TREATMENT AND/OR DIAGNOSIS OF A CANCER TYPE CHARACTERIZED BY EXPRESSING ZINC TRANSPORTER ZIP4
20230211005 · 2023-07-06
Inventors
Cpc classification
A61K47/6925
HUMAN NECESSITIES
A61K47/6859
HUMAN NECESSITIES
A61K47/6843
HUMAN NECESSITIES
A61K41/0052
HUMAN NECESSITIES
A61K47/6929
HUMAN NECESSITIES
International classification
A61K47/68
HUMAN NECESSITIES
A61K47/69
HUMAN NECESSITIES
Abstract
Treatment and/or diagnosis of a cancer type characterized by expressing zinc transporter ZIP4. The present invention is directed to nanocarriers functionalized with a ligand capable to bind to the extracellular domain of zinc transporter ZIP4, for use in the treatment and/or diagnosis of a cancer type characterized by expressing ZIP4.
Claims
1. A method of using a nanocarrier in the treatment and/or diagnosis of a cancer, the method comprising: functionalizing the nanocarrier with an affinity reagent, wherein the affinity reagent binds to an extracellular domain of Zinc transporter ZIP4, wherein the extracellular domain of ZIP4 comprises the sequence of SEQ ID NO: 1, and wherein the cancer expresses ZIP4.
2-15. (canceled)
16. The method of claim 1, wherein the affinity reagent comprises an antibody obtained by an in vitro method, the in vitro method comprising: a) administering an immunogen of SEQ ID NO: 1 to an animal model to induce generation of antibodies, wherein SEQ ID NO: 1 includes the extracellular domain of Zinc transporter ZIP4; and b) obtaining the antibodies generated in step a).
17. The method of claim 1, wherein the affinity reagent comprises a monoclonal antibody comprising: a light chain variable region (VL) comprising LCDR1, LCDR2, and LCDR3 polypeptides; and a heavy chain variable region (VH) comprising HCDR1, HCDR2, and HCDR3 polypeptides, wherein the HCDR1 comprises the sequence of SEQ ID NO: 4, wherein the HCDR2 comprises the sequence of SEQ ID NO: 5, wherein the HCDR3 comprises the sequence of SEQ ID NO: 6, wherein the LCDR1 comprises the sequence of SEQ ID NO: 9, wherein the LCDR2 comprises KVS, and wherein the LCDR3 comprises the sequence of SEQ ID NO: 10.
18. The method of claim 1, wherein the affinity reagent comprises a monoclonal antibody comprising: a light chain variable region (VL) comprising LCDR1, LCDR2, and LCDR3 polypeptides; and a heavy chain variable region (VH) comprising HCDR1, HCDR2, and HCDR3 polypeptides, wherein the HCDR1 comprises the sequence of SEQ ID NO: 13, wherein the HCDR2 comprises the sequence of SEQ ID NO: 14, wherein the HCDR3 comprises the sequence of SEQ ID NO: 15, wherein the LCDR1 comprises the sequence of SEQ ID NO: 18, wherein the LCDR2 comprises STS, and wherein the LCDR3 comprises the sequence of SEQ ID NO: 19.
19. The method of claim 1, wherein the affinity reagent comprises a monoclonal antibody, or fragment thereof.
20. The method of claim 1, wherein the cancer comprises a ZIP-related tumor.
21. The method of claim 20, wherein the cancer is pancreatic cancer.
22. The method of claim 1, wherein the nanocarrier comprises hollow nanocapsules, the nanocapsules comprising a biodegradable material on a layer basis around a sacrificial template with a size lower than 500 nm.
23. The method of claim 1, wherein the nanocarrier comprises an anti-cancer drug.
24. The method of claim 1, wherein the nanocarrier comprises an X-ray contrast agent.
25. The method of claim 21, wherein the nanocarrier transports and delivers an active ingredient to the ZIP-related tumor.
26. The method of claim 20, wherein the nanocarrier transports and delivers an active ingredient to the ZIP-related tumor.
27. The method of claim 1, wherein the nanocarrier transports and delivers an active ingredient to the cancer expressing the ZIP4.
28. The method of claim 1, further comprising diagnosing pancreatic cancer in vivo.
Description
DESCRIPTION OF THE FIGURES
[0042]
[0043]
[0044]
[0045]
DETAILED DESCRIPTION OF THE INVENTION
Example 1. Material and Methods
Example 1.1. Nanocarrier Design
[0046] The nanocarrier is a biocompatible silica hollow nanocapsule. The nanocarrier synthesis mainly comprises 6 synthetic steps which are detailed below. Noteworthy that gold seed deposition and growth and the template type are steps that can be avoided depending on the application. For example, for the therapy, no gold is entrapped within the capsules and the polystyrene template is changed by the albumin nanoparticles conjugated to the paclitaxel acting as template:
[0047] 1—Scaffold Synthesis: [0048] 250 ml of H.sub.2O bubbled with Ar for 4 h [0049] 0.75 g PVP K30 (Mw 55000) [0050] 0.64 g AIBA (iniziator) [0051] Wait until the solution reach 70° c. [0052] Reflux and Ar flux, stirring 300 rpm [0053] 25 g Styrene [0054] 24 h of reaction
[0055] Washing cycles (7500 rpm, 30 min)
[0056] 2—Gold Seeds Deposition Due to Electrostatic Interactions Via Layer by Layer Protocols onto the Scaffold Surface: [0057] I. Previous Polystyrene Functionalization via layer by layer technique: providing the necessary surface charge to the scaffold for later gold seed deposition:
[0058] 5 ml of PS solution (6%) (0.33 g of PS) added drop by drop to 5 ml of ethanol in the ultrasound bath (no more than 40° C.), wait 5 min.
[0059] The previous solution (polystyrene in a mixture ethanol water) was added drop by drop to 50 ml of PSS solution (1 mg/ml in 0.5 M of NaCL) under sonication, keep it for 10 min in the ultrasound bath, and after that, 30 min of incubation time.
[0060] This solution was washed (3 centrifugation cycles) at 4000 rpm for 30 min.
[0061] The same protocol was repeated for PDDA, PSS, and PDDA again. [0062] II. Gold seeds Synthesis:
[0063] 45.5 ml of Milli Q water, followed by subsequent addition of reagents in the described order: NaOH solution (0.2M, 1.5 ml), THPC solution 1 ml, wait for 2 min (basic hydrolysis of THPC), and then the Chloroauric acid solution was added quickly in one-pot, the solution color turn to deep brown immediately, continue stirring around 10 mins. [0064] III. Gold seed deposition onto Polystyrene surface was carried out by mixing Polystyrene-PSS-PDDA-PSS-PDDA nanoparticles (0.85 mg/ml), sonicate for a 5 min, followed by the addition of Au-seed nanoparticles dropwise under sonication in about 5 mins, incubation time 1 h for the completely gold nanoparticles deposition due to electrostatic interactions.
[0065] 3-Silica Coating Via Stober Protocol Modification: [0066] I. 400 μl of 110 mg/ml PVP is added to PS@Au-seeds suspension (0.85 mg/ml, 5 ml), after 2-3 h with stirring, the excess of PVP was removed by centrifugation. Ultracentrifuge with 6000 rpm, 15 mins, after the first centrifugation cycle the supernatant was removed and the sample was redispersed in MillQ water, in the following 2 centrifugations cycles the sample was redisperse and washed with ethanol. [0067] II. When the excess PVP was removed, the pellet obtained was redispersed in 10 ml of 4.2% (v/v) ethanol solution of NH.sub.4OH, and it was sonicated for 5 mins [0068] III. After sample redispersed in 10 ml of 4.2% (v/v) ethanol solution of NH.sub.4OH, 43.5 μl of 10% (v/v) ethanol solution of TEOS was added to the previous solution containing the PS decorated with gold seeds under stirring, and the solution was kept in incubation over night to ensure a homogeneous silica coating. After silica coating, the sample was washed by 3 centrifugation cycles with ethanol (3500 rpm, 10 min).
[0069] 4—Scaffold Dissolution:
[0070] For core dissolution, it means, hollow capsuled formation, the sediment from the last previous step was redispersed in a mixture solution 45 ml (EtOH:Chloroform=1:3), stirred for 36 h, in order to dissolve the core.
[0071] To verify the hollow capsules formation, the suspension was characterized by TEM. If the core was not completely removed, the sample was allowed for incubation in a new chloroform/ethanol mixture for one extra day and washed again after one day to check the core removal.
[0072] 5—Gold Seeds Grown. Gold Seeds are Located in the Inner Walls of the Hollow Cavity. [0073] I. 1 ml from Hollow silica capsules ethanolic solution with a concentration of 3.7 mg polystyrene/ml was added to 10 ml of Au+1 solution, stirred for 5 min, and followed by the addition of 30 microliters of commercial formaldehyde solution. This solution was stirred for 45 min, and after washed using three centrifugation cycles (3500 rpm, 10 min). Last two washing cycles were carried out in ethanol, after the last centrifugation cycle the sample was redisperse in a final volume of 2 ml (EtOH). [0074] II. Gold.sup.+1 solution: 433.46 microliters of 0.1206M HAuCl.sub.4 solution was added to 120 ml of aqueous solution containing 1.8M of K.sub.2CO.sub.3. This solution must to be incubated in darkness place along 1 h before to use. Colour changed from yellow to colorless, and it implied that the gold 3 was turned into gold 1.
[0075] 6—Outer Silica Shell Bio-Functionalization with Anti-ZIP4 Antibodies Via EDC Chemistry. [0076] I. Mix 500 μL capsule suspension (0.83 mg mL.sup.−1, in ethanol) with APS (˜1 APS molecule nm.sup.−2), and stirring at 60-70° C. for 90 min (in water bath) [0077] II. Hollow silica capsules were centrifuged at 2500 rpm for 15 min and washed with ethanol and PBS, respectively. [0078] III. Pre-Preparation “solution A”: 3.5 mg of dodecanedioic acid were dissolved in 0.5 mL of ethanol with 50 μL of aqueous NaOH solution (concentration: 1*10.sup.−3 M, pH basic around 8) [0079] IV. Pre-Prepare EDAC (1-ethyl-3-(3-dimethylaminopropyl)-carbo-diimide) conjugation buffer: 2% (w/v) EDAC, 3% (w/v) N-hydroxysuccinimide in PBS, pH 8.0 [0080] V. Dodecanedioic acid buffer (3.5 mg) was mixed with 50 μL of EDAC conjugation buffer in an orbital shaker for 15 min at room temperature. [0081] VI. hollow capsules (with APS) from the last step were incubated in “solution A” in an orbital shaker or vertex at room temperature; after 2 h, the reaction was quenched with 10 μL of 1 M hydroxylamine (NHS) (react for 5-10 min). (to regenerate the original, nonreacted carboxylic groups); [0082] VII. Carboxylic acid-conjugated capsules were centrifuged at 5000 rpm for 15 min and washed with PBS (3×0.5 mL). Redisperse the capsules with PBS (centrifuge 3 times) [0083] VIII. Ab conjugation: mix the 50 μL EDAC conjugation buffer and capsule with —COOH groups on surface, stirring for 15 min at RT; add 10 μg Ab into the capsule's mixture, keep the reaction for 2 h; quench the reaction with 10 μL of 1 M hydroxylamine (react for 5-10 min). [0084] IX. Centrifuge the Ab-functionalized capsules at 8000 rpm for 5 min and washed with PBS (3×0.5 mL), and keep at 4° C.
Example 1.2. Synthesis of Bovine Serum Albumin (BSA) Nanoparticles
[0085] 10 mg/mL BSA solution was prepared. First, BSA was dissolved in Milli-Q water (pH was around 5.3), an aliquot was taken, and pH shifted to of 7.4. Separately, 6 mL of absolute ethanol was added dropwise to 3 mL of the BSA solution previously prepared under vigorous stirring at room temperature. The solution turned turbid due to the formation of nanoparticles and 30 μL of glutaraldehyde 8% were quickly added. The resulting colloids were left stirring for 2 hours.
Example 1.3. Synthesis of Paclitaxel (PTX)-Loaded BSA Nanoparticles
[0086] 10 mg/mL of BSA were dissolved in phosphate buffer 2 mM at pH 7.4. 1 mL of 1 mg/mL of Paclitaxel dissolved in absolute ethanol was added dropwise to 3 mL of BSA solution followed by another 5 mL of absolute ethanol under vigorous stirring at room temperature. Immediately afterwards, 10 μL of glutaraldehyde 8% was added per each mL of BSA solution. The final solution was left stirring for 2 hours.
Example 1.4. Characterisation of Nanoparticles
[0087] A Zetasizer nano series from Malvern was used to determine the hydrodynamic diameter and the zeta potential of nanoparticles. For the Dynamic Light Scattering (DLS) measurements, as synthesized NPs were diluted 10 times in Milli-Q water and samples were measured at 25° C. Similarly, nanoparticles were diluted 10 times in a 20 μM NaCl solution and Zeta potential measurements were conducted at 25° C.
Example 1.5. Cells
[0088] HEK293 and RWP1 cells were used to generate control cells and constitutively expressing Zip4 by transient transfecting pMSCV-IRES-Puro and pMSCV-Zip4-IRES-Puro plasmids respectively. Transfected cells were selected with 2 μg/ml puromycin and maintained with 0.25 μg/ml puromycin in DMEM containing 10% fetal bovine serum (FBS).
Example 1.6. Xenograft Experiment
[0089] 7.5×10.sup.5 cells were injected on one flank of BALB/c nude animals using 1:1 proportion DMEM:Matrigel. Tumors grew until reaching and average of 100 mm3 (between 6-8 weeks). Then, 100 ul with 0.6 ug/ul red fluorescent nanoparticles were injected intravenously. 24 h later animals were sacrificed, and fluorescence was measured using an using Xenogen IVIS Spectrum equipment.
Example 1.7. Western Blot
[0090] Cells and tumors were homogenized in lysis buffer (50 mM Tris-HCl pH 7.4, 150 mM NaCl, 5 mM EDTA, 0.5% NP40, 1 mM DTT and EDTA-free protease inhibition cocktail, ROCHE 11873580001). Extracts were centrifuged at 14,000×g at 4° C. for 10 min to remove aggregates. Laemmli buffer was added and samples were boiled at 95° C. for 5 min and then loaded onto a 10% poly-acrylamide gel. After electrophoresis, proteins were transferred to nitro-cellulose membranes using the iBlot system (Invitrogen); membranes were then blocked with 5% BSA for 1 h at room temperature (RT). Primary Abs were diluted in blocking solution 0/N at 4° C.: anti Zip4 (Proteintech), monoclonal antibodies anti Zip4, clones 33 and 62, and GAPDH (1:2000; Sigma-Aldrich). Anti-rabbit or anti-mouse HRP secondary Abs (1:2000; GE Healthcare) were used.
Example 1.8. Immunostaining
[0091] Paraffin sections (5 μm) were used for IHC analysis. Samples were boiled with 0.01 M citrate buffer (pH 6.0) at 120° C. for 10 min in a pressure cooker. Endogenous peroxidase activity was quenched with 3% H2O2, and samples were blocked in PBS with 1% BSA. Primary antibodies were added overnight at 4° C. As primary antibody rabbit α-anti Zip4 polyclonal antibody (Proteintech) was used. HRP-anti-rabbit-EnVision (DAKO, EnVision™+ System) was used as a secondary antibody.
Example 1.9. Surface Immunostaining
[0092] Cells were incubated with 50 μg/ml monoclonal antibodies in DMEM for 1 h at 37° C. After washing with PBS, cells were fixed in 4% PFA. The blocking was done incubating with 1% BSA and 2% FBS in PBS for 1 h RT. Incubation with secondary mouse Alexa 488 antibody (1:2000) was done in blocking solution for 1 h RT. Images were taken in a SP8 Leica confocal microscope.
Example 1.10. Sequencing of the Variable Region of the Antibodies
[0093] Sequencing of variable regions of 2 hybridoma cell line antibodies was carried out in the context of the present invention.
[0094] Total RNA was extracted from the hybridoma cells and cDNA was subsequently synthesized. Antibody variable genes were then amplified by isotype-specific PCR, subcloned into a standard cloning vector separately and sequenced.
[0095] The material used was: [0096] Hybridoma cells. [0097] TaKaRa MiniBEST Universal RNA Extraction Kit (Takara, Lot. No. 9767). [0098] PrimeScript RT reagent Kit with gDNA Eraser (Takara, Lot. No. AK3920). [0099] TA-cloning Kit (Takara, Lot. No. 6019). [0100] PacBio RS II sequencer.
[0101] Total RNA was extracted separately from several batches of cultured hybridoma cells, cDNA was then synthetized by reverse transcription using oligo-dT primers and VH and VL were finally amplified by PCR. VH and VL fragments, respectively amplified by IgG degenerate primers and Kappa specific primers, were by gel electrophoresis, confirming that isotype is IgG Kappa. The PCR products were then sub-cloned into a standard vector, followed by bacteria transformation, then colony picking and validation by PCR and finally sequencing of 6-12 positive clones for each VH and VL.
[0102] Experiments were repeated twice, and identical results were obtained for all clones.
[0103] Thus, both hybridomas have been successfully sequenced. Results show that both antibodies have different VL but identical VH sequences. Two hypotheses could explain this finding:
[0104] 1. Both clones originate from a unique one and only its VL has undergone further rearrangement and/or mutations.
[0105] 2. Clones are different but have been selected for their identical VH.
[0106] The variable sequence of each antibody is shown below: [0107] Antibody 1 (clone 33)
[0108] Heavy Chain Variable Region (VH)
[0109] DNA sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (351 bp):
TABLE-US-00001 GAGGTGAAGCTGCAGGAGTCAGGACCTAGCCTCGTGAAACCTTCTCAGT CTCTGTCTCTCACCTGCTCTGTCACTGGCTACTCCATCACCAGTGCTTA TTACTGGAACTGGATCCGGCAGTTTCCAGGAAACAAACTGGAATGGATG GGCTACATAGCCTACGACGGTGGCAATAACTACAACCCATCTCTCAAAA ATCGAATCTCCATCACTCGTGACACATCTAAGAACCAGTTTTTCCTGAA GTTGAATTCTGTGACTACTGAGGACACAGCTACATATTACTGTGTAAGA GATTGGTCACGGGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCG TCTCCTCA
[0110] Amino acid sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (117 amino acids):
TABLE-US-00002 EVKLQESGPSLVKPSQSLSLTCSVTGYSITSAYYWNWIRQFPGNKLEWM GYIAYDGGNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCVR DWSRAMDYWGQGTSVTVSS
[0111] Light Chain Variable Region (VL)
[0112] DNA sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (336 bp):
TABLE-US-00003 GATATCATGCTGACCCAATCTCCACTCTCCCTGCCTGTCAGTCTTGGAG ATCAAGCCTCCATCTCTTGCAGATCTAGTCAGAGCCTTGTGCACAGTAC TGGAAACACCTATTTACATTGGTACCTGCAGAAGCCAGGCCAGTCTCCA AAGCTCCTGATCTACAAAGTTTCCAGCCGATTTTCTGGGGTCCCAGACA GATTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAGGATCAGTAG AGTGGAGGCTGACGATCTGGGAGTTTATTTCTGTTCTCAAACCACACAT GTTCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA
[0113] Amino acid sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (112 amino acids):
TABLE-US-00004 DIMLTQSPLSLPVSLGDQASISCRSSQSLVHSTGNTYLHWYLQKPGQSP KLLIYKVSSRFSGVPDRFSGSGSGTDFTLRISRVEADDLGVYFCSQTTH VPLTFGAGTKLELK [0114] Antibody 2 (clone 62):
[0115] Heavy Chain Variable Region (VH)
[0116] DNA sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (351 bp):
TABLE-US-00005 GAGGTGAAGCTGCAGGAGTCAGGACCTAGCCTCGTGAAACCTTCTCAGT CTCTGTCTCTCACCTGCTCTGTCACTGGCTACTCCATCACCAGTGCTTA TTACTGGAACTGGATCCGGCAGTTTCCAGGAAACAAACTGGAATGGATG GGCTACATAGCCTACGACGGTGGCAATAACTACAACCCATCTCTCAAAA ATCGAATCTCCATCACTCGTGACACATCTAAGAACCAGTTTTTCCTGAA GTTGAATTCTGTGACTACTGAGGACACAGCTACATATTACTGTGTAAGA GATTGGTCACGGGCTATGGACTACTGGGGTCAAGGAACCTCAGTCACCG TCTCCTCA
[0117] Amino acid sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (117 amino acids):
TABLE-US-00006 EVKLQESGPSLVKPSQSLSLTCSVTGYSITSAYYWNWIRQFPGNKLEWM GYIAYDGGNNYNPSLKNRISITRDTSKNQFFLKLNSVTTEDTATYYCVR DWSRAMDYWGQGTSVTVSS
[0118] Light Chain Variable Region (VL)
[0119] DNA sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (318 bp):
TABLE-US-00007 GATATCGTTCTCACTCAATCTCCAGCAATCATGTCTGCATCTCCAGGGG AGAAGGTCACCATAACCTGCAGTGCCAGCTCAAGTGTAAGTTACTTGCA CTGGTTCCAGCAGAAGCCAGGCACTTCTCCCAAACTCTGGATTTATAGC ACATCCAACCTGGCTTCTGGAGTCCCTGCTCGCTTCAGTGCCAGTGGAT CTGGGACCTCTTACTCTCTCACAATCAGCCGAATGGAGGCTGAAGATGC TGCCACTTATTACTGCCAACAAAGGAGTACTTATCCGCTCACGTTCGGT GGTGGGACCAAGCTGGAGCTGAAA
[0120] Amino acid sequence (CDRs underlined: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4) (106 amino acids):
TABLE-US-00008 DIVLTQSPAIMSASPGEKVTITCSASSSVSYLHWFQQKPGTSPKLWIYS TSNLASGVPARFSASGSGTSYSLTISRMEAEDAATYYCQQRSTYPLTFG GGTKLELK
[0121] The sequence listing is herewith included:
[0122] Antibody 1 (Clone 33) [0123] VH DNA sequence SEQ ID NO: 2 [0124] VH amino acid sequence SEQ ID NO: 3 [0125] HCDR1 SEQ ID NO: 4 [0126] HCDR2 SEQ ID NO: 5 [0127] HCDR3 SEQ ID NO: 6 [0128] VL DNA sequence SEQ ID NO: 7 [0129] VL amino acid sequence SEQ ID NO: 8 [0130] LCDR1 SEQ ID NO: 9 [0131] LCDR2 consisting of KVS (Lys Val Ser) [0132] LCDR3 SEQ ID NO: 10
[0133] Antibody 2 (clone 62) [0134] VH DNA sequence SEQ ID NO: 11 [0135] VH amino acid sequence SEQ ID NO: 12 [0136] HCDR1 SEQ ID NO: 13 [0137] HCDR2 SEQ ID NO: 14 [0138] HCDR3 SEQ ID NO: 15 [0139] VL DNA sequence SEQ ID NO: 16 [0140] VL amino acid sequence SEQ ID NO: 17 [0141] LCDR1 SEQ ID NO: 18 [0142] LCDR2 consisting of STS (Ser Thr Ser) [0143] LCDR3 SEQ ID NO: 19
Example 2. Results
Example 2.1. Silica Hollow Nanocapsules with Crosslinked antiZip4 Antibody
[0144] We have synthetized biocompatible silica hollow nanocapsules to target Zip4 expressing tumoral cells using a layer by layer approach. By transmission electron microscopy we observed that the size of our nanocarriers was lower than 500 nm and do not aggregate (
[0145] The silica shell not only act as a platform for covalently antibodies attachment, silica shell also provides rigidity to the structure avoiding the collapsed of the structure after scaffold dissolution and protecting encapsulated molecules and drugs inside the cavity. In order to treat pancreatic cancer, we have created paclitaxel nanoparticles conjugated to BSA (
Example 2.2. In Vivo Targeting Ability
[0146] Once we generated the antiZIP4 nanocapsules we wanted to demonstrate the targeting ability of our nanoformulations in vivo. In order to do that, we have carried out a xenograft experiment using the HEK293 cell line expressing constitutively Zip4 transporter (
Example 2.3. Photothermal Activity
[0147] The nanocapsules are functionalized with discrete gold nanoislands to carry out photothermal therapy.
Example 2.4. Monoclonal antiZip4 Antibodies
[0148] We studied the specificity of two novel monoclonal antibodies generated in our laboratory against human Zip4 extracellular domain (SEQ ID NO: 1). Two different antibodies, antibody 1 (clone 33) and antibody 2 (clone 62), from mouse hybridoma were characterized. We confirmed specificity by western blot using lysates from RWP1 cells constitutively expressing Zip4 (Zip4-RWP1 cells) and the control cell line (