372669 14.92882516 58.52275262 2.00954E?14 2.70718E?11 Gm8730 0.632965858 10.46529795 56.55413113 5.46724E?14 6.79872E?11 Rpl9-ps6 0.735601623 10.06584632 49.89813247 1.61939E?12 1.86993E?09 Rps18-ps3 0.949329603 9.757081417 49.11636357 2.41219E?12 2.5997E?09 Rpl23a-ps3 0.516177035 10.81532166 45.89587466 1.24708E?11 1.26002E?08 Gm11808 0.599716998 10.3153324 44.88415961 2.09042E?11 1.98787E?08 Rpl6l 0.570669176 10.35956478 44.21034092 2.94919E?11 2.6487E?08 Hspe1 ?0.857543595 10.72567371 43.97285148 3.32962E?11 2.83298E?08 Zfp36l2 0.848268603 10.19106218 43.66380014 3.89918E?11 3.15171E?08 Rps12-ps3 0.693919785 10.07841838 42.55899212 6.85823E?11 5.27953E?08 Rpl13a 0.252632783 13.2005704 40.88104103 1.61783E?10 1.18881E?07 Rpl13-ps3 0.768495136 9.869026408 38.6191581 5.15108E?10 3.62054E?07

    TABLE-US-00037 TABLE 3U LPL-8 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Hspa1a ?4.46133106 9.487194307 303.1093704 6.92398E?68 1.11933E?63 Hsp90aa1 ?1.392806426 10.0823126 226.1411471 4.13928E?51 3.34578E?47 Dnajb1 ?1.900971523 8.769887068 179.91552 5.05668E?41 2.72488E?37 Rbm3 0.641674082 11.24281554 156.1928534 7.6829E?36 3.10504E?32 Gm8730 0.780025906 10.21672865 140.0001899 2.66178E?32 8.60607E?29 Hspa8 ?0.674361493 11.79442321 131.7442211 1.70194E?30 4.58559E?27 Hspa1b ?2.527753243 8.164889167 119.0070748 1.04357E?27 2.41004E?24 Malat1 ?0.913828296 12.8841938 103.0583966 3.25413E?24 6.48903E?21 Hsp90ab1 ?0.711121034 10.61566746 102.851369 3.6126E?24 6.48903E?21 Ubb ?0.618061035 12.11138082 88.5469168 4.96434E?21 8.02535E?18 Rplp0 0.386720187 12.56982724 80.78667159 2.51448E?19 3.69537E?16 Hsph1 ?1.509444326 8.280317907 75.08869481 4.50036E?18 6.06273E?15 Hspe1 ?0.879787784 9.328717894 71.0337361 3.51169E?17 4.36692E?14 Ubc ?0.738216636 10.18004219 70.86468308 3.82586E?17 4.41777E?14 Rpl35 0.450528289 11.14097897 68.69089929 1.15171E?16 1.24124E?13 Dnaja1 ?0.660080702 9.700853705 57.96742407 2.66495E?14 2.69259E?11 Rpl27-ps3 0.769290147 8.860371085 56.31921573 6.16104E?14 5.85878E?11 Gm2000 0.803158017 8.865313337 51.98860839 5.58236E?13 5.01358E?10 Gm10076 0.792181373 8.938297761 49.98552982 1.54884E?12 1.31782E?09 H2-K1 ?0.515701257 10.79228433 47.79738871 4.72621E?12 3.8202E?09 H2-Q7 ?0.62224609 9.790270068 47.25801338 6.2231E?12 4.79061E?09 Rpl3 0.295505002 11.93101795 45.77011002 1.32977E?11 9.7714E?09 Gm10073 0.771973453 8.899753731 44.51396459 2.52549E?11 1.77509E?08 Rpl10-ps3 0.794752736 8.799079764 43.51094877 4.21594E?11 2.83979E?08 Rpl13 0.295566129 12.2801827 43.04061266 5.36153E?11 3.46698E?08 Rpl32 0.300115748 12.37635341 42.59945259 6.71782E?11 4.17693E?08 Jund ?0.551080322 10.78767876 42.38224753 7.50683E?11 4.49465E?08 Rpl10a 0.389587396 11.15066686 41.45258432 1.20765E?10 6.73201E?08 Isg15 ?1.276987474 8.306648902 41.51123525 1.17195E?10 6.73201E?08 Rps18-ps3 0.999323395 8.484337215 40.88283659 1.61634E?10 8.70994E?08 Fosb ?1.399459966 8.173149877 40.59851305 1.86949E?10 9.74908E?08 Rps18 0.315086971 12.25780987 40.12474383 2.38252E?10 1.17306E?07 Rpl18a 0.239964236 12.26488225 40.11487131 2.39459E?10 1.17306E?07 Rpl18 0.269829889 11.37724478 39.31803433 3.601E?10 1.71217E?07 Rps4x 0.281160834 11.75181977 39.26100381 3.70773E?10 1.71255E?07

    TABLE-US-00038 TABLE 3V LPL-9 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Hspa1a ?3.208006096 10.63021086 97.57359097 5.18914E?23 8.38877E?19 Ubb ?0.760618634 12.38390677 60.1939278 8.5957E?15 6.9479E?11 Gzma 2.923731333 12.03426076 56.95387224 4.46155E?14 2.40418E?10 Hspa1b ?2.544460073 9.795567163 53.74015844 2.28838E?13 9.24847E?10 Hsp90aa1 ?1.50442418 10.20067248 42.7113425 6.34433E?11 2.05125E?07 Ccr9 2.221991151 9.9641527 40.55436946 1.9122E?10 5.15212E?07

    TABLE-US-00039 TABLE 3W LPL-10 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Hspa1a ?3.279080597 9.77749525 66.6687553 3.21186E?16 5.19229E?12 Malat1 ?0.906756376 13.82786584 48.20036621 3.84816E?12 3.11047E?08 Dnajb1 ?1.9736233 9.859710517 47.29375921 6.11065E?12 3.29282E?08 Ubb ?0.62876509 12.23504229 27.75960127 1.37365E?07 0.00055516 Dnaja1 ?1.070648437 10.15612377 21.95233617 2.79506E?06 0.009037003

    TABLE-US-00040 TABLE 3X LPL-11 Ctrl vs. KO GeneSymbol logFC logCPM LR PValue FDR Gm9843 1.152747768 10.86191498 107.7332038 3.07507E?25 4.97117E?21 Rps27rt 0.936042362 11.6006599 98.51241281 3.22994E?23 2.61076E?19 Uba52 1.259153747 10.29857567 89.76924229 2.67623E?21 1.25309E?17 Gm11808 1.174254179 10.36510957 89.13644101 3.685E?21 1.25309E?17 Rpl6l 1.12148656 10.43521049 89.03662136 3.87571E?21 1.25309E?17 Gm8730 1.178269708 10.48527954 88.52016702 5.03192E?21 1.35577E?17 Rpl23a-ps3 0.97111709 11.05711726 87.23097408 9.65597E?21 2.22998E?17 Rpl9-ps6 1.361164957 10.11088474 85.89170087 1.90065E?20 3.41399E?17 Gm9493 1.04400959 10.54876454 85.92861245 1.8655E?20 3.41399E?17 Rpl27-ps3 1.236714099 10.05185113 73.33936538 1.09169E?17 1.76482E?14 Gm2000 1.283533859 9.738432617 68.91660374 1.02716E?16 1.50956E?13 Rpl35 0.739766449 11.21870405 65.61762991 5.47468E?16 7.37531E?13 Gm10036 1.489161877 9.448810832 64.09537827 1.18539E?15 1.47408E?12 Wdr89 0.805998267 10.97502014 59.64331287 1.13705E?14 1.31297E?11 Gm10073 1.302016708 9.701129124 56.54648834 5.48853E?14 5.91517E?11 Gm10076 1.506003095 9.391444214 50.19653071 1.39094E?12 1.40537E?09 Rpl15 0.715629478 10.88701252 45.13720707 1.83702E?11 1.7469E?08 Rpl36-ps3 1.287158449 9.442853364 41.85453352 9.83225E?11 8.83046E?08 Gm6133 0.942044122 9.994215819 40.6518122 1.81918E?10 1.54784E?07

    TABLE-US-00041 TABLE 3Y GWAS GeneSymbol LPL-2 logFC LPL-2 FDR LPL-9 logFC LPL-9 FDR LPL-7 logFC LPL-7 FDR GWAS? Zfp36l2 0.757 2.01E?14 1.283 6.35E?03 0.848 3.15E?08 TRUE Tnfsf8 ?0.869 1.14E?10 ?0.918 4.04E?01 ?0.359 9.46E?01 TRUE Gpr18 0.867 1.82E?10 1.208 8.21E?02 0.102 1.00E+00 TRUE Ctsw 0.398 1.07E?08 0.231 1.00E+00 0.379 2.95E?01 TRUE Ccr5 0.704 1.48E?08 0.294 1.00E+00 0.239 7.62E?01 TRUE Krtcap2 ?0.312 3.46E?07 ?0.676 5.81E?03 ?0.003 1.00E+00 TRUE Rpl3 0.149 2.99E?06 0.169 9.15E?01 0.195 2.69E?03 TRUE Crem ?0.459 3.59E?05 ?0.286 1.00E+00 ?0.580 2.86E?02 TRUE Cd28 ?0.289 5.47E?05 0.156 1.00E+00 0.237 3.59E?01 TRUE Lsp1 0.201 7.10E?04 ?0.014 1.00E+00 0.098 1.00E+00 TRUE Il7r 0.351 7.68E?04 0.540 8.46E?01 0.910 8.48E?04 TRUE Irf1 ?0.433 1.05E?03 0.143 1.00E+00 ?0.190 1.00E+00 TRUE Itga4 0.408 2.71E?03 0.595 9.15E?01 0.030 1.00E+00 TRUE Apobr ?0.325 7.72E?03 ?0.049 1.00E+00 0.009 1.00E+00 TRUE Tnfrsf9 ?0.127 9.01E?01 ?0.515 9.15E?01 ?0.836 8.81E?03 TRUE Ccnd3 ?0.283 1.64E?02 ?0.302 1.00E+00 0.212 9.60E?01 TRUE Csf2 ?0.426 1.96E?02 ?0.124 1.00E+00 0.000 1.00E+00 TRUE Fermt3 0.314 2.58E?02 0.043 1.00E+00 0.117 1.00E+00 TRUE Dpm3 ?0.287 3.08E?02 0.124 1.00E+00 0.129 1.00E+00 TRUE Gnb2 0.204 3.37E?02 ?0.279 1.00E+00 0.375 7.83E?02 TRUE Dap 0.340 3.38E?02 0.719 7.71E?01 ?0.084 1.00E+00 TRUE Cd74 ?0.489 3.79E?02 ?0.385 1.00E+00 ?0.539 3.37E?01 TRUE Fos ?0.534 4.09E?02 ?0.878 8.71E?01 ?0.802 3.89E?02 TRUE St13 ?0.293 4.51E?02 0.536 9.15E?01 ?0.079 1.00E+00 TRUE Fam213b ?0.144 5.40E?02 0.000 1.00E+00 0.051 1.00E+00 TRUE Cd6 0.228 5.53E?02 ?0.222 1.00E+00 ?0.067 1.00E+00 TRUE Dnajb4 ?0.343 6.08E?02 ?0.126 1.00E+00 ?0.059 1.00E+00 TRUE Ptprc 0.165 6.25E?02 0.265 1.00E+00 ?0.053 1.00E+00 TRUE Socs1 ?0.338 6.39E?02 ?0.358 1.00E+00 ?0.233 9.77E?01 TRUE Ncf4 0.292 6.51E?02 ?0.207 1.00E+00 0.381 5.41E?01 TRUE Rps14 ?0.004 1.00E+00 ?0.003 1.00E+00 0.138 6.58E?02 TRUE Vmp1 0.273 6.92E?02 0.818 6.99E?01 0.202 9.46E?01 TRUE Cd226 0.350 7.33E?02 0.189 1.00E+00 0.086 1.00E+00 TRUE Hdac7 0.285 7.88E?02 0.174 1.00E+00 0.124 1.00E+00 TRUE Pim3 ?0.293 2.16E?01 ?0.032 1.00E+00 ?0.652 8.14E?02 TRUE Traf3ip2 0.286 9.01E?02 0.462 7.75E?01 ?0.003 1.00E+00 TRUE Ets1 0.162 9.20E?02 ?0.032 1.00E+00 0.108 9.68E?01 TRUE Lpxn 0.211 9.69E?02 0.245 1.00E+00 0.258 7.35E?01 TRUE Dnajb1 ?2.545 7.19E?117 ?1.766 3.18E?06 ?1.649 1.13E?15 FALSE Ubb ?0.719 6.98E?110 ?0.761 6.95E?11 ?0.499 1.30E?15 FALSE Hspa1a ?4.265 1.73E?105 ?3.208 8.39E?19 ?1.733 5.26E?06 FALSE Hsp90aa1 ?1.539 9.57E?97 ?1.504 2.05E?07 ?1.002 4.20E?14 FALSE Hsp90ab1 ?1.045 1.54E?91 ?0.600 2.04E?02 ?0.785 1.13E?15 FALSE Malat1 ?0.788 3.06E?83 ?0.680 1.62E?06 ?0.461 2.71E?11 FALSE Dnaja1 ?1.161 4.16E?78 ?0.342 9.15E?01 ?0.843 4.43E?12 FALSE Lmna ?1.945 1.16E?69 ?1.519 8.60E?04 ?0.532 2.38E?01 FALSE Hspa8 ?0.679 3.81E?68 0.219 9.15E?01 ?0.661 8.91E?16 FALSE Gm8730 0.782 1.16E?56 0.971 5.54E?06 0.633 6.80E?11 FALSE Rpl27-ps3 1.053 8.09E?50 0.805 2.26E?01 0.886 1.14E?15 FALSE Rgcc ?1.711 1.89E?45 ?0.813 6.43E?01 ?0.460 7.35E?01 FALSE Jund ?0.676 6.22E?42 ?0.962 8.04E?06 ?0.377 2.69E?03 FALSE Rpl35 0.509 2.46E?40 0.492 1.94E?02 0.489 2.42E?11 FALSE Gm10076 1.043 8.24E?36 0.361 1.00E+00 0.608 6.02E?04 FALSE Hspe1 ?0.936 2.25E?31 ?0.529 7.11E?01 ?0.858 2.83E?08 FALSE Rbm3 0.522 1.00E?30 0.689 2.20E?03 0.154 7.29E?01 FALSE Hspa1b ?1.577 8.12E?29 ?2.544 9.25E?10 ?1.026 1.09E?03 FALSE Rpl6I 0.619 1.52E?27 0.448 7.04E?01 0.571 2.65E?08 FALSE Rpl9-ps6 0.729 4.55E?26 0.328 1.00E+00 0.736 1.87E?09 FALSE Plac8 1.004 1.74E?25 0.891 8.71E?02 0.027 1.00E+00 FALSE Rpl10-ps3 0.892 5.90E?25 0.219 1.00E+00 0.590 2.76E?03 FALSE Rplp0 0.288 2.35E?24 0.335 8.03E?02 0.162 5.42E?02 FALSE Gm2000 0.840 1.60E?23 0.555 8.76E?01 0.761 2.50E?06 FALSE AY036118 1.145 3.92E?23 ?0.264 1.00E+00 0.648 9.48E?03 FALSE Rps11 0.296 3.92E?23 0.236 5.32E?01 0.243 1.39E?04 FALSE Gm9843 0.527 2.80E?22 0.157 1.00E+00 0.679 2.47E?16 FALSE Crip1 ?0.543 9.93E?22 ?0.131 1.00E+00 ?0.778 1.45E?06 FALSE Atf3 ?1.251 9.16E?21 ?0.652 6.82E?01 ?0.067 1.00E+00 FALSE Fosb ?1.291 1.68E?20 ?0.525 4.01E?01 ?0.170 1.00E+00 FALSE Ccl5 1.130 1.94E?20 1.434 3.77E?04 ?0.184 7.29E?01 FALSE H2-D1 ?0.246 2.77E?18 ?0.296 1.15E?01 ?0.151 8.69E?02 FALSE Gzma 1.725 5.05E?18 2.924 2.40E?10 1.884 2.33E?06 FALSE Capg ?0.679 5.65E?18 ?0.770 1.12E?01 0.058 1.00E+00 FALSE Hsph1 ?1.043 8.62E?18 ?0.588 9.15E?01 ?0.608 5.42E?02 FALSE AW112010 0.445 9.11E?18 0.011 1.00E+00 ?0.335 2.06E?02 FALSE Rps12-ps3 0.611 3.47E?17 0.168 1.00E+00 0.694 5.28E?08 FALSE Rpl23a-ps3 0.404 5.51E?17 0.279 9.15E?01 0.516 1.26E?08 FALSE Cd160 1.385 5.51E?17 1.394 4.54E?04 0.356 7.73E?01 FALSE Fth1 ?0.335 7.81E?17 ?0.305 6.82E?01 ?0.210 1.13E?01 FALSE Wdr89 0.370 1.58E?10 0.105 1.00E+00 0.742 2.47E?16 FALSE Rpl32 0.227 4.23E?16 0.259 2.34E?01 0.200 5.19E?04 FALSE Gm10073 0.680 5.48E?16 0.067 1.00E+00 0.567 5.13E?04 FALSE Gimap4 0.436 9.14E?16 0.030 1.00E+00 0.301 1.42E?02 FALSE Odc1 ?0.776 1.42E?15 ?0.233 1.00E+00 ?0.406 1.41E?01 FALSE Klf4 ?0.945 1.52E?15 0.000 1.00E+00 ?0.373 9.46E?01 FALSE Gm9493 0.455 2.68E?15 0.186 1.00E+00 0.476 8.63E?06 FALSE Epsti1 0.517 6.73E?15 0.125 1.00E+00 0.223 8.69E?01 FALSE Mat2a ?0.791 7.03E?15 0.545 9.50E?01 ?0.246 8.90E?01 FALSE Chchd2 ?0.377 7.45E?15 ?0.264 9.44E?01 ?0.256 1.72E?01 FALSE Eef2 0.257 6.16E?14 0.224 9.15E?01 0.279 5.69E?04 FALSE Hspd1 ?0.730 6.37E?14 ?0.022 1.00E+00 ?0.736 1.21E?04 FALSE Tnfsf11 ?1.017 6.37E?14 ?0.485 1.00E+00 ?0.517 2.38E?01 FALSE Rps27rt 0.153 3.85E?02 0.017 1.00E+00 0.538 7.46E?14 FALSE Rpsa 0.270 7.83E?14 0.161 9.96E?01 0.109 7.35E?01 FALSE Ubc ?0.410 8.17E?14 ?0.272 9.31E?01 ?0.333 1.87E?02 FALSE Limd2 0.519 1.01E?13 0.323 9.15E?01 0.021 1.00E+00 FALSE Ddx5 ?0.322 1.29E?13 0.096 1.00E+00 ?0.242 1.87E?02 FALSE Slc25a5 0.364 1.37E?13 0.436 4.18E?01 0.106 1.00E+00 FALSE Calm2 ?0.418 1.37E?13 ?0.269 9.43E?01 ?0.250 2.68E?01 FALSE Coro1a 0.346 1.79E?13 ?0.211 9.15E?01 0.026 1.00E+00 FALSE Rpl7a-ps5 0.793 2.08E?13 0.495 9.82E?01 0.855 2.71E?05 FALSE Kdm6b ?0.839 2.14E?13 ?0.042 1.00E+00 ?0.228 9.94E?01 FALSE Cd7 1.097 2.81E?13 1.933 2.19E?05 ?0.262 1.00E+00 FALSE mt-Co1 0.235 1.31E?12 0.240 7.06E?01 0.134 5.30E?01 FALSE Gm11808 0.461 2.96E?12 ?0.153 1.00E+00 0.600 1.99E?08 FALSE Ptprcap 0.468 3.65E?12 0.222 1.00E+00 ?0.099 1.00E+00 FALSE Rpl29 0.262 6.50E?12 0.377 2.07E?01 0.306 2.80E?04 FALSE Fam110a ?0.790 7.03E?12 ?0.231 1.00E+00 ?0.585 1.38E?01 FALSE Rpl39I ?0.660 1.20E?11 0.063 1.00E+00 ?0.011 1.00E+00 FALSE H2-K1 ?0.262 1.91E?11 ?0.387 1.01E?01 ?0.129 5.03E?01 FALSE Rpl15 0.305 2.06E?11 0.353 6.35E?01 0.300 5.49E?03 FALSE Rpl13-ps3 0.582 2.23E?11 0.125 1.00E+00 0.768 3.62E?07 FALSE Rps6 0.188 3.84E?11 0.218 6.23E?01 0.136 1.36E?01 FALSE Klrk1 ?0.696 9.06E?11 ?1.397 1.40E?01 ?0.182 1.00E+00 FALSE Lrrc58 0.664 1.14E?10 0.153 1.00E+00 0.342 5.86E?01 FALSE mt-Nd1 ?0.317 1.96E?10 ?0.384 4.52E?01 ?0.093 9.89E?01 FALSE Cdkn1a ?0.799 2.00E?10 ?0.160 1.00E+00 ?1.077 2.18E?05 FALSE Pycard 0.552 3.15E?10 0.411 9.15E?01 0.196 9.47E?01 FALSE Rpl24 0.196 6.92E?10 0.424 5.06E?03 0.103 7.35E?01 FALSE Rps26-ps1 0.687 9.14E?10 0.339 1.00E+00 0.587 1.68E?02 FALSE Lgals1 ?0.300 1.31E?09 ?0.372 8.36E?01 ?0.200 8.31E?01 FALSE Rpl18 0.193 1.53E?09 0.239 5.56E?01 0.107 6.97E?01 FALSE Tuba1b ?0.597 1.83E?09 ?0.023 1.00E+00 ?0.159 1.00E+00 FALSE Anxa1 ?0.789 2.26E?09 ?0.508 1.00E+00 ?0.071 1.00E+00 FALSE Eif3f 0.262 2.26E?09 0.628 1.66E?03 0.129 7.72E?01 FALSE Rps18-ps3 0.518 1.84E?06 ?0.035 1.00E+00 0.949 2.60E?09 FALSE Arhgdib 0.265 2.99E?09 0.107 1.00E+00 0.070 1.00E+00 FALSE S100a11 ?0.309 3.72E?09 ?0.571 2.09E?02 ?0.140 9.38E?01 FALSE Gm10250 0.669 4.08E?09 0.479 9.50E?01 0.594 2.22E?02 FALSE Actg1 0.252 5.73E?09 ?0.085 1.00E+00 ?0.255 4.14E?02 FALSE Rgs10 0.576 7.56E?09 0.509 8.47E?01 0.223 1.00E+00 FALSE Cox7a2l 0.344 9.72E?09 0.562 2.23E?01 0.225 5.06E?01 FALSE Ifrd1 ?0.475 1.07E?08 ?0.537 9.15E?01 ?0.207 9.46E?01 FALSE B2m ?0.150 1.93E?08 ?0.197 5.39E?01 ?0.153 8.64E?03 FALSE Gm10020 0.682 2.04E?08 0.130 1.00E+00 0.394 4.80E?01 FALSE Hspa5 ?0.331 2.08E?08 ?0.159 1.00E+00 ?0.539 9.48E?07 FALSE Cd44 ?0.531 2.73E?08 ?0.394 1.00E+00 0.199 9.77E?01 FALSE Id2 ?0.415 4.68E?08 ?0.270 9.15E?01 ?0.485 1.10E?02 FALSE Shisa5 0.242 5.38E?08 0.220 9.15E?01 0.160 6.70E?01 FALSE Srsf2 ?0.454 5.55E?08 ?0.145 1.00E+00 ?0.231 7.35E?01 FALSE Itgae 0.822 6.06E?08 1.438 2.78E?03 0.097 1.00E+00 FALSE H2-Q7 ?0.287 6.64E?08 ?0.330 9.15E?01 ?0.204 2.09E?01 FALSE Nmrk1 ?0.649 6.64E?08 ?0.216 1.00E+00 ?0.349 7.39E?01 FALSE Gm10036 0.543 7.07E?08 0.284 1.00E+00 0.599 3.19E?03 FALSE Sh3bgrl3 ?0.214 7.55E?08 ?0.185 9.15E?01 ?0.135 8.78E?01 FALSE Txn1 ?0.358 7.94E?08 ?0.019 1.00E+00 ?0.413 1.07E?02 FALSE Ly6e ?0.296 1.04E?07 ?0.168 1.00E+00 ?0.115 1.00E+00 FALSE Pim1 ?0.384 1.17E?07 1.112 7.90E?02 ?0.147 1.00E+00 FALSE Rpl22l1 0.264 1.17E?07 0.667 2.78E?03 0.241 1.31E?01 FALSE Prr7 ?0.462 1.18E?07 ?0.038 1.00E+00 ?0.359 6.64E?01 FALSE Rpl13a 0.112 8.57E?04 0.204 5.26E?01 0.253 1.19E?07 FALSE Ifitm1 ?1.211 2.18E?07 ?0.065 1.00E+00 ?0.042 1.00E+00 FALSE Sertad1 ?0.661 2.31E?07 ?0.315 1.00E+00 ?0.515 1.82E?01 FALSE Ybx1 ?0.266 2.52E?07 ?0.190 1.00E+00 ?0.142 8.82E?01 FALSE Cldnd1 ?0.520 2.52E?07 ?1.374 2.60E?04 ?0.132 1.00E+00 FALSE Tmem234 0.427 3.46E?07 0.378 9.96E?01 0.107 1.00E+00 FALSE Bola2 ?0.480 3.67E?07 ?0.411 9.33E?01 ?0.111 1.00E+00 FALSE Serpinb6b 0.564 3.86E?07 0.097 1.00E+00 0.312 8.36E?01 FALSE Gm6133 0.402 3.94E?07 0.500 8.71E?01 0.658 3.94E?07 FALSE Rps3a1 0.171 4.56E?07 0.190 9.15E?01 0.229 1.32E?03 FALSE Ccr9 0.870 4.80E?06 2.222 5.15E?07 0.716 1.43E?01 FALSE Cacybp ?0.535 6.43E?07 ?0.424 9.96E?01 ?0.502 6.32E?02 FALSE Tspan31 ?0.578 7.07E?07 0.251 1.00E+00 ?0.153 1.00E+00 FALSE Gmfg 0.309 7.13E?07 0.002 1.00E+00 0.102 1.00E+00 FALSE Gm12840 0.587 7.30E?07 0.093 1.00E+00 ?0.072 1.00E+00 FALSE Acp5 0.557 8.50E?07 0.657 7.11E?01 0.205 1.00E+00 FALSE Cd69 ?0.535 8.50E?07 ?0.128 1.00E+00 0.325 7.35E?01 FALSE Rps28 0.023 9.39E?01 0.234 8.27E?01 0.346 8.78E?07 FALSE Cd82 ?0.350 1.39E?06 ?0.388 9.15E?01 0.045 1.00E+00 FALSE Rps19 0.000 1.00E+00 0.135 1.00E+00 0.309 1.69E?06 FALSE Gm10709 0.581 1.74E?06 0.044 1.00E+00 0.313 6.24E?01 FALSE Cox4i1 0.210 1.86E?06 0.261 8.76E?01 0.053 1.00E+00 FALSE Gzmb 0.744 1.86E?06 0.314 1.00E+00 ?0.177 1.00E+00 FALSE Il22 ?0.801 2.21E?06 ?0.122 1.00E+00 ?0.588 3.81E?02 FALSE Calm1 ?0.233 2.38E?06 ?0.152 1.00E+00 ?0.075 1.00E+00 FALSE Zc3h12a ?0.459 2.45E?06 ?0.204 1.00E+00 0.018 1.00E+00 FALSE Ier5l ?0.608 2.59E?06 0.058 1.00E+00 ?0.481 4.56E?01 FALSE Fus ?0.382 3.48E?06 ?0.622 4.98E?01 ?0.343 1.31E?01 FALSE Klhl6 0.545 3.88E?06 0.258 1.00E+00 0.321 9.46E?01 FALSE Atp2b1 ?0.507 4.14E?06 ?0.202 1.00E+00 ?0.344 6.89E?01 FALSE Tbc1d10c 0.448 4.33E?06 0.319 9.28E?01 0.419 1.97E?01 FALSE H2-Q6 ?0.388 4.58E?06 ?0.416 9.15E?01 ?0.205 8.35E?01 FALSE Ctla2a ?0.437 5.15E?06 ?0.890 2.05E?01 ?0.240 8.18E?01 FALSE Cnn2 0.317 5.69E?06 0.169 1.00E+00 0.139 1.00E+00 FALSE Selplg 0.263 6.24E?06 0.320 9.15E?01 0.298 2.54E?01 FALSE Apobec3 0.443 7.33E?06 0.324 1.00E+00 0.170 1.00E+00 FALSE Crip2 ?0.681 8.46E?06 0.156 1.00E+00 ?0.339 6.80E?01 FALSE Bcl2a1a 0.582 8.84E?06 0.326 9.15E?01 ?0.028 1.00E+00 FALSE Hist1h1c 0.371 9.01E?02 ?0.174 1.00E+00 1.117 1.07E?05 FALSE Ifitm2 ?0.485 1.18E?05 ?0.775 6.49E?01 ?0.027 1.00E+00 FALSE Eif5 ?0.383 1.28E?05 ?0.338 1.00E+00 ?0.187 8.82E?01 FALSE Ppia ?0.172 1.38E?05 ?0.314 2.26E?01 ?0.053 1.00E+00 FALSE Satb1 0.475 1.39E?05 ?0.205 1.00E+00 0.324 7.61E?01 FALSE Rps5 0.028 8.66E?01 0.096 1.00E+00 0.258 1.39E?05 FALSE Arhgap9 0.469 1.60E?05 0.213 1.00E+00 0.467 9.90E?02 FALSE Eif2s3y 0.559 1.63E?05 0.762 6.37E?01 0.492 1.87E?01 FALSE Sub1 ?0.158 6.18E?03 ?0.302 8.30E?01 ?0.380 1.71E?05 FALSE Tagln2 ?0.242 9.64E?04 ?0.971 1.72E?05 0.083 1.00E+00 FALSE Jun ?0.681 1.22E?03 ?1.899 2.03E?05 0.149 1.00E+00 FALSE Rpl6 0.138 2.04E?05 0.169 9.15E?01 0.244 3.06E?04 FALSE Ptges3 ?0.451 2.22E?05 ?0.287 1.00E+00 ?0.122 1.00E+00 FALSE Ccdc184 ?0.532 2.42E?05 ?0.178 9.15E?01 ?0.033 1.00E+00 FALSE Eif4a2 ?0.402 2.49E?05 ?0.396 9.15E?01 0.040 1.00E+00 FALSE Rgs2 ?0.520 2.53E?05 ?0.607 9.15E?01 ?0.616 3.81E?02 FALSE Actn2 0.565 2.95E?05 0.175 1.00E+00 0.383 7.61E?01 FALSE Jmjd1c ?0.520 3.37E?05 ?0.004 1.00E+00 ?0.343 7.35E?01 FALSE Ass1 0.465 3.41E?05 1.193 8.71E?02 ?0.025 1.00E+00 FALSE Rpl21 0.004 1.00E+00 ?0.013 1.00E+00 0.280 3.44E?05 FALSE Tubb4b ?0.507 3.63E?05 0.023 1.00E+00 ?0.338 7.29E?01 FALSE Gramd1a 0.446 3.76E?05 0.451 9.15E?01 0.157 1.00E+00 FALSE Rps10 0.160 4.16E?05 0.207 9.15E?01 0.232 9.89E?03 FALSE mt-Cytb ?0.203 4.75E?05 ?0.410 2.07E?01 ?0.177 6.78E?01 FALSE Hmgb2 0.286 4.75E?05 ?0.076 1.00E+00 0.025 1.00E+00 FALSE Rpl36-ps3 0.337 7.29E?03 0.158 1.00E+00 0.696 4.88E?05 FALSE Sp100 0.392 5.36E?05 0.196 1.00E+00 0.355 2.26E?01 FALSE Vgll4 ?0.413 5.44E?05 0.179 1.00E+00 ?0.248 8.30E?01 FALSE Rinl 0.443 6.06E?05 ?0.003 1.00E+00 0.315 6.24E?01 FALSE Gem ?0.687 6.58E?05 ?0.047 1.00E+00 ?0.785 5.35E?02 FALSE Stk17b 0.285 6.58E?05 0.217 1.00E+00 ?0.007 1.00E+00 FALSE Unc5cl 0.525 6.58E?05 0.511 9.15E?01 ?0.257 8.90E?01 FALSE Lck 0.228 6.70E?05 0.086 1.00E+00 0.178 5.86E?01 FALSE Gltscr2 0.253 6.94E?05 0.453 7.11E?01 0.092 1.00E+00 FALSE Ict1 0.464 6.94E?05 0.038 1.00E+00 0.288 7.39E?01 FALSE Rpl10a 0.178 7.01E?05 0.338 4.62E?01 0.199 8.74E?02 FALSE Gpi1 0.328 7.47E?05 0.231 1.00E+00 ?0.080 1.00E+00 FALSE Ltb 0.339 7.56E?05 0.547 7.11E?01 0.241 7.35E?01 FALSE Tmsb4x ?0.094 5.14E?03 ?0.213 2.65E?01 ?0.251 8.21E?05 FALSE Calr ?0.310 8.23E?05 ?0.523 7.11E?01 ?0.162 9.46E?01 FALSE Cycs ?0.330 8.59E?05 ?0.521 7.60E?01 ?0.294 5.16E?01 FALSE Cpm ?0.558 1.03E?04 0.220 9.96E?01 ?0.358 5.63E?01 FALSE Madd 0.465 1.10E?04 ?0.029 1.00E+00 0.173 1.00E+00 FALSE Anxa2 ?0.351 1.11E?04 ?0.462 9.15E?01 ?0.193 9.77E?01 FALSE Chn2 0.571 1.11E?04 0.645 8.59E?01 ?0.004 1.00E+00 FALSE Ube2s ?0.304 1.17E?04 ?0.578 6.42E?01 ?0.208 7.35E?01 FALSE Atp5g1 ?0.344 1.24E?04 ?0.227 1.00E+00 ?0.045 1.00E+00 FALSE Tuba4a ?0.504 1.25E?04 ?0.415 1.00E+00 ?0.435 4.02E?01 FALSE Gm9844 0.390 1.29E?04 ?0.103 1.00E+00 0.307 7.04E?01 FALSE Uba52 0.273 1.30E?04 ?0.143 1.00E+00 0.420 5.40E?04 FALSE Il21r ?0.350 1.39E?04 0.082 1.00E+00 ?0.455 1.09E?01 FALSE Rpl13 0.043 5.16E?01 0.116 1.00E+00 0.207 1.39E?04 FALSE Rps24 ?0.020 9.33E?01 0.172 9.15E?01 0.242 1.48E?04 FALSE mt-Nd2 ?0.311 1.70E?04 ?0.428 9.15E?01 ?0.059 1.00E+00 FALSE Eif4a1 ?0.219 1.85E?04 0.476 5.04E?01 ?0.152 8.26E?01 FALSE Ifi27 ?0.389 1.90E?04 ?0.811 1.03E?01 ?0.310 6.69E?01 FALSE Fau 0.018 9.31E?01 0.069 1.00E+00 0.200 1.92E?04 FALSE Bcl2l1 ?0.508 1.97E?04 0.300 1.00E+00 ?0.394 6.06E?01 FALSE Furin ?0.428 2.07E?04 ?0.818 5.16E?01 ?0.120 1.00E+00 FALSE Serf2 ?0.177 2.12E?04 ?0.289 6.92E?01 ?0.081 1.00E+00 FALSE Gm10263 0.514 2.21E?04 0.320 1.00E+00 0.319 7.35E?01 FALSE Rasal3 0.453 2.31E?04 0.084 1.00E+00 0.217 9.46E?01 FALSE Frmd4b ?0.570 2.34E?04 0.034 1.00E+00 ?0.402 3.83E?01 FALSE Tnfrsf4 ?0.387 2.59E?04 ?0.559 9.15E?01 ?0.768 7.68E?04 FALSE H1f0 0.574 2.68E?04 ?0.545 9.15E?01 0.441 7.35E?01 FALSE Bin2 0.322 2.72E?04 0.800 2.52E?01 0.338 4.67E?01 FALSE Lztfl1 0.556 2.81E?04 0.477 9.59E?01 0.462 5.49E?01 FALSE Rpl18a 0.033 6.68E?01 0.190 7.11E?01 0.194 2.95E?04 FALSE Klrc2 ?0.516 3.06E?04 ?0.324 1.00E+00 ?0.068 1.00E+00 FALSE Rps23 ?0.023 9.01E?01 0.175 8.17E?01 0.192 3.35E?04 FALSE Irf7 ?0.557 3.50E?04 ?0.108 1.00E+00 ?0.188 1.00E+00 FALSE Ypel3 0.379 3.68E?04 ?0.191 1.00E+00 0.089 1.00E+00 FALSE Sap30 ?0.491 3.79E?04 ?0.177 1.00E+00 0.023 1.00E+00 FALSE Csk 0.418 3.92E?04 0.021 1.00E+00 0.031 1.00E+00 FALSE Uhrf2 ?0.455 4.30E?04 ?0.840 5.49E?01 ?0.097 1.00E+00 FALSE Romo1 ?0.379 4.47E?04 ?0.138 1.00E+00 ?0.258 7.62E?01 FALSE Agr2 ?0.159 4.57E?04 0.061 1.00E+00 0.000 1.00E+00 FALSE Il17a ?0.068 5.25E?01 ?1.985 4.62E?04 ?0.031 1.00E+00 FALSE Tnf ?0.450 4.66E?04 0.257 1.00E+00 ?0.009 1.00E+00 FALSE Gimap5 0.365 4.76E?04 0.260 1.00E+00 0.304 4.85E?01 FALSE Maff ?0.514 5.01E?04 0.000 1.00E+00 0.057 1.00E+00 FALSE Ptma ?0.190 5.61E?04 ?0.201 1.00E+00 ?0.178 3.32E?01 FALSE Ppid ?0.465 5.99E?04 ?0.153 1.00E+00 ?0.236 9.46E?01 FALSE Rpl17 0.019 9.31E?01 0.113 1.00E+00 0.194 6.89E?04 FALSE Rpl31 0.157 8.80E?03 0.091 1.00E+00 0.336 6.95E?04 FALSE Ccl1 ?0.840 7.05E?04 ?0.183 1.00E+00 ?0.043 1.00E+00 FALSE Nr3c1 ?0.464 7.10E?04 ?0.208 1.00E+00 ?0.183 1.00E+00 FALSE Rasgrp4 ?0.291 3.75E?02 ?1.110 7.22E?04 0.070 9.80E?01 FALSE Rnf166 0.410 7.68E?04 0.114 1.00E+00 0.282 7.35E?01 FALSE Coq10b ?0.414 7.70E?04 ?0.038 1.00E+00 ?0.243 7.99E?01 FALSE Chka ?0.447 8.50E?04 0.061 1.00E+00 ?0.138 1.00E+00 FALSE Cotl1 0.231 8.55E?04 0.017 1.00E+00 ?0.043 1.00E+00 FALSE Cd47 0.207 9.38E?04 0.187 1.00E+00 0.210 7.35E?01 FALSE Ralgds ?0.442 9.42E?04 0.199 1.00E+00 ?0.194 9.77E?01 FALSE Arpc5 0.235 9.42E?04 0.010 1.00E+00 ?0.173 8.55E?01 FALSE Samsn1 ?0.352 9.42E?04 ?0.418 1.00E+00 ?0.180 1.00E+00 FALSE Dgka 0.449 9.42E?04 ?0.189 1.00E+00 0.185 1.00E+00 FALSE Cd40lg ?0.455 9.53E?04 ?0.173 1.00E+00 ?0.187 1.00E+00 FALSE BC021614 0.460 9.64E?04 0.777 7.25E?01 0.087 1.00E+00 FALSE Tsc22d3 0.336 9.41E?03 0.415 1.00E+00 0.729 9.86E?04 FALSE Sfn ?0.582 9.92E?04 ?0.544 7.82E?01 ?0.498 4.50E?01 FALSE Hnrnpa3 0.229 1.00E?03 ?0.019 1.00E+00 0.038 1.00E+00 FALSE Gm42726 0.400 1.15E?03 0.275 9.15E?01 0.553 4.64E?02 FALSE Ccnd2 ?0.336 1.15E?03 ?0.198 1.00E+00 ?0.473 8.21E?02 FALSE Rps29 0.070 2.05E?01 0.193 9.15E?01 0.241 1.22E?03 FALSE Rpl14 ?0.002 1.00E+00 0.048 1.00E+00 0.222 1.23E?03 FALSE Gm5424 0.407 1.24E?03 0.493 6.82E?01 0.013 1.00E+00 FALSE Eif1 ?0.128 1.29E?03 ?0.146 1.00E+00 ?0.063 9.81E?01 FALSE Bag3 ?0.406 1.29E?03 ?0.115 1.00E+00 ?0.500 1.69E?01 FALSE Eif5a ?0.213 1.36E?03 ?0.025 1.00E+00 ?0.186 7.35E?01 FALSE Slc5a3 ?0.354 1.41E?03 0.000 1.00E+00 ?0.174 1.00E+00 FALSE Traf4 ?0.468 1.42E?03 0.135 1.00E+00 ?0.030 1.00E+00 FALSE Traf3ip3 0.439 1.42E?03 0.463 9.74E?01 0.429 3.54E?01 FALSE Mrps6 ?0.503 1.42E?03 0.144 1.00E+00 ?0.431 6.93E?01 FALSE Nfkbia ?0.266 1.43E?03 ?0.226 1.00E+00 0.030 1.00E+00 FALSE Rps27 ?0.114 1.53E?03 0.050 1.00E+00 0.173 1.69E?02 FALSE Cd38 0.495 1.66E?03 0.176 1.00E+00 ?0.090 1.00E+00 FALSE Gimap7 0.261 1.67E?03 0.433 7.11E?01 ?0.016 1.00E+00 FALSE Lcp1 0.222 1.68E?03 0.064 1.00E+00 0.139 9.46E?01 FALSE Gpr171 0.316 1.71E?03 0.317 1.00E+00 0.039 1.00E+00 FALSE Gpsm3 0.278 1.72E?03 ?0.308 9.34E?01 0.162 9.46E?01 FALSE Tuba1a ?0.333 1.72E?03 ?0.654 5.39E?01 ?0.328 6.03E?01 FALSE Gm8186 0.417 1.72E?03 0.148 1.00E+00 0.284 7.56E?01 FALSE Ctbp1 0.350 1.72E?03 0.181 1.00E+00 0.040 1.00E+00 FALSE Tcf7 0.426 1.76E?03 ?0.109 1.00E+00 0.256 9.37E?01 FALSE Ndufs5 ?0.348 1.76E?03 ?0.573 7.11E?01 ?0.148 1.00E+00 FALSE Fasl ?0.351 1.76E?03 0.453 1.00E+00 ?0.156 1.00E+00 FALSE Ier3ip1 ?0.331 1.76E?03 ?0.268 1.00E+00 0.084 1.00E+00 FALSE Itpkb ?0.409 1.80E?03 0.716 8.04E?01 ?0.035 1.00E+00 FALSE Rpl4 0.115 1.80E?03 0.137 1.00E+00 0.137 2.87E?01 FALSE Ccnl1 ?0.372 2.03E?03 0.028 1.00E+00 ?0.276 7.39E?01 FALSE Cd48 0.286 2.03E?03 0.114 1.00E+00 ?0.043 1.00E+00 FALSE Hnrnpab ?0.358 2.03E?03 0.257 1.00E+00 ?0.292 7.35E?01 FALSE Insig1 ?0.488 2.03E?03 0.553 9.68E?01 ?0.456 3.80E?01 FALSE Tceb2 ?0.198 2.03E?03 ?0.050 1.00E+00 ?0.130 9.46E?01 FALSE Gm5093 0.340 2.15E?02 ?0.071 1.00E+00 0.630 2.06E?03 FALSE Tpm4 0.336 2.10E?03 ?0.086 1.00E+00 0.312 7.35E?01 FALSE Ahsa1 ?0.379 2.15E?03 0.328 1.00E+00 ?0.250 8.11E?01 FALSE Haghl 0.414 2.15E?03 ?0.073 1.00E+00 0.013 1.00E+00 FALSE Rpl8 0.118 2.22E?03 0.207 8.72E?01 0.226 2.89E?03 FALSE Tob1 ?0.420 2.23E?03 0.073 1.00E+00 ?0.367 7.29E?01 FALSE Nop10 ?0.316 2.23E?03 ?0.495 7.75E?01 ?0.339 3.59E?01 FALSE Nsa2 0.337 2.28E?03 0.175 1.00E+00 0.020 1.00E+00 FALSE Nasp ?0.429 2.31E?03 ?0.047 1.00E+00 0.232 9.46E?01 FALSE Il4ra ?0.403 2.35E?03 0.012 1.00E+00 ?0.137 1.00E+00 FALSE Rac2 0.145 2.40E?03 ?0.118 1.00E+00 0.090 9.46E?01 FALSE Gm11273 0.410 2.41E?03 0.413 1.00E+00 0.163 1.00E+00 FALSE Cd4 ?0.070 9.13E?01 ?0.953 2.41E?03 0.120 1.00E+00 FALSE Arf4 ?0.256 2.52E?03 ?0.236 1.00E+00 ?0.350 1.59E?01 FALSE Supt4a 0.231 2.64E?03 0.021 1.00E+00 0.131 9.97E?01 FALSE Tmsb10 ?0.111 2.66E?03 ?0.469 8.84E?03 0.103 8.47E?01 FALSE Nab1 0.378 2.66E?03 0.461 1.00E+00 0.123 1.00E+00 FALSE Rps18 0.107 3.65E?03 0.136 9.37E?01 0.206 2.69E?03 FALSE Gm10260 0.230 2.14E?01 0.200 1.00E+00 0.643 2.69E?03 FALSE Ly6a ?0.125 5.25E?01 ?0.565 2.23E?01 ?0.647 2.74E?03 FALSE Ppp1cc 0.008 1.00E+00 0.247 1.00E+00 ?0.500 2.74E?03 FALSE Gm26917 0.351 3.02E?03 0.441 9.15E?01 0.539 9.89E?03 FALSE Gm10269 0.401 3.16E?03 0.159 1.00E+00 0.267 7.97E?01 FALSE Sema4d 0.376 3.19E?03 0.077 1.00E+00 ?0.148 1.00E+00 FALSE Rpl34 0.044 5.40E?01 0.073 1.00E+00 0.193 3.32E?03 FALSE Ap2s1 0.315 3.87E?03 ?0.121 1.00E+00 0.012 1.00E+00 FALSE Lag3 ?0.110 9.31E?01 ?0.703 8.71E?01 ?1.023 3.92E?03 FALSE Hbegf ?0.210 3.96E?03 0.000 1.00E+00 ?0.054 9.77E?01 FALSE Tsix 0.391 3.96E?03 0.221 9.15E?01 0.099 1.00E+00 FALSE Btf3 0.145 4.03E?03 0.201 9.75E?01 0.079 1.00E+00 FALSE Gm42418 0.397 4.06E?03 ?0.702 7.35E?01 0.160 1.00E+00 FALSE 3830403N18Rik 0.436 4.08E?03 0.617 6.82E?01 0.045 9.46E?01 FALSE Hk2 ?0.498 4.17E?03 ?0.358 9.17E?01 0.037 1.00E+00 FALSE Csf1 ?0.559 4.41E?03 ?0.831 2.44E?01 ?0.107 1.00E+00 FALSE Cxcr3 0.369 4.42E?03 0.544 8.76E?01 0.085 1.00E+00 FALSE Mt1 0.658 4.42E?03 0.321 9.15E?01 ?0.354 9.46E?01 FALSE Nkg7 0.163 4.42E?03 0.126 1.00E+00 ?0.166 4.19E?01 FALSE Nudc ?0.360 4.43E?03 0.092 1.00E+00 ?0.028 1.00E+00 FALSE Vasp 0.214 4.50E?03 0.150 1.00E+00 0.011 1.00E+00 FALSE Cd9 ?0.494 4.78E?03 ?0.244 1.00E+00 0.244 9.77E?01 FALSE Gzmk 0.579 7.04E?03 1.524 5.05E?03 0.280 3.28E?01 FALSE Actr3 0.192 5.14E?03 0.060 1.00E+00 ?0.017 1.00E+00 FALSE Lef1 0.365 2.75E?02 ?0.360 1.00E+00 0.708 5.26E?03 FALSE Gm20186 0.449 5.31E?03 ?0.193 1.00E+00 0.177 1.00E+00 FALSE 1810041H14Rik 0.428 5.38E?03 1.449 1.80E?02 ?0.083 1.00E+00 FALSE Pdlim2 0.408 5.65E?03 1.038 1.88E?01 0.589 4.34E?02 FALSE 1600014C10Rik 0.431 5.93E?03 0.217 1.00E+00 ?0.037 1.00E+00 FALSE Cyp51 ?0.427 5.93E?03 0.596 9.15E?01 ?0.344 7.35E?01 FALSE Prdx1 ?0.237 5.93E?03 ?0.475 7.11E?01 ?0.336 1.78E?01 FALSE Sigmar1 ?0.319 5.95E?03 ?0.198 1.00E+00 ?0.106 1.00E+00 FALSE 1810058124Rik 0.323 6.04E?03 ?0.052 1.00E+00 0.148 1.00E+00 FALSE Rps7 0.104 6.04E?03 0.186 9.15E?01 0.176 2.29E?02 FALSE Eno1 0.233 6.04E?03 ?0.361 9.15E?01 0.324 2.78E?01 FALSE Ndufa6 0.227 6.06E?03 0.140 1.00E+00 0.180 8.39E?01 FALSE Gm10146 0.151 6.18E?03 ?0.119 1.00E+00 0.076 1.00E+00 FALSE Dusp14 ?0.426 6.18E?03 0.324 9.15E?01 ?0.222 9.77E?01 FALSE Il18r1 0.033 1.00E+00 ?1.158 6.35E?03 0.235 9.46E?01 FALSE Cuedc2 0.428 6.51E?03 ?0.185 1.00E+00 0.051 1.00E+00 FALSE Gyg 0.417 6.55E?03 0.060 1.00E+00 0.031 1.00E+00 FALSE Ptafr ?0.416 6.56E?03 ?0.186 9.15E?01 0.025 1.00E+00 FALSE Rpl13a-ps1 0.322 4.64E?02 ?0.227 1.00E+00 0.637 6.57E?03 FALSE Klrb1f 0.353 6.58E?03 0.484 9.15E?01 0.020 1.00E+00 FALSE Psme2b 0.400 6.68E?03 ?0.054 1.00E+00 0.240 9.46E?01 FALSE Rras2 0.450 6.68E?03 ?0.666 8.71E?01 0.120 1.00E+00 FALSE Naca 0.143 6.88E?03 0.104 1.00E+00 0.081 1.00E+00 FALSE Rps4x 0.084 5.61E?02 0.223 7.11E?01 0.200 6.95E?03 FALSE Arl6ip1 ?0.237 7.04E?03 ?0.085 1.00E+00 0.120 1.00E+00 FALSE Fabp5 ?0.413 7.29E?03 0.290 1.00E+00 ?0.114 1.00E+00 FALSE Bhlhe40 ?0.178 7.29E?03 0.584 9.15E?01 0.150 9.46E?01 FALSE Ifi27l2a ?0.453 7.29E?03 ?0.400 1.00E+00 ?0.400 5.03E?01 FALSE Gch1 ?0.354 7.34E?03 ?0.211 1.00E+00 ?0.177 1.00E+00 FALSE Pdcd6ip 0.333 7.47E?03 0.094 1.00E+00 0.163 1.00E+00 FALSE Tmem30a 0.354 7.50E?03 0.730 6.80E?01 ?0.044 1.00E+00 FALSE Nkiras2 0.385 7.50E?03 0.432 9.94E?01 ?0.114 1.00E+00 FALSE mt-Nd4 ?0.178 7.50E?03 ?0.397 6.32E?01 ?0.183 7.35E?01 FALSE 5730508B09Rik 0.411 7.56E?03 0.289 1.00E+00 0.126 1.00E+00 FALSE Myl6 ?0.135 7.97E?03 ?0.218 9.15E?01 ?0.269 3.29E?02 FALSE Atp5e ?0.169 8.21E?03 ?0.317 9.14E?01 ?0.217 4.85E?01 FALSE Wdr1 0.295 8.31E?03 ?0.266 1.00E+00 0.122 1.00E+00 FALSE Atp5c1 0.206 8.34E?03 0.374 8.76E?01 0.219 7.35E?01 FALSE Itgb1 ?0.468 8.89E?03 ?0.618 8.72E?01 0.090 1.00E+00 FALSE Cox5b 0.196 9.36E?03 0.240 1.00E+00 ?0.081 1.00E+00 FALSE Serpinb9 0.353 9.55E?03 ?0.480 9.50E?01 0.299 8.20E?01 FALSE Plcxd2 0.420 9.75E?03 0.231 1.00E+00 0.296 8.28E?01 FALSE Lmnb1 ?0.311 9.75E?03 ?0.390 1.00E+00 ?0.461 5.14E?02 FALSE Adrbk1 0.381 9.85E?03 ?0.165 1.00E+00 0.340 6.97E?01 FALSE Nop56 ?0.353 9.85E?03 ?0.093 1.00E+00 ?0.215 9.46E?01 FALSE Cox6a1 ?0.185 1.01E?02 ?0.139 1.00E+00 ?0.212 6.21E?01 FALSE Eif3e 0.189 1.05E?02 0.450 6.82E?01 0.126 9.63E?01 FALSE Pabpc1 0.143 1.07E?02 0.174 1.00E+00 0.076 1.00E+00 FALSE Ier5 ?0.307 1.09E?02 ?0.209 1.00E+00 ?0.233 9.46E?01 FALSE Ywhae 0.259 1.09E?02 0.123 1.00E+00 ?0.257 7.35E?01 FALSE Ndufs2 0.339 1.09E?02 0.051 1.00E+00 0.250 8.90E?01 FALSE Gpr87 0.190 1.10E?02 0.000 1.00E+00 0.049 7.35E?01 FALSE Tox ?0.224 1.14E?02 ?0.463 8.31E?01 0.143 1.00E+00 FALSE Dnajb6 ?0.216 1.16E?02 ?0.168 1.00E+00 ?0.067 1.00E+00 FALSE Atp8a2 0.389 1.16E?02 0.651 8.72E?01 0.250 8.07E?01 FALSE Upf3a 0.388 1.19E?02 ?0.135 1.00E+00 0.269 8.90E?01 FALSE Qrfp 0.330 1.20E?02 0.048 1.00E+00 0.024 1.00E+00 FALSE PhIda1 ?0.420 1.21E?02 ?1.539 1.35E?02 ?0.750 3.16E?02 FALSE Mta3 0.395 1.22E?02 0.655 8.76E?01 0.344 7.29E?01 FALSE Kcnk5 ?0.422 1.24E?02 0.004 1.00E+00 ?0.163 1.00E+00 FALSE Myo1g 0.320 1.24E?02 0.229 1.00E+00 0.108 1.00E+00 FALSE Leprotl1 0.262 1.27E?02 ?0.297 1.00E+00 0.065 1.00E+00 FALSE Cbfa2t3 ?0.182 1.29E?02 0.000 1.00E+00 0.000 1.00E+00 FALSE Fis1 0.262 1.32E?02 0.128 1.00E+00 0.027 1.00E+00 FALSE Gpx1 ?0.347 1.39E?02 ?0.165 1.00E+00 ?0.418 3.81E?01 FALSE Ctla4 ?0.212 1.36E?01 ?0.682 8.76E?01 ?0.553 1.42E?02 FALSE Bptf ?0.374 1.45E?02 ?0.037 1.00E+00 ?0.242 9.46E?01 FALSE Rplp2 ?0.097 1.45E?02 ?0.067 1.00E+00 0.169 8.47E?02 FALSE S1pr4 0.281 1.55E?02 0.045 1.00E+00 0.322 5.96E?01 FALSE Ndufa10 0.312 1.56E?02 ?0.009 1.00E+00 ?0.005 1.00E+00 FALSE Zfp706 0.270 1.59E?02 ?0.057 1.00E+00 ?0.138 1.00E+00 FALSE Lcn4 0.424 1.59E?02 ?0.167 1.00E+00 0.295 5.47E?01 FALSE Ndufa5 ?0.315 1.60E?02 ?0.163 1.00E+00 ?0.082 1.00E+00 FALSE Hnrnpf 0.157 1.61E?02 0.229 9.64E?01 0.005 1.00E+00 FALSE Pglyrp1 0.344 1.61E?02 0.297 1.00E+00 0.190 1.00E+00 FALSE Ccni 0.337 1.61E?02 0.026 1.00E+00 0.053 1.00E+00 FALSE Usp28 ?0.102 1.65E?02 0.000 1.00E+00 ?0.008 1.00E+00 FALSE Adrb2 ?0.424 1.65E?02 0.065 1.00E+00 ?0.173 1.00E+00 FALSE Cox7c ?0.160 1.65E?02 ?0.563 2.25E?02 ?0.196 5.04E?01 FALSE Klra3 0.342 1.66E?02 0.176 1.00E+00 0.000 1.00E+00 FALSE Traf1 ?0.207 1.67E?02 ?0.224 1.00E+00 0.048 1.00E+00 FALSE Idi1 ?0.396 1.67E?02 0.034 1.00E+00 ?0.128 1.00E+00 FALSE Capzb 0.178 1.67E?02 ?0.097 1.00E+00 ?0.183 7.35E?01 FALSE Jtb 0.329 1.68E?02 ?0.142 1.00E+00 ?0.236 9.46E?01 FALSE Tiparp ?0.384 1.70E?02 0.238 1.00E+00 ?0.154 1.00E+00 FALSE Arpp19 ?0.196 1.71E?02 ?0.612 1.15E?01 ?0.077 1.00E+00 FALSE Creg1 ?0.356 1.77E?02 ?0.250 1.00E+00 ?0.091 1.00E+00 FALSE Ten1 0.365 1.77E?02 0.388 1.00E+00 0.065 1.00E+00 FALSE Grcc10 0.340 1.81E?02 ?0.682 5.39E?01 0.383 5.47E?01 FALSE Grk6 0.312 1.82E?02 0.307 1.00E+00 0.284 7.35E?01 FALSE 2210011C24Rik ?0.347 1.84E?02 ?0.271 1.00E+00 ?0.095 1.00E+00 FALSE Racgap1 0.399 1.87E?02 0.222 1.00E+00 0.518 1.15E?01 FALSE Bcl3 0.382 1.92E?02 0.215 1.00E+00 0.069 1.00E+00 FALSE Slc7a5 ?0.363 1.92E?02 0.493 6.82E?01 ?0.261 9.46E?01 FALSE Rnf44 0.380 1.93E?02 0.634 7.11E?01 ?0.204 9.97E?01 FALSE Rcn2 ?0.368 1.94E?02 ?0.171 1.00E+00 ?0.038 1.00E+00 FALSE G3bp2 ?0.325 1.94E?02 0.028 1.00E+00 ?0.415 2.68E?01 FALSE Arf6 ?0.223 1.95E?02 0.089 1.00E+00 ?0.014 1.00E+00 FALSE Sqstm1 ?0.262 1.95E?02 0.318 1.00E+00 ?0.488 8.47E?02 FALSE Cmtm7 0.296 1.97E?02 1.027 8.51E?02 0.302 6.14E?01 FALSE Rhof ?0.357 2.01E?02 0.368 1.00E+00 ?0.245 9.46E?01 FALSE Atp1b3 0.309 2.02E?02 ?0.247 1.00E+00 0.171 1.00E+00 FALSE H2afx ?0.371 2.02E?02 0.061 1.00E+00 0.075 1.00E+00 FALSE Tmem176a ?0.510 2.04E?02 ?0.984 5.60E?01 0.024 1.00E+00 FALSE Tiprl ?0.311 2.06E?02 0.187 1.00E+00 ?0.049 1.00E+00 FALSE Gla ?0.349 2.10E?02 0.000 1.00E+00 0.021 1.00E+00 FALSE Mgst2 0.388 2.10E?02 ?0.115 1.00E+00 ?0.022 1.00E+00 FALSE Lgals3 ?0.235 2.11E?02 ?0.463 9.15E?01 0.243 9.55E?01 FALSE Rgs3 0.392 2.11E?02 ?0.055 1.00E+00 ?0.033 1.00E+00 FALSE Pttg1 ?0.339 2.11E?02 ?0.324 1.00E+00 ?0.268 7.97E?01 FALSE Ncald 0.356 2.13E?02 0.427 1.00E+00 ?0.122 1.00E+00 FALSE Gadd45b ?0.198 4.60E?01 0.177 1.00E+00 ?0.729 2.24E?02 FALSE Malt1 0.138 7.69E?01 ?0.002 1.00E+00 0.595 2.26E?02 FALSE Dgat1 ?0.058 9.75E?01 ?0.018 1.00E+00 ?0.636 2.27E?02 FALSE Ubxn1 0.282 2.27E?02 ?0.490 9.15E?01 0.257 7.41E?01 FALSE Minos1 ?0.224 2.30E?02 ?0.557 4.66E?01 0.016 1.00E+00 FALSE Dctpp1 ?0.347 2.43E?02 ?0.144 1.00E+00 ?0.639 3.29E?02 FALSE Arrb2 0.318 2.45E?02 0.438 9.15E?01 0.178 1.00E+00 FALSE Ifngr1 0.031 9.32E?01 ?0.282 1.00E+00 0.312 2.50E?02 FALSE Mcpt1 ?0.103 2.50E?02 ?0.176 9.15E?01 0.000 1.00E+00 FALSE Kcnab2 0.335 2.61E?02 ?0.066 1.00E+00 0.257 9.26E?01 FALSE Nme1 ?0.256 2.61E?02 ?0.026 1.00E+00 ?0.321 6.24E?01 FALSE Ehd3 0.385 2.62E?02 ?0.101 1.00E+00 0.040 1.00E+00 FALSE Slbp ?0.286 2.62E?02 ?0.230 1.00E+00 ?0.194 9.46E?01 FALSE Sparc ?0.187 2.63E?02 0.000 1.00E+00 ?0.042 1.00E+00 FALSE Ywhab 0.282 2.72E?02 ?0.069 1.00E+00 0.027 1.00E+00 FALSE Umps ?0.356 2.75E?02 0.090 1.00E+00 0.140 1.00E+00 FALSE Zfand2b 0.348 2.78E?02 ?0.257 1.00E+00 0.097 1.00E+00 FALSE Vamp4 0.345 2.78E?02 ?0.247 1.00E+00 ?0.037 1.00E+00 FALSE Pcgf1 0.323 2.78E?02 0.091 1.00E+00 ?0.006 1.00E+00 FALSE Srgap3 ?0.127 2.79E?02 0.000 1.00E+00 ?0.087 7.97E?01 FALSE H2-DMa 0.363 2.83E?02 ?0.277 1.00E+00 ?0.222 9.46E?01 FALSE Dkkl1 ?0.357 2.83E?02 ?0.728 7.11E?01 ?0.088 1.00E+00 FALSE Camk2n1 ?0.374 2.84E?02 0.020 1.00E+00 ?0.148 1.00E+00 FALSE Dnajb9 ?0.335 2.84E?02 ?0.029 1.00E+00 ?0.028 1.00E+00 FALSE Irf2 0.347 2.86E?02 0.340 1.00E+00 0.224 9.01E?01 FALSE Gas7 ?0.410 2.91E?02 ?0.252 1.00E+00 ?0.095 1.00E+00 FALSE Eef1a1 0.015 9.92E?01 0.083 1.00E+00 0.160 2.91E?02 FALSE Dtx1 0.383 2.92E?02 1.064 2.57E?01 0.003 1.00E+00 FALSE Tra2b ?0.246 2.98E?02 ?0.198 1.00E+00 ?0.211 7.41E?01 FALSE Zfp207 ?0.006 1.00E+00 1.181 3.02E?02 0.121 1.00E+00 FALSE Wac ?0.329 3.02E?02 0.143 1.00E+00 ?0.013 1.00E+00 FALSE H2-Q10 ?0.344 3.05E?02 0.052 1.00E+00 ?0.276 9.46E?01 FALSE Ino80b 0.357 3.06E?02 0.345 1.00E+00 0.163 1.00E+00 FALSE Dnajb2 ?0.299 3.06E?02 ?0.203 1.00E+00 ?0.143 1.00E+00 FALSE Abhd2 ?0.391 3.07E?02 0.058 1.00E+00 ?0.104 1.00E+00 FALSE Hmha1 0.213 3.07E?02 ?0.187 1.00E+00 0.225 7.12E?01 FALSE Rbm39 ?0.145 3.08E?02 0.144 1.00E+00 ?0.057 1.00E+00 FALSE Cox17 ?0.225 3.08E?02 ?0.523 4.52E?01 ?0.216 7.61E?01 FALSE Lpcat4 0.358 3.10E?02 0.324 9.15E?01 0.187 9.97E?01 FALSE Rps3 0.083 3.10E?02 0.221 6.98E?01 0.147 6.94E?02 FALSE Eef1b2 0.105 4.60E?01 0.269 1.00E+00 0.352 3.11E?02 FALSE Pltp 0.026 1.00E+00 ?1.002 3.15E?02 0.104 1.00E+00 FALSE Pcbd2 ?0.363 3.18E?02 ?0.327 1.00E+00 ?0.114 1.00E+00 FALSE Eif3h 0.148 3.18E?02 0.241 9.75E?01 0.194 6.12E?01 FALSE Fam103a1 0.235 3.20E?02 0.525 8.76E?01 ?0.045 1.00E+00 FALSE H2-Ke6 ?0.334 3.20E?02 0.192 1.00E+00 0.039 1.00E+00 FALSE Ube2v1 0.305 3.32E?02 ?0.059 1.00E+00 0.246 8.36E?01 FALSE Tbc1d22a 0.117 7.96E?01 ?1.021 3.39E?02 0.012 1.00E+00 FALSE Gimap6 0.179 3.39E?02 0.096 1.00E+00 ?0.086 1.00E+00 FALSE Mien1 ?0.260 3.43E?02 ?0.462 9.15E?01 ?0.345 5.06E?01 FALSE Cbwd1 0.228 3.43E?02 0.007 1.00E+00 0.168 9.56E?01 FALSE Kxd1 0.305 3.43E?02 0.388 1.00E+00 0.295 7.35E?01 FALSE Rpl39 0.101 3.43E?02 0.185 9.15E?01 0.134 4.67E?01 FALSE Dedd2 ?0.264 1.92E?01 ?0.225 1.00E+00 ?0.657 3.47E?02 FALSE Tbc1d17 0.340 3.50E?02 0.289 1.00E+00 0.240 9.46E?01 FALSE Rpl23a ?0.080 3.50E?02 0.004 1.00E+00 0.100 5.96E?01 FALSE Coro1b 0.310 3.50E?02 0.281 1.00E+00 0.261 8.78E?01 FALSE Tmem71 0.354 3.62E?02 ?0.056 1.00E+00 0.410 5.04E?01 FALSE Tmem9b 0.291 3.64E?02 0.253 1.00E+00 0.108 1.00E+00 FALSE S100a6 ?0.059 8.25E?01 ?0.248 1.00E+00 ?0.564 3.72E?02 FALSE Fam49b 0.219 3.75E?02 0.090 1.00E+00 ?0.029 1.00E+00 FALSE Fundc2 0.288 3.77E?02 0.126 1.00E+00 0.407 3.32E?01 FALSE Smim24 0.243 3.77E?02 ?0.154 9.15E?01 0.055 1.00E+00 FALSE Pdia6 ?0.296 3.79E?02 ?0.657 7.11E?01 ?0.255 8.90E?01 FALSE Klrc1 ?0.278 3.82E?02 ?0.712 8.76E?01 0.430 7.35E?01 FALSE Pelp1 ?0.266 3.85E?02 ?0.372 9.96E?01 ?0.099 1.00E+00 FALSE Ncl ?0.195 3.85E?02 0.012 1.00E+00 ?0.067 1.00E+00 FALSE Efcab7 0.106 3.88E?02 0.055 1.00E+00 ?0.062 1.00E+00 FALSE Arl4a ?0.350 3.88E?02 0.488 9.15E?01 ?0.074 1.00E+00 FALSE Id3 ?0.404 3.89E?02 ?0.430 1.00E+00 0.036 1.00E+00 FALSE Gm27166 ?0.090 3.95E?02 ?0.218 1.00E+00 0.000 1.00E+00 FALSE Tnfaip8 ?0.284 3.97E?02 ?0.300 1.00E+00 0.123 1.00E+00 FALSE Rps26 0.132 4.28E?02 0.146 1.00E+00 ?0.003 1.00E+00 FALSE Map2k3 ?0.280 4.28E?02 ?0.009 1.00E+00 ?0.411 4.91E?01 FALSE Pfn1 0.098 4.30E?02 ?0.050 1.00E+00 ?0.053 1.00E+00 FALSE Acoxl 0.266 4.33E?02 0.135 1.00E+00 ?0.180 9.46E?01 FALSE Cxcl10 ?0.504 4.35E?02 ?0.424 8.76E?01 0.135 1.00E+00 FALSE Mbd2 ?0.321 4.35E?02 ?0.438 1.00E+00 ?0.068 1.00E+00 FALSE Fcrls ?0.105 4.35E?02 0.064 1.00E+00 ?0.074 9.46E?01 FALSE Arpc1b 0.128 4.42E?02 ?0.038 1.00E+00 ?0.078 1.00E+00 FALSE Tomm7 ?0.200 4.43E?02 ?0.506 5.07E?01 ?0.005 1.00E+00 FALSE Idh2 0.319 4.43E?02 0.190 1.00E+00 0.073 1.00E+00 FALSE Gbp2 0.396 4.43E?02 ?0.357 1.00E+00 ?0.043 1.00E+00 FALSE Rpl28 0.143 4.43E?02 0.150 1.00E+00 0.112 9.46E?01 FALSE Pgk1 0.324 4.46E?02 0.573 8.76E?01 0.211 7.35E?01 FALSE Caprin1 0.343 4.49E?02 0.070 1.00E+00 ?0.007 1.00E+00 FALSE Rpl7 0.101 4.51E?02 0.178 9.96E?01 0.157 3.06E?01 FALSE Chmp6 0.336 4.53E?02 0.110 1.00E+00 0.248 9.40E?01 FALSE Mtx2 ?0.324 4.55E?02 ?0.280 1.00E+00 0.122 1.00E+00 FALSE Cmc1 ?0.009 1.00E+00 ?0.099 1.00E+00 ?0.605 4.62E?02 FALSE Gm4950 0.216 3.59E?01 0.474 9.96E?01 0.569 4.66E?02 FALSE Clic1 0.142 4.69E?02 0.072 1.00E+00 0.102 1.00E+00 FALSE Junb ?0.182 4.71E?02 ?0.519 7.11E?01 ?0.132 9.47E?01 FALSE Rasl11a ?0.452 4.71E?02 0.081 1.00E+00 ?0.054 1.00E+00 FALSE Celf2 0.236 4.81E?02 0.202 1.00E+00 0.116 1.00E+00 FALSE Rps15a ?0.038 6.52E?01 0.006 1.00E+00 0.153 4.90E?02 FALSE Mapkap1 0.130 7.72E?01 ?1.060 4.90E?02 ?0.216 1.00E+00 FALSE Man1a ?0.336 5.01E?02 ?0.184 1.00E+00 ?0.014 1.00E+00 FALSE Vcpip1 ?0.311 5.17E?02 0.086 1.00E+00 ?0.164 1.00E+00 FALSE Zfp280d 0.083 9.31E?01 0.025 1.00E+00 0.564 5.20E?02 FALSE Pstpip1 0.278 5.28E?02 0.256 1.00E+00 0.157 1.00E+00 FALSE Gramd3 0.212 5.32E?02 0.502 9.26E?01 0.260 5.46E?01 FALSE Edaradd ?0.285 5.32E?02 0.033 1.00E+00 ?0.097 7.83E?01 FALSE Mrpl46 ?0.108 8.72E?01 ?0.102 1.00E+00 ?0.596 5.35E?02 FALSE Ecm1 ?0.279 5.39E?02 ?0.297 1.00E+00 ?0.129 1.00E+00 FALSE Gmfb 0.328 5.39E?02 0.229 1.00E+00 ?0.132 1.00E+00 FALSE Rps16 ?0.068 1.32E?01 ?0.051 1.00E+00 0.154 5.42E?02 FALSE Atp6v0e ?0.084 6.84E?01 ?0.439 7.11E?01 ?0.408 5.42E?02 FALSE Ppp2ca ?0.214 5.53E?02 ?0.178 1.00E+00 ?0.029 1.00E+00 FALSE Spint2 ?0.307 5.56E?02 ?0.062 1.00E+00 ?0.036 1.00E+00 FALSE Gm10031 0.188 5.60E?02 0.051 1.00E+00 0.033 1.00E+00 FALSE Fam134b 0.334 5.61E?02 ?0.002 1.00E+00 0.052 1.00E+00 FALSE Wdr45b ?0.324 5.61E?02 ?1.048 1.03E?01 0.043 1.00E+00 FALSE Lypla1 0.291 5.63E?02 0.042 1.00E+00 0.041 1.00E+00 FALSE B4galnt4 0.211 5.68E?02 0.102 1.00E+00 ?0.115 7.35E?01 FALSE Gstt2 0.331 5.77E?02 0.544 9.15E?01 ?0.080 1.00E+00 FALSE Sh2d2a 0.242 5.78E?02 0.730 5.39E?01 0.125 1.00E+00 FALSE Mllt3 ?0.024 1.00E+00 ?1.062 5.81E?02 0.144 1.00E+00 FALSE H2-DMb1 0.138 5.85E?02 ?0.045 1.00E+00 ?0.032 1.00E+00 FALSE BC055324 ?0.090 5.85E?02 0.000 1.00E+00 0.094 7.35E?01 FALSE Csrnp1 ?0.331 5.85E?02 0.202 1.00E+00 ?0.254 9.40E?01 FALSE Zyg11b 0.329 5.85E?02 0.333 1.00E+00 ?0.155 1.00E+00 FALSE Hadha 0.321 5.85E?02 0.074 1.00E+00 ?0.224 9.61E?01 FALSE Dnaja4 ?0.385 5.87E?02 ?0.358 1.00E+00 ?0.514 3.37E?01 FALSE Abcg2 ?0.115 5.89E?02 0.000 1.00E+00 ?0.043 1.00E+00 FALSE Unc119b 0.327 5.90E?02 0.779 6.82E?01 ?0.031 1.00E+00 FALSE Ablim1 0.278 5.90E?02 ?0.098 1.00E+00 ?0.153 1.00E+00 FALSE Zmym2 ?0.045 1.00E+00 0.119 1.00E+00 0.465 5.96E?02 FALSE Ncf1 0.280 5.96E?02 0.136 1.00E+00 0.163 7.21E?01 FALSE Tomm22 0.220 5.97E?02 0.135 1.00E+00 0.040 1.00E+00 FALSE Srsf5 ?0.179 5.98E?02 0.235 1.00E+00 ?0.080 1.00E+00 FALSE Plin2 ?0.345 5.99E?02 ?0.147 1.00E+00 ?0.199 9.84E?01 FALSE Tlk1 0.321 5.99E?02 0.084 1.00E+00 0.095 1.00E+00 FALSE Cenpl ?0.337 5.99E?02 ?0.048 1.00E+00 ?0.152 1.00E+00 FALSE Galnt3 ?0.232 6.00E?02 0.000 1.00E+00 ?0.059 9.46E?01 FALSE Gm16286 0.160 5.25E?01 0.064 1.00E+00 ?0.520 6.01E?02 FALSE Ctnna1 ?0.336 6.03E?02 ?0.153 1.00E+00 0.048 1.00E+00 FALSE Ift52 0.337 6.05E?02 0.630 8.76E?01 ?0.119 1.00E+00 FALSE Alg6 ?0.185 6.08E?02 ?0.153 1.00E+00 0.014 1.00E+00 FALSE Orc4 0.330 6.08E?02 ?0.195 1.00E+00 0.140 1.00E+00 FALSE Otud1 ?0.266 6.17E?02 0.000 1.00E+00 0.036 1.00E+00 FALSE Ipo11 ?0.273 6.20E?02 ?0.683 2.94E?01 ?0.156 9.77E?01 FALSE Gm12216 0.333 6.20E?02 ?0.090 1.00E+00 0.204 1.00E+00 FALSE D3Ertd751e ?0.267 6.20E?02 ?0.170 1.00E+00 ?0.156 1.00E+00 FALSE Tnfrsf13c 0.174 6.20E?02 0.051 1.00E+00 0.014 1.00E+00 FALSE Hist1h1e 0.316 6.21E?02 0.546 6.92E?01 0.235 6.69E?01 FALSE Emp1 ?0.334 6.44E?02 ?0.323 1.00E+00 0.118 1.00E+00 FALSE Pcbp2 0.180 6.44E?02 0.128 1.00E+00 0.016 1.00E+00 FALSE Tspan3 0.337 6.51E?02 0.000 1.00E+00 0.270 7.96E?01 FALSE Xpa 0.315 6.52E?02 0.152 1.00E+00 0.172 1.00E+00 FALSE Tmem173 0.320 6.52E?02 ?0.293 1.00E+00 ?0.230 9.46E?01 FALSE Ndufa4 0.236 6.53E?02 0.088 1.00E+00 ?0.274 4.85E?01 FALSE Mrto4 ?0.325 6.54E?02 ?0.203 1.00E+00 ?0.130 1.00E+00 FALSE Zfp277 0.321 6.64E?02 0.146 1.00E+00 0.274 8.15E?01 FALSE Nrp1 ?0.342 6.68E?02 0.285 8.76E?01 0.057 7.35E?01 FALSE Yme1l1 ?0.313 6.68E?02 ?0.138 1.00E+00 ?0.183 1.00E+00 FALSE Eva1b 0.313 6.72E?02 0.297 1.00E+00 0.073 1.00E+00 FALSE Pkp4 0.176 6.72E?02 ?0.113 1.00E+00 0.002 1.00E+00 FALSE Etfb ?0.269 6.77E?02 ?0.375 9.96E?01 ?0.039 1.00E+00 FALSE Psmc2 ?0.280 6.77E?02 0.033 1.00E+00 ?0.148 1.00E+00 FALSE Fmnl1 0.284 6.82E?02 0.332 1.00E+00 0.254 8.90E?01 FALSE Ddit4 ?0.349 6.85E?02 ?0.244 1.00E+00 ?0.132 1.00E+00 FALSE Atpif1 ?0.254 6.92E?02 ?0.100 1.00E+00 0.157 1.00E+00 FALSE Uqcrh 0.127 6.93E?02 0.100 1.00E+00 ?0.025 1.00E+00 FALSE Sfpq 0.230 6.95E?02 0.870 2.05E?01 ?0.057 1.00E+00 FALSE Psmb10 0.243 6.95E?02 ?0.180 1.00E+00 0.238 8.20E?01 FALSE Rab5c ?0.261 6.96E?02 ?0.087 1.00E+00 ?0.038 1.00E+00 FALSE Phf3 ?0.305 6.96E?02 0.196 1.00E+00 ?0.109 1.00E+00 FALSE Dusp5 ?0.200 6.98E?02 ?0.086 1.00E+00 ?0.135 1.00E+00 FALSE Psmb1 0.145 6.98E?02 0.181 1.00E+00 0.144 8.93E?01 FALSE Mrpl43 0.282 6.98E?02 ?0.374 1.00E+00 ?0.221 9.57E?01 FALSE Dusp12 0.086 9.05E?01 ?0.202 1.00E+00 0.547 6.99E?02 FALSE Rpn2 ?0.264 7.05E?02 ?0.278 1.00E+00 ?0.187 9.77E?01 FALSE Magohb 0.328 7.05E?02 0.218 1.00E+00 ?0.065 1.00E+00 FALSE Pcna ?0.291 7.34E?02 ?0.023 1.00E+00 ?0.035 1.00E+00 FALSE Nrros ?0.379 7.36E?02 ?0.237 1.00E+00 0.068 1.00E+00 FALSE Banf1 ?0.297 7.43E?02 0.297 1.00E+00 ?0.039 1.00E+00 FALSE Zfp40 0.101 7.43E?02 ?0.176 9.15E?01 0.048 9.46E?01 FALSE Tmem109 ?0.320 7.47E?02 ?0.005 1.00E+00 ?0.051 1.00E+00 FALSE Lbh 0.297 7.49E?02 0.253 1.00E+00 ?0.370 6.10E?01 FALSE Surf1 0.304 7.50E?02 0.341 1.00E+00 0.176 1.00E+00 FALSE Ppp1ca 0.139 7.50E?02 ?0.055 1.00E+00 ?0.015 1.00E+00 FALSE Arid4b ?0.315 7.50E?02 ?0.382 1.00E+00 0.147 1.00E+00 FALSE Akr1a1 0.223 7.50E?02 0.014 1.00E+00 0.033 1.00E+00 FALSE Ctsb ?0.040 1.00E+00 ?0.149 1.00E+00 ?0.485 7.51E?02 FALSE Amd1 ?0.337 7.59E?02 ?0.231 1.00E+00 ?0.155 1.00E+00 FALSE Tulp3 0.134 7.60E?02 0.058 1.00E+00 ?0.043 1.00E+00 FALSE Hsd17b7 ?0.260 7.72E?02 ?0.222 1.00E+00 ?0.024 1.00E+00 FALSE Nsun3 0.221 7.72E?02 0.333 1.00E+00 0.163 1.00E+00 FALSE Tgfbr1 ?0.276 7.74E?02 0.522 9.15E?01 ?0.067 1.00E+00 FALSE Lsm2 ?0.308 7.80E?02 ?0.321 1.00E+00 ?0.023 1.00E+00 FALSE Fam118b 0.255 7.84E?02 0.261 1.00E+00 0.244 7.35E?01 FALSE Impact ?0.321 7.84E?02 0.441 1.00E+00 ?0.186 1.00E+00 FALSE Lamtor1 0.291 7.84E?02 ?0.066 1.00E+00 ?0.020 1.00E+00 FALSE R3hdm4 0.273 7.87E?02 ?0.385 1.00E+00 ?0.149 1.00E+00 FALSE Ilk 0.286 7.88E?02 ?0.143 1.00E+00 0.310 7.35E?01 FALSE mt-Nd3 ?0.253 9.74E?02 ?0.472 9.15E?01 ?0.548 7.90E?02 FALSE Mdh1 ?0.024 1.00E+00 ?0.038 1.00E+00 ?0.428 7.90E?02 FALSE Rpl27 0.089 7.95E?02 0.094 1.00E+00 0.133 3.83E?01 FALSE Enc1 ?0.105 7.96E?02 0.059 1.00E+00 ?0.067 9.46E?01 FALSE Cd3d 0.025 1.00E+00 ?0.443 7.99E?02 ?0.055 1.00E+00 FALSE Rnf2 0.314 8.02E?02 0.039 1.00E+00 0.139 1.00E+00 FALSE Rnf167 ?0.155 6.14E?01 ?0.996 8.03E?02 0.336 6.95E?01 FALSE Ptpn1 ?0.048 9.95E?01 0.347 1.00E+00 ?0.471 8.07E?02 FALSE Grhpr 0.283 8.07E?02 0.106 1.00E+00 0.037 1.00E+00 FALSE Polr2f ?0.285 8.11E?02 ?0.614 8.71E?01 0.012 1.00E+00 FALSE Vcp ?0.107 6.84E?01 ?0.592 6.37E?01 ?0.475 8.19E?02 FALSE Atl2 ?0.280 8.20E?02 0.000 1.00E+00 0.188 1.00E+00 FALSE Etv5 ?0.078 8.20E?02 0.109 1.00E+00 ?0.018 1.00E+00 FALSE Postn ?0.077 8.20E?02 0.000 1.00E+00 ?0.022 1.00E+00 FALSE Gm18025 0.197 8.27E?02 0.000 1.00E+00 0.093 1.00E+00 FALSE Pot1a 0.288 8.27E?02 ?0.438 9.15E?01 0.031 1.00E+00 FALSE Sdhb 0.224 8.27E?02 ?0.064 1.00E+00 0.014 1.00E+00 FALSE Bmyc ?0.252 8.27E?02 ?0.049 1.00E+00 0.074 1.00E+00 FALSE Hamp ?0.072 8.27E?02 0.000 1.00E+00 0.000 1.00E+00 FALSE Btg1 0.124 1.23E?01 0.404 6.60E?01 0.229 8.31E?02 FALSE Il4 0.110 8.33E?02 ?0.335 7.11E?01 0.000 1.00E+00 FALSE Nrg4 ?0.070 8.33E?02 ?0.175 9.15E?01 ?0.011 1.00E+00 FALSE Eif2a 0.296 8.33E?02 0.207 1.00E+00 0.297 7.42E?01 FALSE Xbp1 ?0.236 1.17E?01 0.226 1.00E+00 ?0.512 8.36E?02 FALSE Btg3 0.296 8.36E?02 ?0.102 1.00E+00 0.404 4.24E?01 FALSE Skap1 ?0.084 7.23E?01 ?0.735 8.40E?02 0.052 1.00E+00 FALSE Lysmd2 0.341 8.45E?02 0.142 1.00E+00 ?0.156 1.00E+00 FALSE Golm1 0.316 8.45E?02 ?0.067 1.00E+00 0.027 1.00E+00 FALSE 1700025G04Rik 0.329 8.48E?02 ?0.016 1.00E+00 0.461 1.30E?01 FALSE Arf5 0.066 7.56E?01 0.088 1.00E+00 ?0.329 8.50E?02 FALSE Rpl9 ?0.078 8.62E?02 0.056 1.00E+00 0.032 1.00E+00 FALSE Thap3 0.316 8.66E?02 0.168 1.00E+00 0.162 1.00E+00 FALSE Hmgb3 ?0.281 8.66E?02 0.003 1.00E+00 0.093 1.00E+00 FALSE Sirt2 0.269 8.67E?02 0.180 1.00E+00 ?0.080 1.00E+00 FALSE Rbm8a2 0.307 8.67E?02 0.102 1.00E+00 0.086 1.00E+00 FALSE Elmsan1 0.171 5.18E?01 0.276 9.15E?01 0.478 8.68E?02 FALSE Gm12355 0.215 1.99E?01 0.329 8.80E?01 0.461 8.69E?02 FALSE Chst11 0.008 1.00E+00 0.199 1.00E+00 ?0.507 8.69E?02 FALSE Gm6576 0.212 8.76E?02 0.170 1.00E+00 0.201 8.03E?01 FALSE Rpe 0.309 8.76E?02 0.388 1.00E+00 0.361 5.96E?01 FALSE Exph5 ?0.115 8.76E?02 0.059 1.00E+00 0.000 1.00E+00 FALSE Snx5 0.265 8.76E?02 ?0.061 1.00E+00 ?0.016 1.00E+00 FALSE Rpl35a 0.035 7.86E?01 0.041 1.00E+00 0.175 8.83E?02 FALSE Aars ?0.293 8.93E?02 ?0.280 1.00E+00 ?0.119 1.00E+00 FALSE Rlim ?0.306 8.95E?02 0.121 1.00E+00 ?0.249 9.46E?01 FALSE Gm17056 ?0.239 8.96E?02 0.000 1.00E+00 0.080 1.00E+00 FALSE Zdhhc16 0.279 8.96E?02 ?0.225 1.00E+00 0.031 1.00E+00 FALSE Kras 0.260 8.97E?02 0.619 9.15E?01 ?0.045 1.00E+00 FALSE Rnf7 0.268 8.97E?02 ?0.266 1.00E+00 0.129 1.00E+00 FALSE Casc4 0.109 8.97E?02 0.180 1.00E+00 ?0.067 1.00E+00 FALSE Ggt5 0.181 9.01E?02 0.333 1.00E+00 0.026 1.00E+00 FALSE Cks1brt ?0.077 9.01E?02 0.000 1.00E+00 0.000 1.00E+00 FALSE Taf1b 0.308 9.01E?02 ?0.219 1.00E+00 0.114 1.00E+00 FALSE Tmed10 ?0.232 9.01E?02 ?0.182 1.00E+00 ?0.131 1.00E+00 FALSE Eif4e3 0.323 9.01E?02 0.310 1.00E+00 0.201 1.00E+00 FALSE Sh2d1a 0.280 9.01E?02 ?0.024 1.00E+00 0.126 1.00E+00 FALSE Brd2 ?0.280 9.01E?02 ?0.274 1.00E+00 ?0.020 1.00E+00 FALSE Ruben ?0.152 9.01E?02 0.058 1.00E+00 0.035 1.00E+00 FALSE Arrdc1 0.297 9.01E?02 0.108 1.00E+00 0.098 1.00E+00 FALSE Fam46a ?0.371 9.01E?02 ?0.161 1.00E+00 0.079 1.00E+00 FALSE Neat1 0.270 9.01E?02 0.623 9.15E?01 0.504 9.18E?02 FALSE Mrps21 0.263 9.01E?02 ?0.402 9.31E?01 0.113 1.00E+00 FALSE 5330426L24Rik 0.102 9.01E?02 0.169 1.00E+00 0.000 1.00E+00 FALSE Aprt 0.225 9.01E?02 ?0.208 1.00E+00 ?0.072 1.00E+00 FALSE Hivep2 0.311 9.01E?02 ?0.315 1.00E+00 0.408 4.29E?01 FALSE Commd8 0.258 9.01E?02 0.346 1.00E+00 0.158 1.00E+00 FALSE Dcaf15 0.314 9.05E?02 ?0.192 1.00E+00 0.250 8.20E?01 FALSE Gm5426 0.146 9.14E?02 ?0.126 1.00E+00 ?0.044 1.00E+00 FALSE Zfos1 0.253 9.20E?02 0.560 9.15E?01 ?0.034 1.00E+00 FALSE Htatsf1 ?0.306 9.20E?02 0.455 9.15E?01 ?0.208 9.77E?01 FALSE Gmppa 0.080 9.31E?01 ?0.438 9.96E?01 0.486 9.29E?02 FALSE Acat2 ?0.316 9.35E?02 0.199 1.00E+00 0.179 1.00E+00 FALSE Abtb1 0.305 9.43E?02 ?0.168 1.00E+00 0.284 7.36E?01 FALSE Cers4 ?0.066 1.00E+00 ?1.014 9.45E?02 ?0.577 1.21E?01 FALSE Ranbp1 ?0.239 9.48E?02 0.214 1.00E+00 ?0.069 1.00E+00 FALSE Rpl26 0.073 2.14E?01 0.036 1.00E+00 0.161 9.52E?02 FALSE Mif4gd 0.264 9.63E?02 0.345 1.00E+00 0.042 1.00E+00 FALSE Hspa9 ?0.286 9.69E?02 0.368 1.00E+00 ?0.011 1.00E+00 FALSE Gpr15 ?0.155 9.74E?02 ?0.349 7.11E?01 0.053 1.00E+00 FALSE Sprtn ?0.143 9.77E?02 0.000 1.00E+00 ?0.093 1.00E+00 FALSE Usp16 ?0.308 9.85E?02 ?0.380 1.00E+00 ?0.080 1.00E+00 FALSE Ptpn6 0.294 9.87E?02 0.292 1.00E+00 ?0.008 1.00E+00 FALSE Gm26532 ?0.361 9.87E?02 0.102 1.00E+00 ?0.009 1.00E+00 FALSE Hba-a2 0.025 9.31E?01 0.062 1.00E+00 0.176 9.90E?02 FALSE Sit1 ?0.284 9.92E?02 0.223 1.00E+00 ?0.047 1.00E+00 FALSE Skil ?0.267 9.94E?02 0.407 1.00E+00 ?0.085 1.00E+00 FALSE Kat8 0.275 9.94E?02 0.712 4.66E?01 ?0.165 9.89E?01 FALSE Rhoh ?0.058 9.95E?01 ?0.435 9.96E?01 ?0.488 9.97E?02 FALSE

    TABLE-US-00042 TABLE 4 Table detailing the ranking procedure used to prioritize genes for follow-up study. Gathers, for each gene, the final score used for ranking in addition to the component statistics used in computing this score. Details on the formula used are provided in the methods section. The scores above 2 are shown. Final In-Vivo In-Vivo In-Vitro Gene Score Cluster Tissue Summary GWAS? LPL-9_logFC LPL-9_FDR LPL-9_Geno_logFC Gpr18 6.04 0.87 0.96 1.34 1 0.05 9.16E?01 ?1.21 Gzmb 5.33 0.74 1.73 2.11 0 ?0.18 8.28E?01 ?0.31 Itgb1 5.07 1.75 0.00 1.57 0 ?0.52 1.23E?01 0.62 Ccr3 5.00 0.00 0.00 3.00 1 0.02 9.16E?01 ?0.06 Gzma 5.00 1.73 1.55 0.00 0 1.65 1.07E?14 ?2.92 Il22 4.80 0.00 2.00 2.80 0 ?1.98 6.26E?05 0.12 Zfp36l2 4.80 0.76 1.28 0.00 1 ?0.51 3.71E?03 ?1.28 Zbtb38 4.72 0.30 0.21 1.90 1 0.61 1.07E?03 ?0.38 Cd74 4.58 0.29 0.47 1.53 1 ?0.71 3.68E?02 0.39 Ccr5 4.55 0.70 1.14 0.00 1 ?0.01 9.77E?01 ?0.29 Cd160 4.15 1.39 1.38 0.00 0 2.21 8.92E?39 ?1.39 Map3k8 4.11 0.27 1.57 0.00 1 ?1.07 1.04E?07 ?0.05 Tnfsf8 4.00 0.00 2.00 0.00 1 ?2.58 3.47E?29 0.92 Ifitm1 4.00 2.00 0.00 0.00 0 0.42 7.73E?01 0.06 Nfkbiz 4.00 0.00 2.00 0.00 1 ?1.84 5.04E?26 0.00 Fosl2 4.00 0.00 2.00 0.00 1 ?2.22 2.11E?28 ?0.04 Crem 4.00 0.00 2.00 0.00 1 ?2.64 3.66E?42 0.29 Ccdc85b 4.00 0.24 0.31 1.20 1 0.49 5.14E?03 0.25 Fos 3.94 0.00 1.94 0.00 1 ?0.39 3.85E?01 0.88 Gpr183 3.77 0.21 1.35 0.00 1 ?1.70 2.41E?24 ?0.09 S100a4 3.76 1.53 0.71 0.00 0 0.21 5.67E?01 ?0.64 1110008f13rik 3.63 0.32 0.00 3.00 0 ?0.24 3.26E?01 ?0.22 Lsp1 3.63 0.61 0.41 0.00 1 0.54 2.06E?11 0.01 Litaf 3.61 0.00 1.61 0.00 1 ?0.08 9.16E?01 ?0.60 Cd7 3.60 1.10 1.40 0.00 0 1.84 6.17E?25 ?1.93 Dusp2 3.59 0.36 0.42 2.46 0 0.71 8.19E?05 ?1.01 Plac8 3.59 1.00 1.58 0.00 0 ?0.08 9.16E?01 ?0.89 H1f0 3.56 0.57 0.75 1.67 0.24 5.20E?01 0.55 S1pr1 3.56 0.88 0.42 1.37 0 ?0.16 8.29E?01 ?0.60 Ncf4 3.53 0.62 0.29 0.00 1 0.30 2.08E?01 0.21 Smim3 3.46 0.00 1.46 0.00 1 ?0.48 4.13E?02 ?0.11 Tesc 3.43 0.00 0.47 2.96 0 0.01 9.59E?01 ?0.05 Rbms1 3.39 0.29 0.18 2.64 0 0.00 9.81E?01 ?0.27 Lpxn 3.39 0.21 0.97 0.00 1 ?0.02 9.16E?01 ?0.25 Tnfrsf9 3.37 0.00 1.37 0.00 1 ?1.43 4.83E?10 0.51 Pmm1 3.37 0.14 0.15 0.95 1 0.16 7.88E?01 ?0.41 Tob2 3.32 0.00 1.32 0.00 1 ?1.09 4.21E?08 0.30 Ifng 3.32 0.00 1.69 1.63 0 ?1.20 7.19E?06 0.66 Cd226 3.32 0.55 0.23 0.00 1 1.09 1.32E?13 ?0.19 Ctsw 3.28 0.47 0.35 0.00 1 0.93 3.13E?26 ?0.23 Itga4 3.26 0.41 0.44 0.00 1 0.25 3.38E?01 ?0.60 Cd28 3.23 0.08 1.08 0.00 1 ?1.13 4.90E?26 ?0.16 Klf2 3.21 1.25 0.71 0.00 0 ?0.39 2.50E?01 ?1.19 Ly6c2 3.19 1.60 0.00 0.00 0 ?0.73 1.12E?01 ?0.47 Ccr9 3.19 1.11 0.97 0.00 0 1.55 7.75E?14 ?2.22 Ets1 3.19 0.16 0.87 0.00 1 ?0.57 2.15E?09 0.03 Il7r 3.19 0.35 0.48 0.00 1 0.43 2.27E?03 ?0.54 Ptpn22 3.18 0.00 1.18 0.00 1 ?0.69 1.93E?09 ?0.57 Gm12840 3.17 0.59 2.00 0.00 0 ?1.43 4.99E?14 ?0.09 Zfp36l1 3.17 0.00 1.17 0.00 1 ?0.78 3.31E?05 ?0.69 Atxn2l 3.17 0.00 0.07 1.10 1 ?0.12 8.69E?01 ?0.04 Pde4b 3.17 0.00 2.00 1.17 0 ?1.76 8.34E?28 ?0.20 Selp 3.16 0.00 0.00 1.16 1 0.00 9.16E?01 0.00 Anxa6 3.16 0.48 0.20 0.00 1 0.30 2.42E?02 0.22 Peli1 3.14 0.00 0.92 2.22 0 ?1.00 7.94E?13 0.23 Odc1 3.12 0.00 2.00 1.12 0 ?2.92 6.12E?65 0.23 Pglyrp1 3.12 1.21 0.70 0.00 0 0.12 8.90E?01 ?0.30 Pim3 3.12 0.00 1.12 0.00 1 ?1.08 4.71E?07 0.03 Pim1 3.11 0.56 2.00 0.00 0 ?1.85 2.32E?50 ?1.11 Mt1 3.08 0.69 0.65 1.06 0 ?0.74 9.16E?03 ?0.32 Stat3 3.08 0.00 1.08 0.00 1 ?0.85 1.15E?07 0.28 Stat5a 3.07 0.00 0.47 0.60 1 ?0.41 9.10E?02 ?0.12 Vmp1 3.05 0.27 0.51 0.00 1 ?0.11 8.77E?01 ?0.82 Ier2 3.05 0.21 0.43 2.19 0 ?0.98 4.39E?12 ?0.26 Tnip1 3.02 0.13 0.77 0.00 1 ?0.88 1.43E?06 0.41 Timp1 3.00 0.00 0.00 3.00 0 0.00 9.16E?01 0.00 Amdhd1 3.00 0.00 0.00 3.00 0 ?0.03 7.89E?01 0.00 Rora 2.99 0.12 1.63 1.12 0 ?1.51 6.78E?27 0.19 Gm5111 2.99 0.00 0.02 2.97 0 0.04 7.22E?01 ?0.06 Fermt3 2.99 0.31 0.36 0.00 1 0.41 1.78E?02 ?0.04 Dap 2.96 0.34 0.28 0.00 1 0.06 9.16E?01 ?0.72 Hist1h1c 2.94 0.52 1.90 0.00 0 ?1.01 9.38E?06 0.17 Cfl1 2.93 0.21 0.14 0.38 1 0.41 1.20E?13 0.33 Ipmk 2.92 0.00 0.92 0.00 1 ?0.84 4.49E?05 ?0.25 Klrd1 2.90 1.28 0.34 0.00 0 0.21 6.79E?01 1.08 Gfi1 2.89 0.40 0.09 0.00 1 0.81 5.66E?07 ?0.52 S100a6 2.89 1.20 0.50 0.00 0 0.44 3.37E?04 0.25 Rorc 2.89 0.00 0.07 0.82 1 0.05 9.16E?01 0.05 Stat4 2.87 0.00 0.87 0.00 1 ?0.54 2.67E?03 0.11 Fdps 2.86 0.36 0.15 0.00 1 0.71 7.75E?05 ?0.21 Gpr65 2.86 0.00 0.86 0.00 1 ?0.53 2.06E?02 ?0.36 Rapgef6 2.85 0.22 0.41 0.00 1 0.44 1.06E?02 ?0.40 Tmem160 2.84 0.27 0.20 2.12 0 0.16 4.72E?01 0.20 Rasgrp1 2.84 0.00 0.84 0.00 1 ?0.60 1.41E?03 ?0.39 Pnkd 2.83 0.31 0.21 0.00 1 0.63 1.17E?04 ?0.58 Ccnd3 2.82 0.41 0.00 0.00 1 0.58 9.30E?06 0.30 Panx1 2.82 0.20 0.00 2.42 0 ?0.11 9.10E?01 0.22 Thap11 2.81 0.31 0.13 2.06 0 0.62 2.48E?04 ?0.56 Lysmd2 2.80 0.34 0.25 1.86 0 0.26 4.08E?01 ?0.14 Ubac2 2.80 0.25 0.29 0.00 1 0.51 7.50E?04 ?0.24 Lgals3 2.79 1.40 0.00 0.00 0 ?0.27 2.98E?01 0.46 Cyb5r4 2.78 0.32 0.29 1.86 0 0.22 4.11E?01 0.13 Upf3a 2.78 0.39 0.34 1.66 0 0.22 5.09E?01 0.13 Gm10076 2.78 1.04 0.69 0.00 0 0.07 9.16E?01 ?0.36 Ccdc69 2.77 0.30 0.18 0.00 1 0.59 2.73E?04 ?0.40 Ccl5 2.76 1.13 0.50 0.00 0 0.92 7.28E?10 ?1.43 Gramd3 2.75 0.42 1.92 0.00 0 ?2.80 1.99E?64 ?0.50 Errfi1 2.75 0.00 0.75 0.00 1 ?0.85 6.10E?05 0.00 Itgae 2.75 0.86 1.03 0.00 0 1.72 6.36E?26 ?1.44 Il2ra 2.74 0.00 0.74 0.00 1 ?0.71 7.84E?04 ?0.03 Gpx4 2.72 0.00 0.72 0.00 1 ?0.61 3.04E?08 0.17 Ndfip1 2.72 0.00 0.72 0.00 1 ?1.00 1.29E?12 ?0.02 Syt11 2.72 0.31 0.11 0.00 1 0.61 6.33E?04 ?0.13 Dph5 2.71 0.00 0.00 0.71 1 ?0.34 1.73E?01 0.43 Slc39a8 2.70 0.00 0.08 0.62 1 0.25 2.07E?01 0.49 Rnf187 2.69 0.00 0.00 2.69 0 ?0.03 9.16E?01 ?0.04 Fam53b 2.68 0.27 0.14 0.00 1 0.54 4.97E?03 ?0.40 Prdx5 2.68 0.15 0.37 0.00 1 0.30 3.27E?02 0.36 Ccrl2 2.67 0.00 0.67 0.00 1 ?0.50 4.03E?02 0.57 Ep300 2.67 0.00 0.00 0.67 1 ?0.02 9.22E?01 ?0.09 Hdac7 2.66 0.28 0.10 0.00 1 0.19 5.54E?01 ?0.17 Cd6 2.66 0.23 0.21 0.00 1 0.16 4.22E?01 0.22 Traf3ip2 2.66 0.29 0.09 0.00 1 ?0.01 9.79E?01 ?0.46 Gnb2 2.66 0.20 0.25 0.00 1 0.14 4.84E?01 0.28 Tet2 2.66 0.00 0.66 0.00 1 ?0.33 2.15E?01 0.29 Fam189b 2.66 0.33 0.00 0.00 1 0.66 1.50E?05 ?0.30 Skap2 2.65 0.26 0.13 0.00 1 0.53 4.39E?03 0.03 Lgals1 2.64 1.11 0.17 0.25 0 0.03 9.16E?01 0.37 Socs1 2.64 0.00 0.64 0.00 1 ?1.20 3.60E?09 0.36 Itgav 2.64 0.00 0.64 0.00 1 ?0.46 5.45E?02 ?0.44 Dnajb4 2.63 0.00 0.63 0.00 1 ?0.35 2.20E?01 0.13 Cdkn1a 2.63 0.00 2.00 0.63 0 ?1.97 4.97E?22 0.16 Arhgef2 2.62 0.20 0.23 0.00 1 0.40 5.38E?02 0.01 Dnmt3a 2.62 0.26 0.11 0.00 1 0.51 2.67E?03 ?0.34 Jund 2.61 0.00 2.00 0.61 0 ?1.56 1.41E?54 0.96 Scamp3 2.61 0.19 0.23 0.00 1 0.38 2.05E?02 ?0.28 Tmem30a 2.61 0.35 0.35 1.55 0 0.22 3.63E?01 ?0.73 Ash1l 2.60 0.30 0.00 0.00 1 0.60 6.06E?04 ?0.13 Lsm14a 2.60 0.17 0.26 0.00 1 0.34 7.25E?02 ?0.04 Slain2 2.60 0.00 0.00 0.60 1 ?0.16 7.57E?01 0.25 Muc1 2.60 0.11 0.38 0.00 1 ?0.31 1.19E?01 ?0.12 Adamts14 2.59 0.00 0.00 2.59 0 0.00 9.16E?01 0.00 Ptk2b 2.59 0.25 0.09 0.00 1 0.50 3.11E?03 0.23 Stk11 2.59 0.00 0.59 0.00 1 ?0.38 7.50E?02 ?0.01 Ccr2 2.58 0.17 0.23 0.00 1 ?0.82 5.53E?07 0.19 Itgal 2.57 0.23 0.11 0.00 1 0.47 4.68E?03 ?0.85 Elf1 2.57 0.00 0.57 0.00 1 ?0.12 8.01E?01 ?0.44 Ptprc 2.57 0.20 0.16 0.00 1 0.05 9.16E?01 ?0.26 Rbx1 2.56 0.21 0.14 0.00 1 0.42 4.59E?05 0.23 Traf3ip3 2.56 0.44 0.45 1.23 0 0.79 1.50E?07 ?0.46 Ccdc88b 2.55 0.24 0.08 0.00 1 0.48 1.39E?02 ?0.36 Tsen34 2.55 0.23 0.00 2.09 0 0.46 2.92E?03 ?0.30 Ay036118 2.54 1.15 0.25 0.00 0 ?0.70 9.08E?04 0.26 Il24 2.54 0.00 0.00 2.54 0 H2-q10 2.54 0.00 0.06 2.48 0 ?0.40 9.22E?02 ?0.05 Scand1 2.54 0.16 0.38 1.83 0 0.11 7.40E?01 ?0.08 Tab2 2.54 0.14 0.26 0.00 1 0.14 7.87E?01 0.31 Nfkb1 2.53 0.00 0.53 0.00 1 ?0.80 1.07E?06 0.41 Rusc1 2.51 0.20 0.11 0.00 1 0.40 5.20E?02 ?0.38 Esyt1 2.51 0.48 0.24 1.32 0 0.50 2.99E?03 0.14 Commd7 2.51 0.21 0.08 0.00 1 0.42 1.69E?02 0.43 Rfng 2.50 0.21 0.14 1.94 0 0.42 1.91E?02 ?0.41 Rpl27-ps3 2.50 1.05 0.40 0.00 0 ?0.39 1.47E?02 ?0.81 Gigyf1 2.50 0.25 0.00 0.00 1 0.50 3.73E?03 0.04 Rgcc 2.49 0.00 1.58 0.92 0 ?2.01 3.98E?17 0.81 Rpl3 2.49 0.15 0.19 0.00 1 0.03 8.98E?01 ?0.17 Mrpl20 2.49 0.16 0.16 0.00 1 ?0.12 8.00E?01 ?0.15 Gm2a 2.48 0.15 0.18 0.00 1 0.30 9.19E?02 0.11 Mus81 2.47 0.17 0.13 0.00 1 0.34 6.54E?02 ?0.25 Lpp 2.47 0.00 0.00 0.47 1 0.02 9.32E?01 0.11 Chp1 2.47 0.16 0.14 0.00 1 0.24 3.53E?01 ?0.58 Mob4 2.46 0.11 0.24 0.00 1 ?0.16 6.52E?01 ?0.20 Lamp1 2.46 0.00 0.08 2.38 0 0.17 5.79E?01 ?0.15 Phf5a 2.46 0.16 0.14 0.00 1 ?0.18 5.90E?01 ?0.06 Fnip1 2.46 0.11 0.25 0.00 1 ?0.35 5.02E?02 0.12 Calm3 2.45 0.19 0.07 0.00 1 0.38 3.36E?03 0.27 Lrp10 2.45 0.21 0.20 1.82 0 0.43 9.66E?03 0.00 Stat5b 2.45 0.00 0.45 0.00 1 ?0.42 7.05E?02 ?0.17 Bach2 2.45 0.00 0.00 0.45 1 ?0.19 9.99E?02 0.00 Prkab1 2.44 0.22 0.00 0.00 1 0.44 1.85E?02 ?0.07 Hvcn1 2.44 0.39 0.00 1.65 0 0.79 3.23E?07 ?0.51 Tmem150a 2.44 0.00 0.00 2.44 0 ?0.01 9.16E?01 0.00 Nfkbia 2.44 0.22 2.00 0.00 0 ?2.00 6.41E?52 0.23 Ifitm3 2.43 1.07 0.28 0.00 0 ?0.15 8.69E?01 ?0.26 Egfp_ires_il23r 2.43 0.00 0.00 2.43 0 Bad 2.43 0.15 0.13 0.00 1 0.25 3.65E?01 ?0.14 Zbtb46 2.42 0.10 0.21 0.00 1 ?0.24 4.01E?02 0.00 Cacna1s 2.42 0.00 0.10 0.32 1 ?0.02 9.16E?01 0.12 Vamp3 2.42 0.15 0.11 0.00 1 ?0.12 8.75E?01 ?0.20 Fyn 2.41 0.21 0.00 0.00 1 0.41 6.91E?03 0.01 Stx6 2.41 0.00 0.29 2.12 0 ?0.54 9.36E?03 0.33 Ikzf3 2.41 0.00 0.41 0.00 1 0.03 9.16E?01 0.01 Mgat2 2.41 0.17 0.00 2.07 0 ?0.13 7.90E?01 0.01 Serpinb9 2.41 0.35 1.70 0.00 0 ?2.27 2.37E?29 0.48 Dennd1b 2.41 0.20 0.00 0.00 1 0.41 4.95E?02 0.56 Bloc1s4 2.40 0.00 0.27 2.13 0 ?0.32 2.26E?01 0.29 Anxa1 2.40 1.20 0.00 0.00 0 ?0.39 2.24E?01 0.51 Smad3 2.39 0.15 0.10 0.00 1 ?0.17 6.80E?01 ?0.20 Tmem258 2.39 0.16 0.08 0.00 1 0.31 1.20E?02 ?0.15 Lmna 2.39 0.20 1.99 0.00 0 ?2.18 3.54E?21 1.52 Sp140 2.38 0.15 0.09 0.00 1 0.07 9.16E?01 ?0.07 Actn2 2.38 0.56 1.25 0.00 0 0.97 1.90E?11 ?0.17 Acbd6 2.38 0.00 0.22 2.16 0 ?0.20 5.59E?01 ?0.03 Ahnak 2.38 0.50 0.16 1.22 0 ?0.68 6.25E?06 ?0.15 Arpc2 2.37 0.16 0.06 0.00 1 ?0.21 6.08E?03 0.10 Erp29 2.37 0.19 0.00 0.00 1 0.09 9.16E?01 ?0.38 Nhp2l1 2.37 0.00 0.37 0.00 1 ?0.78 2.02E?09 0.23 Ctbp1 2.36 0.35 0.32 1.34 0 ?0.18 5.38E?01 ?0.18 Gba 2.36 0.11 0.13 0.00 1 0.19 5.83E?01 ?0.11 Lztfl1 2.35 0.56 1.24 0.00 0 0.50 7.25E?03 ?0.48 Ptpn2 2.35 0.00 0.35 0.00 1 ?0.50 1.46E?02 0.14 Usp36 2.35 0.00 0.35 0.00 1 ?0.33 2.19E?01 0.35 Grb7 2.34 0.00 0.34 0.00 1 ?0.23 3.56E?01 0.28 Fndc3a 2.34 0.00 0.34 0.00 1 ?0.27 3.66E?01 0.38 Mt2 2.33 0.41 0.21 1.32 0 ?0.12 9.16E?01 ?0.21 Dctn4 2.33 0.00 0.33 0.00 1 ?0.13 8.69E?01 ?0.49 Nusap1 2.33 0.00 0.33 0.00 1 ?0.47 2.85E?02 ?0.06 Rbm22 2.33 0.16 0.00 0.00 1 0.31 1.24E?01 ?0.08 Crip1 2.32 1.16 0.00 0.00 0 ?0.16 4.44E?01 0.13 Anp32b 2.32 0.00 0.19 2.13 0 ?0.03 9.16E?01 0.09 Aurkaip1 2.31 0.16 0.00 0.00 1 0.31 4.66E?02 0.23 Ripk2 2.31 0.21 0.36 1.53 0 ?0.31 2.52E?01 ?0.29 Nubp1 2.31 0.12 0.37 1.70 0 0.05 9.16E?01 ?0.11 Camta1 2.31 0.00 0.31 0.00 1 0.15 7.66E?01 0.04 Ube2j2 2.30 0.00 0.30 0.00 1 ?0.51 1.26E?03 ?0.09 Kif3b 2.30 0.00 0.00 0.30 1 0.21 2.31E?01 0.43 Brap 2.30 0.00 0.30 0.00 1 ?0.36 1.42E?01 ?0.02 Gm8096 2.30 0.00 0.00 2.30 0 Ermn 2.30 0.00 1.01 1.29 0 ?0.82 2.08E?03 0.18 Plagl2 2.29 0.00 0.00 0.29 1 0.11 8.12E?01 ?0.24 Plek 2.29 0.44 0.00 1.42 0 ?0.17 7.62E?01 ?0.02 D030056l22rik 2.29 0.00 0.23 2.06 0 ?0.22 5.63E?01 0.12 Ccr1 2.28 0.00 0.28 0.00 1 ?0.25 3.19E?01 0.33 Krtcap2 2.28 0.14 0.00 0.00 1 0.15 2.54E?01 0.68 Sh2b1 2.28 0.00 0.28 0.00 1 0.00 9.89E?01 0.10 Abi3 2.27 0.65 0.97 0.00 0 1.31 2.58E?20 ?0.41 Ccnl2 2.27 0.00 0.27 0.00 1 ?0.11 8.44E?01 ?0.32 Kbtbd7 2.27 0.14 0.00 0.00 1 0.27 3.02E?02 0.32 Csf2 2.27 0.00 0.27 0.00 1 ?0.27 4.91E?01 0.12 Pycard 2.27 0.82 0.63 0.00 0 0.67 2.06E?07 ?0.41 Dock7 2.27 0.00 0.00 0.27 1 0.00 9.16E?01 0.00 Herpud1 2.26 0.00 1.16 1.10 0 ?1.41 4.94E?17 ?0.99 Arf6 2.26 0.12 0.39 1.63 0 ?0.07 8.95E?01 ?0.09 Zyx 2.26 0.87 0.52 0.00 0 0.34 1.46E?01 ?0.27 Zfp91 2.25 0.00 0.25 0.00 1 ?0.19 6.33E?01 0.28 Fam171b 2.25 0.13 0.00 0.00 1 0.25 6.60E?03 ?0.05 Maml2 2.25 0.12 0.00 0.00 1 0.28 3.01E?01 0.08 Ifngr2 2.24 0.00 0.24 0.00 1 ?0.35 7.19E?03 0.00 Bhlhe40 2.24 0.12 2.00 0.00 0 ?2.05 5.44E?83 ?0.58 Cisd1 2.23 0.00 0.23 0.00 1 0.29 2.94E?01 0.39 Zfp420 2.22 0.00 0.00 2.22 0 0.05 9.16E?01 0.32 Zc3h12a 2.22 0.11 2.00 0.00 0 ?1.90 3.03E?26 0.20 Plcg2 2.22 0.08 0.05 0.00 1 0.14 3.14E?01 ?0.27 2310036o22rik 2.21 0.00 0.13 2.09 0 0.10 8.00E?01 0.13 Eif3c 2.21 0.11 0.00 0.00 1 ?0.03 9.16E?01 0.00 Slc15a3 2.21 0.00 0.52 1.69 0 ?0.62 2.28E?03 ?0.01 Acap3 2.21 0.10 0.00 0.00 1 0.14 7.00E?01 0.20 Tef 2.21 0.00 0.21 0.00 1 ?0.20 4.12E?01 0.03 Emp3 2.20 0.93 0.34 0.00 0 0.17 4.01E?01 ?0.30 Ssr2 2.20 0.00 0.20 0.00 1 ?0.02 9.16E?01 ?0.24 Usp1 2.19 0.00 0.19 0.00 1 0.05 9.16E?01 0.13 Rpl10-ps3 2.18 0.89 0.40 0.00 0 ?0.20 4.07E?01 ?0.22 Plcxd2 2.18 0.42 1.34 0.00 0 ?0.89 1.41E?05 ?0.23 Adcy7 2.18 0.00 0.18 0.00 1 0.18 6.40E?01 ?0.04 Irf1 2.18 0.00 0.18 0.00 1 0.00 9.81E?01 ?0.14 Aamp 2.17 0.00 0.17 0.00 1 ?0.08 9.16E?01 0.39 Gm8730 2.17 0.78 0.61 0.00 0 0.03 9.16E?01 ?0.97 Zgpat 2.17 0.00 0.17 0.00 1 0.23 4.47E?01 ?0.28 St13 2.17 0.00 0.17 0.00 1 0.03 9.16E?01 ?0.54 Cdc42se2 2.17 0.00 0.17 0.00 1 ?0.02 9.36E?01 ?0.44 Anxa2 2.16 0.69 0.00 0.77 0 ?0.14 6.71E?01 0.46 Cpsf3l 2.16 0.00 0.16 0.00 1 0.30 2.53E?01 0.25 Gm2000 2.15 0.84 0.47 0.00 0 ?0.16 5.62E?01 ?0.56 Trim46 2.15 0.08 0.00 0.00 1 0.00 9.76E?01 ?0.12 Dusp16 2.15 0.00 0.15 0.00 1 ?0.16 1.48E?01 0.00 Zmat5 2.15 0.00 0.15 0.00 1 0.30 1.96E?01 0.39 Ptprk 2.15 0.00 0.15 0.00 1 0.17 6.28E?01 ?0.02 Zdhhc7 2.15 0.15 0.00 1.85 0 0.14 7.96E?01 0.64 Il2 2.14 0.00 0.14 0.00 1 0.21 6.26E?01 0.62 Msto1 2.14 0.00 0.14 0.00 1 0.22 3.66E?01 0.22 Il10 2.14 0.00 0.14 0.00 1 ?0.26 1.52E?01 0.00 Sbno2 2.14 0.00 0.14 0.00 1 ?0.14 4.66E?01 ?0.06 Snx17 2.14 0.00 0.14 0.00 1 0.15 7.29E?01 0.11 Kif11 2.14 0.00 0.14 0.00 1 ?0.14 3.28E?01 ?0.06 Ndfip2 2.13 0.00 0.08 2.05 0 ?0.02 9.43E?01 ?0.19 Card9 2.13 0.07 0.00 0.00 1 0.13 1.78E?02 0.26 Lsm4 2.13 0.15 0.25 1.59 0 0.29 4.77E?02 0.35 Ormdl3 2.13 0.00 0.13 0.00 1 ?0.22 5.67E?01 ?0.44 S100a10 2.13 0.71 0.00 0.70 0 0.24 4.32E?03 0.34 Notch2 2.13 0.00 0.13 0.00 1 0.28 3.07E?01 ?0.29 Senp7 2.12 0.00 0.12 0.00 1 0.27 2.72E?01 ?0.03 Cd48 2.12 0.80 0.52 0.00 0 1.09 4.17E?26 ?0.11 Ssbp4 2.12 0.13 0.26 1.61 0 0.12 7.93E?01 0.07 Cul1 2.12 0.00 0.12 0.00 1 ?0.24 4.52E?01 0.14 Mettl10 2.12 0.00 0.12 0.00 1 0.32 1.67E?01 0.29 Rabep2 2.11 0.00 0.11 0.00 1 0.25 3.59E?01 0.27 Pkig 2.11 0.00 0.11 0.00 1 ?0.11 7.47E?01 0.45 Desi1 2.11 0.00 0.11 0.00 1 ?0.05 9.16E?01 ?0.44 Furin 2.11 0.00 2.00 0.11 0 ?1.32 2.08E?16 0.82 Tcof1 2.11 0.00 0.11 0.00 1 0.16 7.20E?01 ?0.17 Glipr2 2.11 0.84 0.43 0.00 0 0.28 1.81E?01 ?0.10 Tgfbr3 2.11 0.00 0.11 0.00 1 ?0.12 6.95E?01 ?0.12 Tyk2 2.10 0.00 0.10 0.00 1 0.24 2.94E?01 ?0.66 Kif21b 2.10 0.00 0.10 0.00 1 0.32 1.73E?01 0.12 Tufm 2.10 0.00 0.10 0.00 1 0.25 3.89E?01 ?0.14 Zmiz1 2.10 0.00 0.10 0.00 1 0.04 9.16E?01 ?0.32 Il21 2.10 0.00 0.10 0.00 1 ?0.08 8.15E?01 ?0.06 Ttpal 2.10 0.00 0.10 0.00 1 0.05 9.16E?01 ?0.33 Rps6kb1 2.10 0.00 0.10 0.00 1 ?0.15 7.63E?01 ?0.71 Camk2g 2.10 0.00 0.10 0.00 1 0.07 9.16E?01 0.16 Tom1 2.10 0.00 0.10 0.00 1 0.20 4.19E?01 ?0.14 Actr1a 2.10 0.00 0.10 0.00 1 0.15 7.74E?01 ?0.30 Rgs14 2.10 0.00 0.10 0.00 1 ?0.03 9.16E?01 ?0.10 Ublcp1 2.10 0.00 0.10 0.00 1 ?0.04 9.16E?01 0.10 Otud3 2.09 0.00 0.09 0.00 1 0.01 9.56E?01 0.22 Tmem180 2.09 0.00 0.09 0.00 1 ?0.03 9.16E?01 ?0.27 Ergic1 2.09 0.00 0.09 0.00 1 0.02 9.53E?01 ?0.05 Aa467197 2.09 0.97 0.16 0.00 0 0.42 4.68E?02 ?0.01 Tdp2 2.09 0.00 0.25 1.84 0 ?0.56 1.00E?02 0.04 Rac1 2.09 0.07 0.06 1.88 0 ?0.22 1.23E?01 0.22 Phlda3 2.09 0.00 0.00 2.09 0 ?0.08 9.16E?01 0.12 Trmt112 2.09 0.00 0.09 0.00 1 0.13 6.94E?01 ?0.19 Ccny 2.08 0.00 0.08 0.00 1 ?0.18 6.57E?01 ?0.22 Slc43a3 2.08 0.00 0.08 0.00 1 0.03 9.16E?01 ?0.32 Ezh2 2.08 0.00 0.08 0.00 1 ?0.30 2.75E?01 ?0.19 Rps14 2.08 0.00 0.08 0.00 1 ?0.06 2.70E?01 0.00 Spred2 2.08 0.00 0.08 0.00 1 ?0.13 6.12E?01 0.12 Rn7s2 2.08 0.00 0.00 2.08 0 Rn7s1 2.08 0.00 0.00 2.08 0 Rpap2 2.08 0.00 0.08 0.00 1 0.19 4.73E?01 0.10 Cit 2.08 0.00 0.08 0.00 1 ?0.08 8.92E?01 ?0.16 Ascc2 2.08 0.00 0.08 0.00 1 0.01 9.56E?01 ?0.15 Ksr1 2.08 0.00 0.08 0.00 1 ?0.02 9.16E?01 ?0.18 Edem2 2.08 0.00 0.08 0.00 1 0.35 1.30E?01 ?0.12 Blzf1 2.08 0.00 0.08 0.00 1 ?0.04 9.16E?01 0.00 Ppp5c 2.08 0.00 0.08 0.00 1 0.22 4.78E?01 ?0.09 Smurf1 2.08 0.00 0.08 0.00 1 ?0.17 3.56E?01 0.18 Nop9 2.08 0.00 0.08 2.00 0 ?0.23 4.77E?01 0.05 Slc30a7 2.08 0.00 0.08 0.00 1 0.07 9.16E?01 ?0.29 Tnfrsf8 2.08 0.00 0.00 2.08 0 ?0.04 6.49E?01 0.00 Adcy3 2.08 0.00 0.08 0.00 1 0.14 6.08E?01 ?0.10 Pdcd1 2.07 0.00 0.00 2.07 0 ?0.01 9.93E?01 0.18 Fen1 2.07 0.00 0.07 0.00 1 ?0.19 5.90E?01 ?0.08 Themis 2.07 0.00 0.07 0.00 1 0.21 4.38E?01 ?0.47 Nudt22 2.07 0.00 0.07 0.00 1 0.28 2.11E?01 ?0.10 Cyth1 2.07 0.00 0.07 0.00 1 ?0.12 8.69E?01 0.11 Tmbim1 2.07 0.00 0.07 0.00 1 0.00 9.82E?01 0.35 Ndufaf1 2.07 0.00 0.07 0.00 1 0.24 3.44E?01 0.13 Klrc1 2.07 0.87 0.33 0.00 0 ?1.21 7.84E?09 0.71 Pomc 2.07 0.00 0.07 0.00 1 ?0.07 8.21E?01 0.17 Cpeb4 2.07 0.00 0.07 0.00 1 0.06 9.16E?01 0.41 Cul2 2.07 0.00 0.07 0.00 1 ?0.03 9.16E?01 0.19 Hgfac 2.07 0.03 0.00 0.00 1 ?0.02 9.09E?01 0.00 Pofut1 2.07 0.00 0.07 0.00 1 0.16 5.63E?01 ?0.20 Clasp2 2.07 0.00 0.06 2.00 0 0.08 9.16E?01 ?0.05 Nme7 2.06 0.00 0.06 0.00 1 0.16 4.96E?01 0.66 Ndst1 2.06 0.00 0.06 0.00 1 ?0.11 2.93E?01 0.00 Gpr137 2.06 0.00 0.06 0.00 1 0.01 9.61E?01 ?0.18 Ncoa5 2.06 0.00 0.06 0.00 1 0.24 3.02E?01 ?0.10 Mapkapk5 2.06 0.00 0.06 0.00 1 ?0.10 6.31E?01 ?0.06 Auh 2.05 0.00 0.05 0.00 1 0.16 7.47E?01 ?0.32 Gpx3 2.05 0.00 0.05 0.00 1 ?0.06 5.82E?01 0.00 Tmem116 2.05 0.03 0.00 0.00 1 ?0.01 9.16E?01 0.00 Hint1 2.05 0.00 0.05 0.00 1 ?0.11 5.88E?01 ?0.01 Mtmr3 2.05 0.00 0.05 0.00 1 ?0.04 9.16E?01 ?0.20 Ube2l3 2.05 0.00 0.05 0.00 1 0.06 9.16E?01 0.13 Il23r 2.05 0.00 0.05 0.00 1 0.01 9.16E?01 ?0.07 Asb2 2.05 0.46 1.12 0.00 0 0.93 8.67E?11 0.94 Snx32 2.05 0.00 0.05 0.00 1 0.15 3.44E?01 0.02 Fgfr1op 2.04 0.00 0.04 0.00 1 ?0.14 6.79E?01 0.01 Ccl2 2.04 0.00 0.04 0.00 1 ?0.04 7.20E?01 0.00 Slc16a10 2.04 0.00 0.04 0.00 1 0.04 9.16E?01 ?0.12 Batf 2.04 0.19 0.76 0.90 0 ?0.99 1.85E?09 ?0.11 Trpt1 2.04 0.00 0.04 0.00 1 0.09 7.33E?01 0.28 Jazf1 2.04 0.00 0.04 0.00 1 ?0.11 2.74E?01 0.00 Tubd1 2.04 0.00 0.04 0.00 1 ?0.01 9.16E?01 ?0.06 Rtel1 2.04 0.00 0.04 0.00 1 0.11 6.34E?01 0.22 Srm 2.04 0.00 0.08 1.96 0 ?0.02 9.16E?01 ?0.37 Thada 2.03 0.00 0.03 0.00 1 ?0.09 8.72E?01 0.43 Tppp 2.03 0.00 0.03 0.00 1 0.02 9.16E?01 0.18 Ppp4c 2.03 0.16 0.24 1.47 0 0.12 6.55E?01 ?0.24 Per3 2.03 0.00 0.03 0.00 1 0.09 7.22E?01 0.05 Hormad2 2.03 0.00 0.03 0.00 1 ?0.04 6.91E?01 0.00 Gm20186 2.03 0.45 1.13 0.00 0 ?1.00 1.94E?06 0.19 Ccdc122 2.02 0.00 0.02 0.00 1 0.05 7.03E?01 ?0.06 Fasl 2.02 0.19 1.65 0.00 0 ?1.32 8.53E?15 ?0.45 Sh2d2a 2.02 0.24 1.54 0.00 0 ?0.82 1.67E?09 ?0.73 Atp6v0a1 2.02 0.00 0.02 0.00 1 ?0.03 8.25E?01 0.00 Fosl1 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Itgb8 2.01 0.00 0.01 0.00 1 ?0.02 9.16E?01 0.00 Amz1 2.01 0.00 0.01 0.00 1 0.05 6.82E?01 0.15 Cxcl5 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Nkx2-3 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Thbs3 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Pf4 2.01 0.00 0.01 0.00 1 0.03 8.56E?01 ?0.06 Ephx4 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Osmr 2.01 0.00 0.01 0.00 1 0.00 9.16E?01 0.00 Ccl11 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Fndc4 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Ccl7 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Ptrf 2.01 0.00 0.01 0.00 1 ?0.01 9.16E?01 0.00 Mei1 2.00 0.00 0.00 0.00 1 0.00 9.16E?01 0.00 Lamb1 2.00 0.00 0.00 0.00 1 0.00 9.16E?01 0.00 Gene LPL-9_Geno_FDR LPL-2_logFC LPL-2_FDR LPL-2_Geno_logFC LPL-2_Geno_FDR Gpr18 8.21E?02 0.30 2.12E?06 ?0.87 1.82E?10 Gzmb 1.00E+00 0.46 9.03E?09 ?0.74 1.86E?06 Itgb1 8.72E?01 1.75 1.74E?200 0.47 8.89E?03 Ccr3 1.00E+00 0.00 8.83E?01 0.02 9.32E?01 Gzma 2.40E?10 1.16 4.89E?41 ?1.73 5.05E?18 Il22 1.00E+00 ?1.76 3.12E?27 0.80 2.21E?06 Zfp36l2 6.35E?03 0.22 9.29E?06 ?0.76 2.01E?14 Zbtb38 1.00E+00 ?0.09 3.49E?01 ?0.17 5.91E?01 Cd74 1.00E+00 0.29 3.04E?03 0.49 3.79E?02 Ccr5 1.00E+00 ?0.08 4.32E?01 ?0.70 1.48E?08 Cd160 4.54E?04 0.24 1.01E?02 ?1.39 5.51E?17 Map3k8 1.00E+00 0.27 4.85E?06 0.10 9.09E?01 Tnfsf8 4.04E?01 ?0.74 3.11E?27 0.87 1.14E?10 Ifitm1 1.00E+00 3.16 1.00E?167 1.21 2.18E?07 Nfkbiz 1.00E+00 ?0.17 1.07E?03 0.20 3.50E?01 Fosl2 1.00E+00 ?0.70 4.61E?36 0.14 6.91E?01 Crem 1.00E+00 ?0.94 1.07E?66 0.46 3.59E?05 Ccdc85b 1.00E+00 0.06 4.76E?01 ?0.25 1.73E?01 Fos 8.71E?01 ?1.04 1.20E?32 0.53 4.09E?02 Gpr183 1.00E+00 0.21 5.21E?06 ?0.09 8.27E?01 S100a4 8.76E?01 1.53 2.23E?210 0.10 6.18E?01 1110008f13rik 1.00E+00 0.32 2.97E?13 0.06 9.31E?01 Lsp1 1.00E+00 0.61 9.93E?121 ?0.20 7.10E?04 Litaf 9.15E?01 ?0.23 6.76E?04 0.29 1.70E?01 Cd7 2.19E?05 0.76 1.54E?22 ?1.10 2.81E?13 Dusp2 2.07E?01 0.22 2.20E?03 ?0.21 5.56E?01 Plac8 8.71E?02 0.32 8.98E?09 ?1.00 1.74E?25 H1f0 9.15E?01 0.39 4.24E?09 ?0.57 2.68E?04 S1pr1 9.15E?01 0.88 1.61E?61 ?0.15 6.60E?01 Ncf4 1.00E+00 0.62 2.05E?37 ?0.29 6.51E?02 Smim3 1.00E+00 ?0.11 1.78E?01 0.23 4.28E?01 Tesc 1.00E+00 ?0.34 4.70E?12 0.04 1.00E+00 Rbms1 1.00E+00 0.29 7.80E?10 ?0.15 5.25E?01 Lpxn 1.00E+00 ?0.04 6.22E?01 ?0.21 9.69E?02 Tnfrsf9 9.15E?01 ?0.34 8.09E?06 0.13 9.01E?01 Pmm1 1.00E+00 0.14 5.91E?02 ?0.09 9.31E?01 Tob2 1.00E+00 ?0.75 9.68E?37 ?0.03 1.00E+00 Ifng 9.15E?01 ?0.11 4.38E?01 0.25 4.83E?01 Cd226 1.00E+00 0.22 3.24E?04 ?0.35 7.33E?02 Ctsw 1.00E+00 0.41 2.35E?33 ?0.40 1.07E?08 Itga4 9.15E?01 0.40 1.49E?15 ?0.41 2.71E?03 Cd28 1.00E+00 0.08 6.50E?02 0.29 5.47E?05 Klf2 5.50E?01 1.25 4.15E?91 ?0.23 2.36E?01 Ly6c2 8.72E?01 1.60 2.37E?58 0.29 6.52E?01 Ccr9 5.15E?07 ?0.39 8.08E?05 ?0.87 4.80E?06 Ets1 1.00E+00 ?0.13 1.64E?05 ?0.16 9.20E?02 Il7r 8.46E?01 0.14 5.94E?03 ?0.35 7.68E?04 Ptpn22 6.92E?01 ?0.12 2.54E?03 ?0.03 1.00E+00 Gm12840 1.00E+00 0.09 3.27E?01 ?0.59 7.30E?07 Zfp36l1 8.94E?01 ?0.35 2.80E?10 ?0.11 7.89E?01 Atxn2l 1.00E+00 0.01 8.67E?01 0.02 1.00E+00 Pde4b 1.00E+00 ?0.05 4.58E?01 ?0.04 1.00E+00 Selp 1.00E+00 0.01 5.37E?01 0.03 5.25E?01 Anxa6 1.00E+00 0.48 6.74E?49 0.01 1.00E+00 Peli1 1.00E+00 0.00 9.94E?01 0.18 2.36E?01 Odc1 1.00E+00 ?1.00 1.42E?103 0.78 1.42E?15 Pglyrp1 1.00E+00 1.21 4.44E?123 ?0.34 1.61E?02 Pim3 1.00E+00 ?0.48 3.57E?14 0.29 2.16E?01 Pim1 7.90E?02 ?0.11 1.68E?02 0.38 1.17E?07 Mt1 9.15E?01 0.69 2.54E?19 ?0.66 4.42E?03 Stat3 1.00E+00 ?0.26 1.03E?07 0.19 3.44E?01 Stat5a 1.00E+00 ?0.11 1.64E?01 0.16 7.24E?01 Vmp1 6.99E?01 ?0.01 9.62E?01 ?0.27 6.92E?02 Ier2 1.00E+00 0.21 2.69E?07 ?0.03 1.00E+00 Tnip1 1.00E+00 0.13 3.16E?02 0.14 6.52E?01 Timp1 1.00E+00 0.00 5.52E?01 0.00 1.00E+00 Amdhd1 1.00E+00 0.01 6.41E?01 ?0.02 1.00E+00 Rora 1.00E+00 0.12 9.23E?03 0.16 2.68E?01 Gm5111 1.00E+00 0.01 5.23E?01 ?0.04 5.70E?01 Fermt3 1.00E+00 0.19 2.35E?04 ?0.31 2.58E?02 Dap 7.71E?01 0.15 1.25E?02 ?0.34 3.38E?02 Hist1h1c 1.00E+00 0.52 2.52E?16 ?0.37 9.01E?02 Cfl1 2.14E?01 0.15 5.96E?13 0.02 1.00E+00 Ipmk 1.00E+00 ?0.36 1.89E?08 0.16 6.84E?01 Klrd1 2.07E?01 1.28 3.41E?111 ?0.26 1.92E?01 Gfi1 9.92E?01 ?0.01 9.97E?01 ?0.11 8.05E?01 S100a6 1.00E+00 1.20 1.69E?261 0.06 8.25E?01 Rorc 1.00E+00 ?0.11 3.02E?04 ?0.02 9.31E?01 Stat4 1.00E+00 ?0.28 2.49E?08 0.25 1.02E?01 Fdps 1.00E+00 ?0.09 2.97E?01 0.06 1.00E+00 Gpr65 1.00E+00 ?0.33 1.74E?07 0.02 1.00E+00 Rapgef6 1.00E+00 ?0.02 8.37E?01 ?0.07 9.35E?01 Tmem160 1.00E+00 0.27 2.30E?12 ?0.02 1.00E+00 Rasgrp1 1.00E+00 ?0.39 6.41E?14 ?0.07 9.31E?01 Pnkd 9.15E?01 0.08 2.94E?01 ?0.11 8.44E?01 Ccnd3 1.00E+00 0.41 1.47E?21 0.28 1.64E?02 Panx1 1.00E+00 0.20 5.88E?04 ?0.06 1.00E+00 Thap11 9.15E?01 0.15 1.28E?02 ?0.22 3.96E?01 Lysmd2 1.00E+00 ?0.01 8.99E?01 ?0.34 8.45E?02 Ubac2 1.00E+00 0.03 7.34E?01 ?0.21 2.85E?01 Lgals3 9.15E?01 1.40 2.98E?233 0.23 2.11E?02 Cyb5r4 1.00E+00 0.32 4.83E?11 ?0.07 9.31E?01 Upf3a 1.00E+00 0.12 9.45E?02 ?0.39 1.19E?02 Gm10076 1.00E+00 ?0.09 8.50E?02 ?1.04 8.24E?36 Ccdc69 1.00E+00 0.08 3.35E?01 ?0.10 8.77E?01 Ccl5 3.77E?04 0.81 6.76E?48 ?1.13 1.94E?20 Gramd3 9.26E?01 0.42 2.99E?26 ?0.21 5.32E?02 Errfi1 1.00E+00 ?0.25 4.81E?04 0.26 2.86E?01 Itgae 2.78E?03 0.27 2.71E?04 ?0.82 6.06E?08 Il2ra 1.00E+00 0.03 7.88E?01 0.22 5.25E?01 Gpx4 1.00E+00 ?0.35 2.78E?26 0.11 5.10E?01 Ndfip1 1.00E+00 ?0.14 2.09E?03 0.14 4.52E?01 Syt11 1.00E+00 0.10 2.17E?01 ?0.05 1.00E+00 Dph5 9.15E?01 ?0.02 7.93E?01 0.11 8.35E?01 Slc39a8 9.15E?01 ?0.07 2.01E?01 ?0.08 7.03E?01 Rnf187 1.00E+00 ?0.11 5.11E?02 0.02 1.00E+00 Fam53b 1.00E+00 0.19 2.10E?03 0.04 1.00E+00 Prdx5 9.15E?01 ?0.07 2.29E?01 0.11 6.80E?01 Ccrl2 5.56E?01 ?0.15 8.31E?02 0.24 4.99E?01 Ep300 1.00E+00 0.06 5.04E?01 ?0.13 7.40E?01 Hdac7 1.00E+00 0.02 7.59E?01 ?0.28 7.88E?02 Cd6 1.00E+00 ?0.05 4.17E?01 ?0.23 5.53E?02 Traf3ip2 7.75E?01 0.08 2.19E?01 ?0.29 9.01E?02 Gnb2 1.00E+00 0.17 7.24E?07 ?0.20 3.37E?02 Tet2 1.00E+00 ?0.17 1.02E?02 0.11 8.71E?01 Fam189b 1.00E+00 ?0.09 2.93E?01 ?0.08 9.31E?01 Skap2 1.00E+00 0.04 6.97E?01 ?0.06 1.00E+00 Lgals1 8.36E?01 1.11 0.00E+00 0.30 1.31E?09 Socs1 1.00E+00 ?0.29 3.38E?06 0.34 6.39E?02 Itgav 9.15E?01 ?0.36 1.44E?09 0.30 1.07E?01 Dnajb4 1.00E+00 ?0.31 3.77E?06 0.34 6.08E?02 Cdkn1a 1.00E+00 ?0.69 6.69E?31 0.80 2.00E?10 Arhgef2 1.00E+00 0.16 1.31E?02 ?0.19 5.25E?01 Dnmt3a 1.00E+00 ?0.06 4.56E?01 ?0.08 9.31E?01 Jund 8.04E?06 ?0.12 1.18E?03 0.68 6.22E?42 Scamp3 1.00E+00 0.09 1.62E?01 ?0.09 8.64E?01 Tmem30a 6.80E?01 0.14 1.32E?02 ?0.35 7.50E?03 Ash1l 1.00E+00 ?0.03 7.62E?01 0.02 1.00E+00 Lsm14a 1.00E+00 0.10 1.22E?01 ?0.15 6.13E?01 Slain2 1.00E+00 0.02 8.45E?01 ?0.14 6.99E?01 Muc1 1.00E+00 0.11 9.34E?02 0.02 1.00E+00 Adamts14 1.00E+00 0.00 7.34E?01 0.00 1.00E+00 Ptk2b 1.00E+00 0.02 8.39E?01 ?0.06 1.00E+00 Stk11 1.00E+00 ?0.34 1.06E?11 0.11 8.41E?01 Ccr2 1.00E+00 0.17 2.17E?03 0.11 7.02E?01 Itgal 4.62E?01 0.06 5.02E?01 0.06 9.60E?01 Elf1 9.15E?01 0.01 9.24E?01 0.01 1.00E+00 Ptprc 1.00E+00 0.20 4.24E?12 ?0.17 6.25E?02 Rbx1 1.00E+00 0.06 1.77E?01 ?0.07 8.72E?01 Traf3ip3 9.74E?01 0.27 6.92E?07 ?0.44 1.42E?03 Ccdc88b 1.00E+00 0.10 2.07E?01 0.12 8.72E?01 Tsen34 1.00E+00 ?0.01 8.73E?01 ?0.08 8.78E?01 Ay036118 1.00E+00 ?0.29 8.27E?06 ?1.15 3.92E?23 Il24 H2-q10 1.00E+00 ?0.07 5.33E?01 0.34 3.05E?02 Scand1 1.00E+00 0.16 8.97E?05 ?0.17 2.65E?01 Tab2 1.00E+00 0.14 3.65E?02 0.09 9.31E?01 Nfkb1 1.00E+00 ?0.15 5.50E?03 0.14 5.92E?01 Rusc1 1.00E+00 0.13 5.06E?02 ?0.09 9.12E?01 Esyt1 1.00E+00 0.48 8.09E?24 ?0.13 6.89E?01 Commd7 9.96E?01 0.04 6.83E?01 ?0.10 9.01E?01 Rfng 1.00E+00 0.01 9.19E?01 ?0.19 4.61E?01 Rpl27-ps3 2.26E?01 ?0.28 1.77E?10 ?1.05 8.09E?50 Gigyf1 1.00E+00 ?0.10 1.28E?01 ?0.11 7.49E?01 Rgcc 6.43E?01 0.04 7.34E?01 1.71 1.89E?45 Rpl3 9.15E?01 ?0.02 4.86E?01 ?0.15 2.99E06 Mrpl20 1.00E+00 0.16 1.55E?03 ?0.03 1.00E+00 Gm2a 1.00E+00 ?0.21 3.51E?05 0.15 5.25E?01 Mus81 1.00E+00 0.13 1.54E?02 ?0.03 1.00E+00 Lpp 1.00E+00 0.06 3.71E?01 ?0.18 5.12E?01 Chp1 9.15E?01 0.16 4.42E?03 0.00 1.00E+00 Mob4 1.00E+00 0.11 5.09E?02 0.10 8.35E?01 Lamp1 1.00E+00 ?0.06 4.76E?01 ?0.03 1.00E+00 Phf5a 1.00E+00 0.16 2.65E?03 ?0.24 1.51E?01 Fnip1 1.00E+00 0.11 8.89E?02 ?0.01 1.00E+00 Calm3 1.00E+00 ?0.05 4.72E?01 0.08 8.45E?01 Lrp10 1.00E+00 0.13 2.73E?02 ?0.14 5.81E?01 Stat5b 1.00E+00 ?0.12 1.09E?01 0.02 1.00E+00 Bach2 1.00E+00 ?0.04 4.97E?01 ?0.04 1.00E+00 Prkab1 1.00E+00 ?0.02 8.52E?01 0.27 1.41E?01 Hvcn1 9.15E?01 ?0.18 5.47E?03 0.21 4.56E?01 Tmem150a 1.00E+00 0.01 5.10E?01 ?0.01 1.00E+00 Nfkbia 1.00E+00 0.22 5.16E?08 0.27 1.43E?03 Ifitm3 1.00E+00 1.07 9.58E?66 0.02 1.00E+00 Egfp_ires_il23r Bad 1.00E+00 0.15 1.86E?02 ?0.05 1.00E+00 Zbtb46 1.00E+00 0.10 2.77E?02 ?0.08 8.94E?01 Cacna1s 1.00E+00 ?0.05 2.78E?01 ?0.01 1.00E+00 Vamp3 1.00E+00 0.15 1.23E?02 0.05 1.00E+00 Fyn 1.00E+00 ?0.06 4.94E?01 ?0.06 9.32E?01 Stx6 1.00E+00 ?0.25 1.19E?05 ?0.05 1.00E+00 Ikzf3 1.00E+00 ?0.24 5.66E?04 0.17 6.73E?01 Mgat2 1.00E+00 0.17 1.12E?03 0.16 5.10E?01 Serpinb9 9.50E?01 0.26 8.45E?06 ?0.35 9.55E?03 Dennd1b 9.15E?01 ?0.02 8.68E?01 ?0.16 5.86E?01 Bloc1s4 1.00E+00 0.00 9.85E?01 0.18 5.25E?01 Anxa1 1.00E+00 1.20 1.76E?91 0.79 2.26E?09 Smad3 1.00E+00 0.15 1.68E?02 0.01 1.00E+00 Tmem258 1.00E+00 ?0.02 7.37E?01 0.06 9.31E?01 Lmna 8.60E?04 0.20 1.46E?02 1.94 1.16E?69 Sp140 1.00E+00 0.15 2.19E?02 ?0.23 3.43E?01 Actn2 1.00E+00 0.15 3.07E?02 ?0.56 2.95E?05 Acbd6 1.00E+00 0.01 8.54E?01 ?0.20 4.30E?01 Ahnak 1.00E+00 0.50 1.39E?39 0.16 3.54E?01 Arpc2 1.00E+00 0.16 4.07E?15 ?0.02 9.72E?01 Erp29 1.00E+00 0.19 6.28E?04 ?0.03 1.00E+00 Nhp2l1 1.00E+00 ?0.23 1.13E?09 0.19 1.40E?01 Ctbp1 1.00E+00 0.03 6.83E?01 ?0.35 1.72E?03 Gba 1.00E+00 0.11 9.45E?02 ?0.20 4.53E?01 Lztfl1 9.59E?01 ?0.32 1.88E?07 ?0.56 2.81E?04 Ptpn2 1.00E+00 0.04 6.83E?01 ?0.13 7.03E?01 Usp36 1.00E+00 ?0.15 4.22E?02 ?0.16 6.31E?01 Grb7 9.96E?01 ?0.19 4.07E?04 0.15 5.18E?01 Fndc3a 9.96E?01 ?0.03 7.34E?01 0.08 9.31E?01 Mt2 9.78E?01 0.41 1.92E?10 ?0.40 3.25E?01 Dctn4 9.15E?01 0.03 7.34E?01 0.05 1.00E+00 Nusap1 1.00E+00 ?0.43 6.53E?13 0.12 4.14E?01 Rbm22 1.00E+00 0.16 1.75E?03 ?0.19 3.93E?01 Crip1 1.00E+00 1.16 3.21E?287 0.54 9.93E?22 Anp32b 1.00E+00 ?0.20 1.65E?05 0.14 5.25E?01 Aurkaip1 1.00E+00 0.04 6.22E?01 0.04 1.00E+00 Ripk2 1.00E+00 0.21 1.59E?04 ?0.15 6.84E?01 Nubp1 1.00E+00 0.12 6.45E?02 ?0.28 1.17E?01 Camta1 1.00E+00 ?0.05 5.65E?01 ?0.08 9.33E?01 Ube2j2 1.00E+00 0.05 4.56E?01 ?0.04 1.00E+00 Kif3b 9.15E?01 0.00 9.36E?01 ?0.09 7.23E?01 Brap 1.00E+00 ?0.08 3.33E?01 ?0.04 1.00E+00 Gm8096 Ermn 1.00E+00 ?0.10 4.16E?01 ?0.13 9.31E?01 Plagl2 1.00E+00 ?0.05 5.51E?01 ?0.10 8.23E?01 Plek 1.00E+00 0.44 1.16E?12 0.01 1.00E+00 D030056l22rik 1.00E+00 ?0.29 3.39E?06 0.22 3.86E?01 Ccr1 7.11E?01 ?0.20 1.53E?03 0.17 4.25E?01 Krtcap2 5.81E?03 0.14 3.21E?06 0.31 3.46E?07 Sh2b1 1.00E+00 0.01 8.91E?01 ?0.13 8.16E?01 Abi3 9.96E?01 ?0.51 3.25E?16 ?0.12 8.68E?01 Ccnl2 1.00E+00 0.06 4.38E?01 ?0.02 1.00E+00 Kbtbd7 1.00E+00 0.03 4.57E?01 0.06 8.26E?01 Csf2 1.00E+00 0.07 7.09E?01 0.43 1.96E?02 Pycard 9.15E?01 0.82 8.39E?90 ?0.55 3.15E?10 Dock7 1.00E+00 0.00 6.83E?01 0.00 1.00E+00 Herpud1 2.44E?01 0.06 4.49E?01 0.22 1.99E?01 Arf6 1.00E+00 0.12 1.50E?03 0.22 1.95E?02 Zyx 1.00E+00 0.87 1.51E?71 ?0.22 2.86E?01 Zfp91 1.00E+00 ?0.04 6.57E?01 0.09 9.35E?01 Fam171b 1.00E+00 0.02 5.51E?01 0.02 1.00E+00 Maml2 1.00E+00 0.12 7.23E?02 0.02 1.00E+00 Ifngr2 1.00E+00 ?0.22 6.48E?06 0.04 1.00E+00 Bhlhe40 9.15E?01 0.12 1.44E?04 0.18 7.29E?03 Cisd1 1.00E+00 ?0.01 8.15E?01 0.07 9.58E?01 Zfp420 7.11E?01 ?0.01 7.62E?01 0.02 1.00E+00 Zc3h12a 1.00E+00 0.11 6.00E?02 0.46 2.45E?06 Plcg2 9.15E?01 0.08 1.03E?02 ?0.07 8.19E?01 2310036o22rik 1.00E+00 0.03 6.28E?01 ?0.11 6.52E?01 Eif3c 1.00E+00 0.11 4.69E?02 ?0.06 9.31E?01 Slc15a3 1.00E+00 ?0.18 1.93E?02 ?0.01 1.00E+00 Acap3 1.00E+00 0.10 4.53E?02 0.13 6.52E?01 Tef 1.00E+00 0.02 7.34E?01 0.18 4.17E?01 Emp3 1.00E+00 0.93 4.59E?187 0.05 9.01E?01 Ssr2 1.00E+00 0.06 5.51E?01 ?0.06 9.83E?01 Usp1 1.00E+00 ?0.10 1.51E?01 0.18 5.37E?01 Rpl10-ps3 1.00E+00 ?0.25 1.60E?07 ?0.89 5.90E?25 Plcxd2 1.00E+00 ?0.30 1.20E?06 ?0.42 9.75E?03 Adcy7 1.00E+00 0.03 7.34E?01 ?0.06 9.85E?01 Irf1 1.00E+00 0.07 4.01E?01 0.43 1.05E?03 Aamp 1.00E+00 ?0.10 7.72E?02 0.06 9.31E?01 Gm8730 5.54E?06 0.05 1.49E?01 ?0.78 1.16E?56 Zgpat 1.00E+00 0.03 6.95E?01 ?0.18 5.25E?01 St13 9.15E?01 ?0.30 3.36E?10 0.29 4.51E?02 Cdc42se2 9.52E?01 ?0.01 8.95E?01 ?0.06 9.35E?01 Anxa2 9.15E?01 0.69 3.68E?70 0.35 1.11E?04 Cpsf3l 1.00E+00 0.09 2.85E?01 ?0.04 1.00E+00 Gm2000 8.76E?01 ?0.23 7.20E?07 ?0.84 1.60E?23 Trim46 1.00E+00 0.08 4.53E?02 ?0.06 9.31E?01 Dusp16 1.00E+00 0.02 6.23E?01 ?0.03 1.00E+00 Zmat5 1.00E+00 0.05 5.51E?01 ?0.04 1.00E+00 Ptprk 1.00E+00 0.06 5.33E?01 ?0.18 5.86E?01 Zdhhc7 8.47E?01 0.15 1.69E?02 0.13 7.72E?01 Il2 8.72E?01 ?0.23 8.82E?04 0.01 1.00E+00 Msto1 1.00E+00 0.02 7.46E?01 ?0.14 5.96E?01 Il10 1.00E+00 ?0.26 2.62E?05 ?0.02 1.00E+00 Sbno2 1.00E+00 0.03 6.75E?01 ?0.11 6.35E?01 Snx17 1.00E+00 ?0.02 8.03E?01 ?0.26 1.84E?01 Kif11 1.00E+00 ?0.13 8.65E?06 ?0.10 3.77E?01 Ndfip2 1.00E+00 0.07 3.33E?01 ?0.07 9.31E?01 Card9 9.96E?01 ?0.01 7.34E?01 0.02 5.25E?01 Lsm4 9.15E?01 0.02 7.43E?01 ?0.12 5.91E?01 Ormdl3 9.96E?01 ?0.22 4.71E?04 ?0.04 1.00E+00 S100a10 5.39E?01 0.71 2.92E?237 0.06 6.52E?01 Notch2 1.00E+00 ?0.14 3.79E?02 0.02 1.00E+00 Senp7 1.00E+00 0.00 9.90E?01 ?0.12 8.32E?01 Cd48 1.00E+00 0.80 2.02E?100 ?0.29 2.03E?03 Ssbp4 1.00E+00 0.13 1.85E?02 0.14 5.70E?01 Cul1 1.00E+00 ?0.05 5.74E?01 ?0.09 9.31E?01 Mettl10 1.00E+00 0.11 1.33E?01 0.05 1.00E+00 Rabep2 1.00E+00 0.10 1.23E?01 ?0.08 9.31E?01 Pkig 4.59E?01 ?0.09 4.74E?02 0.10 7.03E?01 Desi1 1.00E+00 ?0.04 6.83E?01 ?0.15 6.87E?01 Furin 5.16E?01 ?0.61 7.81E?32 0.43 2.07E?04 Tcof1 1.00E+00 ?0.05 6.22E?01 ?0.01 1.00E+00 Glipr2 1.00E+00 0.84 2.28E?92 ?0.01 1.00E+00 Tgfbr3 1.00E+00 ?0.05 4.97E?01 ?0.05 9.06E?01 Tyk2 4.66E?01 0.07 3.28E?01 ?0.03 1.00E+00 Kif21b 1.00E+00 0.00 9.79E?01 ?0.07 9.62E?01 Tufm 1.00E+00 0.02 7.86E?01 0.01 1.00E+00 Zmiz1 1.00E+00 0.05 5.75E?01 ?0.24 3.12E?01 Il21 1.00E+00 ?0.13 8.93E?04 0.04 8.72E?01 Ttpal 1.00E+00 0.05 5.37E?01 ?0.04 1.00E+00 Rps6kb1 7.31E?01 ?0.10 1.94E?01 0.03 1.00E+00 Camk2g 1.00E+00 0.07 4.32E?01 ?0.14 7.13E?01 Tom1 1.00E+00 0.07 3.82E?01 ?0.05 9.90E?01 Actr1a 1.00E+00 ?0.03 7.34E?01 ?0.16 6.52E?01 Rgs14 1.00E+00 0.03 7.34E?01 ?0.04 1.00E+00 Ublcp1 1.00E+00 0.05 5.51E?01 ?0.19 4.10E?01 Otud3 1.00E+00 0.03 6.85E?01 ?0.11 7.40E?01 Tmem180 9.15E?01 ?0.01 9.00E?01 ?0.02 1.00E+00 Ergic1 1.00E+00 ?0.17 1.27E?03 0.16 4.65E?01 Aa467197 1.00E+00 0.97 4.55E?86 0.14 6.47E?01 Tdp2 1.00E+00 0.03 7.93E?01 0.27 2.02E?01 Rac1 1.00E+00 0.07 7.04E?02 ?0.05 9.27E?01 Phlda3 1.00E+00 0.01 9.18E?01 0.17 3.67E?01 Trmt112 1.00E+00 0.00 9.68E?01 0.02 1.00E+00 Ccny 1.00E+00 ?0.07 4.44E?01 ?0.11 8.67E?01 Slc43a3 9.15E?01 ?0.03 6.07E?01 ?0.14 4.53E?01 Ezh2 1.00E+00 ?0.27 4.40E?06 ?0.08 9.31E?01 Rps14 1.00E+00 ?0.06 7.47E?06 0.00 1.00E+00 Spred2 1.00E+00 ?0.05 4.68E?01 ?0.01 1.00E+00 Rn7s2 Rn7s1 Rpap2 1.00E+00 ?0.02 7.66E?01 ?0.14 5.25E?01 Cit 1.00E+00 ?0.08 4.93E?03 0.21 3.02E?01 Ascc2 1.00E+00 0.04 6.64E?01 ?0.06 9.35E?01 Ksr1 1.00E+00 0.06 2.37E?01 ?0.09 8.29E?01 Edem2 1.00E+00 0.02 7.93E?01 ?0.06 1.00E+00 Blzf1 1.00E+00 0.02 8.41E?01 ?0.04 1.00E+00 Ppp5c 1.00E+00 0.00 9.71E?01 0.08 9.31E?01 Smurf1 9.15E?01 0.02 7.34E?01 ?0.18 2.27E?01 Nop9 1.00E+00 ?0.01 9.08E?01 ?0.23 3.48E?01 Slc30a7 1.00E+00 0.09 1.87E?01 ?0.02 1.00E+00 Tnfrsf8 1.00E+00 ?0.01 6.87E?01 ?0.02 9.96E?01 Adcy3 1.00E+00 ?0.01 8.94E?01 ?0.08 8.75E?01 Pdcd1 1.00E+00 ?0.01 9.71E?01 0.37 1.36E?01 Fen1 1.00E+00 ?0.21 2.53E?04 0.04 1.00E+00 Themis 9.15E?01 ?0.02 8.61E?01 0.07 9.31E?01 Nudt22 1.00E+00 0.01 9.16E?01 0.07 9.33E?01 Cyth1 1.00E+00 ?0.02 8.30E?01 0.07 9.53E?01 Tmbim1 9.15E?01 ?0.01 9.43E?01 ?0.02 1.00E+00 Ndufaf1 1.00E+00 0.04 6.31E?01 ?0.09 8.87E?01 Klrc1 8.76E?01 0.87 4.48E?57 0.28 3.82E?02 Pomc 9.15E?01 0.03 6.62E?01 ?0.18 1.32E?01 Cpeb4 8.76E?01 ?0.04 5.59E?01 0.04 9.44E?01 Cul2 1.00E+00 ?0.11 9.35E?02 0.02 1.00E+00 Hgfac 1.00E+00 0.03 2.80E?02 0.00 1.00E+00 Pofut1 1.00E+00 ?0.10 6.46E?02 0.02 1.00E+00 Clasp2 1.00E+00 ?0.04 4.34E?01 ?0.01 1.00E+00 Nme7 3.48E?01 0.04 5.71E?01 ?0.04 9.97E?01 Ndst1 1.00E+00 ?0.03 4.51E?01 0.01 1.00E+00 Gpr137 1.00E+00 0.02 6.96E?01 ?0.03 1.00E+00 Ncoa5 1.00E+00 ?0.05 4.56E?01 ?0.16 3.19E?01 Mapkapk5 1.00E+00 0.02 6.95E?01 0.01 1.00E+00 Auh 1.00E+00 ?0.04 6.83E?01 ?0.21 4.42E?01 Gpx3 1.00E+00 ?0.01 7.93E?01 0.04 9.02E?01 Tmem116 1.00E+00 0.03 4.43E?02 0.01 1.00E+00 Hint1 1.00E+00 ?0.05 2.86E?01 0.03 9.94E?01 Mtmr3 1.00E+00 ?0.04 6.89E?01 0.04 1.00E+00 Ube2l3 1.00E+00 0.04 5.15E?01 0.01 1.00E+00 Il23r 1.00E+00 ?0.06 3.06E?02 0.01 1.00E+00 Asb2 1.01E?01 ?0.82 1.21E?45 0.23 4.53E?01 Snx32 1.00E+00 0.03 4.97E?01 0.02 1.00E+00 Fgfr1op 1.00E+00 ?0.07 2.95E?01 ?0.05 1.00E+00 Ccl2 1.00E+00 ?0.02 6.93E?01 0.01 1.00E+00 Slc16a10 1.00E+00 ?0.04 1.79E?01 ?0.06 5.37E?01 Batf 1.00E+00 0.19 1.01E?04 ?0.08 9.31E?01 Trpt1 9.96E?01 ?0.01 9.76E?01 0.02 1.00E+00 Jazf1 1.00E+00 ?0.02 7.34E?01 ?0.05 8.91E?01 Tubd1 1.00E+00 ?0.03 3.98E?01 ?0.02 1.00E+00 Rtel1 1.00E+00 0.05 3.81E?01 ?0.08 8.67E?01 Srm 9.15E?01 ?0.06 3.16E?01 0.06 9.41E?01 Thada 8.76E?01 ?0.23 1.60E?07 ?0.03 9.94E?01 Tppp 9.15E?01 0.00 9.14E?01 0.10 5.10E?01 Ppp4c 1.00E+00 0.16 7.01E?05 ?0.14 4.53E?01 Per3 1.00E+00 ?0.09 1.74E?03 ?0.01 1.00E+00 Hormad2 1.00E+00 ?0.03 9.85E?02 ?0.02 5.72E?01 Gm20186 1.00E+00 ?0.20 8.04E?03 ?0.45 5.31E?03 Ccdc122 1.00E+00 0.01 4.72E?01 ?0.03 8.72E?01 Fasl 1.00E+00 0.19 2.41E?04 0.35 1.76E?03 Sh2d2a 5.39E?01 ?0.13 6.69E?03 ?0.24 5.78E?02 Atp6v0a1 1.00E+00 ?0.01 7.06E?01 0.02 9.94E?01 Fosl1 1.00E+00 ?0.01 5.87E?01 ?0.01 9.31E?01 Itgb8 1.00E+00 ?0.01 6.74E?01 ?0.01 9.31E?01 Amz1 9.15E?01 0.00 8.96E?01 0.03 8.33E?01 Cxcl5 1.00E+00 0.00 6.83E?01 ?0.01 9.31E?01 Nkx2-3 1.00E+00 0.00 9.18E?01 0.05 2.36E?01 Thbs3 1.00E+00 ?0.01 1.82E?01 0.00 1.00E+00 Pf4 1.00E+00 ?0.02 7.34E?01 ?0.01 1.00E+00 Ephx4 1.00E+00 0.00 9.01E?01 0.00 1.00E+00 Osmr 1.00E+00 0.00 4.97E?01 0.00 1.00E+00 Ccl11 1.00E+00 ?0.01 2.61E?01 0.00 1.00E+00 Fndc4 1.00E+00 ?0.01 2.98E?01 0.00 1.00E+00 Ccl7 1.00E+00 ?0.01 2.61E?01 0.00 1.00E+00 Ptrf 1.00E+00 0.01 6.89E?01 0.02 7.31E?01 Mei1 1.00E+00 0.00 4.97E?01 0.00 1.00E+00 Lamb1 1.00E+00 0.00 4.20E?01 0.00 1.00E+00 Gene logFC_LPL_TissueDE FDRLPL_TissueDE LPL_Geno_logFc LPLGeno_FDR Gpr18 0.96 1.73E?191 ?0.43 2.85E?23 Gzmb 1.73 0.00E+00 ?0.07 3.72E?01 Itgb1 ?2.90 0.00E+00 ?0.02 8.68E?01 Ccr3 ?0.01 1.50E?01 0.01 3.64E?01 Gzma 0.25 3.52E?05 ?1.55 6.24E?128 Il22 2.34 1.69E?284 0.09 5.63E?01 Zfp36l2 1.28 0.00E+00 ?0.77 1.26E?128 Zbtb38 ?0.02 7.35E?01 ?0.21 4.35E?07 Cd74 0.47 2.30E?23 0.35 1.00E?07 Ccr5 1.14 4.43E?273 ?0.19 4.51E?06 Cd160 0.54 3.27E?37 ?1.38 3.92E?160 Map3k8 1.57 0.00E+00 ?0.05 2.66E?01 Tnfsf8 2.00 0.00E+00 0.25 1.80E?07 Ifitm1 ?1.25 2.03E?53 0.27 7.06E?02 Nfkbiz 2.36 0.00E+00 0.24 1.85E?13 Fosl2 2.34 0.00E+00 0.42 1.93E?30 Crem 3.18 0.00E+00 0.87 1.52E?146 Ccdc85b ?0.08 3.66E?03 ?0.31 1.45E?22 Fos 1.94 0.00E+00 0.90 3.74E?58 Gpr183 1.35 0.00E+00 0.03 5.64E?01 S100a4 ?1.82 0.00E+00 ?0.71 9.86E?65 1110008f13rik ?0.29 3.34E?38 ?0.02 7.17E?01 Lsp1 ?0.86 0.00E+00 ?0.41 5.73E?94 Litaf 1.61 0.00E+00 0.31 5.15E?14 Cd7 ?0.36 9.57E?25 ?1.40 5.09E?150 Dusp2 ?0.23 8.06E?13 ?0.42 2.72E?20 Plac8 1.58 0.00E+00 ?0.29 8.95E?15 H1f0 0.30 2.02E?17 ?0.75 1.19E?64 S1pr1 ?0.73 1.05E?149 ?0.42 4.66E?22 Ncf4 ?0.29 2.67E?26 ?0.29 6.15E?15 Smim3 1.46 0.00E+00 0.20 2.60E?06 Tesc 0.47 2.25E?70 0.09 1.66E?02 Rbms1 ?0.42 3.83E?72 ?0.18 1.11E?07 Lpxn 0.97 0.00E+00 ?0.04 2.29E?01 Tnfrsf9 1.37 6.99E?304 0.50 1.36E?26 Pmm1 ?0.02 5.25E?01 ?0.15 2.31E?04 Tob2 1.32 0.00E+00 0.38 7.86E?22 Ifng 1.69 0.00E+00 0.45 4.62E?16 Cd226 ?0.30 8.07E?26 ?0.23 6.66E?08 Ctsw 0.32 2.47E?57 ?0.35 3.78E?45 Itga4 ?0.39 1.20E?42 ?0.44 9.68E?35 Cd28 1.08 0.00E+00 0.11 1.52E?06 Klf2 ?1.77 0.00E+00 ?0.71 1.06E?46 Ly6c2 ?2.35 0.00E+00 ?0.04 8.54E?01 Ccr9 0.97 9.81E?132 ?0.93 5.85E?62 Ets1 0.87 0.00E+00 0.03 1.65E?01 Il7r ?0.06 6.14E?02 ?0.48 7.56E?56 Ptpn22 1.18 0.00E+00 ?0.14 5.52E?08 Gm12840 2.19 0.00E+00 ?0.09 5.83E?02 Zfp36l1 1.17 0.00E+00 ?0.19 8.62E?07 Atxn2l 0.07 2.08E?02 0.01 8.40E?01 Pde4b 2.14 0.00E+00 ?0.02 6.98E?01 Selp 0.00 2.17E?01 0.00 9.89E?01 Anxa6 ?0.83 0.00E+00 ?0.20 3.31E?15 Peli1 0.92 0.00E+00 0.12 2.03E?05 Odc1 3.27 0.00E+00 0.72 2.42E?135 Pglyrp1 ?1.58 0.00E+00 ?0.70 2.94E?61 Pim3 1.12 2.33E?266 0.33 3.82E?14 Pim1 2.65 0.00E+00 0.14 3.43E?07 Mt1 0.65 1.10E?60 ?0.23 8.28E?05 Stat3 1.08 0.00E+00 0.50 5.92E?61 Stat5a 0.47 7.41E?57 0.24 1.92E?09 Vmp1 0.51 1.96E?93 ?0.22 2.35E?11 Ier2 0.43 6.68E?88 ?0.02 5.61E?01 Tnip1 0.77 2.23E?173 0.22 1.10E?10 Timp1 0.00 5.92E?02 0.00 4.94E?01 Amdhd1 0.00 7.11E?01 0.00 8.98E?01 Rora 1.63 0.00E+00 0.12 3.53E?05 Gm5111 0.01 7.54E?02 ?0.02 6.99E?03 Fermt3 ?0.46 4.11E?84 ?0.36 5.96E?27 Dap ?0.33 2.26E?36 ?0.28 2.10E?15 Hist1h1c 1.90 0.00E+00 ?0.48 4.45E?25 Cfl1 ?0.48 0.00E+00 ?0.14 3.20E?22 Ipmk 0.92 4.46E?219 0.27 5.98E?10 Klrd1 ?1.07 1.81E?199 ?0.34 2.65E?12 Gfi1 ?0.01 7.95E?01 ?0.09 7.38E?02 S100a6 ?1.05 0.00E+00 ?0.50 2.02E?69 Rorc 0.02 2.72E?01 ?0.07 3.21E?03 Stat4 0.87 7.48E?245 0.35 3.64E?28 Fdps ?0.05 1.34E?01 ?0.15 1.10E?03 Gpr65 0.86 4.47E?166 0.17 1.39E?04 Rapgef6 0.41 8.06E?51 ?0.10 1.05E?02 Tmem160 ?0.11 6.65E?08 ?0.20 8.36E?13 Rasgrp1 0.84 1.94E?202 0.12 2.14E?03 Pnkd ?0.24 4.02E?19 ?0.21 3.09E?08 Ccnd3 ?1.12 0.00E+00 0.02 7.93E?01 Panx1 ?0.17 1.23E?09 0.01 8.01E?01 Thap11 ?0.29 2.70E?26 ?0.13 6.17E?04 Lysmd2 0.09 1.88E?03 ?0.25 2.67E?09 Ubac2 0.29 3.46E?29 ?0.17 2.34E?06 Lgals3 ?0.30 1.46E?24 0.05 3.04E?01 Cyb5r4 ?0.50 2.63E?95 ?0.29 9.44E?17 Upf3a 0.02 5.65E?01 ?0.34 8.61E?21 Gm10076 0.20 5.88E?17 ?0.69 1.02E?153 Ccdc69 ?0.49 4.22E?76 ?0.18 1.53E?07 Ccl5 0.23 5.28E?10 ?0.50 1.70E?33 Gramd3 1.92 0.00E+00 ?0.22 1.66E?13 Errfi1 0.75 2.26E?126 0.43 1.84E?24 Itgae 0.83 3.08E?116 ?1.03 1.01E?109 Il2ra 0.74 2.94E?134 0.22 9.64E?07 Gpx4 0.72 0.00E+00 0.22 6.61E?24 Ndfip1 0.72 8.87E?237 0.19 8.28E?12 Syt11 ?0.61 4.65E?99 ?0.11 1.72E?02 Dph5 ?0.39 2.02E?42 0.06 2.10E?01 Slc39a8 0.08 6.23E?05 0.01 8.96E?01 Rnf187 ?0.15 1.19E?11 ?0.05 2.23E?01 Fam53b ?0.83 4.51E?193 ?0.14 1.68E?03 Prdx5 0.37 1.56E?69 0.12 4.74E?05 Ccrl2 0.67 3.95E?127 0.14 2.06E?02 Ep300 ?0.06 4.74E?02 0.00 9.89E?01 Hdac7 ?0.21 2.97E?15 ?0.10 1.22E?02 Cd6 0.21 1.47E?23 ?0.04 3.00E?01 Traf3ip2 ?0.30 2.68E?31 ?0.09 2.46E?02 Gnb2 ?0.28 9.03E?64 ?0.25 5.08E?28 Tet2 0.66 2.79E?130 0.14 6.32E?04 Fam189b ?0.31 1.60E?32 ?0.07 1.12E?01 Skap2 ?0.02 4.09E?01 ?0.13 1.54E?03 Lgals1 ?1.15 0.00E+00 ?0.17 1.87E?14 Socs1 0.64 5.14E?93 0.46 3.55E?32 Itgav 0.64 5.62E?112 0.24 8.61E?09 Dnajb4 0.63 7.45E?98 0.38 1.46E?19 Cdkn1a 2.23 0.00E+00 0.77 1.83E?88 Arhgef2 ?0.77 1.60E?174 ?0.23 6.78E?10 Dnmt3a ?0.20 1.16E?14 ?0.11 3.41E?03 Jund 2.11 0.00E+00 0.61 1.37E?184 Scamp3 ?0.26 1.01E?30 ?0.23 3.47E?13 Tmem30a ?0.08 2.09E?03 ?0.35 1.16E?26 Ash1l ?0.29 2.45E?23 ?0.05 2.62E?01 Lsm14a ?0.33 4.06E?43 ?0.26 1.10E?14 Slain2 ?0.04 1.61E?01 ?0.06 2.29E?01 Muc1 0.38 1.56E?88 0.16 8.62E?06 Adamts14 0.00 4.18E?01 0.00 3.99E?01 Ptk2b 0.09 1.97E?03 0.01 9.09E?01 Stk11 0.59 2.94E?110 0.28 3.12E?17 Ccr2 0.23 3.04E?18 0.03 4.65E?01 Itgal ?0.19 2.04E?14 ?0.11 6.79E?03 Elf1 0.57 2.94E?128 ?0.05 1.85E?01 Ptprc 0.02 2.51E?01 ?0.16 3.89E?15 Rbx1 ?0.46 3.93E?187 ?0.14 4.63E?09 Traf3ip3 ?0.85 2.40E?253 ?0.45 4.63E?34 Ccdc88b 0.06 3.10E?02 ?0.08 9.71E?02 Tsen34 ?0.38 5.90E?55 ?0.05 1.20E?01 Ay036118 0.21 4.92E?12 ?0.25 9.09E?11 Il24 H2-q10 0.06 5.93E?02 0.34 4.29E?19 Scand1 0.38 4.88E?74 ?0.12 3.10E?05 Tab2 0.26 1.01E?20 ?0.01 8.65E?01 Nfkb1 0.53 7.48E?97 0.20 7.58E?10 Rusc1 0.11 1.24E?04 ?0.05 3.89E?01 Esyt1 ?0.90 6.87E?301 ?0.24 3.30E?11 Commd7 ?0.23 7.48E?19 ?0.08 4.85E?02 Rfng ?0.05 9.05E?02 ?0.14 2.09E?05 Rpl27-ps3 ?0.04 8.61E?02 ?0.40 1.29E?45 Gigyf1 ?0.02 7.64E?01 ?0.03 5.00E?01 Rgcc 1.58 0.00E+00 1.13 9.68E?131 Rpl3 0.05 1.55E?11 ?0.19 6.04E?99 Mrpl20 ?0.25 3.76E?28 ?0.16 1.68E?06 Gm2a 0.18 5.94E?14 0.01 7.98E?01 Mus81 ?0.25 1.10E?24 ?0.13 2.72E?05 Lpp ?0.08 8.01E?03 ?0.05 3.01E?01 Chp1 0.14 4.48E?07 ?0.03 5.50E?01 Mob4 0.24 4.38E?22 0.00 9.70E?01 Lamp1 ?0.09 1.99E?03 ?0.08 6.29E?02 Phf5a ?0.12 1.13E?06 ?0.14 4.68E?05 Fnip1 0.25 4.48E?27 0.08 5.52E?02 Calm3 ?0.41 2.42E?100 ?0.07 2.01E?02 Lrp10 ?0.42 1.30E?69 ?0.20 1.15E?08 Stat5b 0.45 8.98E?58 0.03 5.23E?01 Bach2 0.00 8.46E?01 ?0.02 4.95E?01 Prkab1 ?0.35 6.30E?38 0.08 4.65E?02 Hvcn1 0.04 1.62E?01 ?0.01 8.83E?01 Tmem150a 0.00 4.94E?01 0.00 9.89E?01 Nfkbia 2.07 0.00E+00 0.12 8.93E?05 Ifitm3 ?0.83 1.03E?104 ?0.28 5.76E?08 Egfp_ires_il23r Bad ?0.41 1.49E?50 ?0.13 1.83E?03 Zbtb46 0.21 2.32E?49 ?0.02 7.54E?01 Cacna1s 0.10 1.50E?12 0.07 5.13E?02 Vamp3 0.11 1.11E?04 0.00 9.72E?01 Fyn ?0.07 4.20E?03 ?0.03 4.63E?01 Stx6 0.29 1.07E?25 0.10 1.24E?02 Ikzf3 0.41 2.25E?36 0.33 4.87E?15 Mgat2 ?0.26 4.37E?28 0.05 3.30E?01 Serpinb9 1.70 0.00E+00 0.21 1.47E?07 Dennd1b ?0.03 3.51E?01 ?0.04 3.92E?01 Bloc1s4 0.27 2.06E?22 0.04 3.99E?01 Anxa1 ?1.54 0.00E+00 0.09 2.17E?01 Smad3 0.10 2.25E?04 ?0.01 8.89E?01 Tmem258 ?0.20 4.26E?30 ?0.08 3.54E?03 Lmna 1.99 0.00E+00 1.14 3.52E?154 Sp140 ?0.08 9.86E?03 ?0.09 6.70E?02 Actn2 1.25 0.00E+00 ?0.55 1.65E?44 Acbd6 0.22 5.41E?17 ?0.04 4.00E?01 Ahnak 0.16 3.21E?12 0.09 5.88E?03 Arpc2 ?0.07 4.13E?12 ?0.06 2.31E?05 Erp29 ?0.16 2.63E?10 ?0.03 5.61E?01 Nhp2l1 0.37 1.56E?79 0.24 1.76E?23 Ctbp1 ?0.21 4.08E?23 ?0.32 5.84E?28 Gba ?0.08 5.03E?03 ?0.13 8.46E?04 Lztfl1 1.24 0.00E+00 ?0.30 3.32E?13 Ptpn2 0.35 1.25E?39 0.04 4.25E?01 Usp36 0.35 5.76E?37 0.05 3.77E?01 Grb7 0.34 2.65E?72 0.17 1.68E?05 Fndc3a 0.34 2.71E?37 0.09 4.78E?02 Mt2 0.21 1.44E?13 ?0.16 3.94E?05 Dctn4 0.33 2.12E?33 ?0.10 2.80E?02 Nusap1 ?0.73 1.52E?56 ?0.33 1.32E?09 Rbm22 0.03 3.51E?01 ?0.07 1.15E?01 Crip1 ?0.76 0.00E+00 0.11 1.42E?04 Anp32b ?0.48 1.60E?118 ?0.19 2.26E?10 Aurkaip1 ?0.26 5.78E?38 ?0.05 1.47E?01 Ripk2 0.36 9.55E?40 0.05 3.16E?01 Nubp1 ?0.12 1.43E?05 ?0.37 1.05E?25 Camta1 0.31 1.48E?28 ?0.19 1.30E?06 Ube2j2 0.30 1.69E?44 0.00 9.68E?01 Kif3b ?0.10 1.34E?06 ?0.03 2.61E?01 Brap 0.30 4.45E?28 0.01 8.00E?01 Gm8096 Ermn 1.01 4.90E?162 ?0.05 6.77E?01 Plagl2 ?0.01 8.42E?01 ?0.03 4.69E?01 Plek ?0.25 1.29E?15 0.20 5.12E?05 D030056l22rik 0.23 5.67E?14 0.18 5.19E?05 Ccr1 0.28 7.44E?31 0.20 6.92E?06 Krtcap2 ?0.07 9.75E?06 0.14 1.66E?11 Sh2b1 0.28 5.19E?22 ?0.14 9.77E?04 Abi3 0.97 2.99E?212 ?0.09 6.99E?02 Ccnl2 0.27 6.75E?30 ?0.12 4.01E?04 Kbtbd7 0.01 7.26E?01 0.00 9.31E?01 Csf2 0.27 9.13E?25 0.10 3.81E?01 Pycard ?1.19 0.00E+00 ?0.63 4.09E?86 Dock7 0.00 4.69E?01 0.00 9.89E?01 Herpud1 1.16 0.00E+00 0.13 1.68E?04 Arf6 0.39 1.96E?101 0.04 1.73E?01 Zyx ?1.05 0.00E+00 ?0.52 4.55E?41 Zfp91 0.25 9.43E?19 0.01 9.89E?01 Fam171b 0.00 9.50E?01 ?0.02 2.29E?01 Maml2 ?0.07 1.11E?02 ?0.04 3.99E?01 Ifngr2 0.24 7.48E?36 0.07 2.88E?02 Bhlhe40 2.48 0.00E+00 0.02 4.83E?01 Cisd1 ?0.22 1.92E?15 ?0.23 3.43E?09 Zfp420 0.01 4.10E?01 0.01 6.99E?01 Zc3h12a 2.18 0.00E+00 0.27 2.84E?16 Plcg2 0.01 9.88E?01 ?0.05 1.75E?02 2310036o22rik ?0.31 3.53E?60 ?0.13 6.10E?06 Eif3c ?0.15 1.10E?11 ?0.04 2.64E?01 Slc15a3 0.52 3.74E?74 0.26 8.00E?09 Acap3 ?0.13 1.29E?08 ?0.01 9.21E?01 Tef 0.21 2.35E?22 0.06 1.33E?01 Emp3 ?1.21 0.00E+00 ?0.34 2.78E?39 Ssr2 ?0.40 1.17E?65 ?0.20 9.50E?09 Usp1 ?0.30 5.06E?26 ?0.19 2.01E?06 Rpl10-ps3 ?0.35 1.51E?57 ?0.40 8.76E?41 Plcxd2 1.34 0.00E+00 ?0.10 5.09E?02 Adcy7 0.01 8.47E?01 ?0.18 2.99E?06 Irf1 0.18 1.70E?09 0.26 5.53E?11 Aamp 0.17 2.36E?13 0.15 2.87E?06 Gm8730 ?0.08 1.81E?08 ?0.61 8.94E?278 Zgpat ?0.03 3.39E?01 ?0.17 1.52E?05 St13 0.17 5.97E?12 0.22 1.00E?12 Cdc42se2 0.17 2.04E?12 ?0.09 1.19E?02 Anxa2 ?0.54 2.39E?116 0.15 1.29E?05 Cpsf3l ?0.45 9.24E?61 ?0.16 9.05E?05 Gm2000 ?0.37 7.22E?67 ?0.47 4.20E?62 Trim46 0.00 9.99E?01 ?0.01 7.82E?01 Dusp16 0.15 3.73E?34 0.04 2.24E?01 Zmat5 ?0.35 2.87E?41 ?0.15 1.08E?04 Ptprk ?0.03 1.26E?01 ?0.15 3.37E?06 Zdhhc7 ?0.08 3.65E?03 0.00 9.65E?01 Il2 0.14 1.06E?05 0.06 2.32E?01 Msto1 ?0.13 2.19E?07 ?0.14 5.82E?06 Il10 0.14 2.17E?05 0.27 1.69E?08 Sbno2 0.14 2.71E?19 0.02 6.45E?01 Snx17 ?0.21 2.10E?16 ?0.14 1.67E?04 Kif11 ?0.28 2.26E?31 ?0.14 3.85E?07 Ndfip2 0.08 2.32E?03 ?0.08 3.29E?02 Card9 ?0.01 1.41E?01 0.00 8.89E?01 Lsm4 ?0.35 5.60E?77 ?0.25 6.16E?21 Ormdl3 0.13 1.24E?05 0.16 7.45E?05 S100a10 ?0.84 0.00E+00 ?0.03 1.80E?01 Notch2 ?0.03 5.11E?01 ?0.13 3.92E?03 Senp7 ?0.20 5.37E?13 ?0.12 1.26E?03 Cd48 ?1.55 0.00E+00 ?0.52 2.68E?69 Ssbp4 0.26 2.33E?29 ?0.15 2.08E?06 Cul1 0.12 3.32E?05 ?0.01 8.54E?01 Mettl10 ?0.20 5.48E?13 ?0.12 3.84E?03 Rabep2 ?0.27 7.52E?23 ?0.11 2.82E?03 Pkig 0.11 4.31E?08 0.06 1.22E?01 Desi1 0.11 3.42E?04 ?0.11 9.85E?03 Furin 3.23 0.00E+00 0.30 1.88E?17 Tcof1 ?0.40 4.30E?48 ?0.11 1.01E?02 Glipr2 ?1.36 0.00E+00 ?0.43 3.68E?38 Tgfbr3 0.11 1.03E?08 0.00 9.89E?01 Tyk2 ?0.09 6.73E?04 ?0.10 4.23E?03 Kif21b ?0.27 1.72E?21 ?0.10 1.08E?02 Tufm ?0.39 1.54E?46 ?0.10 1.12E?02 Zmiz1 ?0.23 2.23E?15 ?0.10 1.92E?02 Il21 0.10 5.13E?06 0.07 1.23E?01 Ttpal 0.10 1.87E?04 ?0.10 1.11E?02 Rps6kb1 0.10 5.80E?04 0.14 2.52E?04 Camk2g ?0.16 4.70E?08 ?0.10 2.24E?02 Tom1 ?0.06 1.33E?02 ?0.10 4.27E?03 Actr1a ?0.19 3.12E?12 ?0.10 2.29E?02 Rgs14 ?0.39 3.10E?46 ?0.10 2.57E?02 Ublcp1 ?0.15 3.40E?09 ?0.10 6.49E?03 Otud3 0.09 1.54E?07 0.00 9.81E?01 Tmem180 0.09 1.18E?05 0.01 8.13E?01 Ergic1 0.09 2.69E?04 0.05 3.21E?01 Aa467197 ?0.49 3.65E?58 ?0.16 3.18E?04 Tdp2 0.25 2.02E?16 0.08 1.26E?01 Rac1 ?0.03 7.10E?02 ?0.06 9.85E?03 Phlda3 ?0.24 1.02E?25 0.04 3.99E?01 Trmt112 ?0.22 2.35E?26 ?0.09 7.80E?03 Ccny 0.07 1.27E?02 ?0.08 5.36E?02 Slc43a3 ?0.14 1.56E?10 ?0.08 1.18E?03 Ezh2 ?0.52 5.20E?63 ?0.08 4.97E?02 Rps14 0.08 4.48E?27 0.00 9.98E?01 Spred2 0.08 2.35E?05 0.06 5.38E?02 Rn7s2 Rn7s1 Rpap2 ?0.10 4.04E?05 ?0.08 1.47E?02 Cit ?0.45 5.44E?71 ?0.08 5.23E?03 Ascc2 ?0.11 3.83E?06 ?0.08 2.40E?02 Ksr1 ?0.08 1.46E?04 ?0.08 3.19E?03 Edem2 ?0.33 1.05E?32 ?0.08 7.89E?02 Blzf1 0.08 2.57E?03 0.08 4.28E?02 Ppp5c ?0.21 1.24E?13 ?0.08 8.53E?02 Smurf1 0.08 1.11E?04 ?0.04 2.94E?01 Nop9 ?0.04 2.17E?01 ?0.08 8.95E?02 Slc30a7 ?0.27 1.11E?24 ?0.08 4.46E?02 Tnfrsf8 0.01 2.34E?01 0.01 7.17E?01 Adcy3 ?0.27 4.90E?33 ?0.08 1.04E?02 Pdcd1 ?0.14 5.58E?05 0.38 1.56E?12 Fen1 ?0.29 1.27E?22 ?0.07 8.71E?02 Themis 0.07 1.93E?02 ?0.07 7.05E?02 Nudt22 ?0.26 9.63E?24 ?0.07 4.38E?02 Cyth1 0.07 1.27E?02 ?0.01 9.32E?01 Tmbim1 0.07 5.46E04 0.06 9.22E?02 Ndufaf1 ?0.21 3.92E?16 ?0.07 6.18E?02 Klrc1 0.33 8.00E?22 0.15 2.72E?03 Pomc 0.07 6.94E?06 ?0.03 2.65E?01 Cpeb4 0.07 8.20E?05 0.04 2.26E?01 Cul2 0.07 1.47E?02 0.06 2.27E?01 Hgfac ?0.01 2.52E?02 0.00 6.98E?01 Pofut1 0.01 6.89E?01 ?0.07 5.41E?02 Clasp2 ?0.02 3.61E?01 ?0.06 4.22E?02 Nme7 ?0.15 1.54E?13 ?0.06 1.67E?02 Ndst1 0.06 3.15E?07 ?0.02 7.44E?01 Gpr137 0.06 3.32E?04 0.00 9.89E?01 Ncoa5 ?0.18 2.59E?15 ?0.06 8.44E?02 Mapkapk5 ?0.01 5.29E?01 ?0.06 3.66E?02 Auh 0.05 8.17E?02 ?0.02 7.13E?01 Gpx3 0.05 1.20E?10 0.01 7.82E?01 Tmem116 0.00 4.95E?01 0.00 9.13E?01 Hint1 ?0.21 1.37E?47 ?0.05 2.25E?02 Mtmr3 0.05 5.19E?02 0.03 4.45E?01 Ube2l3 ?0.05 1.87E?02 ?0.05 9.69E?02 Il23r 0.05 2.13E?05 0.01 3.99E?01 Asb2 1.12 3.45E?261 0.22 4.47E?08 Snx32 ?0.14 2.89E?16 ?0.05 2.48E?02 Fgfr1op 0.04 8.22E?02 ?0.01 9.15E?01 Ccl2 0.04 4.18E?11 0.02 4.55E?01 Slc16a10 0.04 4.30E?05 ?0.02 3.99E?01 Batf 0.76 4.63E?195 ?0.09 2.50E?02 Trpt1 0.04 7.43E?03 0.01 8.02E?01 Jazf1 0.04 1.18E?02 ?0.02 3.32E?01 Tubd1 ?0.14 2.33E?19 ?0.04 2.75E?02 Rtel1 ?0.08 8.41E?06 ?0.04 3.22E?02 Srm ?0.46 6.71E?57 ?0.08 5.19E?02 Thada 0.03 4.55E?02 0.04 3.99E?01 Tppp 0.03 3.23E?05 0.05 8.78E?04 Ppp4c ?0.27 3.36E?47 ?0.24 1.20E?20 Per3 0.03 5.93E?02 0.00 8.86E?01 Hormad2 0.03 1.67E?04 ?0.01 6.21E?01 Gm20186 1.13 8.50E?290 ?0.13 8.29E?03 Ccdc122 0.00 8.24E?01 ?0.02 1.13E?02 Fasl 1.65 0.00E+00 0.26 4.15E?15 Sh2d2a 1.54 0.00E+00 ?0.08 8.11E?03 Atp6v0a1 0.02 1.45E?02 0.01 9.38E?01 Fosl1 0.01 7.04E?05 0.01 2.56E?01 Itgb8 0.01 9.57E?02 0.01 4.42E?01 Amz1 0.01 2.39E?02 0.01 2.94E?01 Cxcl5 0.01 2.03E?04 0.00 3.64E?01 Nkx2-3 0.01 5.48E?04 0.01 1.81E?01 Thbs3 0.01 4.77E?03 0.02 4.17E?03 Pf4 0.01 7.65E?02 0.00 8.61E?01 Ephx4 0.00 8.43E?01 ?0.01 9.78E?02 Osmr 0.00 2.42E?01 ?0.01 3.74E?02 Ccl11 0.01 3.59E?03 0.01 1.30E?01 Fndc4 0.01 4.96E?03 0.01 4.45E?01 Ccl7 0.01 2.68E?03 0.01 2.94E?01 Ptrf 0.01 1.09E?02 0.01 5.60E?01 Mei1 0.00 4.07E?02 0.00 7.56E?01 Lamb1 0.00 1.95E?02 0.00 7.59E?01 Headings description (All logFC are log2 based): Final Score: Total score used to rank genes In-Vivo Cluster: Combined score for in-vivo cluster-specific results In-Vivo Tissue: Combined score for in-vivo tissue-specific results In-Vitro Summary: Combined score for in-vitro results GWAS?: Whether or not the gene is associated with an IBD GWAS loci LPL-9_logFC: logFC of the gene's expression in the LPL-9 cluster vs LPL remainder comparison LPL-9_FDR: FDR value for the gene in the LPL-9 cluster vs LPL remainder comparison LPL-9_Geno_logFC: logFC of the gene's expression in the LPL-9 within-cluster Wild Type vs Knockout comparison LPL-9_Geno_FDR: FDR value for the gene in the LPL-9 within-cluster Wild Type vs Knockout comparison LPL-2_logFC: logFC of the gene's expression in the LPL-2 cluster vs LPL remainder comparison LPL-2_FDR: FDR value for the gene in the LPL-2 cluster vs LPL remainder comparison LPL-2_Geno_logFC: logFC of the gene's expression in the LPL-2 within-cluster Wild Type vs Knockout comparison LPL-2_Geno_FDR: FDR value for the gene in the LPL-2 within-cluster Wild Type vs Knockout comparison logFC_LPL_TissueDE: logFC of the gene's expression in the LPL vs. Spleen comparison FDR_LPL_TissueDE: FDR value for the gene in the LPL vs. Spleen comparison LPL_Geno_logFC: logFC of the gene's expression in the within-LPL Wild Type vs Knockout comparison LPL_Geno_FDR: FDR value for the gene in the within-LPL Wild Type vs Knockout comparison

    [0542] Various modifications and variations of the described methods, pharmaceutical compositions, and kits of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it will be understood that it is capable of further modifications and that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention. This application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure come within known customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.