CHIMERIC ANTIGEN RECEPTORS TARGETING TIM-1
20190336534 ยท 2019-11-07
Inventors
- Terrance A. Stadheim (Lyme, NH)
- Joana M. Murad (Hanover, NH, US)
- Jake Reder (Hanover, NH, US)
- Henry C. Marsh, Jr. (Reading, MA)
- Li-Zhen He (Allentown, PA, US)
- Tibor Keler (Pipersville, PA)
Cpc classification
A61K39/4611
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
C07K2319/40
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
A61K39/464402
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
Abstract
The invention provides chimeric antigen receptors (CARs) that specifically bind to the T-cell immunoglobulin and mucin domain 1 (TIM-1) protein. The invention further relates to modified immune cells, e.g., T or NK cells, comprising such CARs, CAR-encoding nucleic acids, CAR-encoding vectors, and methods of making such compositions. The invention further relates to methods for therapeutic use of these CARs and modified immune cells for the treatment of a condition, disorder, or disease associated with cells expressing TIM-1 (e.g., cancer).
Claims
1. An isolated chimeric antigen receptor (CAR) comprising (i) an antigen-binding domain that binds to TIM-1; (ii) a transmembrane domain; and (iii) at least one intracellular signaling domain.
2. The isolated CAR according to claim 1, wherein the antigen-binding domain comprises an antibody or an antigen-binding fragment thereof that binds to TIM-1.
3. The isolated CAR according to claim 2, wherein the antibody or antigen-binding fragment thereof is selected from the group of: a monoclonal antibody; a monospecific antibody; a polyspecific antibody; a humanized antibody; a human antibody; a tetrameric antibody; a tetravalent antibody; a multispecific antibody; a single chain antibody; a domain-specific antibody; a single domain antibody; a domain-deleted antibody; an scFc fusion protein; a single-chain antibody; a chimeric antibody; a synthetic antibody; a recombinant antibody; a hybrid antibody; a mutated antibody; a CDR-grafted antibody; an antibody fragment comprising an Fab; an F(ab)2 fragment; an Fab fragment; an Fv fragment; a single-chain Fv (scFv) fragment; an Fd fragment; a dAb fragment; a diabody; a nanobody; a bivalent nanobody; a shark variable IgNAR domain; a VHH antibody; a camelid antibody; and a minibody.
4. The isolated CAR according to claim 1, wherein the antigen-binding domain comprises a human IgG antibody or antigen-binding fragment thereof, a Fab, or an scFv.
5. The isolated CAR according to any one of claims 1-4, wherein the antigen-binding domain binds to the extracellular mucin domain region of TIM-1, optionally binding to the amino acid sequence LPRQNH (SEQ ID NO:97) or to the amino acid residues at positions 192-197 of TIM-1 (SEQ ID NO:315).
6. The isolated CAR according to any one of claims 1-5, wherein the antigen-binding domain competes for binding to TIM-1 with an antibody comprising a VL chain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of the VL chain of Ab 1.29, Ab 2.70.2, or Ab 2.59.2 (SEQ ID NO: 203, 205, or 207), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 253, 255, or 257; and comprising a VH chain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of the VH chain of Ab 1.29, Ab 2.70.2, or Ab 2.59.2 (SEQ ID NO: 202, 204, or 206), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 252, 254, or 256.
7. The isolated CAR according to any one of claims 1-6, wherein the antigen-binding domain comprises an antibody or antigen-binding fragment thereof that comprises a VL chain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of the VL chain of Ab 1.29, Ab 2.70.2, or Ab 2.59.2 (SEQ ID NO: 203, 205, or 207), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 253, 255, or 257; and comprises a VH chain having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of the VH chain of Ab 1.29, Ab 2.70.2, or Ab 2.59.2 (SEQ ID NO: 202, 204, or 206), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 252, 254, or 256.
8. The isolated CAR according to any one of claims 1-7, wherein the antigen-binding domain comprises a variable light (VL) chain linked to a variable heavy (VH) chain by a flexible linker.
9. The isolated CAR according to claim 8, wherein the flexible linker is a G4S linker, optionally having at least 80G %, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 201, or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 251.
10. The isolated CAR according to any one of claims 1-9, wherein the antigen-binding domain has at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of the scFv 129H, 129L, 272H, 272L, 2592H, or 2592L (SEQ ID NO: 208, 209, 210, 211, 212, or 213), or has at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 258, 259, 260, 261, 262, or 263.
11. The isolated CAR according to any one of claims 1-10, wherein the antigen-binding domain comprises an antibody VL chain and an antibody VH chain, and wherein: (i) the VL chain is located at the N-terminus of the CAR (the VL chain is positioned N-terminal to the VH chain in the CAR); or (ii) the VH chain is located at the N-terminus of the CAR (the VH chain is positioned N-terminal to the VL chain in the CAR).
12. The isolated CAR according to any one of claims 1-11, wherein said antigen-binding domain is joined to said transmembrane domain by a linker, a spacer, or a hinge, optionally derived from one or more of the group of: CD28, CD8, an immunoglobulin constant region or variant thereof, an immunoglobulin hinge region, an IgG4 hinge region, an immunoglobulin CH1/CL region, an Fc region, an immunoglobulin CH2 domain, an immunoglobulin CH3 domain, and/or any combination thereof.
13. The isolated CAR according to claim 12, wherein the linker, the spacer, or the hinge is derived from CD28, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of CD28H (SEQ ID NO: 214), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 264.
14. The isolated CAR according to any one of claims 1-13, wherein the antigen-binding domain is conjugated to a cytotoxic agent.
15. The isolated CAR according to any one of claims 1-14, wherein the transmembrane domain comprises a transmembrane domain derived from a protein selected from the group consisting of CD28, CD3 epsilon, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137, CD154, TCR alpha, TCR beta, and CD3 zeta.
16. The isolated CAR according to any one of claims 1-15, wherein the transmembrane domain is derived from CD28, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of CD28TM (SEQ ID NO: 215), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 265.
17. The isolated CAR according to any one of claims 1-16, wherein the intracellular signaling domain is an intracellular signaling domain of a lymphocyte receptor chain, a TCR/CD3 complex protein, an Fc receptor subunit, an IL-2 receptor subunit, CD3, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, CD278 (ICOS), FcRI, DAP10, and DAP12.
18. The isolated CAR according to any one of claims 1-17, wherein the intracellular signaling domain is derived from CD3, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of CD3 CYP (SEQ ID NO: 219), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 269.
19. The isolated CAR according to any one of claims 1-18, further comprising one or more costimulatory domains derived from a protein selected from the group consisting of an MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, a Toll ligand receptor, B7-H3, BAFFR, BTLA, BLAME (SLAMF8), CD2, CD4, CD5, CD7, CD8alpha, CD8beta, CD11a, LFA-1 (CD11a/CD18), CD11b, CD11c, CD11d, CD18, CD19, CD19a, CD27, CD28, CD29, CD30, CD40, CD49a, CD49D, CD49f, CD69, CD84, CD96 (Tactile), CD100 (SEMA4D), CD103, OX40 (CD134), 4-1BB (CD137), SLAM (SLAMF1, CD150, IPO-3), CD160 (BY55), SELPLG (CD162), DNAM1 (CD226), Ly9 (CD229), SLAMF4 (CD244, 2B4), ICOS (CD278), CEACAM1, CDS, CRTAM, DAP10, GADS, GITR, HVEM (LIGHTR), IA4, ICAM-1, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, ITGA6, ITGAD, ITGAE, ITGAL, ITGAM, ITGAX, ITGB1, ITGB2, ITGB7, KIRDS2, LAT, LFA-1, LIGHT, LTBR, NKG2C, NKG2D, NKp30, NKp44, NKp46, NKp80 (KLRF1), PAG/Cbp, PD-1, PSGL1, SLAMF6 (NTB-A, Ly108), SLAMF7, SLP-76, TNFR2, TRANCE/RANKL, VLA1, VLA-6, and a ligand that specifically binds with CD83.
20. The isolated CAR according to any one of claims 1-19, further comprising one or more costimulatory domains derived from a protein selected from the group consisting of CD28, 4-1BB (CD137), and DAP10, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of CD28CYP (SEQ ID NO: 217), BBCYP (SEQ ID NO: 216), or DAP10CYP (SEQ ID NO: 218), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 266, 267, or 268.
21. The isolated CAR according to any one of claims 1-20, wherein the transmembrane domain comprises a CD28 transmembrane domain comprising the amino acid sequence of CD28TM (SEQ ID NO: 215); the intracellular signaling domain comprises a CD3 intracellular signaling domain comprising the amino acid sequence of CD3 CYP (SEQ ID NO: 219); and the antigen-binding domain comprises an scFv comprising the amino acid sequence of (i) 272H (SEQ ID NO: 210); (ii) 2592H (SEQ ID NO: 212); or (iii) 2592L (SEQ ID NO:213).
22. The isolated CAR according to claim 21, wherein the antigen-binding domain is joined to the transmembrane domain via a CD28 hinge, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of CD28H (SEQ ID NO: 214), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 264.
23. The isolated CAR according to claim 21 or 22, further comprising one or more costimulatory domains derived from CD28, 4-1 BB, or DAP10, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of CD28CYP (SEQ ID NO: 217), BBCYP (SEQ ID NO: 216), or DAP10CYP (SEQ ID NO: 218), or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 266, 267, or 268.
24. An isolated CAR comprising an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of (i) 272H-BB (SEQ ID NO: 222); (ii) 272H-CD28 (SEQ ID NO: 223); (iii) 272H-DAP10 (SEQ ID NO: 224); (iv) 2592H-BB (SEQ ID NO: 226); (v) 2592H-CD28 (SEQ ID NO: 227); (vi) 2592H-DAP10 (SEQ ID NO: 228); or (vii) 2592L-CD28 (SEQ ID NO: 229); or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%0, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 272, 273, 274, 276, 277, 278, 279.
25. An isolated nucleic acid sequence encoding a CAR according to any one of claims 1-24.
26. A vector comprising the nucleic acid sequence according to claim 25.
27. The vector according to claim 26, which is selected from the group consisting of a DNA, an RNA, a plasmid, a lentivirus vector, adenoviral vector, a retrovirus vector, or an in vitro transcribed vector.
28. The isolated nucleic acid sequence according to claim 25 or the vector according to claim 26 or claim 27, further comprising a sequence encoding: (i) a signal peptide, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 230, or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 280; (ii) a T2A ribosome skip sequence, optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 231, or having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 281; (iii) a selectable marker, optionally wherein the selectable marker is truncated CD19 (tCD119), optionally having at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence of SEQ ID NO: 232, or having at least 80*%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identity to the amino acid sequence encoded by SEQ ID NO: 282; (iv) a promoter (v) a poly(A) tail; (vi) a 3UTR; (vii) a suicide mechanism; (viii) one or more signaling domains of a co-inhibitory receptor, such as CTLA-4 or PD-1 (iCAR); and/or (ix) a substrate peptide cleaved in the presence of matrix metalloproteinases enriched within the tumor microenvironment (masked CAR).
29. A recombinant or isolated cell comprising a CAR according to any one of claims 1-24 or comprising a nucleic acid sequence or vector encoding a CAR according to any one of claims 25-28.
30. The recombinant or isolated cell according to claim 29 which is a primary human cell or other mammalian cell or is derived therefrom.
31. The recombinant or isolated cell according to claim 29 or 30, which is an immune cell, optionally selected from a T lymphocyte, a B lymphocyte, a natural killer cell, an eosinophil, an NK/T cells, a macrophage, and a monocyte.
32. The recombinant or isolated cell according to any one of claims 29-31, which is selected from a T cell, a CD4+ T cell, a CD8+ T cell, a naive T (TN) cell, an effector T (TEFF) cell, a memory T cell, a stem cell memory T (TSCM) cell, a central memory T (TCM) cell, an effector memory T (TEM) cell, a terminally differentiated effector memory T cell, a tumor-infiltrating lymphocyte (TIL), an immature T cell, a mature T cell, a helper T cell, a cytotoxic T cell, a mucosa-associated invariant T (MAIT) cell, a regulatory T (Treg) cell, a helper T cell, a TH1 cell, a TH2 cell, a TH3 cell, a TH17 cell, a TH9 cell, a TH22 cell, a follicular helper T cell, an alpha/beta T cell, a delta/gamma T cell, a Natural Killer (NK) cell, a Natural Killer T (NKT) cell, a cytokine-induced killer (CIK) cell, and a lymphokine-activated killer (LAK) cell.
33. The recombinant or isolated cell according to any one of claims 30-33, which is a T cell or a T cell progenitor cell.
34. The recombinant or isolated cell according to any one of claims 29-33, which is further modified or selected to incorporate one or more of the following features: (i) to express another CAR, optionally an activating or inhibitory CAR; (ii) to comprise a suicide gene; (iii) to be specific for another antigen, optionally a tumor antigen; (iv) to be a pp65CMV-specific T cell, a CMV-specific T cell, an EBV-specific T cell, a Varicella Virus-specific T cell, an Influenza Virus-specific T cell and/or an Adenovirus-specific T cell; (v) to overexpress pro-survival signals; (vi) to reverse anti-survival signals; (vii) to overexpress Bcl-xL or BCL-2; (viii) to suppress the expression or inhibit the function of cell death genes, including, but not limited to, Bak or Bax; (ix) to overexpress hTERT; (x) to eliminate Fas expression; (xi) to express a TGF dominant negative receptor; (xii) to reduce or eliminate expression of its endogenous TCR compared to a wildtype T cell; (xiii) to evade immunosuppressive mediators; and/or (xiv) to comprise a homing mechanism.
35. The recombinant or isolated cell according to any one of claims 29-34, wherein the cell: (i) exhibits anti-tumor cytotoxicity when the CAR binds to TIM-1; (ii) increases production of cytokines and/or chemokines upon exposure to TIM-1-expressing cells, optionally one or more of GM-CSF, IL-6, RANTES (CCL5), TNF-, IL-4, IL-10, IL-13, and IFN-; (iii) exhibits cytotoxic activity upon exposure to TIM-1-expressing cells, optionally measured via lactate dehydrogenase production; (iv) is activated or stimulated to proliferate when the CAR binds to TIM-1.
36. A pharmaceutical composition comprising a pharmaceutically effective amount of a CAR according to any one of claims 1-24 or a recombinant or isolated cell according to any one of claims 29-35 and a pharmaceutically acceptable carrier or excipient.
37. The composition of claim 36, further comprising one or more additional agents that specifically bind to one or more tumor-associated antigens.
38. A method for stimulating an immune cell-mediated response in a subject, the method comprising administering to a subject in need thereof an effective amount of an immune cell modified to express a CAR comprising (i) an antigen-binding domain that binds to TIM-1; (ii) a transmembrane domain; and (iii) at least one intracellular signaling domain, wherein the modified immune cell is activated or stimulated to proliferate when the CAR binds to TIM-1 thereby stimulating an immune cell-mediated response in the subject.
39. A method for treating a disease, a disorder, or a condition associated with undesired proliferation of cells expressing TIM-1 in a subject, the method comprising administering to the subject in need thereof an effective amount of an immune cell genetically modified to express a CAR comprising (i) an antigen-binding domain that binds to TIM-1; (ii) a transmembrane domain; and (iii) at least one intracellular signaling domain, wherein the modified immune cell is activated or stimulated to proliferate when the CAR binds to TIM-1 thereby treating the disease, disorder, or condition associated with undesired proliferation of cells expressing TIM-1.
40. The method according to claim 38 or 39, which is used in the treatment of a condition selected from cancer, autoimmunity, infection, and an inflammatory disorder.
41. A method for treating a cancer in a subject, the method comprising administering to the subject in need thereof an effective amount of an immune cell modified to express a CAR comprising (i) an antigen-binding domain that binds to TIM-1, (ii) a transmembrane domain, and (iii) at least one intracellular signaling domain.
42. The method according to any one of claims 38-41, wherein the modified immune cell induces an immune response as measured via increased production of cytokines and chemokines, optionally one or more of GM-CSF, IL-6, RANTES (CCL5), TNF-, IL-4, IL-10, IL-13, and IFN-.
43. The method according to any one of claims 38-42, wherein the modified immune cell is a T cell, optionally an autologous T cell or a donor-derived T cell.
44. The method according to any one of claims 38-43, wherein the method is used to treat a cancer in a subject, and wherein: (i) the cancer is a solid tumor, optionally selected from a group consisting of carcinomas, melanomas, sarcomas, gliomas, and skin cancers; (ii) the tumor cells express TIM-1; (iii) the cancer is selected from a renal cell carcinoma, an ovarian clear cell carcinoma, and a lung carcinoma; (iv) the method reduces tumor growth and/or tumor volume; and/or (v) the treated subject is resistant to at least one chemotherapeutic agent.
45. The method according to any one of claims 38-44, further comprising (i) administration of another therapy to the subject, optionally wherein the therapy is chemotherapy, radiotherapy, toxin-based therapy, radiochemical based therapy, or surgical therapy; and/or (ii) administration in combination with another therapeutic agent, optionally wherein the therapeutic agent increases the efficacy of a cell expressing a CAR molecule and/or the therapeutic agent ameliorates one or more side effects associated with administration of a cell expressing a CAR molecule
46. The method according to any one of claims 38-45, wherein the modified immune cell is a recombinant or isolated cell according to any one of claims 29-35, or wherein the immune cell expresses a CAR according to any one of claims 1-24 or comprises a nucleic acid or vector encoding a CAR according to any one of claims 25-28.
47. A method of expanding a population of or generating a persisting population of modified immune cells in a subject, the method comprising administering to the subject an immune cell expressing a CAR according to any one of claims 1-24, an immune cell comprising a nucleic acid or vector encoding a CAR according to any one of claims 25-28, or an immune cell which is a recombinant or isolated cell according to any one of claims 29-35, wherein the modified immune cells persist in the subject for at least one month after administration, optionally wherein the population of modified immune cells comprises at least one modified immune cell that was administered to the subject, a progeny of the modified immune cell that was administered to the subject, or a combination thereof, and/or a memory T cell.
48. The method according to claim 47, wherein the population of cells persists in the subject for at least three months, at least four months, at least five months, at least six months, at least seven months, at least eight months, at least nine months, at least ten months, at least eleven months, at least twelve months, at least eighteen months, at least two years, or at least three years after administration.
49. A method of producing a CAR-expressing immune cell comprising introducing into an immune cell an isolated nucleic acid sequence or vector encoding a CAR according to any one of claims 25-28.
50. The method according to claim 49, wherein the CAR-expressing immune cell: (i) is isolated based on expression of said CAR as determined via flow cytometry or immunofluorescence assays, optionally enriching for CD3 and tCD19 expression; and/or (ii) is stimulated to grow via exposure to magnetic beads; soluble antibodies, optionally including OKT3; and/or cytokines, optionally including IL-2.
Description
DETAILED DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
DETAILED DESCRIPTION OF THE INVENTION
[0118] An aspect of the invention in general relates to the construction and use of novel TIM-1 binding chimeric antigen receptors (CARs). In particular, the CARs of the present invention comprise an antigen-binding domain that binds to TIM-1, a transmembrane domain, and one or more intracellular signaling domains. The invention also provides polynucleotides encoding these CARs, vectors comprising polynucleotides encoding these CARs, compositions comprising cells expressing these CARs, and methods of making and using these CARs and CAR-expressing cells. The invention also provides methods for treating a condition associated with malignant TIM-1 expression in a subject, such as cancer. These CARs, and particularly isolated cells comprising nucleic acid sequences encoding these CARs, may be used to treat diseases, disorders, or conditions associated with the undesired proliferation of cells expressing TIM-1. In particular embodiments, these cells may be used to treat a cancer.
Car Target: Tim-1
[0119] The CAR of the present invention comprises an antigen-binding domain which binds to T-cell immunoglobulin and mucin domain 1 protein (TIM-1), also known as HAVCR1, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM1, TIMD-1, TIMD1, CD365, and hepatitis A virus cellular receptor 1. In general, TIM-1 belongs to the group of type 1 cell-surface glycoproteins, the structure of which include an N-terminal immunoglobulin (Ig)-like domain, a mucin domain with distinct length, a single transmembrane domain, and a C-terminal short cytoplasmic tail. In humans, TIM-1 is encoded by the HAVCR1 gene on chromosome 5, with gene location 5q33.3 (NCBI). Human TIM-1 has an amino acid sequence provided as GenBank Ace. No. AAC39862.1, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like. In one aspect, TIM-1 is the sequence provided as SEQ ID NO: 315 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
[0120] T-cell immunoglobulin mucin I/kidney injury molecule 1 (TIM-1/KIM1) is a protein with limited surface expression in healthy tissues. In the case of ovarian cancer, >93% of OCCC tumors tested positive for TIM-1 expression while other types of ovarian cancer were TIM-1 negative (Lin et al. Am J Surg Pathol. 2007; 31:371-381). The examples below describe chimeric antigen receptors comprising a TIM-1 binding domain that can be used for the treatment of TIM-1 expressing malignancies. It is anticipated that the paucity of TIM-1 expression in healthy tissues will provide a favorable therapeutic window with limited on target, off target effects. To the best of applicant's knowledge this target has never been used in T cell-based interventions.
[0121] The historical one therapy fits all approach to cancer therapy has proven largely unsuccessful. Instead, rationally designed therapies that selectively target and exploit the vulnerabilities of a particular cancer type have elicited unprecedented treatment responses and will continue to be the most successful. We have identified potent anti-TIM-1 antibodies that, when formatted into CAR constructs, recognize TIM-1.sup.+ target cells and activate CAR T cells. Additionally, anti-TIM-1 CAR T cells prevent the growth of TIM-1.sup.+ ovarian tumor cells when administered in vivo. This development of an efficacious CAR T immunotherapy against OCCC represents a significant advance in the treatment of ovarian cancer. Moreover, it is expected that this approach would also be appropriate for the treatment of other TIM-1.sup.+ cancers, including renal cell carcinoma.
[0122] The examples herein illustrate the potential of targeting TIM-1 as a target selectively expressed in certain cancers such as ovarian clear cell carcinoma through the use of anti-TIM-1 scFvs derived from human full length antibodies.
Antigen-Binding Domain
[0123] The present invention provides a chimeric antigen receptor (CAR) comprising an antigen-binding domain, a transmembrane domain, and one or more intracellular signaling domains. The antigen-binding domain comprises a target-specific binding element that binds to TIM-1.
[0124] The antigen-binding domain may be derived from a polypeptide that binds to TIM-1. In some embodiments, the polypeptide may be a receptor or a portion of a receptor that binds TIM-1. In another embodiment, the antigen-binding domain may be derived from ligands that bind to TIM-1, including, but not limited to, HAVC, TIM-4, and TIM-1 itself.
[0125] In another embodiment, the antigen-binding domain may be derived from an antibody or antigen-binding fragment thereof that binds to TIM-1. Examples of antibody fragments include, but are not limited to, fragment antigen-binding (Fab) fragments, F(ab).sub.2 fragments, Fab fragments, Fv fragments, recombinant IgG (rIgG) fragments, single chain antibody fragments, single chain variable fragments (scFv), single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments, diabodies, and multi-specific antibodies formed from antibody fragments. In particular embodiments, the antibodies are single-chain antibody fragments comprising a variable heavy chain region and/or a variable light chain region, such as scFvs.
[0126] Single-domain antibodies are antibody fragments comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody.
[0127] Antibody fragments can be made by various techniques, including but not limited to proteolytic digestion of an intact antibody as well as production by recombinant host cells. In some embodiments, the antibodies are recombinantly-produced fragments, such as fragments comprising arrangements that do not occur naturally, such as those with two or more antibody regions or chains joined by synthetic linkers, e.g., peptide linkers, and/or that may not be produced by enzyme digestion of a naturally-occurring intact antibody. In some aspects, the antibody fragments are scFvs.
[0128] In some aspects, the antigen-binding domain may be derived from an antibody or antigen-binding fragment thereof that has one or more specified functional features, such as binding properties, including binding to particular epitopes, such as epitopes that are similar to or overlap with those of other antibodies, the ability to compete for binding with other antibodies, and/or particular binding affinities. In a preferred embodiment, the antibody or antigen-binding fragment thereof binds to TIM-1. In certain aspects, they bind to human TIM-1, such as the human TIM-1 set forth in SEQ ID NO: 315. In another aspect, the antibody or antigen-binding fragment thereof competes for binding to TIM-1 with Ab 1.29, Ab 2.70.2, or Ab 2.59.2. In yet another aspect, the antibody or antigen-binding fragment thereof binds to the same epitope bin as Ab 1.29 and Ab 2.70.2 or Ab 2.59.2 (See U.S. Pat. No. 8,067,544 B2).
[0129] In some embodiments, the antigen-binding domain binds to an epitope containing one or more amino acids within (or is entirely within) an extracellular domain of TIM-1 and/or within (or is entirely within) a membrane-proximal region of the extracellular portion of TIM-1. In some embodiments, the antibody binds to an epitope containing one or more amino acids within, or is entirely within, the mucin domain of TIM-1, the IgV-like domain of TIM-1, and/or the membrane-proximal-most 100, 90, 80, 75, 70, 65, 60, 55, 50, 45, 44, 43, 43, 41, or 40 amino acid portion of the extracellular portion of TIM-1. In some embodiments, such a portion or domain is required for binding of the antigen-binding domain to TIM-1. In some embodiments, the epitope contains (or further contains) one or more amino acids that is within, or is entirely within, the mucin domain of TIM-1. In some embodiments, such a portion or domain is required for binding of the antigen-binding domain to TIM-1. In some embodiments, the antigen-binding domain specifically binds to a peptide comprising or consisting of or consisting essentially of the sequence of such a portion, and not containing the entire sequence of full-length TIM-1. For example, the antigen-binding domain may bind in a TCR-like manner, in which it binds to a peptide derived from TIM-1 in the MHC groove without reactivity against MHC.
[0130] In some embodiments, the epitope contains one or more amino acids within, is within, or includes a portion of TIM-1 corresponding to residues 192-197 of the human TIM-1 sequence set forth in SEQ ID NO: 315, such as a portion having the sequence set forth in SEQ ID NO: 97. In some embodiments, the epitope may include one or more neighboring residues. In a particular aspect, the epitope may comprise the amino acid sequence PMPLPRQNHEPVAT. In some embodiments, the antigen-binding domain may comprise sequences of anti-TIM-1 antibodies known to bind to such epitopes. In one aspect, the CAR of the invention may comprise an antigen-binding domain comprising sequences of anti-TIM-1 antibodies as disclosed in U.S. Pat. No. 8,067,544, the sequences of which are incorporated herein by reference.
[0131] In some embodiments, the epitope includes an amino acid (such as a histidine) at a position of TIM-1 corresponding to the histidine at position 64 of the human TIM-1 sequence set forth in SEQ ID NO: 315; in some embodiments, such amino acid is important for binding of the antigen-binding domain to TIM-1. In some embodiments, the epitope includes an amino acid (such as a glutamate) at a position of TIM-1 corresponding to the glutamate at position 67 of the human TIM-1 sequence set forth in SEQ ID NO: 315; in some embodiments, such amino acid is important for binding of the antigen-binding domain to TIM-1.
[0132] In some embodiments, the epitope is the same as, similar to, overlapping with, or contains one or more of the same amino acids as an epitope that is specifically bound to by a reference antibody, such as Ab 1.29, Ab 2.70.2, or Ab 2.59.2. In some embodiments, the same one or more amino acids is important for the binding of the provided antibody and the reference antibody.
[0133] In some embodiments, the extent of binding of an anti-TIM-1 antigen-binding domain to an unrelated, non-TIM-1 protein is less than about 40% of the binding of the antigen-binding domain to human TIM-1. In some embodiments, among provided antigen-binding domains are antigen-binding domains in which binding to a non-human TIM-1 or other non-TIM-1 protein is less than or about 30%, less than or about 20% or less than or about 10% of the binding of the antibody to human TIM-1.
[0134] In some embodiments, the antigen-binding domain competes for binding with, and/or binds to the same or an overlapping epitope of TIM-1 as Ab 1.29, Ab 2.70.2, or Ab 2.59.2 or an antigen-binding fragment thereof.
[0135] In some embodiments, the antigen-binding domain is derived from an antibody or antigen-binding fragment thereof with heavy and light chain CDRs that are distinct from the CDRs present in antibodies such as Ab 1.29, Ab 2.70.2, and Ab 2.59.2. For example, among the provided antibodies and antigen-binding fragments thereof are those that compete for binding with and/or bind to the same or overlapping epitopes of TIM-1 as those bound by an antibody, but nonetheless contain distinct CDRs, e.g., distinct heavy and/or light chain CDR1, CDR2, and CDR3. In some embodiments, the provided antibody contains heavy and light chain CDRs that are distinct from the CDRs present in the antibody designated Ab 1.29, such as present in the VH region set forth in SEQ ID NO: 202 and/or the VL region set forth in SEQ ID NO: 203. In some embodiments, the provided antibody contains heavy and light chain CDRs that are distinct from the CDRs present in the antibody designated Ab 2.70.2, such as present in the VH region set forth in SEQ ID NO:204 and/or the VL region set forth in SEQ ID NO:205. In some embodiments, the provided antibody contains heavy and light chain CDRs that are distinct from the CDRs present in the antibody designated Ab 2.59.2, such as present in the VH region set forth in SEQ ID NO:206 and/or the VL region set forth in SEQ ID NO:207.
[0136] In some embodiments, the antigen-binding domain, the CARs comprising such, and the cells comprising such CARs display a binding preference for TIM-1-expressing cells as compared to TIM-1-negative cells, such as particular cells known in the art and/or described herein. In some embodiments, the binding preference is observed where a significantly greater degree of binding is measured to the TIM-1-expressing, as compared to the non-expressing, cells. In some cases, the total degree of observed binding to TIM-1 or to the TIM-1-expressing cells is approximately the same, at least as great, or greater than that observed for non-TIM-1 specific domains, CARs, or cells. In any of the provided embodiments, comparison of binding properties, such as affinities or competition, may be via measurement by the same or similar assay.
[0137] In some embodiments, the antigen-binding domain comprises an scFv comprising the CDR sequences of a TIM-1 binding antibody. CDRs may be determined using conventional methods, The precise amino acid sequence boundaries of a given CDR or FR can be readily determined using any of a number of well-known schemes, including those described by Kabat et al. (1991), Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (Kabat numbering scheme), Al-Lazikani et al., (1997) JMB 273, 927-948 (Chothia numbering scheme), MacCallum et al., J. Mol. Biol. 262:732-745 (1996), Antibody-antigen interactions: Contact analysis and binding site topography, J. Mol. Biol. 262, 732-745. (Contact numbering scheme), Lefranc M P et al., IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains, Dev Comp Immunol, 2003 Jan.; 27(1):55-77 (IMGT numbering scheme), and Honegger A and Pluckthun A, Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool, J Mol Biol, 2001 Jun. 8; 309(3):657-70, (Aho numbering scheme).
[0138] In an embodiment, the sequence comprising the antigen-binding domain further comprises a leader sequence or signal sequence. In embodiments where the antigen-binding domain comprises an scFv, the leader sequence may be positioned at the amino terminus of the scFv. In some embodiments, when the heavy chain variable region is N-terminal, the leader sequence may be positioned at the amino terminus of the heavy chain variable region. In some embodiments, when the light chain variable region is N-terminal, the leader sequence may be positioned at the amino terminus of the light chain variable region. The leader sequence may comprise any suitable leader sequence. In embodiments of the invention, the leader sequence may comprise the nucleic acid sequence set forth in SEQ ID NO: 280. In some embodiments, the leader sequence may comprise a nucleic acid sequence encoding the amino acid sequence set forth in SEQ ID NO: 230. In some embodiments, the leader sequence may comprise the amino acid sequence set forth in SEQ ID NO: 230. In the mature form of the isolated cells of the invention, the leader sequence may not be present.
[0139] In a preferred embodiment, the antigen-binding domain comprises an scFv comprising the CDR sequences of Ab 1.29, 2.70.2, or 2.59.2.
[0140] Preferably, the antigen-binding domain in the CAR of the invention is an anti-TIM-1 scFv, wherein the nucleic acid sequence of the anti-TIM-1 scFv comprises a sequence set forth in SEQ ID NO: 258, 259, 260, 261, 262, or 263. In one embodiment, the anti-TIM-1 scFV comprises a nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 208, 209, 210, 211, 212, or 213. In another embodiment, the anti-TIM-1 scFV portion of the CAR of the invention comprises the amino acid sequence set forth in SEQ ID NO: 208, 209, 210, 211, 212, or 213.
[0141] In particular, in a preferred embodiment, the antigen-binding domain in the CAR of the invention is derived from the antibody, or antigen-binding fragment thereof, of Ab 2.59.2, Ab 2.70.2, or Ab 1.29. Ab 2.59.2 comprises a VL chain of SEQ ID NO: 207 (encoded by SEQ ID NO: 257) with light chain CDRs of SEQ ID NO: 248, 249, and 250 (encoded by SEQ ID NO: 298, 299, and 300) and a VH chain of SEQ ID NO: 206 (encoded by SEQ ID NO: 256) with heavy chain CDRs of SEQ ID NO: 245, 246, and 247 (encoded by SEQ ID NO: 295, 296, and 297). Ab 2.70.2 comprises a VL chain of SEQ ID NO: 205 (encoded by SEQ ID NO: 255), with light chain CDRs of SEQ ID NO: 242, 243, and 244 (encoded by SEQ ID NO: 292, 293, and 294), and a VH chain of SEQ ID NO: 204 (encoded by SEQ ID NO: 254), with heavy chain CDRs of SEQ ID NO: 239, 240, and 241 (encoded by SEQ ID NO: 289, 290, and 291). Ab 1.29 comprises a VL chain of SEQ ID NO: 203 (encoded by SEQ ID NO: 253), with light chain CDRs of SEQ ID NO: 236, 237, and 238 (encoded by SEQ ID NO: 286, 287, and 288), and a VH chain of SEQ ID NO: 202 (encoded by SEQ ID NO: 252), with heavy chain CDRs of SEQ ID NO: 233, 234, and 235 (encoded by SEQ ID NO: 283, 284, and 285).
Hinge
[0142] In some embodiments, the CAR comprises a linker, spacer, or hinge sequence between the antigen-binding domain and the transmembrane domain. One of ordinary skill in the art will appreciate that a hinge sequence is a short sequence of amino acids that facilitates flexibility (see, e.g., Woof et al., Nat. Rev. Immunol., 4(2): 89-99 (2004)). The hinge sequence can be any suitable sequence derived or obtained from any suitable molecule. In some embodiments, the length of the hinge sequence may be optimized based on the distance between the CAR and the TIM-1 binding epitope, e.g., longer hinges may be optimal for membrane proximal TIM-1 epitopes.
[0143] In some embodiments, the CAR, such as the antigen-binding portion thereof, further includes a hinge, linker or spacer. The hinge may be derived from or include at least a portion of an immunoglobulin Fc region, for example, an IgG1 Fc region, an IgG2 Fc region, an IgG3 Fc region, an IgG4 Fc region, an IgE Fc region, an IgM Fc region, or an IgA Fc region. In certain embodiments, the spacer domain includes at least a portion of an IgG1, an IgG2, an IgG3, an IgG4, an IgE, an IgM, or an IgA immunoglobulin Fc region that falls within its CH2 and CH3 domains. In some embodiments, the spacer domain may also include at least a portion of a corresponding immunoglobulin hinge region. In some embodiments, the hinge is derived from or includes at least a portion of a modified immunoglobulin Fc region, for example, a modified IgG1 Fc region, a modified IgG2 Fc region, a modified IgG3 Fc region, a modified IgG4 Fc region, a modified IgE Fc region, a modified IgM Fc region, or a modified IgA Fc region. The modified immunoglobulin Fc region may have one or more mutations (e.g., point mutations, insertions, deletions, duplications) resulting in one or more amino acid substitutions, modifications, or deletions that cause impaired binding of the spacer domain to an Fc receptor (FcR). In some aspects, the modified immunoglobulin Fc region may be designed with one or more mutations which result in one or more amino acid substitutions, modifications, or deletions that cause impaired binding of the spacer domain to one or more FcR including, but not limited to, FcRI, FcR2A, FcR2B1, FcR2B2, FcR3A, FcR3B, FcRI, FcR2, FcRI, Fc/R, or FcRn.
[0144] In some aspects, a portion of the immunoglobulin constant region serves as a spacer region between the antigen-binding domain, e.g., scFv, and transmembrane domain. The spacer can be of a length that provides for increased responsiveness of the cell following antigen-binding, as compared to in the absence of the spacer. In some examples, the spacer is at or about 12 amino acids in length or is no more than 12 amino acids in length. Exemplary spacers include those having at least about 10 to 229 amino acids, about 10 to 200 amino acids, about 10 to 175 amino acids, about 10 to 150 amino acids, about 10 to 125 amino acids, about 10 to 100 amino acids, about 10 to 75 amino acids, about 10 to 50 amino acids, about 10 to 40 amino acids, about 10 to 30 amino acids, about 10 to 20 amino acids, or about 10 to 15 amino acids, and including any integer between the endpoints of any of the listed ranges. In some embodiments, a spacer region has about 12 amino acids or less, about 119 amino acids or less, or about 229 amino acids or less. Exemplary spacers include a CD28 hinge, IgG4 hinge alone, IgG4 hinge linked to CH2 and CH3 domains, or IgG4 hinge linked to the CH3 domain. Exemplary spacers include, but are not limited to, those described in Hudecek et al. (2013) Clin. Cancer Res., 19:3153, international patent application publication number WO2014031687, U.S. Pat. No. 8,822,647 or published app. No. US2014/0271635.
[0145] In some embodiments, the hinge sequence is derived from the human CD8-alpha molecule or a CD28 molecule. In a preferred embodiment, the hinge sequence is derived from CD28. In one embodiment, the CD28 hinge sequence comprises the nucleic acid sequence encoding CD28H (SEQ ID NO: 264). In one embodiment, the hinge has the amino acid sequence of CD28H (SEQ ID NO: 214). In some embodiments, the spacer has a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NO: 214.
Transmembrane Domain
[0146] With respect to the transmembrane domain, the CAR can be designed to comprise a transmembrane domain that is fused to the antigen-binding domain of the CAR. In one embodiment, the transmembrane domain that naturally is associated with one of the domains in the CAR is used. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
[0147] The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Typically, the transmembrane domain denotes a single transmembrane alpha helix of a transmembrane protein, also known as an integral protein. Transmembrane regions of particular use in this invention may be derived from (i.e. comprise at least the transmembrane region(s) of) CD28, CD3 epsilon, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD45, CD64, CD80, CD86, CD134, CD137, CD154, TCR alpha, TCR beta, or CD3 zeta and/or transmembrane regions containing functional variants thereof such as those retaining a substantial portion of the structural, e.g., transmembrane, properties thereof.
[0148] Alternatively, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. A transmembrane domain of the invention is thermodynamically stable in a membrane. It may be a single alpha helix, a transmembrane beta barrel, a beta-helix of gramicidin A, or any other structure. Transmembrane helices are usually about 20 amino acids in length.
[0149] Preferably, the transmembrane domain in the CAR of the invention is the CD28 transmembrane domain. In one embodiment, the CD28 transmembrane domain comprises the nucleic acid sequence of CD28TM (SEQ ID NO: 265). In one embodiment, the CD28 transmembrane domain comprises the nucleic acid sequence that encodes the amino acid sequence of CD28TM (SEQ ID NO: 215). In one embodiment, the CD28 transmembrane domain comprises the amino acid sequence of CD28TM (SEQ ID NO: 215).
[0150] Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the intracellular signaling domain(s) of the CAR. A glycine-serine doublet may provide a suitable linker.
Intracellular Signaling Domain
[0151] The intracellular signaling domain or otherwise the cytoplasmic domain of the CAR of the invention triggers or elicits activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed. The term effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus, the term intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.
[0152] Preferred examples of intracellular signaling domains for use in the CAR of the invention include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
[0153] Signals generated through one intracellular signaling domain alone may be insufficient for full activation of an immune cell, and a secondary or co-stimulatory signal may also be required. For example, T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences). Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
[0154] Examples of ITAM-containing primary cytoplasmic signaling sequences that are of particular use in the invention include those derived from an intracellular signaling domain of a lymphocyte receptor chain, a TCR/CD3 complex protein, an Fc receptor subunit, an IL-2 receptor subunit, CD3 , FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, CD278(ICOS), FcRI, DAP10, and DAP12. It is particularly preferred that the intracellular signaling domain in the CAR of the invention comprises a cytoplasmic signaling sequence derived from CD3.
[0155] In one embodiment, the CD35 intracellular signaling domain comprises the nucleic acid sequence of CD3 CYP (SEQ ID NO: 269). In one embodiment, the CD3 intracellular signaling domain comprises the nucleic acid sequence that encodes the amino acid sequence of CD3CYP (SEQ ID NO: 219). In one embodiment, the CD3 intracellular signaling domain comprises the amino acid sequence of CD3CYP (SEQ ID NO: 219).
[0156] In a preferred embodiment, the cytoplasmic domain of the CAR can be designed to comprise the CD3- (signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the invention. For example, the cytoplasmic domain of the CAR can comprise a CD3 chain portion and a costimulatory signaling region. The costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than an antigen receptor or their ligands that is required for an efficient response of lymphocytes to an antigen.
[0157] Various co-stimulatory domains have been reported to confer differing properties. For example, the 4-1BB co-stimulatory domain showed enhanced persistence in in vivo xenograph models (Milone et al. Mol Ther 2009; 17:1453-1464; Song et al. Cancer Res 2011; 71:4617-4627) whereas CARs that associate with DAP10 are associated with a decreased persistence in vivo (Barber et al. Gene Ther 2011; 18:509-516). Additionally, these different co-stimulatory domains produce different cytokine profiles which, in turn, may produce effects on target cell-mediated cytotoxicity and the tumor microenvironment. Indeed, DAP10 signaling in NK cells has been associated with an increase in Th1 and inhibition of Th2 type cytokine production in CD8.sup.+ T cells (Barber et al. Blood 2011; 117:6571-6581).
[0158] Examples of co-stimulatory molecules include an MHC class I molecule, TNF receptor proteins, immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, a Toll ligand receptor, B7-H3, BAFFR, BTLA, BLAME (SLAMF8), CD2, CD4, CD5, CD7, CD8alpha, CD8beta, CD11a, LFA-1 (CD11a/CD18), CD11b, CD11c, CD11d, CD18, CD19, CD19a, CD27, CD28, CD29, CD30, CD40, CD49a, CD49D, CD49f, CD69, CD84, CD96 (Tactile), CD100 (SEMA4D), CD103, CRTAM, OX40 (CD134), 4-1BB (CD137), SLAM (SLAMF1, CD150, IPO-3), CD160 (BY55), SELPLG (CD162), DNAM1 (CD226), Ly9 (CD229), SLAMF4 (CD244, 2B4), ICOS (CD278), CEACAM1, CDS, CRTAM, DAP10, GADS, GITR, HVEM (LIGHTR), IA4, ICAM-1, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, ITGA6, ITGAD, ITGAE, ITGAL, ITGAM, ITGAX, ITGB1, ITGB2, ITGB7, KIRDS2, LAT, LFA-1, LIGHT, LTBR, NKG2C, NKG2D, NKp30, NKp44, NKp46, NKp80 (KLRF1), PAG/Cbp, PD-1, PSGL1, SLAMF6 (NTB-A, Ly108), SLAMF7, SLP-76, TNFR2, TRANCE/RANKL, VLA1, VLA-6, a ligand that specifically binds with CD83, and the like. Thus, while the invention is exemplified primarily with regions of CD28, DAP10, and/or 4-1BB as the co-stimulatory signaling elements, other costimulatory elements are within the scope of the invention.
[0159] The cytoplasmic signaling sequences within the intracellular signaling domain of the CAR of the invention may be linked to each other in a random or specified order. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage. A glycine-serine doublet provides a particularly suitable linker.
[0160] In one embodiment, the intracellular signaling domain is designed to comprise the signaling domain of CD3- and a costimulatory domain derived from CD28. In another embodiment, the intracellular signaling domain is designed to comprise the signaling domain of CD3- and a costimulatory domain derived from DAP10. In yet another embodiment, the intracellular signaling domain is designed to comprise the signaling domain of CD3- and a costimulatory domain derived from 4-1BB.
[0161] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from CD28 and the signaling domain of CD3-, wherein the costimulatory domain derived from CD28 comprises the nucleic acid sequence set forth in SEQ ID NO: 267 and the signaling domain of CD3- comprises the nucleic acid sequence set forth in SEQ ID NO: 269.
[0162] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from CD28 and the signaling domain of CD3-, wherein the costimulatory domain derived from CD28 comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 217 and the signaling domain of CD3- comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 219.
[0163] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from CD28 and the signaling domain of CD3-, wherein the costimulatory domain derived from CD28 comprises the amino acid sequence set forth in SEQ ID NO: 217 and the signaling domain of CD3- comprises the amino acid sequence set forth in SEQ ID NO: 219.
[0164] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from DAP10 and the signaling domain of CD3-, wherein the costimulatory domain derived from DAP10 comprises the nucleic acid sequence set forth in SEQ ID NO: 268 and the signaling domain of CD3- comprises the nucleic acid sequence set forth in SEQ ID NO: 269.
[0165] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from DAP10 and the signaling domain of CD3- wherein the costimulatory domain derived from DAP10 comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 218 and the signaling domain of CD3- comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 219.
[0166] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from DAP10 and the signaling domain of CD3-, wherein the costimulatory domain derived from DAP10 comprises the amino acid sequence set forth in SEQ ID NO: 218 and the signaling domain of CD3- comprises the amino acid sequence set forth in SEQ ID NO: 219.
[0167] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from 4-1BB and the signaling domain of CD3-, wherein the costimulatory domain derived from 4-1BB comprises the nucleic acid sequence set forth in SEQ ID NO: 266 and the signaling domain of CD3- comprises the nucleic acid sequence set forth in SEQ ID NO: 269.
[0168] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from 4-1BB and the signaling domain of CD3-, wherein the costimulatory domain derived from 4-1 BB comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 216 and the signaling domain of CD3-; comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 219.
[0169] In one embodiment, the intracellular signaling domain in the CAR of the invention is designed to comprise a costimulatory domain derived from 4-1BB and the signaling domain of CD3-, wherein the costimulatory domain derived from 4-1BB comprises the amino acid sequence set forth in SEQ ID NO: 216 and the signaling domain of CD3- comprises the amino acid sequence set forth in SEQ ID NO: 219.
Exemplary Anti-TIM-1 CAR Constructs
[0170] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 129H-CD28 (SEQ ID NO: 270). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 220. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 220.
[0171] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 129L-CD28 (SEQ ID NO: 271). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 221. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 221.
[0172] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272H-BB (SEQ ID NO: 272). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 222. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 222.
[0173] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272H-CD28 (SEQ ID NO: 273). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 223. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 223.
[0174] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272H-DAP10 (SEQ ID NO: 274). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 224. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 224.
[0175] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272L-CD28 (SEQ ID NO: 275). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 225. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 225.
[0176] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592H-BB (SEQ ID NO: 276). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 226. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 226.
[0177] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592H-CD28 (SEQ ID NO: 277). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 227. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 227.
[0178] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592H-DAP10 (SEQ ID NO: 278). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 228. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 228.
[0179] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592L-CD28 (SEQ ID NO: 279). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 229. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 229.
[0180] In some embodiments, the nucleic acid sequences encoding the foregoing exemplary CARs further comprise a T2A ribosomal skip sequence and a sequence encoding tCD19.
[0181] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272H-BB_tCD19 (SEQ ID NO: 302). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 301. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 301.
[0182] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272H-CD28_tCD19 (SEQ ID NO: 304). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 303. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 303.
[0183] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 272H-DAP10_tCD19 (SEQ ID NO: 306). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 305. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 305.
[0184] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592H-BB_tCD19 (SEQ ID NO: 308). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 307. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 307.
[0185] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592H-CD28_tCD19 (SEQ ID NO: 310). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 309. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 309.
[0186] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592H-DAP10 tCD19 (SEQ ID NO: 312). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 311. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 311.
[0187] In one embodiment, the CAR of the invention comprises the nucleic acid sequence of 2592L-CD28_tCD19 (SEQ ID NO: 314). In one embodiment, the CAR of the invention comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 313. In one embodiment, the CAR of the invention comprises the amino acid sequence of SEQ ID NO: 313.
Further Modifications
[0188] The CARs of the present invention, nucleotide sequences encoding the same, vectors encoding the same, and cells comprising nucleotide sequences encoding said CARs may be further modified, engineered, optimized, or appended in order to provide or select for various features. These features may include, but are not limited to, efficacy, persistence, target specificity, reduced immunogenicity, multi-targeting, enhanced immune response, expansion, growth, reduced off-tumor effect, reduced subject toxicity, improved target cytotoxicity, improved tumor infiltration, detection, selection, targeting, and the like. For example, the cells may be engineered to express another CAR, a suicide mechanism, and may be modified to remove or modify expression of an endogenous receptor or molecule such as a TCR and/or MHC molecule.
[0189] In some embodiments, the vector or nucleic acid sequence encoding the CAR further encodes other genes. The vector or nucleic acid sequence may be constructed to allow for the co-expression of multiple genes using a multitude of techniques including co-transfection of two or more plasmids, the use of multiple or bidirectional promoters, or the creation of bicistronic or multicistronic vectors. The construction of multicistronic vectors may include the encoding of IRES elements or 2A peptides, such as T2A, P2A, E2A, or F2A. In a particular embodiment, the nucleic acid sequence or vector encoding the CAR further encodes tCD19 with the use of a T2A ribosomal skip sequence. In one embodiment, the T2A ribosomal skip sequence comprises the nucleic acid sequence of SEQ ID NO: 281. In one embodiment, the T2A ribosomal skip sequence comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 231. In one embodiment, the T2A ribosomal skip sequence comprises the amino acid sequence of SEQ ID NO: 231.
[0190] In one embodiment, tCD19 comprises the nucleic acid sequence of SEQ ID NO: 282. In one embodiment, tCD19 comprises the nucleic acid sequence that encodes the amino acid sequence of SEQ ID NO: 232. In one embodiment, tCD19 comprises the amino acid sequence of SEQ ID NO: 232.
[0191] The CAR expressing cell may further comprise a disruption to one or more endogenous genes. In some embodiments, the endogenous gene encodes TCR, TCR, CD52, glucocorticoid receptor (GR), deoxycytidine kinase (dCK), or an immune checkpoint protein such as, for example, programmed death-1 (PD-1).
Efficacy in Solid Tumors
[0192] The CARs of the present invention and cells expressing these CARs may be further modified to improve efficacy against solid tumors. This increased efficacy may be measured by an increase in tumor cytotoxicity, tumor infiltration, and evasion of or resistance to tumor immunosuppressive mediators. In some embodiments, enhanced anti-tumor efficacy may be characterized by increased TCR signaling, increased cytokine release, enhanced killing of tumor cells, increased T cell infiltration of established tumors, improved tumor trafficking, attenuated tumor-induced hypofunction, and improved migration and chemotaxis.
[0193] In one aspect, the CAR expressing cells are further modified to evade or neutralize the activity of immunosuppressive mediators, including, but not limited to prostaglandin E2 (PGE2) and adenosine. In some embodiments, this evasion or neutralization is direct. In other embodiments, this evasion or neutralization is mediated via the inhibition of protein kinase A (PKA) with one or more binding partners, for example ezrin. In a specific embodiment, the CAR-expressing cells further express the peptide regulatory subunit I anchoring disruptor (RIAD). RIAD is thought to inhibit the association of protein kinase A (PKA) with ezrin, which thus prevents PKA-mediated inhibition of TCR activation (Newick et al. Cancer Res 2016 August; 76(15 Suppl): Abstract nr B27).
[0194] In some embodiments, the CAR expressing cells of the invention may induce a broad antitumor immune response consistent with epitope spreading.
[0195] In some embodiments, the CAR expressing cells of the invention further comprise a homing mechanism. For example, the cell may transgenically express one or more stimulatory chemokines or cytokines or receptors thereof. In particular embodiments, the cells are genetically modified to express one or more stimulatory cytokines. In certain embodiments, one or more homing mechanisms are used to render the inventive cells resistant to an inhibitory tumor microenvironment. In some embodiments, the CAR expressing cells are further modified to release inducible cytokines upon CAR activation, e.g., to attract or activate innate immune cells to a targeted tumor (so-called fourth generation CARs or TRUCKS). In some embodiments, CARs may co-express homing molecules, e.g., CCR4 or CCR2b, to increase tumor trafficking.
[0196] Controlling CAR Expression
[0197] In some instances, it may be advantageous to regulate the activity of the CAR or CAR expressing cells CAR. For example, inducing apoptosis using, e.g., a caspase fused to a dimerization domain (see, e.g., Di et al., N Engl. J. Med. 2011 Nov. 3; 365(18):1673-1683), can be used as a safety switch in the CAR therapy of the instant invention. In another example, CAR-expressing cells can also express an inducible Caspase-9 (iCaspase-9) molecule that, upon administration of a dimerizer drug (e.g., rimiducid (also called AP1903 (Bellicum Pharmaceuticals) or AP20187 (Ariad)) leads to activation of the Caspase-9 and apoptosis of the cells. The iCaspase-9 molecule contains a chemical inducer of dimerization (CID) binding domain that mediates dimerization in the presence of a CID. This results in inducible and selective depletion of CAR-expressing cells. In some cases, the iCaspase-9 molecule is encoded by a nucleic acid molecule separate from the CAR-encoding vector(s). In some cases, the iCaspase-9 molecule is encoded by the same nucleic acid molecule as the CAR-encoding vector. The iCaspase-9 can provide a safety switch to avoid any toxicity of CAR-expressing cells. See, e.g., Song et al. Cancer Gene Ther. 2008; 15(10):667-75; Clinical Trial Id. No. NCT02107963; and Di Stasi et al. N. Engl. J. Med. 2011; 365:1673-83.
[0198] Alternative strategies for regulating the CAR therapy of the instant invention include utilizing small molecules or antibodies that deactivate or turn off CAR activity, e.g., by deleting CAR-expressing cells, e.g., by inducing antibody dependent cell-mediated cytotoxicity (ADCC). For example, CAR-expressing cells described herein may also express an antigen that is recognized by molecules capable of inducing cell death, e.g., ADCC or compliment-induced cell death. For example, CAR expressing cells described herein may also express a receptor capable of being targeted by an antibody or antibody fragment. Examples of such receptors include EpCAM, VEGFR, integrins (e.g., integrins v3, 4, I3/43, 47, 51, v3, v), members of the TNF receptor superfamily (e.g., TRAIL-R1, TRAIL-R2), PDGF Receptor, interferon receptor, folate receptor, GPNMB, ICAM-1, HLA-DR, CEA, CA-125, MUC1, TAG-72, IL-6 receptor, 5T4, GD2, GD3, CD2, CD3, CD4, CD5, CD11, CD11a/LFA-1, CD15, CD18/ITGB2, CD19, CD20, CD22, CD23/lgE Receptor, CD25, CD28, CD30, CD33, CD38, CD40, CD41, CD44, CD51, CD52, CD62L, CD74, CD80, CD125, CD147/basigin, CD152/CTLA-4, CD154/CD40L, CD195/CCR5, CD319/SLAMF7, and EGFR, and truncated versions thereof (e.g., versions preserving one or more extracellular epitopes but lacking one or more regions within the cytoplasmic domain). For example, CAR-expressing cells described herein may also express a truncated epidermal growth factor receptor (EGFR) which lacks signaling capacity but retains the epitope that is recognized by molecules capable of inducing ADCC, e.g., cetuximab (ERBITUX), such that administration of cetuximab induces ADCC and subsequent depletion of the CAR-expressing cells (see, e.g., WO2011/056894, and Jonnalagadda et al., Gene Ther. 2013; 20(8)853-860).
[0199] In some embodiments, the CAR cell comprises a polynucleotide encoding a suicide polypeptide, such as for example RQR8. See, e.g., WO2013153391A, which is hereby incorporated by reference in its entirety. In CAR cells comprising the polynucleotide, the suicide polypeptide may be expressed at the surface of a CAR cell. The suicide polypeptide may also comprise a signal peptide at the amino terminus. Another strategy includes expressing a highly compact marker/suicide gene that combines target epitopes from both CD32 and CD20 antigens in the CAR-expressing cells described herein, which binds rituximab, resulting in selective depletion of the CAR-expressing cells, e.g., by ADCC (see, e.g., Philip et al., Blood. 2014; 124(8)1277-1287). Other methods for depleting CAR-expressing cells described herein include administration of CAMPATH, a monoclonal anti-CD52 antibody that selectively binds and targets mature lymphocytes, e.g., CAR-expressing cells, for destruction, e.g., by inducing ADCC. In other embodiments, the CAR-expressing cell can be selectively targeted using a CAR ligand, e.g., an anti-idiotypic antibody. In some embodiments, the anti-idiotypic antibody can cause effector cell activity, e.g, ADCC or ADC activities, thereby reducing the number of CAR-expressing cells. In other embodiments, the CAR ligand, e.g., the anti-idiotypic antibody, can be coupled to an agent that induces cell killing, e.g., a toxin, thereby reducing the number of CAR-expressing cells. Alternatively, the CAR molecules themselves can be configured such that the activity can be regulated, e.g., turned on and off as described below.
[0200] In some embodiments, a regulatable CAR (RCAR) where the CAR activity can be controlled is desirable to optimize the safety and efficacy of a CAR therapy. In some embodiments, a RCAR comprises a set of polypeptides, typically two in the simplest embodiments, in which the components of a standard CAR described herein, e.g., an antigen-binding domain and an intracellular signaling domain, are partitioned on separate polypeptides or members. In some embodiments, the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen-binding domain to an intracellular signaling domain. Additional description and exemplary configurations of such regulatable CARs are provided herein and in International Publication No. WO 2015/090229, hereby incorporated by reference in its entirety.
[0201] In an aspect, an RCAR comprises two polypeptides or members: I) an intracellular signaling member comprising an intracellular signaling domain, e.g., a primary intracellular signaling domain described herein, and a first switch domain; 2) an antigen-binding member comprising an antigen-binding domain, e.g., that specifically binds a tumor antigen described herein, as described herein and a second switch domain. Optionally, the RCAR comprises a transmembrane domain described herein. In an embodiment, a transmembrane domain can be disposed on the intracellular signaling member, on the antigen-binding member, or on both. Unless otherwise indicated, when members or elements of an RCAR are described herein, the order can be as provided, but other orders are included as well. In other words, in an embodiment, the order is as set out in the text, but in other embodiments, the order can be different. E.g., the order of elements on one side of a transmembrane region can be different from the example, e.g., the placement of a switch domain relative to an intracellular signaling domain can be different, e.g., reversed.
[0202] In some embodiments, the CAR expressing immune cell may only transiently express a CAR. For example, the cells of the invention may be transduced with mRNA comprising a nucleic acid sequence encoding an inventive CAR. In this vein, the present invention also includes an RNA construct that can be directly transfected into a cell. A method for generating mRNA for use in transfection involves in vitro transcription (IVT) of a template with specially designed primers, followed by polyA addition, to produce a construct containing 3 and 5 untranslated sequences (UTRs), a 5 cap and/or Internal Ribosome Entry Site (IRES), the nucleic acid to be expressed, and a polyA tail, typically 50-2000 bases in length. RNA so produced can efficiently transfect different kinds of cells. In one embodiment, the template includes sequences for the CAR. In an embodiment, an RNA CAR vector is transduced into a cell by electroporation.
Target Specificity
[0203] The CAR expressing cells of the present invention may further comprise one or more additional CARs. These additional CARs may or may not be specific for TIM-1. In some embodiments, the one or more additional CARs may act as inhibitory or activating CARs. In some aspects, the TIM-1-targeting CAR is the stimulatory or activating CAR; in other aspects, it is the costimulatory CAR. In some embodiments, the cells further include inhibitory CARs (iCARs, see Fedorov et al., Sci. Transl. Medicine, 2013 December; 5(215): 215ra172), such as a CAR recognizing an antigen other than TIM-1, whereby an activating signal delivered through the TIM-1-targeting CAR is diminished or inhibited by binding of the inhibitory CAR to its ligand, e.g., to reduce off-target effects.
[0204] In some embodiments, the CAR expressing cells of the present invention may further comprise one or more additional CARs that may target one or more antigens selected from the group of: BCMA; BCR-Ab1; BST2; CAIX; CD19; CD20; CD22; CD123; CD171; CD30; CD33; CD38; CD44v6; CD44v7/8; CEA; CLL-1; EGFRvIII; EGP-2; EGP-40; ERBB2 (Her2/neu); EPCAM; fetal acetylcholine receptor, FBP; FLT3; Folate receptor alpha; GD2; GD3; Her3 (ErbB3); Her4 (ErbB4); k-light chain; KDR; MAD-CT-1; MAD-CT-2; MAGE-A1; MARTI; ML-IAP; MYCN; Oncofetal antigen (h5T4); NKG2D ligands PDK1; PDL1; PSCA; PSMA; PRSS21; ROR1; SLAMF7; TAG-72; Tn Ag; TSLPR; B7H3 (CD276); KIT (CD17); IL-13Ra2; Mesothelin; IL-11Ra; VEGFR2; LeY; CD24; PDGFR-beta; SSEA-4; CD20; MUC1; EGFR; NCAM; Prostase; PAP; ELF2M; Ephrin B2; FAP; IGF-1 receptor; CAFX; LMP2; gp100; tyrosinase; EphA2; Fucosyl GM1; sLe; ganglioside GM3; TGS5; HMWMAA; OAcGD2; OR51E2; Folate receptor beta; TEM1/CD248; TEM7R; CLDN6; TSHR; GloboH; GPR20; GPRC5D; CXORF61; CD97; CD179a; ADRB3; ALK; Polysialic acid; PANX3; PLAC1; NY-BR-1; NY-ESO-1; UPK2; TIM-1; HAVCR1; LY6K; TARP; WT1; LAGE-1a; ETV6-AML; SPA17; XAGE1; Tie 2; Fos-related antigen 1; p53; p53 mutant; prostein; surviving; telomerase; PCTA-1; Rat sarcoma Ras mutant; hTERT; sarcoma translocation breakpoints; ERG; NA17; PAX3; Androgen receptor; Cyclin B1; RhoC; TRP-2; CYP1B1; BORIS, SART3; PAX5; OY-TES1; LCK; AKAP-4; SSX2; RAGE-1; RU1; RU2; legumain; HPV E6; HPV E7; intestinal carboxyl esterase; mut hsp70-2; CD79a; CD79b; CD72; LAIR1; CD89; LILRA2; CD300LF; CLEC12A; EMR2; FCRL5; GPC3; IGLL1; and LY75.
[0205] In some embodiments, the antigen-binding domain of the inventive CAR is affinity tuned. In particular, the affinity of the anti-TIM-1 CAR antigen-binding domain is adjusted to discriminate cells overexpressing TIM-1, e.g. tumor cells, from normal tissues which express TIM-1 at physiological levels. This may be accomplished, e.g., through the use of a CAR-expressing T cell with target antigen affinities varying over three orders of magnitude (Liu et al. Cancer Res 2015 September; 75(17):3596-607). Additionally, in vivo xenograt models may be used to evaluate the toxicity of affinity tuned anti-TIM-1 CARs on normal human tissue (Johnson et al. Sci Transl Med 2015 February; 7(275):275ra22).
[0206] In some embodiments, the antigen-binding domain of the CAR is or is part of an immunoconjugate, in which the antigen-binding domain is conjugated to one or more heterologous molecule(s), such as, but not limited to, a cytotoxic agent, an imaging agent, a detectable moiety a multimerization domain or other heterologous molecule. Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At211, I131, I125, Y90, Re186, Re188, Sm153, Bi212, P32, Pb212 and radioactive isotopes of Lu); chemotherapeutic agents (e.g., methotrexate, adriamycin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins. In some embodiments, the antigen-binding domain is conjugated to one or more cytotoxic agents, such as chemotherapeutic agents or drugs, growth inhibitory agents, toxins (e.g., protein toxins, enzymatically active toxins of bacterial, fungal, plant, or animal origin, or fragments thereof), or radioactive isotopes.
Other
[0207] In some embodiments, the CAR expressing cells of the invention may be further genetically modified to express the dominant negative form of the transforming growth factor (TGF) beta receptor (DNR).
[0208] In another embodiment, the CAR expressing cell may be specific for another antigen, including a tumor antigen in some cases. In some embodiments, the transformed host cells may be selected for specificity for one or more strong viral antigens or may be transformed to exhibit specificity for these antigens. In specific embodiments, the cells are pp65CMV-specific T cells, CMV-specific T cells, EBV-specific T cells, Varicella Virus-specific T cells, Influenza Virus-specific T cells and/or Adenovirus-specific T cells.
[0209] To increase persistence, the cells of the invention may be further modified to overexpress pro-survival signals, reverse anti-survival signals, overexpress Bcl-xL, overexpress hTERT, lack Fas, or express a TGF dominant negative receptor. Persistence may also be facilitated by the administration of cytokines, e.g., IL-2, IL-7, and IL-15.
Vectors
[0210] The present invention also provides vectors in which a DNA of the present invention is inserted. Vectors derived from retroviruses are suitable tools to achieve long-term gene transfer since they allow for genetic stability and high expression, in addition to having a flexible genome. Furthermore, clinical experience with retroviral vectors provides guidance for optimizing efficacy and safety in their use.
[0211] In brief summary, the expression of natural or synthetic nucleic acids encoding CARs is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector. The vectors can be suitable for replication and integration in eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.
[0212] The expression constructs of the present invention may also be used for nucleic acid immunization and gene therapy, using standard gene delivery protocols. Methods for gene delivery are known in the art. See, e.g., U.S. Pat. Nos. 5,399,346, 5,580,859, 5,589,466, incorporated by reference herein in their entireties. In another embodiment, the invention provides a gene therapy vector.
[0213] The nucleic acid can be cloned into a number of types of vectors. For example, the nucleic acid can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.
[0214] Further, the expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, gammaretroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).
[0215] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, retrovirus vectors are used. In some embodiments, the retroviral vector is pFSG or pFB.
[0216] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 bp upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.
[0217] Various promoter sequences may be used, including, but not limited to the immediate early cytomegalovirus (CMV) promoter, Elongation Growth Factor-1 (EF-1), simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.
[0218] In order to assess the expression of a CAR polypeptide or portions thereof, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.
[0219] In a preferred embodiment, the selectable marker gene comprises a nucleic acid sequence encoding truncated CD19 (tCD19).
[0220] Reporter genes are used for identifying potentially transfected cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5 flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.
Transduction
[0221] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.
[0222] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A preferred method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.
[0223] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.
[0224] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vive is a liposome (e.g., an artificial membrane vesicle).
[0225] In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a collapsed structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
[0226] Lipids suitable for use can be obtained from commercial sources. For example, dimyristyl phosphatidylcholine (DMPC) can be obtained from Sigma, St. Louis, Mo.; dicetyl phosphate (DCP) can be obtained from K & K Laboratories (Plainview, N.Y.); cholesterol (Choi) can be obtained from Calbiochem-Behring; dimyristyl phosphatidylglycerol (DMPG) and other lipids may be obtained from Avanti Polar Lipids, Inc. (Birmingham, Ala.). Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about 20 degrees Celsius. Chloroform is used as the only solvent since it is more readily evaporated than methanol. Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution. The lipid components undergo self-rearrangement before the formation of closed structures and entrap water and dissolved solutes between the lipid bilayers (Ghosh et al., 1991 Glycobiology 5: 505-10). However, compositions that have different structures in solution than the normal vesicular structure are also encompassed. For example, the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules. Also contemplated are lipofectamine-nucleic acid complexes.
[0227] Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present invention, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, molecular biological assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; biochemical assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.
Cells of the Invention
[0228] Also provided are cells, cell populations, and compositions containing the cells, e.g., cells comprising a nucleic acid sequence encoding an anti-TIM-1 chimeric antigen receptor. Among the compositions are pharmaceutical compositions and formulations for administration, such as for adoptive cell therapy. Also provided are therapeutic methods for administering the cells and compositions to subjects, e.g., patients.
Cell Types
[0229] Thus also provided are cells expressing the anti-TIM-1 CARs. The cells generally are eukaryotic cells, such as mammalian cells, and typically are human cells, more typically primary human cells, e.g., allogeneic or autologous donor cells. The cells for introduction of the CAR may be isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject. In some embodiments, the subject from which the cell is isolated is one having the disease or condition or in need of a cell therapy or to which cell therapy will be administered. The subject in some embodiments is a human in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered. In some embodiments, the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, are cells of the immune system, such as cells of the innate or adaptive immune systems, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells. Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs). The cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen. In some embodiments, the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4.sup.+ cells, CD8.sup.+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation.
[0230] With reference to the subject to be treated, the cells may be allogeneic and/or autologous. Among the methods included are off-the-shelf methods. In some aspects, such as for off-the-shelf technologies, the cells are pluripotent and/or multipotent, such as stem cells, induced pluripotent stem cells (iPSCs), or T cells that either lack or are engineered to be deficient in T cell receptor function. In some embodiments, the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation.
[0231] Among the sub-types and subpopulations of T cells and/or of CD4.sup.+ and/or of CD8.sup.+ T cells are nave T (TN) cells, effector T cells (TEFF), memory T cells and sub-types thereof, such as stem cell memory T (TSCM), central memory T (TCM), effector memory T (TEM), or terminally differentiated effector memory T cells, tumor-infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
[0232] In some embodiments, the cells are natural killer (NK) cells, Natural Killer T (NKT) cells, cytokine-induced killer (CIK) cells, tumor-infiltrating lymphocytes (TIL), lymphokine-activated killer (LAK) cells, or the like. In some embodiments, the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
[0233] In some embodiments, the cells are derived from cell lines, e.g., T cell lines. The cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, and pig.
Cell Acquisition
[0234] Prior to expansion and genetic modification, a source of cells can be obtained from a subject through a variety of non-limiting methods. Cells can be obtained from a number of non-limiting sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In some embodiments, any number of T cell lines available and known to those skilled in the art, may be used. In some embodiments, cells can be derived from a healthy donor, from a patient diagnosed with cancer, from a patient diagnosed with an autoimmune or inflammatory disorder or from a patient diagnosed with an infection. In some embodiments, cells can be part of a mixed population of cells which present different phenotypic characteristics.
[0235] Accordingly, the cells in some embodiments are primary cells, e.g., primary human cells. The samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation. The biological sample can be a sample obtained directly from a biological source or a sample that is processed. Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.
[0236] In some aspects, the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product. Exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom. Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.
[0237] In some examples, cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis. The samples, in some aspects, contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contain cells other than red blood cells and platelets.
[0238] Also provided herein are cell lines obtained from a transformed cell according to any of the above-described methods. Also provided herein are modified cells resistant to an immunosuppressive treatment. In some embodiments, an isolated cell according to the invention comprises a polynucleotide encoding a CAR.
Cell Purification
[0239] In some embodiments, isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps. In some examples, cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted components, enrich for desired components, lyse or remove cells sensitive to particular reagents. In some examples, cells are separated based on one or more property, such as density, adherent properties, size, sensitivity and/or resistance to particular components.
[0240] In some embodiments, the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In some embodiments, the wash solution lacks calcium and/or magnesium and/or many or all divalent cations. In some aspects, a washing step is accomplished by a semi-automated flow-through centrifuge (for example, the Cobe 2991 cell processor, Baxter) according to the manufacturer's instructions. In some aspects, a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions. In some embodiments, the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca.sup.++/Mg.sup.++ free PBS. In certain embodiments, components of a blood cell sample are removed and the cells directly resuspended in culture media.
[0241] In some embodiments, the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In a specific embodiment, the surface maker is tCD19. In some embodiments, any known method for separation based on such markers may be used. In some embodiments, the separation is affinity- or immunoaffinity-based separation. For example, the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.
[0242] Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.
[0243] In some embodiments, multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection. In some examples, a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection. Likewise, multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.
[0244] For example, in some aspects, specific subpopulations of T cells, such as cells positive or expressing high levels of one or more surface markers, e.g., CD28.sup.+, CD62L.sup.+, CCR7.sup.+, CD27.sup.+, CD127.sup.+, CD4.sup.+, CD8.sup.+, CD45RA.sup.+, and/or CD45RO.sup.+ T cells, are isolated by positive or negative selection techniques. For example, CD3.sup.+ T cells can be expanded using CD3 conjugated magnetic beads (e.g., DYNABEADS M-450 CD3/CD28 T Cell Expander).
[0245] In some embodiments, isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection. In some embodiments, positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker.sup.+) at a relatively higher level (marker.sup.high) on the positively or negatively selected cells, respectively.
[0246] In some embodiments, T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD14. In some aspects, a CD4.sup.+ or CD8.sup.+ selection step is used to separate CD4.sup.+ helper and CD8.sup.+ cytotoxic T cells. Such CD4.sup.+ and CD8.sup.+ populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
[0247] In some embodiments, CD8.sup.+ cells are further enriched for or depleted of nave, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation. In some embodiments, enrichment for central memory T (T.sub.CM) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakura et al. (2012) Blood. 1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701. In some embodiments, combining T.sub.CM-enriched CD8.sup.+ T cells and CD4.sup.+ T cells further enhances efficacy.
[0248] In embodiments, memory T cells are present in both CD62L.sup.+ and CD62L.sup. subsets of CD8.sup.+ peripheral blood lymphocytes. PBMC can be enriched for or depleted of CD62L.sup.CD8.sup.+ and/or CD62L.sup.+CD8 fractions, such as using anti-CD8 and anti-CD62L antibodies.
[0249] In some embodiments, the enrichment for central memory T (T.sub.CM) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD127; in some aspects, it is based on negative selection for cells expressing or highly expressing CD45RA and/or granzyme B. In some aspects, isolation of a CD8 population enriched for T.sub.CM cells is carried out by depletion of cells expressing CD4, CD14, CD45RA, and positive selection or enrichment for cells expressing CD62L. In one aspect, enrichment for central memory T (T.sub.CM) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD14 and CD45RA, and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order. In some aspects, the same CD4 expression-based selection step used in preparing the CD8.sup.+ cell population or subpopulation, also is used to generate the CD4.sup.+ cell population or subpopulation, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.
[0250] In some aspects, the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microparticles, such as paramagnetic beads (e.g., such as Dynabeads or MACS beads). The magnetically responsive material, e.g., particle, generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.
[0251] In some embodiments, the magnetic particle or bead comprises a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner. There are many well-known magnetically responsive materials used in magnetic separation methods. Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby incorporated by reference. Colloidal sized particles, such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084 are other examples.
[0252] The incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
[0253] In some aspects, the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells. For positive selection, cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained. In some aspects, a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.
[0254] In certain embodiments, the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin. In certain embodiments, the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers. In certain embodiments, the cells, rather than the beads, are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added. In certain embodiments, streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.
[0255] In some embodiments, the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient. In some embodiments, the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, magnetizable particles or antibodies conjugated to cleavable linkers, etc. In some embodiments, the magnetizable particles are biodegradable.
[0256] In certain embodiments, the isolation or separation is carried out using a system, device, or apparatus that carries out one or more of the isolation, cell preparation, separation, processing, incubation, culture, and/or formulation steps of the methods. In some aspects, the system is used to carry out each of these steps in a closed or sterile environment, for example, to minimize error, user handling and/or contamination. In one example, the system is a system as described in International Patent Application, Publication Number WO2009/072003, or US 20110003380 Al.
[0257] In some embodiments, the system or apparatus carries out one or more, e.g., all, of the isolation, processing, engineering, and formulation steps in an integrated or self-contained system, and/or in an automated or programmable fashion. In some aspects, the system or apparatus includes a computer and/or computer program in communication with the system or apparatus, which allows a user to program, control, assess the outcome of, and/or adjust various aspects of the processing, isolation, engineering, and formulation steps.
[0258] In some embodiments, a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream. In some embodiments, a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting. In certain embodiments, a cell population described herein is collected and enriched (or depleted) by use of microelectromechanical systems (MEMS) chips in combination with a FACS-based detection system (see, e.g., WO 2010/033140, Cho et al. (2010) Lab Chip 10, 1567-1573; and Godin et al. (2008) J Biophoton. 1(5):355-376. In both cases, cells can be labeled with multiple markers, allowing for the isolation of well-defined T cell subsets at high purity.
[0259] In some embodiments, the antibodies or binding partners are labeled with one or more detectable marker, to facilitate separation for positive and/or negative selection. For example, separation may be based on binding to fluorescently labeled antibodies. In some examples, separation of cells based on binding of antibodies or other binding partners specific for one or more cell surface markers are carried in a fluidic stream, such as by fluorescence-activated cell sorting (FACS), including preparative scale (FACS) and/or microelectromechanical systems (MEMS) chips, e.g., in combination with a flow-cytometric detection system. Such methods allow for positive and negative selection based on multiple markers simultaneously.
[0260] In some embodiments, the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.
[0261] In any of the aforementioned separation steps, the separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker. For example, positive selection of or enrichment for cells of a particular type, such as those expressing a marker, refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker. Likewise, negative selection, removal, or depletion of cells of a particular type, such as those expressing a marker, refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.
Cell Preparation and Expansion
[0262] In some embodiments, the provided methods include cultivation, incubation, culture, and/or genetic engineering steps. For example, in some embodiments, provided are methods for incubating and/or engineering the depleted cell populations and culture-initiating compositions.
[0263] Thus, in some embodiments, the cell populations are incubated in a culture-initiating composition. The incubation and/or engineering may be carried out in a culture vessel, such as a unit, chamber, well, column, tube, tubing set, valve, vial, culture dish, bag, or other container for culture or cultivating cells.
[0264] In some embodiments, the cells are incubated and/or cultured prior to or in connection with genetic engineering. The incubation steps can include culture, cultivation, stimulation, activation, and/or propagation.
[0265] In some embodiments, the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a recombinant antigen receptor. The cells of the invention can be activated and expanded, either prior to or after genetic modification of the cells, using methods as generally described, for example without limitation, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and U.S. Patent Application Publication No. 20060121005. The conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
[0266] T cells can be expanded in vitro or in vivo. Generally, the T cells of the invention can be expanded, for example, by contact with an agent that stimulates a CD3 TCR complex and a co-stimulatory molecule on the surface of the T cells to create an activation signal for the T cell. For example, chemicals such as calcium ionophore A23187, phorbol 12-myristate 13-acetate (PMA), or mitogenic lectins like phytohemagglutinin (PHA) can be used to create an activation signal for the T cell.
[0267] In some embodiments, T cell populations may be stimulated in vitro by contact with, for example, an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore. In some embodiments, the T cell populations may be stimulated in vitro by contact with Muromonab-CD3 (OKT3). For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 5, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-, IL-4, IL-7, GM-CSF, IL-10, IL-2, IL-15, IL-21, TGFp, and TNF, or any other additives for the growth of cells known to the skilled artisan. In a preferred embodiment, T cells are stimulated in vitro by exposure to OKT3 and IL-2. Other additives for the growth of cells include, but are not limited to, surfactant, Plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol. Media can include RPMI 1640, AIM-V, DMEM, MEM, a-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells. Antibiotics, e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject. The target cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37 degrees Celsius) and atmosphere (e.g., air plus 5% CO.sub.2). T cells that have been exposed to varied stimulation times may exhibit different characteristics.
[0268] In some embodiments, the isolated cells of the invention can be expanded by co-culturing with tissue or cells. The cells can also be expanded in vivo, for example in the subject's blood after administrating the cell into the subject.
[0269] In some embodiments, the T cells are expanded by adding to the culture-initiating composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells). In some aspects, the non-dividing feeder cells can comprise gamma-irradiated PBMC feeder cells. In some embodiments, the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division. In some aspects, the feeder cells are added to culture medium prior to the addition of the populations of T cells.
[0270] In some embodiments, the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering. In some embodiments, the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population. In some embodiments, the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used. One example involves using PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1:1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively. The cells are then frozen to 80 degrees Celsius at a rate of 1 degree per minute and stored in the vapor phase of a liquid nitrogen storage tank.
Therapeutic Applications
[0271] Isolated cells obtained by the methods described above, or cell lines derived from such isolated cells, can be used as a medicament in the treatment of a disease, disorder, or condition in a subject. In some embodiments, such a medicament can be used for treating cancer.
Cell Origin
[0272] For purposes of the inventive methods, wherein host cells or populations of cells are administered, the cells can be cells that are xenogeneic, allogeneic or autologous to the subject. Generally, the cells are autologous to the subject.
[0273] In some embodiments, the cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is carried out by autologous transfer, in which the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject. Thus, in some aspects, the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, following isolation and processing are administered to the same subject.
[0274] In some embodiments, the cell therapy, e.g., adoptive cell therapy, e.g., adoptive T cell therapy, is carried out by allogeneic transfer, in which the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject. In such embodiments, the cells then are administered to a different subject, e.g., a second subject, of the same species. In some embodiments, the first and second subjects are genetically identical. In some embodiments, the first and second subjects are genetically similar. In some embodiments, the second subject expresses the same HLA class or supertype as the first subject.
Subject
[0275] The subject referred to herein may be any living subject. In a preferred embodiment, the subject is a mammal. The mammal referred to herein can be any mammal. As used herein, the term mammal refers to any mammal, including, but not limited to, mammals of the order Rodentia, such as mice and hamsters, and mammals of the order Logomorpha, such as rabbits. The mammals may be from the order Carnivora, including Felines (cats) and Canines (dogs). The mammals may be from the order Artiodactyla, including Bovines (cows) and Swines (pigs) or of the order Perssodactyla, including Equines (horses). The mammals may be of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes)
[0276] In some embodiments, the subject, to whom the cells, cell populations, or compositions are administered is a primate, such as a human. In some embodiments, the primate is a monkey or an ape. The subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects. In some examples, the patient or subject is a validated animal model for disease, adoptive cell therapy, and/or for assessing toxic outcomes such as cytokine release syndrome (CRS).
[0277] In some embodiments, the subject has persistent or relapsed disease, e.g., following treatment with another immunotherapy and/or other therapy, including chemotherapy, radiation, and/or hematopoietic stem cell transplantation (HSCT), e.g., allogenic HSCT. In some embodiments, the administration effectively treats the subject despite the subject having become resistant to another therapy. In some embodiments, the subject has not relapsed but is determined to be at risk for relapse, such as at a high risk of relapse, and thus the compound or composition is administered prophylactically, e.g., to reduce the likelihood of or prevent relapse.
[0278] In some embodiments, the methods include administration of CAR expressing cells or a composition containing the cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having a disease, condition or disorder associated with the expression of TIM-1. In some embodiments, the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy. In some embodiments, the cells or compositions are administered to the subject, such as a subject having or at risk for the disease or condition. In some aspects, the methods thereby treat, e.g., ameliorate one or more symptom of the disease or condition, such as by lessening tumor burden in a TIM-1-expressing cancer.
Functional Activity
[0279] In one embodiment, the present invention includes a type of cellular therapy where isolated cells are genetically modified to express an anti-TIM-1 CAR and the CAR cell is infused into a subject in need thereof. Such administration can promote activation of the cells (e.g., T cell activation) in a TIM-1-targeted manner, such that the cells of the disease or disorder are targeted for destruction. In the case where the cell is a T cell, CAR T cells, unlike antibody therapies, are able to replicate in vivo resulting in long-term persistence that may lead to sustained control of TIM-1 related diseases, disorders, or conditions.
[0280] In one embodiment, the isolated cells of the invention can undergo in vivo expansion and can persist for an extended amount of time. In another embodiment, where the isolated cell is a T cell, the isolated T cells of the invention evolve into specific memory T cells that can be reactivated to inhibit any additional TIM-1-expressing cell growth. CAR T cells may differentiate in vive into a central memory-like state upon encounter and subsequent elimination of target cells expressing the surrogate antigen.
[0281] Without wishing to be bound by any particular theory, the anti-tumor immunity response elicited by the isolated CAR-modified immune cells may be an active or a passive immune response. In addition, the CAR mediated immune response may be part of an adoptive immunotherapy approach in which CAR-modified immune cells induce an immune response specific to the antigen-binding domain in the CAR.
[0282] In certain embodiments, CAR expressing cells are modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased. For example, the CAR may be conjugated either directly or indirectly through a linker to a targeting moiety. The practice of conjugating compounds, e.g., the CAR, to targeting moieties is known in the art. See, for instance, Wadhwa et al., J. Drug Targeting 1995; 3(2): 111-127, and U.S. Pat. No. 5,087,616.
[0283] Once the cells are administered to a subject (e.g., a human), the biological activity of the engineered cell populations and/or antibodies in some aspects is measured by any of a number of known methods. Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry. In certain embodiments, the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J. Immunological Methods, 285(1): 25-40 (2004). In certain embodiments, the biological activity of the cells also can be measured by assaying expression and/or secretion of certain cytokines, such as GM-CSF, IL-6, RANTES (CCL5), TNF-, IL-4, IL-10, IL-13, IFN-, CD 107a, or IL-2.
[0284] In some aspects the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load, stabilization of tumor, progression free survival, or overall survival.
Target Cells
[0285] Cancers that may be treated include tumors that are not vascularized, or not yet substantially vascularized, as well as vascularized tumors. The cancers may comprise non-solid tumors (such as hematological tumors, for example, leukemias and lymphomas) or may comprise solid tumors. Types of cancers to be treated with the CARs of the invention include, but are not limited to, carcinoma, blastoma, and sarcoma, and certain leukemia or lymphoid malignancies, benign and malignant tumors, and malignancies e.g., sarcomas, carcinomas, and melanomas. Adult tumors/cancers and pediatric tumors/cancers are also included.
[0286] Hematologic cancers are cancers of the blood or bone marrow. Examples of hematological (or hematogenous) cancers include leukemias, including acute leukemias (such as acute lymphocytic leukemia, acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic and erythroleukemia), chronic leukemias (such as chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, and chronic lymphocytic leukemia), polycythemia vera, lymphoma, Hodgkin's disease, non-Hodgkin's lymphoma (indolent and high grade forms), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, myelodysplastic syndrome, hairy cell leukemia and myelodysplasia.
[0287] Solid tumors are abnormal masses of tissue that usually do not contain cysts or liquid areas. Solid tumors can be benign or malignant. Different types of solid tumors are named for the type of cells that form them (such as sarcomas, carcinomas, and lymphomas). Examples of solid tumors, such as sarcomas and carcinomas, include fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteosarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leciomyosarcoma, rhabdomyosarcoma, colon carcinoma, lymphoid malignancy, pancreatic cancer, breast cancer, lung cancers, ovarian cancer, prostate cancer, hepatocellular carcinoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, medullary thyroid carcinoma, papillary thyroid carcinoma, pheochromocytomas sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, Wilms' tumor, cervical cancer, testicular tumor, seminoma, bladder carcinoma, melanoma, and CNS tumors (such as a glioma (such as brainstem glioma and mixed gliomas), glioblastoma (also known as glioblastoma multiforme) astrocytoma, CNS lymphoma, germinoma, medulloblastoma, Schwannoma craniopharyogioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, neuroblastoma, retinoblastoma and brain metastases).
[0288] Preferably, the CAR expressing cells of the invention are used to treat a cancer the tumorous cells are positive for surface TIM-1 expression. In particular, the cells of the invention may be used to treat TIM-1 positive ovarian carcinoma, renal cell carcinoma, and lung cancer. In general, TIM-1 positive tumor cells may be identified via known methods. For example, TIM-1 expression on tumor cells may be identified via immunofluorescence or flow cytometry using anti-TIM-1 antibodies. Alternatively, TIM-1 expression may be measured functionally through CAR cytotoxicity against target cells.
[0289] Methods of testing a CAR for the ability to recognize target cells and for antigen specificity are known in the art. For instance, Clay et al., J. Immunol., 163: 507-513 (1999), teaches methods of measuring the release of cytokines (e.g., interferon-, granulocyte/monocyte colony stimulating factor (GM-CSF), tumor necrosis factor a (TNF-) or interleukin 2 (IL-2)). In addition, CAR function can be evaluated by measurement of cellular cytotoxicity, as described in Zhao et al., J. Immunol., 174: 4415-4423 (2005).
[0290] A biopsy is the removal of tissue and/or cells from an individual. Such removal may be to collect tissue and/or cells from the individual in order to perform experimentation on the removed tissue and/or cells. This experimentation may include experiments to determine if the individual has and/or is suffering from a certain condition or disease-state. The condition or disease may be, e.g., cancer. With respect to detecting the presence of TIM-1 expressing tumor cells in a host, the sample comprising cells of the host can be a sample comprising whole cells, lysates thereof, or a fraction of the whole cell lysates, e.g., a nuclear or cytoplasmic fraction, a whole protein fraction, or a nucleic acid fraction. If the sample comprises whole cells, the cells can be any cells of the host, e.g., the cells of any organ or tissue, including blood cells or endothelial cells.
Other Targets
[0291] The CARs of the present invention, and in particular the CAR-expressing immune cells of the invention, may also be used to treat, prevent, or diagnose any other conditions, disorders, or diseases involving the expression of TIM-1 in healthy or diseased cells. For example, the invention also contemplates a method of treating or preventing immune dysfunction, atopic dermatitis, allergy, rheumatoid arthritis, asthma, systemic lupus erythematosus, hepatitis A virus infection, Ebola virus infection, Dengue virus infection, disease of the trachea, or disease of the cornea and conjunctiva in a subject, the method of which comprises administering cells expressing a CAR according to the invention. For example, as a six amino acid insertion in the mucin domain of TIM-1 is associated with protection from atopic diseases, the invention contemplates the administration of cells expressing a CAR targeting the mucin domain of TIM-1 as a method of treating or preventing atopic diseases.
Modes of Administration
[0292] The compositions of the present invention may be administered in a number of ways depending upon whether local or systemic treatment is desired.
[0293] In the case of adoptive cell therapy, methods for administration of cells for adoptive cell therapy are known and may be used in connection with the provided methods and compositions. For example, adoptive T cell therapy methods are described, e.g., in US Patent Application Publication No. 2003/0170238 to Gruenberg et al; U.S. Pat. No. 4,690,915 to Rosenberg; Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85). See, e.g., Themeli et al. (2013) Nat Biotechnol. 31(10): 928-933; Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1): 84-9; Davila et al. (2013) PLoS ONE 8(4): e61338.
[0294] In general, administration may be topical, parenteral, or enteral.
[0295] The compositions of the invention are typically suitable for parenteral administration. As used herein, parenteral administration of a pharmaceutical composition includes any route of administration characterized by physical breaching of a tissue of a subject and administration of the pharmaceutical composition through the breach in the tissue, thus generally resulting in the direct administration into the blood stream, into muscle, or into an internal organ. Parenteral administration thus includes, but is not limited to, administration of a pharmaceutical composition by injection of the composition, by application of the composition through a surgical incision, by application of the composition through a tissue-penetrating non-surgical wound, and the like. In particular, parenteral administration is contemplated to include, but is not limited to, subcutaneous, intraperitoneal, intramuscular, intrasternal, intravenous, intraarterial, intrathecal, intraventricular, intraurethral, intracranial, intratumoral, intrasynovial injection or infusions; and kidney dialytic infusion techniques. In a preferred embodiment, parenteral administration of the compositions of the present invention comprises subcutaneous or intraperitoneal administration.
[0296] Formulations of a pharmaceutical composition suitable for parenteral administration typically generally comprise the active ingredient combined with a pharmaceutically acceptable carrier, such as sterile water or sterile isotonic saline. Such formulations may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable formulations may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative. Formulations for parenteral administration include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and the like. Such formulations may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. In one embodiment of a formulation for parenteral administration, the active ingredient is provided in dry (i.e. powder or granular) form for reconstitution with a suitable vehicle (e.g. sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition. Parenteral formulations also include aqueous solutions which may contain excipients such as salts, carbohydrates and buffering agents (preferably to a pH of from 3 to 9), but, for some applications, they may be more suitably formulated as a sterile non-aqueous solution or as a dried form to be used in conjunction with a suitable vehicle such as sterile, pyrogen-free water. Exemplary parenteral administration forms include solutions or suspensions in sterile aqueous solutions, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms can be suitably buffered, if desired. Other parentally-administrable formulations which are useful include those which comprise the active ingredient in microcrystalline form, or in a liposomal preparation. Formulations for parenteral administration may be formulated to be immediate and/or modified release. Modified release formulations include delayed-, sustained-, pulsed-, controlled-, targeted and programmed release.
[0297] The terms oral, enteral, enterally, orally, non-parenteral, non-parenterally, and the like, refer to administration of a compound or composition to an individual by a route or mode along the alimentary canal. Examples of oral routes of administration of a composition include, without limitation, swallowing liquid or solid forms of a composition from the mouth, administration of a composition through a nasojejunal or gastrostomy tube, intraduodenal administration of a composition, and rectal administration, e.g., using suppositories for the lower intestinal tract of the alimentary canal.
[0298] Preferably, the formulated composition comprising isolated TIM-1 CAR-expressing cells is suitable for administration via injection.
[0299] Pharmaceutical compositions and formulations for topical administration may include transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids, semi-solids, monophasic compositions, multiphasic compositions (e.g., oil-in-water, water-in-oil), foams, microsponges, liposomes, nanoemulsions, aerosol foams, polymers, fullerenes, and powders. Conventional pharmaceutical carriers, aqueous, powder or oily bases, thickeners and the like may be necessary or desirable.
[0300] Compositions and formulations for oral administration include powders or granules, suspensions or solutions in water or non-aqueous media, capsules, sachets or tablets. Thickeners, flavoring agents, diluents, emulsifiers, dispersing aids or binders may be desirable.
[0301] Compositions and formulations for parenteral, intrathecal, or intraventricular administration may include sterile aqueous solutions that may also contain buffers, diluents and other suitable additives such as, but not limited to, penetration enhancers, carder compounds and other pharmaceutically acceptable carriers or excipients.
[0302] Pharmaceutical compositions of the present invention include, but are not limited to, solutions, emulsions, and liposome-containing formulations. These compositions may be generated from a variety of components that include, but are not limited to, preformed liquids, self-emulsifying solids and self-emulsifying semisolids.
[0303] The pharmaceutical compositions of the present invention, which may conveniently be presented in unit dosage form, may be prepared according to conventional techniques well known in the pharmaceutical industry. Such techniques include the step of bringing into association the active ingredients with the pharmaceutical carrier(s) or excipient(s). In general the formulations are prepared by uniformly and intimately bringing into association the active ingredients with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product.
[0304] The compositions of the present invention may be formulated into any of many possible dosage forms such as, but not limited to, tablets, capsules, liquid syrups, soft gels, suppositories, aerosols, and enemas. The compositions of the present invention may also be formulated as suspensions in aqueous, non-aqueous or mixed media. Aqueous suspensions may further contain substances that increase the viscosity of the suspension including, for example, sodium carboxymethylcellulose, sorbitol and/or dextran. The suspension may also contain stabilizers.
[0305] In one embodiment of the present invention the pharmaceutical compositions may be formulated and used as foams. Pharmaceutical foams include formulations such as, but not limited to, emulsions, microemulsions, creams, jellies and liposomes. While basically similar in nature these formulations vary in the components and the consistency of the final product. Agents that enhance uptake of oligonucleotides at the cellular level may also be added to the pharmaceutical and other compositions of the present invention. For example, cationic lipids, such as lipofectin (U.S. Pat. No. 5,705,188), cationic glycerol derivatives, and polycationic molecules, such as polylysine (WO 97/30731), also enhance the cellular uptake of oligonucleotides.
[0306] The compositions of the present invention may additionally contain other adjunct components conventionally found in pharmaceutical compositions. Thus, for example, the compositions may contain additional, compatible, pharmaceutically-active materials such as, for example, antipruritics, astringents, local anesthetics or anti-inflammatory agents, or may contain additional materials useful in physically formulating various dosage forms of the compositions of the present invention, such as dyes, flavoring agents, preservatives, antioxidants, opacifiers, thickening agents and stabilizers. However, such materials, when added, should not unduly interfere with the biological activities of the components of the compositions of the present invention. The formulations can be sterilized and, if desired, mixed with auxiliary agents, e.g., lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, colorings, flavorings and/or aromatic substances and the like which do not deleteriously interact with the nucleic acid(s) of the formulation.
[0307] Formulations comprising populations of anti-TIM-1-CAR-expressing cells may include pharmaceutically acceptable excipient(s). Excipients included in the formulations will have different purposes depending, for example, on the CAR construct, the subpopulation of cells used, and the mode of administration. Examples of generally used excipients include, without limitation: saline, buffered saline, dextrose, water-for-infection, glycerol, ethanol, and combinations thereof, stabilizing agents, solubilizing agents and surfactants, buffers and preservatives, tonicity agents, bulking agents, and lubricating agents. The formulations comprising populations of anti-TIM-1 CAR-expressing cells will typically have been prepared and cultured in the absence of any non-human components, such as animal serum (e.g., bovine serum albumin).
[0308] The formulation or composition may also contain more than one active ingredient useful for the particular indication, disease, or condition being treated with the binding molecules or cells, preferably those with activities complementary to the binding molecule or cell, where the respective activities do not adversely affect one another. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended. Thus, in some embodiments, the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. In some embodiments, the pharmaceutically active agents or drugs may comprise immune checkpoint inhibitors, e.g., drugs that target PD-1, PD-L1, PD-L2, LAG3, CTLA4, KIR, CD244, B7-H3, B7-H4, BTLA, HVEM, GAL9, TIM3, and/or A2aR. Examples of these inhibitors include, but are not limited to, pidilizumab, nivolumab, pembrolizumab, atezolizumab, MDX-1105, BMS-936559, MED14736, MPDL3280A, MSB0010718C, tremelimumab, and ipilimumab, which may be administered alone or in combination with other agents, e.g., GM-CSF.
[0309] The pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. Many types of release delivery systems are available and known. Such systems can avoid repeated administrations of the composition, thereby increasing convenience to the subject and the physician.
Dosing
[0310] The pharmaceutical composition in some embodiments contains the anti-TIM-1 CAR cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactically effective amount. Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and can be determined. The desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
[0311] In certain embodiments, in the context of genetically engineered cells expressing the CARs, a subject is administered the range of about one million to about 100 billion cells, such as, e.g., 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), and in some cases about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells) or any value in between these ranges, and/or such a number of cells per kilogram of body weight of the subject. For example, in some embodiments the administration of the cells or population of cells can comprise administration of about 10.sup.3 to about 10.sup.9 cells per kg body weight including all integer values of cell numbers within those ranges.
[0312] The cells or population of cells can be administrated in one or more doses. In some embodiments, said effective amount of cells can be administrated as a single dose. In some embodiments, said effective amount of cells can be administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions within the skill of the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired. In some embodiments, an effective amount of cells or composition comprising those cells are administrated parenterally. In some embodiments, administration can be an intravenous administration. In some embodiments, administration can be directly done by injection within a tumor.
[0313] For purposes of the invention, the amount or dose of the inventive CAR material administered should be sufficient to effect a therapeutic or prophylactic response in the subject or animal over a reasonable time frame. For example, the dose of the inventive CAR material should be sufficient to bind to antigen, or detect, treat or prevent disease in a period of from about 2 hours or longer, e.g., about 12 to about 24 or more hours, from the time of administration. In certain embodiments, the time period could be even longer. The dose will be determined by the efficacy of the particular inventive CAR material and the condition of the animal (e.g., human), as well as the body weight of the animal (e.g., human) to be treated.
[0314] For purposes of the invention, an assay, which comprises, for example, comparing the extent to which target cells are lysed or IFN- is secreted by T cells expressing the inventive CAR, polypeptide, or protein upon administration of a given dose of such T cells to a mammal, among a set of mammals of which is each given a different dose of the T cells, could be used to determine a starting dose to be administered to a mammal. The extent to which target cells are lysed or IFN- is secreted upon administration of a certain dose can be assayed by methods known in the art.
[0315] In some embodiments, the cells are administered as part of a combination treatment, such as simultaneously with or sequentially with, in any order, another therapeutic intervention, such as an antibody or engineered cell or receptor or agent, such as a cytotoxic or therapeutic agent. The cells or antibodies in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order. In some contexts, the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa. In some embodiments, the cells or antibodies are administered prior to the one or more additional therapeutic agents. In some embodiments, the cells or antibodies are administered after to the one or more additional therapeutic agents.
[0316] In embodiments, a lymphodepleting chemotherapy is administered to the subject prior to, concurrently with, or after administration (e.g., infusion) of CAR cells. In an example, the lymphodepleting chemotherapy is administered to the subject prior to administration of the cells. For example, the lymphodepleting chemotherapy ends 1-4 days (e.g., 1, 2, 3, or 4 days) prior to CAR cell infusion. In embodiments, multiple doses of CAR cells are administered, e.g., as described herein. In embodiments, a lymphodepleting chemotherapy is administered to the subject prior to, concurrently with, or after administration (e.g., infusion) of a CAR-expressing cell described herein. Examples of lymphodepletion include, but may not be limited to, nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, total body irradiation, etc. Examples of lymphodepleting agents include, but are not limited to, antithymocyte globulin, anti-CD3 antibodies, anti-CD4 antibodies, anti-CD8 antibodies, anti-CD52 antibodies, anti-CD2 antibodies, TCR blockers, anti-CD20 antibodies, anti-CD19 antibodies, Bortezomib, rituximab, anti-CD 154 antibodies, rapamycin, CD3 immunotoxin, fludarabine, cyclophosphamide, busulfan, melphalan, Mabthera, Tacrolimus, alefacept, alemtuzumab, OKT3, OKT4, OKT8, OKT11, fingolimod, anti-CD40 antibodies, anti-BR3 antibodies, Campath-1H, anti-CD25 antibodies, calcineurin inhibitors, mycophenolate, and steroids, which may be used alone or in combination.
Variations
[0317] Included in the scope of the invention are functional portions of the inventive CARs described herein. The term functional portion when used in reference to a CAR refers to any part or fragment of the CAR of the invention, which part or fragment retains the biological activity of the CAR of which it is a part (the parent CAR). Functional portions encompass, for example, those parts of a CAR that retain the ability to recognize target cells, or detect, treat, or prevent a disease, to a similar extent, the same extent, or to a higher extent, as the parent CAR. In reference to the parent CAR, the functional portion can comprise, for instance, about 10%, 25%, 30%, 50%, 68%, 80%, 90%, 95%, or more, of the parent CAR.
[0318] The functional portion can comprise additional amino acids at the amino or carboxy terminus of the portion, or at both termini, which additional amino acids are not found in the amino acid sequence of the parent CAR. Desirably, the additional amino acids do not interfere with the biological function of the functional portion, e.g., recognize target cells, detect cancer, treat or prevent cancer, etc. More desirably, the additional amino acids enhance the biological activity, as compared to the biological activity of the parent CAR.
[0319] Included in the scope of the invention are functional variants of the inventive CARs described herein. The term functional variant as used herein refers to a CAR, polypeptide, or protein having substantial or significant sequence identity or similarity to a parent CAR, which functional variant retains the biological activity of the CAR of which it is a variant. Functional variants encompass, for example, those variants of the CAR described herein (the parent CAR) that retain the ability to recognize target cells to a similar extent, the same extent, or to a higher extent, as the parent CAR. In reference to the parent CAR, the functional variant can, for instance, be at least about 30%, 50%, 75%, 80%, 90%, 98% or more identical in amino acid sequence to the parent CAR.
[0320] A functional variant can, for example, comprise the amino acid sequence of the parent CAR with at least one conservative amino acid substitution. Alternatively or additionally, the functional variants can comprise the amino acid sequence of the parent CAR with at least one non-conservative amino acid substitution. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with or inhibit the biological activity of the functional variant. The non-conservative amino acid substitution may enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the parent CAR.
[0321] Amino acid substitutions of the inventive CARs are preferably conservative amino acid substitutions. Conservative amino acid substitutions are known in the art, and include amino acid substitutions in which one amino acid having certain physical and/or chemical properties is exchanged for another amino acid that has the same or similar chemical or physical properties. For instance, the conservative amino acid substitution can be an acidic/negatively charged polar amino acid substituted for another acidic/negatively charged polar amino acid (e.g., Asp or Glu), an amino acid with a nonpolar side chain substituted for another amino acid with a nonpolar side chain (e.g., Ala, Gly, Val, lie, Leu, Met, Phe, Pro, Trp, Cys, Val, etc.), a basic/positively charged polar amino acid substituted for another basic/positively charged polar amino acid (e.g. Lys, His, Arg, etc.), an uncharged amino acid with a polar side chain substituted for another uncharged amino acid with a polar side chain (e.g., Asn, Gin, Ser, Thr, Tyr, etc.), an amino acid with a beta-branched side-chain substituted for another amino acid with a beta-branched side-chain (e.g., Ile, Thr, and Val), an amino acid with an aromatic side-chain substituted for another amino acid with an aromatic side chain (e.g., His, Phe, Trp, and Tyr), etc.
[0322] Also, amino acids may be added or removed from the sequence based on vector design.
[0323] The CAR can consist essentially of the specified amino acid sequence or sequences described herein, such that other components, e.g., other amino acids, do not materially change the biological activity of the functional variant.
[0324] The CARs of embodiments of the invention (including functional portions and functional variants) can be of any length, i.e., can comprise any number of amino acids, provided that the CARs (or functional portions or functional variants thereof) retain their biological activity, e.g., the ability to specifically bind to antigen, detect diseased cells in a mammal, or treat or prevent disease in a mammal, etc. For example, the CAR can be about 50 to about 5000 amino acids long, such as 50, 70, 75, 100, 125, 150, 175, 200, 300, 400, 500, 600, 700, 800, 900, 1000 or more amino acids in length.
[0325] The CARs of embodiments of the invention (including functional portions and functional variants of the invention) can comprise synthetic amino acids in place of one or more naturally-occurring amino acids. Such synthetic amino acids are known in the art, and include, for example, aminocyclohexane carboxylic acid, norleucine, -amino n-decanoic acid, homoserine, S-acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4-aminophenylalanine, 4-nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, -phenylserine -hydroxyphenylalanine, phenylglycine, -naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, aminomalonic acid, aminomalonic acid monoamide, N-benzyl-N-methyl-lysine, N,N-dibenzyl-lysine, 6-hydroxylysine, ornithine, -aminocyclopentane carboxylic acid, -aminocyclohexane carboxylic acid, -aminocycloheptane carboxylic acid, -(2-amino-2-norbornane)-carboxylic acid, ,-diaminobutyric acid, ,-diaminopropionic acid, homophenylalanine, and -tert-butylglycine.
[0326] The CARs of embodiments of the invention (including functional portions and functional variants) can be glycosylated, amidated, carboxylated, phosphorylated, esterified, N-acylated, cyclized via, e.g., a disulfide bridge, or converted into an acid addition salt and/or optionally dimerized or polymerized, or conjugated.
[0327] The CARs of embodiments of the invention (including functional portions and functional variants thereof) can be obtained by methods known in the art. The CARs may be made by any suitable method of making polypeptides or proteins. Suitable methods of de novo synthesizing polypeptides and proteins are described in references, such as Chan et al., Fmoc Solid Phase Peptide Synthesis, Oxford University Press, Oxford, United Kingdom, 2000; Peptide and Protein Drug Analysis, ed. Reid, R., Marcel Dekker, Inc., 2000; Epitope Mapping, ed. Westwood et al., Oxford University Press, Oxford, United Kingdom, 2001; and U.S. Pat. No. 5,449,752. Also, polypeptides and proteins can be recombinantly produced using the nucleic acids described herein using standard recombinant methods. See, for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, 3rd ed., Cold Spring Harbor Press, Cold Spring Harbor, N.Y. 2001; and Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing Associates and John Wiley & Sons, N Y, 1994. Further, some of the CARs of the invention (including functional portions and functional variants thereof) can be isolated and/or purified from a source, such as a plant, a bacterium, an insect, a mammal, e.g., a rat, a human, etc. Methods of isolation and purification are well-known in the art. Alternatively, the CARs described herein (including functional portions and functional variants thereof) can be commercially synthesized by companies. In this respect, the inventive CARs can be synthetic, recombinant, isolated, and/or purified.
Definitions
[0328] The term 4-1 BB or BB refers to a member of the TNFR superfamily with an amino acid sequence provided as GenBank Acc. No. AAA53133.1, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like. In one aspect, the 4-1BB costimulatory domain is the sequence provided as SEQ ID NO: 216 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
[0329] As used herein, a 5 cap (also termed an RNA cap, an RNA 7-methylguanosine cap or an RNA m.sup.7G cap) is a modified guanine nucleotide that has been added to the front or 5 end of a eukaryotic messenger RNA shortly after the start of transcription. The 5 cap consists of a terminal group which is linked to the first transcribed nucleotide. Its presence is critical for recognition by the ribosome and protection from RNases. Cap addition is coupled to transcription, and occurs co-transcriptionally, such that each influences the other. Shortly after the start of transcription, the 5 end of the mRNA being synthesized is bound by a cap-synthesizing complex associated with RNA polymerase. This enzymatic complex catalyzes the chemical reactions that are required for mRNA capping. Synthesis proceeds as a multi-step biochemical reaction. The capping moiety can be modified to modulate functionality of mRNA such as its stability or efficiency of translation.
The term allogeneic or donor-derived refers to any material derived from a different animal of the same species as the individual to whom the material is introduced. Two or more individuals are said to be allogeneic to one another when the genes at one or more loci are not identical. In some aspects, allogeneic material from individuals of the same species may be sufficiently unlike genetically to interact antigenically.
The term anti-tumor cytotoxicity generally refers to any cytocidal activity resulting from the exposure of the CARs of the invention or cells comprising the same to target tumor cells. This activity may be measured by known cytotoxicity assays, including IFN- production assays.
The term antibody, as used herein, refers to an immunoglobulin molecule which specifically binds with an antigen. In one aspect, the antigen is TIM-1. Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoreactive portions of intact immunoglobulins. The term is used in the broadest sense and includes polyclonal and monoclonal antibodies, including intact antibodies and functional (antigen-binding) antibody fragments, including fragment antigen-binding (Fab) fragments, F(ab).sub.2 fragments, Fab fragments, Fv fragments, recombinant IgG (rIgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), diabodies, and single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments. The term encompasses genetically engineered and/or otherwise modified forms of immunoglobulins, such as intrabodies, peptibodies, chimeric antibodies, fully human antibodies, humanized antibodies, and heteroconjugate antibodies, multispecific, e.g., bispecific, antibodies, diabodies, triabodies, and tetrabodies, tandem di-scFv, tandem tri-scFv. Unless otherwise stated, the term antibody should be understood to encompass functional antibody fragments thereof. The term also encompasses intact or full-length antibodies, including antibodies of any class or sub-class, including IgG and sub-classes thereof, IgM, IgE, IgA, and IgD.
The term antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody. Examples of antibody fragments include, but are not limited to, fragment antigen-binding (Fab) fragments, F(ab).sub.2 fragments, Fab fragments, Fv fragments, recombinant IgG (rIgG) fragments, single chain antibody fragments, including single chain variable fragments (scFv), single domain antibodies (e.g., sdAb, sdFv, nanobody) fragments, diabodies, and multispecific antibodies formed from antibody fragments. In a specific embodiment, the antibody fragment is an scFv.
An antibody heavy chain, as used herein, refers to the larger of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations.
An antibody light chain, as used herein, refers to the smaller of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations. Kappa and lambda light chains refer to the two major antibody light chain isotypes.
The term antigen or Ag refers to a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an antigen as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to encode polypeptides that elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a gene at all. It is readily apparent that an antigen can be generated, synthesized, or can be derived from a biological sample, or might be macromolecule besides a polypeptide. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a fluid with other biological components. In one aspect, the antigen is TIM-1.
The term antigen-binding domain refers to one or more extracellular domains of the chimeric antigen receptor which have specificity for a particular antigen.
The term apheresis as used herein refers to the art-recognized extracorporeal process by which the blood of a donor or patient is removed from the donor or patient and passed through an apparatus that separates out selected particular constituent(s) and returns the remainder to the circulation of the donor or patient, e.g., by retransfusion. Thus, in the context of an apheresis sample refers to a sample obtained using apheresis.
The term autologous refers to any material derived from the same individual to whom it is later to be re-introduced.
The term bind refers to an attractive interaction between two molecules that results in a stable association in which the molecules are in close proximity to each other. The result of molecular binding is sometimes the formation of a molecular complex in which the attractive forces holding the components together are generally non-covalent, and thus are normally energetically weaker than covalent bonds.
The term cancer refers to a disease characterized by the uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers are described herein and include, but are not limited to ovarian cancer, renal cancer, lung cancer, breast cancer, prostate cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, liver cancer, brain cancer, lymphoma, leukemia, and the like.
The term CD28 refers to the protein Cluster of Differentiation 28, one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival. The protein may have at least 85, 90, 95, 96, 97, 98, 99 or 100% identity to NCBI Reference No: NP_006130 or a fragment thereof that has stimulatory activity.
The term CD3 or alternatively, zeta, zeta chain, CD3-zeta or TCR-zeta is defined as the protein provided as GenBan Acc. No. BAG36664.1, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like, and a CD3 intracellular signaling domain or alternatively a zeta intracellular signaling domain or a TCR-zeta intracellular signaling domain is defined as the amino acid residues from the cytoplasmic domain of the CD3 chain, or functional derivatives thereof, that are sufficient to functionally transmit an initial signal necessary for T cell activation. In one aspect, a CD3 intracellular signaling domain is the sequence provided as SEQ ID NO: 219.
The term Chimeric Antigen Receptor or alternatively a CAR refers to a set of polypeptides, typically two in the simplest embodiments, which when in an immune effector cell, provides the cell with specificity for a target cell, typically a cancer cell, and with intracellular signal generation. In some embodiments, a CAR comprises at least an extracellular antigen-binding domain, a transmembrane domain and a cytoplasmic signaling domain (also referred to herein as an intracellular signaling domain) comprising a functional signaling domain derived from a stimulatory molecule and/or costimulatory molecule as defined below. In some aspects, the set of polypeptides are contiguous with each other. In some embodiments, the set of polypeptides include a dimerization switch that, upon the presence of a dimerization molecule, can couple the polypeptides to one another, e.g., can couple an antigen-binding domain to an intracellular signaling domain. In one aspect, the stimulatory molecule is the zeta chain associated with the T cell receptor complex. In one aspect, the cytoplasmic signaling domain further comprises one or more functional signaling domains derived from at least one costimulatory molecule as defined below. In one aspect, the costimulatory molecule is chosen from the costimulatory molecules described herein, e.g., 4-1 BB (i.e., CD137), DAP10 and/or CD28. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen-binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a stimulatory molecule. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen-binding domain, a transmembrane domain and an intracellular signaling domain comprising a functional signaling domain derived from a costimulatory molecule and a functional signaling domain derived from a stimulatory molecule. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen-binding domain, a transmembrane domain and an intracellular signaling domain comprising two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule. In one aspect, the CAR comprises a chimeric fusion protein comprising an extracellular antigen-binding domain, a transmembrane domain and an intracellular signaling domain comprising at least two functional signaling domains derived from one or more costimulatory molecule(s) and a functional signaling domain derived from a stimulatory molecule. In one aspect the CAR comprises an optional leader sequence at the amino-terminus (N-ter) of the CAR fusion protein. In one aspect, the CAR further comprises a leader sequence at the N-terminus of the extracellular antigen-binding domain, wherein the leader sequence is optionally cleaved from the antigen-binding domain (e.g., an scFv) during cellular processing and localization of the CAR to the cellular membrane.
The term compete, as used herein with regard to an antibody, means that a first antibody, or an antigen-binding fragment (or portion) thereof, binds to an epitope in a manner sufficiently similar to the binding of a second antibody, or an antigen-binding portion thereof, such that the result of binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody. The alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody, can, but need not be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope. However, where each antibody detectably inhibits the binding of the other antibody with its cognate epitope or ligand, whether to the same, greater, or lesser extent, the antibodies are said to cross-compete with each other for binding of their respective epitope(s). Both competing and cross-competing antibodies are encompassed by the invention. Regardless of the mechanism by which such competition or cross-competition occurs (e.g., steric hindrance, conformational change, or binding to a common epitope, or portion thereof), the skilled artisan would appreciate, based upon the teachings provided herein, that such competing and/or cross-competing antibodies are encompassed and can be useful for the methods disclosed herein.
The terms complementarity determining region, and CDR, synonymous with hypervariable region or HVR, are known in the art to refer to non-contiguous sequences of amino acids within antibody variable regions, which confer antigen specificity and/or binding affinity. In general, there are three CDRs in each heavy chain variable region (CDR-H1, CDR-H2, CDR-H3) and three CDRs in each light chain variable region (CDR-L1, CDR-L2, CDR-L3). Framework regions and FR are known in the art to refer to the non-CDR portions of the variable regions of the heavy and light chains. In general, there are four FRs in each full-length heavy chain variable region (FR-H1, FR-H2, FR-H3, and FR-H4), and four FRs in each full-length light chain variable region (FR-L1, FR-L2, FR-L3, and FR-L4).
The term costimulatory molecule refers to a cognate binding partner on a T cell that specifically binds with a costimulatory ligand, thereby mediating a costimulatory response by the T cell, such as, but not limited to, proliferation. Costimulatory molecules are cell surface molecules other than antigen receptors or their ligands that are contribute to an efficient immune response. Costimulatory molecules include, but are not limited to a protein selected from the group consisting of an MHC class I molecule, TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), activating NK cell receptors, a Toll ligand receptor, B7-H3, BAFFR, BTLA, BLAME (SLAMF8), CD2, CD4, CD5, CD7, CD8alpha, CD8beta, CD11a, LFA-1 (CD11a/CD18), CD11b, CD11c, CD11d, CD18, CD19, CD19a, CD27, CD28, CD29, CD30, CD40, CD49a, CD49D, CD49f, CD69, CD84, CD96 (Tactile), CD100 (SEMA4D), CD103, OX40 (CD134), 4-1BB (CD137), SLAM (SLAMF1, CD150, IPO-3), CD160 (BY55), SELPLG (CD162), DNAM1 (CD226), Ly9 (CD229), SLAMF4 (CD244, 2B4), ICOS (CD278), CEACAM1, CDS, CRTAM, DAP10, GADS, GITR, HVEM (LIGHTR), IA4, ICAM-1, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, ITGA6, ITGAD, ITGAE, ITGAL, ITGAM, ITGAX, ITGB1, ITGB2, ITGB7, KIRDS2, LAT, LFA-1, LIGHT, LTBR, NKG2C, NKG2D, NKp30, NKp44, NKp46, NKp80 (KLRF1), PAG/Cbp, PD-1. PSGL1, SLAMF6 (NTB-A, Ly108), SLAMF7, SLP-76, TNFR2, TRANCE/RANKL, VLA1, VLA-6, and a ligand that specifically binds with CD83. In embodiments, the encoded costimulatory domain comprises 4-1BB, CD28, or DAP10. In one embodiment, the costimulatory domain comprises the amino acid sequence of BBCYP, CD28CYP, or DAP10CYP (SEQ ID NO: 216, 217, or 218), or nucleotide sequence encoding such (SEQ ID NO: 266, 267, or 268).
The term cytokines refers to a broad category of small proteins that are involved in cell signaling. Generally, their release has some effect on the behavior of cells around them. Cytokines may be involved in autocrine signalling, paracrine signalling and/or endocrine signalling as immunomodulating agents. Cytokines include chemokines, interferons, interleukins, lymphokines, and tumour necrosis factors. Cytokines are produced by a broad range of cells, including immune cells like macrophages, B lymphocytes, T lymphocytes and mast cells, as well as endothelial cells, fibroblasts, and various stromal cells. Chemokines are a family of cytokines generally involved in mediating chemotaxis.
The term DAP10 refers to a protein, which in humans is encoded by the HSCT gene. It may also be referred to as HCST, KAP10, PIK3AP, or hematopoietic cell signal transducer. In some embodiments, DAP10 may have the sequence provided in Genbank Accession No.: Q9UBK5.1.
The phrase disease associated with expression of TIM-1 includes, but is not limited to, a disease associated with expression of TIM-1 or condition associated with cells which express TIM-1 including, e.g., proliferative diseases such as a cancer or malignancy or a precancerous condition; or a noncancer related indication associated with cells which express TIM-1. Noncancer-related indications associated with TIM-1 include hepatitis A virus, Ebola virus, Dengue virus, atopic dermatitis, allergy, rheumatoid arthritis, asthma, systemic lupus erythematosus, and immune dysfunction. Examples of various cancers that express TIM-1 include but are not limited to, ovarian cancer, renal cancer, lung cancer, and the like.
An effective amount or an amount effective to treat refers to a dose that is adequate to prevent or treat a disease, condition, or disorder in an individual. Amounts effective for a therapeutic or prophylactic use will depend on, for example, the stage and severity of the disease or disorder being treated, the age, weight, and general state of health of the patient, and the judgment of the prescribing physician. The size of the dose will also be determined by the active selected, method of administration, timing and frequency of administration, the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular active, and the desired physiological effect. It will be appreciated by one of skill in the art that various diseases or disorders could require prolonged treatment involving multiple administrations, perhaps using the inventive CAR materials in each or various rounds of administration.
The term hinge, spacer, or linker refers to an amino acid sequence of variable length typically encoded between two or more domains of a polypeptide construct to confer flexibility, improved spatial organization, proximity, etc.
As used herein, human antibody means an antibody having an amino acid sequence corresponding to that of an antibody produced by a human and/or which has been made using any of the techniques for making human antibodies known to those skilled in the art or disclosed herein. This definition of a human antibody includes antibodies comprising at least one human heavy chain polypeptide or at least one human light chain polypeptide. One such example is an antibody comprising murine light chain and human heavy chain polypeptides. Human antibodies can be produced using various techniques known in the art. In one embodiment, the human antibody is selected from a phage library, where that phage library expresses human antibodies (Vaughan et al., Nature Biotechnology, 14:309-314, 1996; Sheets et al., Proc. Natl. Acad. Sci. (USA) 95:6157-6162, 1998; Hoogenboom and Winter, J. Mol. Biol., 227:381, 1991; Marks et al., J. Mol. Biol., 222:581, 1991). Human antibodies can also be made by immunization of animals into which human immunoglobulin loci have been transgenically introduced in place of the endogenous loci, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. This approach is described in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016. Alternatively, the human antibody may be prepared by immortalizing human B lymphocytes that produce an antibody directed against a target antigen (such B lymphocytes may be recovered from an individual or from single cell cloning of the cDNA, or may have been immunized in vitro). See, e.g., Cole et al. Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77, 1985; Boerner et al., J. Immunol., 147 (1):86-95, 1991; and U.S. Pat. No. 5,750,373.
An iCAR is a chimeric antigen receptor which contains inhibitory receptor signaling domains. These domains may be based, for example, on protectin D1 (PD1) or CTLA-4 (CD 152). In some embodiments, the CAR expressing cells of the invention are further transduced to express an iCAR. In one aspect, this iCAR is added to restrict the CAR expressing cell's functional activity to tumor cells.
As used herein, immune cell refers to a cell of hematopoietic origin functionally involved in the initiation and/or execution of innate and/or adaptive immune response.
An intracellular signaling domain, as the term is used herein, refers to an intracellular portion of a molecule. The intracellular signaling domain generates a signal that promotes an immune effector function of the cell transduced with a nucleic acid sequence comprising a CAR, e.g., a CAR T cell. Examples of immune effector function, e.g., in a CAR T cell, include cytolytic activity and helper activity, including the secretion of cytokines. Intracellular signaling domains include an intracellular signaling domain of a lymphocyte receptor chain, a TCR/CD3 complex protein, an Fc receptor subunit, an IL-2 receptor subunit, CD3, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, CD66d, CD278(ICOS), FcRI, DAP10, and DAP12.
An isolated biological component (such as an isolated chimeric antigen receptor or cell or vector or protein or nucleic acid) refers to a component that has been substantially separated or purified away from its environment or other biological components in the cell of the organism in which the component naturally occurs, for instance, other chromosomal and extra-chromosomal DNA and RNA, proteins, and organelles. Nucleic acids and proteins that have been isolated include nucleic acids and proteins purified by standard purification methods. The term also embraces nucleic acids and proteins prepared by recombinant technology as well as chemical synthesis. An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
The term linker as used in the context of an scFv refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link variable heavy and variable light chain regions together. In one embodiment, the flexible polypeptide linker is a Gly/Ser linker and comprises one or more repeats of the amino acid sequence Gly-Gly-Gly-Gly-Ser (SEQ ID NO:200). In one embodiment, the flexible polypeptide linker includes, but is not limited to, (Gly.sub.4Ser).sub.3 (SEQ ID NO: 201).
The term masked CAR refers to a CAR expressing cell that further comprises a masking peptide. This masking peptide may prevent off-target cell killing. The masking peptide is often N-terminal to the CAR construct and may block the cell's ability to bind to unintended targets. The masking peptide may be cleaved from the CAR expressing cell when it encounters a tumor thereby allowing the CAR expressing cell to attack its target without killing off-target cells.
The term nucleic acid and polynucleotide refer to RNA or DNA that is linear or branched, single or double stranded, or a hybrid thereof. The term also encompasses RNA/DNA hybrids. The following are non-limiting examples of polynucleotides: a gene or gene fragment, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs, uracil, other sugars and linking groups such as fluororibose and thiolate, and nucleotide branches. The sequence of nucleotides may be further modified after polymerization, such as by conjugation, with a labeling component. Other types of modifications included in this definition are caps, substitution of one or more of the naturally occurring nucleotides with an analog, and introduction of means for attaching the polynucleotide to proteins, metal ions, labeling components, other polynucleotides or solid support. The polynucleotides can be obtained by chemical synthesis or derived from a microorganism. The term gene is used broadly to refer to any segment of polynucleotide associated with a biological function. Thus, genes include introns and exons as in genomic sequence, or just the coding sequences as in cDNAs and/or the regulatory sequences required for their expression. For example, gene also refers to a nucleic acid fragment that expresses mRNA or functional RNA, or encodes a specific protein, and which includes regulatory sequences.
The term OKT3 or Muromonab-CD3 or Orthoclone OKT3 refers to a monoclonal anti-CD3 antibody.
A pharmaceutically acceptable carrier or excipient refers to compounds or materials conventionally used in immunogenic compositions during formulation and/or to permit storage.
The term promoter, as used herein, is defined as a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a polynucleotide sequence
The term recombinant means a polynucleotide with semisynthetic or synthetic origin which either does not occur in nature or is linked to another polynucleotide in an arrangement not found in nature.
The term scFv refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked, e.g., via a synthetic linker, e.g., a short flexible polypeptide linker, and capable of being expressed as a single chain polypeptide, and wherein the scFv retains the specificity of the intact antibody from which it is derived. Unless specified, as used herein an scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL. The linker may comprise portions of the framework sequences.
A signal peptide (also referred to as a signal sequence, targeting signal, localization signal, localization sequence, transit peptide, leader sequence or leader peptide) is a short peptide present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway. The core of the signal peptide may contain a long stretch of hydrophobic amino acids. The signal peptide may or may not be cleaved from the mature polypeptide.
The term signaling domain refers to the functional portion of a protein which acts by transmitting information within the cell to regulate cellular activity via defined signaling pathways by generating second messengers or functioning as effectors by responding to such messengers.
The term stimulatory molecule, refers to a molecule expressed by an immune cell (e.g., T cell, NK cell, B cell) that provides the cytoplasmic signaling sequence(s) that regulate activation of the immune cell in a stimulatory way for at least some aspect of the immune cell signaling pathway. In one aspect, the signal is a primary signal that is initiated by, for instance, binding of a TCR/CD3 complex with an MHC molecule loaded with peptide, and which leads to mediation of a T cell response, including, but not limited to, proliferation, activation, differentiation, and the like. A primary cytoplasmic signaling sequence (also referred to as a primary signaling domain) that acts in a stimulatory manner may contain a signaling motif which is known as an immunoreceptor tyrosine-based activation motif or ITAM. Examples of an ITAM containing cytoplasmic signaling sequence that are of particular use in the invention include, but are not limited to, those derived from CD3, common FcR gamma (FCER1G), Fc gamma RIIa, FcR beta (Fc Epsilon R1b), CD3, CD38, CD3e, CD79a, CD79b, DAP10, and DAP12. In a specific CAR of the invention, the intracellular signaling domain in any one or more CARS of the invention comprises an intracellular signaling sequence, e.g., a primary signaling sequence of CD3. In a specific CAR of the invention, the primary signaling sequence of CD3 is the amino acid sequence provided as SEQ ID NO: 219, or nucleotide sequence encoding such (SEQ ID NO:269), or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
The term subject is intended to include living organisms in which an immune response can be elicited (e.g., mammals, human).
By the term synthetic antibody as used herein, is meant an antibody which is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage as described herein. The term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.
The T2A ribosome skip sequence refers to an amino acid sequence that, when translated, causes cleavage of a nascent polyprotein on the ribosome, allowing for co-expression of multiple genes. In one aspect, the T2A ribosome skip sequence may comprise the amino acid sequence of SEQ ID NO: 231, or nucleotide sequence encoding such (SEQ ID NO: 281).
The term tCD19 refers to a truncated version of the CD19 protein, B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), which is a protein that in humans is encoded by the CD19 gene and is found on the surface of B-cells. The tCD19 construct is any truncated version of said protein, such that a nucleic acid sequence encoding this construct may be transduced into a host cell and expressed on the surface of this cell for the purposes of detection, selection, and/or targeting. In one aspect, tCD19 is the amino acid sequence of SEQ ID NO: 232, or nucleotide sequence encoding such (SEQ ID NO: 282).
The term TIM-1 refers to the T-cell immunoglobulin and mucin domain 1 protein that is encoded in humans by the HAVCR1 gene. TIM-1 is also known as HAVCR1, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1, CD365, and hepatitis A virus cellular receptor 1. TIM-1 has an amino acid sequence provided as GenBank Acc. No. AAC39862.1, or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like. In one aspect, TIM-1 is the sequence provided as SEQ ID NO: 315 or the equivalent residues from a non-human species, e.g., mouse, rodent, monkey, ape and the like.
The term transfected or transformed or transduced refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A transfected or transformed or transduced cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
By the term transmembrane domain, what is implied is any three-dimensional protein structure which is thermodynamically stable in a membrane. This may be a single alpha helix, a transmembrane beta barrel, a beta-helix of gramicidin A, or any other structure. Transmembrane helices are usually about 20 amino acids in length. Typically, the transmembrane domain denotes a single transmembrane alpha helix of a transmembrane protein, also known as an integral protein.
As used herein, the terms treat, treatment and treating refer to the reduction or amelioration of the progression, severity and/or duration of a proliferative disorder, or the amelioration of one or more symptoms (preferably, one or more discernible symptoms) of a proliferative disorder resulting from the administration of one or more therapies (e.g., one or more therapeutic agents such as a CAR of the invention). In specific embodiments, the terms treat, treatment and treating refer to the amelioration of at least one measurable physical parameter of a proliferative disorder, such as growth of a tumor, not necessarily discernible by the patient. In other embodiments the terms treat, treatment and treating-refer to the inhibition of the progression of a proliferative disorder, either physically by, e.g., stabilization of a discernible symptom, physiologically by, e.g., stabilization of a physical parameter, or both. In other embodiments the terms treat, treatment and treating refer to the reduction or stabilization of tumor size or cancerous cell count. Additionally, the terms treat, and prevent as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment or prevention. Rather, there are varying degrees of treatment or prevention of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. In this respect, the inventive methods can provide any amount of any level of treatment or prevention of cancer in a mammal. Furthermore, the treatment or prevention provided by the inventive method can include treatment or prevention of one or more conditions or symptoms of the disease, e.g., cancer, being treated or prevented. Also, for purposes herein, prevention can encompass delaying the onset of the disease, or a symptom or condition thereof.
The term xenogeneic refers to a graft derived from an animal of a different species.
[0330] The experimental details of these experiments are described in more detail in the following examples. These examples are offered to illustrate, but not to limit, the claimed invention.
EXAMPLES
Example 1: Design and Synthesis of Anti-TIM-1 CAR Variants
[0331] Anti-TIM-1 CARs were generated according to the general schematic of
[0332] The CAR structures were then further varied based on composition of the intracellular co-stimulatory domain, as depicted in
[0333] To facilitate the attainment of a high purity of transduced T cells, CAR variant constructs were designed to include a truncated CD19 (tCD19) marker sequence (residues 1-327 of CD19, or SEQ ID NO: 232) separated from the CAR construct by a T2A ribosomal skip element (SEQ ID NO: 231) (
[0334] Overall, the CAR variants that were designed and cloned (in frame) into retroviral vectors were as follows. Two variants based on the scFvs derived from Ab 1.29: 129L-CD28 and 129H-CD28. Four variants based on the scFv's derived from Ab 2.70.2: 272L-CD28; 272H-CD28; 272H-BB; and 272H-DAP10. And four variants based on the scFv's derived from Ab 2.59.2: 2592L-CD28; 2592H-CD28; 2592H-BB; and 2592H-DAP10. See Table 1. A number of these constructs were further synthesized with a T2A ribosomal skip sequence and a gene encoding for the expression of tCD19.
TABLE-US-00001 TABLE 1 Amino Nucleic acid acid Antigen- Trans- Co- Intracellular SEQ SEQ binding Hinge membrane stimulatory signaling ID ID Name domain domain domain domain domain NO NO 129H-CD28 129H CD28 H CD28 CD28 CYP CD3 CYP 220 270 scFv TM 129L-CD28 129L scFv CD28 H CD28 CD28 CYP CD3 CYP 221 271 TM 272H-BB 272H CD28 H CD28 4-1BB CD3 CYP 222 272 scFv TM CYP 272H-CD28 272H CD28 H CD28 CD28 CYP CD3 CYP 223 273 scFv TM 272H- 272H CD28 H CD28 DAP10 CD3 CYP 224 274 DAP10 scFv TM CYP 272L-CD28 272L scFv CD28 H CD28 CD28 CYP CD3 CYP 225 275 TM 2592H-BB 2592H CD28 H CD28 4-1BB CD3 CYP 226 276 scFv TM CYP 2592H- 2592H CD28 H CD28 CD28 CYP CD3 CYP 227 277 CD28 scFv TM 2592H- 2592H CD28 H CD28 DAP10 CD3 CYP 228 278 DAP10 scFv TM CYP 2592L- 2592L CD28 H CD28 CD28 CYP CD3 CYP 229 279 CD28 scFv TM
[0335] Vectors:
[0336] The aforementioned anti-TIM-1 constructs were cloned into either the retroviral vector pFB-neo (Stratagene. Palo Alto. Calif.) or pSFG. pSFG vectors have been used for similar retroviral transduction of T cells in clinical trials (Hollyman et al. J Immunother 2009; 32:169-180; Pule et al. Nat Med 2008; 14:1264-1270). pFB-neo DNA was digested with Sail and NotI restriction enzymes. Product of digestion was loaded onto agarose gels, and the digested band was cut out and purified using a gel extraction kit (Qiagen).
Example 2: Generation of Anti-TIM-1 CAR T-Cells
[0337] Cell Culturing and Retroviral Transduction:
[0338] The aforementioned retroviral stocks were used to transduce human T cells from healthy donors, using optimized methods (Cubillos-Ruiz et al. Oncotarget 2010; 1:329-33; Huarte et al. Blood 2008; 112:1259-1268; Stephen et al. Immunity 2014; 41:427-439), protocols, and resources previously developed at Celdara Medical.
[0339] For some of the variants, the cell culturing, retroviral transduction and purification scheme is summarized in
[0340] For in vivo assays, cells were cultured, transduced, harvested, purified and expanded as in
Example 3: In Vitro Functional Activity of Anti-TIM-1 CAR T-Cells
[0341] Anti-TIM-1 CAR T-Cell Production:
[0342] anti-TIM-1 CAR T-cells were produced as described in Example 2 and
[0343] IFN Induction Assay:
[0344] IFN induction reports on stimulatory and cytotoxic properties of anti-TIM-1 CAR variants in vitro, i.e., their ability to activate the CAR T-cell upon exposure to TIM-1 target cells. IFN is an important effector cytokine, and an increase in its production indicates whether CAR T cells have been stimulated, with it acting as a biomarker of effector cell:target cell engagement. Essentially, the presence of IFN only when CAR T cells are incubated with cells expressing the target TIM-1 protein is indicative of selective target engagement.
[0345] We co-cultured IGROV-1 cells and CAR T cell variants in triplicate, collected the supernatants at 24 h and measured IFN production by ELISA.
[0346] Several CAR T cell variants produced with the scFv sequences described in Example 1 were capable of stimulating the production of IFN when incubated with the TIM-1 ovarian cancer cell line IGROV-1 (
[0347] Similarly,
[0348] In Vitro Cytokine Production Assay:
[0349] Another parameter important for therapeutic effectiveness is the production of effector cytokines that influence the immunoenvironment in vivo. We co-cultured IGROV-1 cells and CAR T cell variants in triplicate, collected the supernatants at 24 h and measured cytokine production via Luminex. CAR T-cells were also co-cultured under the same conditions with A549 cells, Caki-1 cells, (additional TIM-1.sup.+ cancer cell lines) and EL-4 cells (TIM-1 control). In addition, to verify that TIM-1 binding was responsible for cytokine production, in one condition, CAR T cells were co-cultured with IGROV-1 cells in the presence of the full length antibody from which the scFv was derived. In each case, mock-transduced cells were used as a control. See results in
[0350] In vitro cytotoxicity assay: To determine the specificity of Anti-TIM-1 CAR T cells for TIM-1.sup.+ cells, the CAR T cell cytotoxic potential against TIM-1.sup.+ (IGROV-1 human ovarian cancer cells) and TIM-1.sup. cells (EL4 murine lymphoma cells) was determined using a standard cytotoxicity assay based on the release of lactate dehydrogenase. The IGROV-1 ovarian carcinoma cell line serves as a useful initial target population for these experiments (Bernard et al. Cancer Res 1985; 45:4970-4979), as IGROV-1 cells express the TIM-1 target antigen and serve as a model of ovarian clear cell carcinoma (Domcke et al. Nat Commun 2013; 4:2126).
[0351] In each well, 10.sup.4 IGROV-1 cells were plated and co-cultured with effector T cells expressing the different anti-TIM-1 CAR variants at ratios of 1:1 (effector cells: target cells), 5:1, 10:1 and 20:1. Several control conditions were also carried out, including: media only; CAR T cells only (effector spontaneous release); IGROV-1 cells only (target spontaneous release); and maximum IGROV-1 toxicity (cells treated with Triton-X 100). Twenty-two hours after plating the cells in co-culture, the co-cultures were centrifuged and the supernatants, collected. The assay reagent was added (containing diaphorase and the INT substrate intermediate) and the reaction was allowed to proceed. At the end of the incubation, a stop solution was added and sample absorbance determined. The corrected absorbance values from the experimental samples performed in triplicate were used to calculate a percent cytotoxicity based on the total lysis control, as described above.
[0352]
[0353] For this purpose, OVCAR-5 ovarian carcinoma cells could also be used, as they express the TIM-1 target antigen and have been shown to be responsive to anti-TIM-1 antibodies, as well (U.S. Pat. No. 8,067,544).
Example 4: In Vivo TIM-1 CAR T Antitumor Activity in Murine IGROV-1 Tumor Model
[0354] Mice:
[0355] SCID-beige female, 6 weeks (See Table 2).
TABLE-US-00002 TABLE 2 Group 2: Group 1: Mock Group 3: Group 4: Group 5: saline CAR-T 2592H_tCD19 2592L_tCD19 272H_tCD19 sb-118 sb-123 sb-133 sb-143 sb-153 sb-119 sb-124 sb-134 sb-144 sb-154 sb-120 sb-125 sb-135 sb-145 sb-155 sb-121 sb-126 sb-136 sb-146 sb-156 sb-122 sb-127 sb-137 sb-147 sb-157 sb-128 sb-138 sb-148 sb-158 sb-129 sb-139 sb-149 sb-159 sb-130 sb-140 sb-150 sb-160 sb-131 sb-141 sb-151 sb-161 sb-132 sb-142 sb-152 sb-162
[0356] IGROV-1 Cell Preparation:
[0357] IGROV-1 cells were thawed. Cells were passed one day before inoculation. Cells were harvested, washed once with RPMI, and then made into 5010.sup.6/ml cell suspensions in RPMI without supplements. IGROV-1 cells were prepared using trypsin.
[0358] CAR T Cell Preparation:
[0359] Anti-TIM-1 CAR T cells were produced via retroviral transduction of anti-TIM-1 CAR constructs into PBMCs (healthy human volunteer); anti-TIM-1 positive cells were enriched via purification (CD3.sup.+/CD19t.sup.+) and further prepared according to
[0360] CAR T cells were thawed, counted and checked for viability instantly. Vials were removed from liquid N2 storage and placed on dry ice. Vials were then warmed in a 37 C. water bath until a small ice crystal remained. At that point, 1 mL of warmed RPMI was added dropwise with swirling. 2 mL of mix was removed from vial and placed into 15 mL conical. 4 mL of warmed RPMI was then added to 15 mL conical. Tubes were centrifuged at 1000 rpm for 5 min at 10 C. Cells were resuspended in 1 mL RPMI and then counted twice and viability analyzed. Tubes were placed on ice when not in use.
[0361] CAR T cell suspensions were made at 7510.sup.6/ml in RPMI without supplements.
[0362] Cell Administration:
[0363] On day 0, mice were inoculated in the right flank with 2.510.sup.6 IGROV-1 cells+7.510.sup.6 CAR T cells in 150 l RPMI. For each group, 1 volume of IGROV-1 preparation was added to 2 volumes of CAR-T preparation based on CAR-T counts. CAR-T/IGROV mixes were left on ice during injections. Cells injections began immediately after cell preparation and took approximately 1 hr to complete.
[0364] 1 volume of IGROV-1 cell suspension for group 1 (50 l injected);
[0365] 1 volume of IGROV-1 cell suspension+2 volume of Mock CAR-T for group 2;
[0366] 1 volume of IGROV-1 cell suspension+2 volume of 2592H_tCD19 for group 3;
[0367] 1 volume of IGROV-1 cell suspension+2 volume of 2592L_tCD19 for group 4;
[0368] 1 volume of IGROV-1 cell suspension+2 volume of 272H_tCD19 for group 5;
[0369] Results:
[0370] Tumor size was measured twice a week. A general health check was performed on a daily basis and date of death was recorded for each mouse. Study was terminated on day 56. See
Example 5: Persistence of CAR T Cells in Tumor-Bearing Mice
[0371] An important parameter associated with both safety and potentially long-term protection is the persistence of CAR T cells that can respond on tumor recurrence (Song et al. Cancer Res 2011; 71:4617-4627). To measure persistence in vivo, first establish IGROV-1 cells (310.sup.6 cells) intraperitoneally in female NSG mice (3 mice/group). On day 10 post implantation, administer 0.510.sup.7 anti-TIM-1 CAR T cells intraperitoneally. Determine the presence of CAR T cells at days 14 and 28 after adoptive transfer using Q-PCR specific to the CAR variant. Tissue compartments to be analyzed will include blood, tumor tissue, bone marrow and spleen. The amount of signal measured by Q-PCR will be used to estimate the relative number of CAR T cells present per tissue analyzed and provide a means to compare the survival and proliferative potential of the two CAR variants.
Example 6: In Vivo TIM-1 CAR T Effect on Survival in Murine IGROV-1 Tumor Model
[0372] Mice:
[0373] SCID-beige female, 6 weeks (See Table 3).
TABLE-US-00003 TABLE 3 Group 1: Group 2: Group 3: saline Mock CAR-T 2592H_tCD19 sb-383 sb-388 sb-398 sb-384 sb-389 sb-399 sb-385 sb-390 sb-400 sb-386 sb-391 sb-401 sb-387 sb-392 sb-402 sb-393 sb-403 sb-394 sb-404 sb-395 sb-405 sb-396 sb-406 sb-397 sb-407
[0374] IGROV-Tumor Establishment:
[0375] IGROV-1 cells were thawed and passed one day before inoculation. On day 0, IGROV-1 cells were harvested using trypsin and washed once with RPMI, and each mouse shown in Table 3 was intraperitoneally inoculated with 2.510.sup.6 IGROV-1 cells in 200 L RPMI without supplements.
[0376] CAR T Cell Preparation:
[0377] Mock CAR T cells and anti-TIM-1 CAR T cells were produced by transducing PBMCs (from healthy human donor) with retroviruses generated using the mock CAR construct (pSFG._tCD19) or the anti-TIM-1 CAR construct (pSFG.CX272H_tCD19), respectively. Successfully transduced cells were purified, expanded, and frozen until use, according to
[0378] CAR T Cell Administration:
[0379] On each of days 2, 9, and 16, mock CAR T cells and anti-TIM-1 CAR T cells were thawed, counted, and checked for viability instantly. Viable cell suspensions were made with 37.510.sup.6 cells/ml in RPMI without supplements and kept on ice until administration into mice were complete (within about 1 h). Each mouse in Group 2 was intraperitoneally administered with 7.510.sup.6 mock CAR-T cells and each mouse in Group 3 was intraperitoneally administered with 7.510.sup.6 anti-TIM-1 CAR-T cells in 200 L RPMI without supplements. Each mouse in Group 1 was intraperitoneally administered with 200 L saline.
[0380] Results:
[0381] Mice were monitored and deaths were recorded on a daily basis. Mice were euthanized when adverse clinical signs, such as severe lethargy, hunched posture, or immobility, were observed. The graph in
[0382] Exemplary Sequences
TABLE-US-00004 i. 2592minimalbindingepitope2592epitope97Aminoacidsequenceof 2592minimalbindingepitope(2592epitope),SEQIDNO:97LRPQNH ii. LinkerregionsubunitG4S200AminoacidsequenceofLinkerregion subunit(G4S),SEQIDNO:200GGGGS iii. LinkerregionG4SLinker201AminoacidsequenceofLinkerregion (G4SLinker),SEQIDNO:201GGGGSGGGGSGGGGS iv. Ab129VH129VH202AminoacidsequenceofAb129VH(129VH), SEQIDNO:202QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGGYYWSWIRQPPGKGLEWIGFIYYT GSTNYNPSLKSRVSISVDTSKNQFSLKLSSVTAADAAVYYCARDYDWSFHFDYWGQGTLVTVSS v. Ab129VL129VL203AminoacidsequenceofAb129VL(129VL), SEQIDNO:203DIQMTQSPSSLSASIGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQS GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK vi. Ab272VH272VH204AminoacidsequenceofAb272VH(272VH), SEQIDNO:204QVQLVESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGS NKLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGLTVTVSS vii. Ab272VL272VL205AminoacidsequenceofAb272VL(272VL), SEQIDNO:205DIVMTQTPLSLPVTPGEPASISCRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYT LSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRVEFPITFGQGTRLEIK viii. Ab2592VH2592VH206AminoacidsequenceofAb2592VH(2592VH), SEQIDNO:206QVQLQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYS GSTFYNPSLKSRVAISVDTSKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSS ix. Ab2592VL2592VL207AminoacidsequenceofAb2592VL(2592VL), SEQIDNO:207EIVLTQSPDFQSVTPEKEVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFS GVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSNLPFTFGPGTKVDIK x. 129hv-linker-lv129H208Aminoacidsequenceof129hv-linker-lv (129H),SEQIDNO:208QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGGYYWSWIRQPPGKGLE WIGFIYYTGSTNYNPSLKSRVSISVDTSKNQFSLKLSSVTAADAAVYYCARDYDWSFHFDYWGQGTLVTVS SGGGGSGGGGSGGGGSDIQMTQSPSSLSASIGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQ SGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIK xi. 129lv-linker-hv129L209Aminoacidsequenceof129lv-linker-hv (129L),SEQIDNO:209DIQMTQSPSSLSASIGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLI YAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDFATYYCLQHNSYPLTFGGGTKVEIKGGGGSGGGGSGG GGSQVQLQESGPGLVKPSETLSLTCTVSGGSVSSGGYYWSWIRQPPGKGLEWIGFIYYTGSTNYNPSLKSR VSISVDTSKNQFSLKLSSVTAADAAVYYCARDYDWSFHFDYWGQGTLVTVSS xii. 272hv-linker-lv272H210Aminoacidsequenceof272hv-linker-lv (272H),SEQIDNO:210QVQLVESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWV AVIWYDGSNKLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYWWGQGTL VTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLPVTPGEPASISVRSSRSLLDSDDGNTYLDWYLQKPGQSPQ LLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQRVEFPITFGQGTRLEIK xiii. 272lv-linker-hv272L211Aminoacidsequenceof272lv-linker-hv (272L),SEQIDNO:211DIVMTQTPLSLPVTPGEPASISCRSSRSLLDSDDGNTYLDWYLQKPGQ SPQLLIYTLSYRASGVPDRFSGSGSGTDFLTKISRVEAEDVGVYYCMQRVEFPITFGQGTRLEIKGGGGSG GGGSGGGGSQVQLVESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYAD SVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSS xiv. 2529hv-linker-lv2592H212Aminoacidsequenceof2592hv-linker-lv (2592H),SEQIDNO:212QVQLQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGL EWIGYIYYSGSTFYNPSLKSRVAISVDTSKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGT LVTVSSGGGGSGGGGSGGGGSEIVLTQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKY ASQSFSGVPSRFSGSGSGTDFTLTINSLEADAATYYCHQSSNLPFTFGPGTKVDIK xv. 2592lv-linker-hv2592L213Aminoacidsequenceof2592lv-linker-hv (2592L),SEQIDNO:213EIVLTQSPSFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPLLI KYASQSFSGVPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKGGGGSGGGGSGG GGSQVQLQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSR VAISVDTSKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSS xvi. CD28hingedomainCD28H214AminoacidsequenceofCD28hingedomain (CD28H),SEQIDNO:214VKGKHLCPSPLFPGPSKP xvii. CD28transmembranedomainCD28TM215AminoacidsequenceofCD28 transmembranedomain(CD28TM),SEQIDNO:215FWVLVVVGGVLACYSLLVTVAFIIF WV xviii. 4-1BBcostimulatorydomainBBCYP216Aminoacidsequenceof4-1BB costimulatorydomain(BBCYP),SEQIDNO:216KRGRKKLLYIFKQPFMRPVQTTQEED GCSCRFPEEEEGGCEL xix. CD28costimulatorydomainCD28CYP217AminoacidsequenceofCD28 costimulatorydomain(CD28CYP),SEQIDNO:217SKRSRLLHSDYMNMTPRRPGPTRK HYQPYAPPRDFAAYRS xx. DAP10costimulatorydomainDAP10CYP218AminoacidsequenceofDAP10 costimulatorydomain(DAP10CYP),SEQIDNO:218LCARPRRSPAQEDGKVYINMPGR G xxi. CD3zeatintracellulardomainCD3CYP219Aminoacidsequenceof CD3zetaintracellulardomain(CD3CYP),SEQIDNO:219LRVKFSRSADAPAYQQ GQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPR xxii. 129H-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)129H-CD28220 Aminoacidsequenceof129H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(129H-CD28),SEQIDNO:220METPAQLLFLLLLWLPDTTGQVQLQ ESGPGLVKPSETLSLTCTVSGGSVSSGGYYWSWIRQPPGKGLEWIGFIYYTGSTNYNPSLKSRVSISVDTS KNQFSLKLSSVTAADAAVYYCARDYDWSFHFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLS ASIGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPEDF ATYYCLQHNSYPLTFGGGTKVEIKASVKGKHLCPSPLFPGPSKPFWLVLVVVGGVLACYSLLVTVAFIIFW VRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQLYNELNLG RREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR xxiii. 129L-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)129L-CD28221 Aminoacidsequenceof129L-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(129L-CD28),SEQIDNO:221METPAQLLFLLLLWLPDTTGDIQMT QSPSSLSASIGDRVTITVRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPSRFSGSGSGTEFTLTIS SLQPEDFATYYCLQHNSYPLTFGGGTKVEIKGGGGSGGGGSGGGGSQVQLQESGPGLVKPSETLSLTCTVS GGSVSSGGYYWSWIRQPPGKGLEWIGFIYYTGSTNYNPSLKSRVSISVDTSKNQFSLKLSSVTAADAAVYY CARDYDWSFHFDYWGQGTLVTVSSASVKGKHLCPSPLFPGPSKPFWLVLVVVGGVLACYSLLVTVAFIIFW VRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQLYNELNLG RREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTAT KDTYDALHMQALPPR xxiv. 272H-CD28H-CD28TM-BBCYP-CD3CYPCAR(includesleader)272H-BB222 Aminoacidsequenceof272H-CD28H-CD28TM-BBCYP-CD3CYPCAR (includesleader)(272H-BB),SEQIDNO:222METPAQLLFLLLLWLPDTTGQVQLVES GGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKNT LYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSL PVTPGEPASISVRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKIS RVEAEDVGVYYCMQRVEFPITFGQGTRLEIKLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTV AFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELKLRVKFSRSADAPAYQQGQNQL YNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR xxv. 272H-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)272H-CD28223 Aminoacidsequenceof272H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(272H-CD28),SEQIDNO:223METPAQLLFLLLLWLPDTTGQVQLV ESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSK NTLYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLS LPVTPGEPASISVRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKI SRVEAEDVYVYYCMQRVEFPITFGQGTRLEIKLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVT VAFIIFWVRSKRSRLLHSDYMNNTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQL YNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR xxvi. 272H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR(includesleader)272H-DAP10 224Aminoacidsequenceof272H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR (includesleader)(272H-DAP10),SEQIDNO:224METPAQLLFLLLLWLPDTTGQVQL VESGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNS KNTLYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTP LSLPVTPGEPASISVRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTL KISRVEAEDVGVYYCMQRVEFPITFGQGTRLEIKLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLL VTVAFIIFWVLCARPRRSPAQEDGKVYINMPGRGKLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVL DKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALH MQALPPR xxvii. 272L-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)272L-CD28225 Aminoacidsequenceof272L-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(272L-CD28),SEQIDNO:225METPQALLFLLLLWLPDTTGDIVMT QTPLSLPVTPGEPASISCRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTD FTLKISRVEAEDVGVYYCMQRVEFPITFGQGTRLEIKGGGGSGGGGSGGGGSQVQLVESGGGVVQPGRSLR LSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKNTLYLQMNSLRAED TAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSSLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLV TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQELGYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYDALHMQALPRR xxviii. 2592H-CD28H-CD28TM-BBCYP-CD3CYPCAR(includesleader)2592H-BB28226 Aminoacidsequenceof272H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(2592H-BB),SEQIDNO:226METPAQLLFLLLLWLPDTTGQVQLQE SGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRVAISVDTSK NQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPD FQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSKPKLLIHYASQSFSGVPSRFSGSGSGTDFTLTINSLE AEDAATYYCHQSSNLPFTFGPGTKVDIKASVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFI IFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELKLRVKFSRSADAPAYQQGQNQLYNE LNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPR xxix. 2592H-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)2592H-CD28 227Aminoacidsequenceof2592H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(2592H-CD28),SEQIDNO:227METPAQLLFLLLLWLPDTTGQVQL QESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRVAISVDT SKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQS PDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTINSL EAEDAATYYCHQSSNLPFTFGPGTKVDIKASVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAF IIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQLYNE LNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPR xxx. 2592H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR(includesleader)2592H-DAP10 228Aminoacidsequenceof2592H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR (includesleader)(2592H-DAP10),SEQIDNO:228METPAQLLFLLLLWLPDTTGQVQ LQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRVAISVD TSKNQFSLSGGGGSEIVLTQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSG VPSRFSGSGSGTDFTLTINSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKASVKGKHLCPSPLFPGPSKPF WVLVVVGGVLACYSLLVTVAFIIFWVLCARPRRSPAQEDGKVYINMPGRGKLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYDALHMQALPPR xxxi. 2592L-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)2592L-CD28 229Aminoacidsequenceof2592H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(2592L-CD28),SEQIDNO:229METPAQLLFLLLLWLPDTTGEIVL TQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTI NSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKGGGGSGGGGSGGGGSQVQLQESGPRLVKPSQTLSLTCTV SGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRVAISVDTSKNQFSLKLSSVTAADTAVY YCARESPHSSNWYSGFDCWGQGTLVTVSSASVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAF IIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQLYNE LNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGL STATKDTYDALHMQALPPR xxxii. signalpeptidesignal230Aminoacidsequenceofsignalpeptide (signal),SEQIDNO:230METPAQLLFLLLLWLPDTTG xxxiii. T2AribosomalskipsequenceT2A231AminoacidsequenceofT2A ribosomalskipsequence(T2A),SEQIDNO:231GSGEGRGSLLTCGDVEENPGP xxxiv. TruncatedCD19tCD19232AminoacidsequenceofTruncatedCD19(tCD19), SEQIDNO:232MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDVANLQCLKGTSDGPTQQLTWSRES PLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVWQQMGGFYLCQPGPPSEKAWGPGWTVNVEGSGELFRWNVS DLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWL SCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMS FHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRKRMT xxxv. Ab129CDRH1Ab129CDR1233AminoacidsequenceofAb129CDRH1 (Ab129CDR1),SEQIDNO:233GGSVSSGGYY xxxvi. Ab129CDRH2Ab129CDR2234AminoacidsequenceofAb129CDRH2 (Ab129CDR2),SEQIDNO:234IYYTGST xxxvii. Ab129CDRH3Ab129CDR3235AminoacidsequenceofAb129CDRH3 (Ab129CDR3,SEQIDNO:235DYDWSFHFDY xxxviii. Ab129CDRL1Ab129CDR4236AminoacidsequenceofAb129CDRL1 (Ab129CDR4),SEQIDNO:236QGIRND xxxix. Ab129CDRL2Ab129CDR5237AminoacidsequenceofAb129CDRL2 (Ab129CDR5),SEQIDNO:237AAS xl. Ab129CDRL3Ab129CDR6238AminoacidsequenceofAb129CDRL3 (Ab129CDR6),SEQIDNO:238LQHNSYP xli, Ab272CDRH1Ab272CDR1239AminoacidsequenceofAb272CDRH1 (Ab272CDR1),SEQIDNO:239GFIFSRYG xlii. Ab272CDRH2Ab272CDR2240AminoacidsequenceofAb272CDRH2 (Ab272CDR2),SEQIDNO:240IWYDGSNK xliii, Ab272CDRH3Ab272CDR3241AminoacidsequenceofAb272CDRH3 (Ab272CDR3),SEQIDNO:241DYYDNSRHHWGFDY xliv. Ab272CDRL1Ab272CDR4242AminoacidsequenceofAb272CDRL1 (Ab272CDR4),SEQIDNO:242RSSRSLLDSDDGNTYLD xlv. Ab272CDRL2Ab272CDR5243AminoacidsequenceofAb272CDRL2 (Ab272CDR5),SEQIDNO:243TLSYRAS xlvi. Ab272CDRL3Ab272CDR6244AminoacidsequenceofAb272CDRL3 (Ab272CDR6),SEQIDNO:244MQRVEFPIT xlvii. Ab2592CDRH1Ab2592CDR1245AminoacidsequenceofAb2592CDR H1(Ab2592CDR1),SEQIDNO:245GGSISSDGY xlviii. Ab2592CDRH2Ab2592CDR2246AminoacidsequenceofAb2592CDR H2(Ab2592CDR2),SEQIDNO:246IYYSGST xlix. Ab2592CDRH3Ab2592CDR3247AminoacidsequenceofAb2592CDR H3(Ab2592CDR3),SEQIDNO:247ESPHSSNWYSGFDC l. Ab2592CDRL1Ab2592CDR4248AminoacidsequenceofAb2592CDR L1(Ab2592CDR4),SEQIDNO:248QSIGSR li. Ab2592CDRL2Ab2592CDR5249AminoacidsequenceofAb2592CDR L2(Ab2592CDR5),SEQIDNO:249YAS lii. Ab2592CDRL3Ab2592CDR6250AminoacidsequenceofAb2592CDR L3(Ab2592CDR6),SEQIDNO:250HQSSNLPFT liii. LinkerregionsubunitG4S316NucleicacidsequenceofLinkerregion subunit(G4S),SEQIDNO:316GGTGGTGGTGGTTCT liv. LinkerregionG4SLinker251NucleicacidsequenceofLinkerregino (G4SLinker),SEQIDNO:251GGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGT TCC lv. Ab129VH129VH252NucleicacidsequenceofAb129VH(129VH), SEQIDNO:252CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTC CCTCACCTGCACTGTCTCTGGTGGCTCCGTCAGCAGTGGTGGTTACTACTGGAGCTGGATCCGGACGGGGG CAGGGAAGGGACTGGAGTGGATTGGGTTTATCTATTACACTGGGAGCACCAACTACAACCCCTCCCTCAAG AGTCGAGTCTCCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGC GGACGCGGCCGTGTATTACTGTGCGAGAGATTATGACTGGAGCTTCCACTTTGACTACTGGGGCCAGGGAA CCCTGGTCACCGTCTCCTCA lvi. Ab129VL129VL253NucleicacidsequenceofAb129VL(129VL), SEQIDNO:253GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATAGGAGACAGAGT CACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCAGAAACCAGGGAAAG CCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGA TCTGGGACAGAATTCACTCTCACAATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACA GCATAATAGTTACCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA lvii. Ab272VH272VH254NucleicacidsequenceofAb272VH(272VH), SEQIDNO:254CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAG ACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCA AGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTATGCAGACTCCGTGAAGGGC CGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGA CACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCACTGGGGGTTTGACTACTGGG GCCAGGGAACCCTGGTCACCGTCTCCTCA lviii. Ab272VL272VL255NucleicacidsequenceofAb272VL(272VL), SEQIDNO:255GATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCGGC CTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGACTGGTACC TGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAGTCCCAGAC AGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGG AGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAGATTAAA lix. Ab2592VH2592VH256NucleicacidsequenceofAb2592VH(2592VH), SEQIDNO:256CAGGTGCAGCTGCAGGAGTCGGGCCCAAGACTGGTGAAGCCTTCACAGACCCTGTC CCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTACTACTGGAGCTGGATCCGCCAGCACC CAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCACCTTCTACAACCCGTCCCTCAAG AGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGACTGCCGC GGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGCAACTGGTACTCGGGCTTTGACTGCT GGGGCCAGGGAACCCTGGTCACCGTCTCCTCA lx. Ab2592VL2592VH257NucleicacidsequenceofAb2592VL(2592VL), SEQIDNO:257GAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGACTCCAAAGGAGAAAGT CACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAGCAGAAACCAGATCAGT CTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAGGTTCAGTGGCAGTGGA TCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAACGTATTACTGTCATCA GAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAA lxi. 129hv-linker-lv129H258Nucleicacidsequenceof129hv-linker-lv (129H),SEQIDNO:258CAGGTGCAGCTGCAGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGA CCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCGTCAGCAGTGGTGGTTACTACTGGAGCTGGATCCGG CAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTTTATCTATTACACTGGGAGCACCAACTACAACCCCTC CCTCAAGAGTCGAGTCTCCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGTGA CCGCTGCGGACGCGGCCGTGTATTACTGTGCGAGAGATTATGACTGGAGCTTCCACTTTGACTACTGGGGC CAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTC CGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATAGGAGACAGAGTCACCATCACTTGCC GGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCAGAAACCAGGGAAAGCCCCTAAGCGCCTG ATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATT CACTCTCACAATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAGCATAATAGTTACC CTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA lxii. 129lv-linker-hv129L259Nucleicacidsequenceof129lv-linker-hv (129L),SEQIDNO:259GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATAGGA GACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCAGAAACC AGGGAAAGCCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAGGTTCAGCG GCAGTGGATCTGGGACAGAATTCACTCTCACAATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTAC TGTCTACAGCATAATAGTTACCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAAGGTGGTGGTGG TTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGA AGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCGTCAGCAGTGGTGGTTACTACTGG AGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTTTATCTATTACACTGGGAGCACCAA CTACAACCCCTCCCTCAAGAGTCGAGTCTCCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAGC TCTGTGACCGCTGCGGACGCGGCCGTGTATTACTGTGCGAGAGATTATGACTGGAGCTTCCACTTTGACTA CTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA lxiii. 272hv-linker-lv272H260Nucleicacidsequenceof272hv-linker-lv (272H),SEQIDNO:260CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGG TCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGGGTCCGCCAGGC TCCAGGCAAGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTATGCAGACTCCGT GAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAG CCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCACTGGGGGTTTGAC TACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGG TGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCGGCCTCCA TCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGACTGGTACCTGCAG AAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAGTCCCAGACAGGTT CAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGAGGATGTTGGAGT TTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAGATTAAA lxiv. 272lv-linker-hv272L261Nucleicacidsequenceof272lv-linker-hv (272L),SEQIDNO:261GATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGA GAGCCGGCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGA CTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAG TCCCAGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTTCACACTGAAAATCAGCACAGGTTCAGTGGC AGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGGAGTTTATTACTG CATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAGATTAAAGGTGGTGGTGGTT CTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAG CCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGGGT CCGCCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTATG CAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAAC AGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCACTG GGGGTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA lxv. 2592hv-linker-lv259H262Nucleicacidsequenceof2592hv-linker-lv (2592H),SEQIDNO:262CAGGTGCAGCTGCAGGAGTCGGGCCCAAGACTGGTGAAGCCTTCACA GACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTACTACTGGAGCTGGATCC GCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCACCTTCTACAACCCG TCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCCTGAAGCTGAGCTCTGT GACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGCAACTGGTACTCGGGCT TTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCC GGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGACTCCAAAGGAGAAAGT CACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAGCAGAAACCAGATCAGT CTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAGGTTCAGTGGCAGTGGA TCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAACGTATTACTGTCATCA GAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAA lxvi. 2592lv-linker-hv259L263Nucleicacidsequenceof2592lv-linker-hv (2592L),SEQIDNO:263GAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGACTCCAAA GGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAGCAGAAAC CAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAGGTTCAGT GGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAACGTATTA CTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAGGTGGTGGTG GTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGCAGCTGCAGGAGTCGGGCCCAAGACTGGTG AAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTACTACTG GAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCACCT TCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCCTGAAG CTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGCAACTG GTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCA lxvii. CD28hingedomainCD28H264NucleicacidsequenceofCD28hingedomain (CD28H),SEQIDNO:264GTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTC TAAGCCC lxviii. CD28transmembranedomainCD28TM265NucleicacidsequenceofCD28 transmembranedomain(CD28TM),SEQIDNO:265TTTTGGGTGCTGGTGGTGGTTGGTG GAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTG lxix. 4-1BBcostimulatorydomainBBCYP266Nucleicacidsequenceof4-1BB costimulatorydomain(BBCYP),SEQIDNO:266AAACGGGGCAGAAAGAAACTCCTGTAT ATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCC AGAAGAAGAAGAAGGAGGATGTGAACTG lxx. CD28costimulatorydomainCD28CYP267NucleicacidsequenceofCD28 costimdomain(CD28CYP),SEQIDNO:267AGGAGTAAGAGGAGCAGGCTCCTGCACAGTG ACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGC GACTTCGCAGCCTATCGCTCC lxxi. DAP10costimulatorydomainDAP10CYP268NucleicacidsequenceofDAP10 costimulatorydomain(DAP10CYP),SEQIDNO:268CTGTGCGCACGCCCACGCCGCAG CCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGC lxxii. CD3zetaintracellulardomainCD3CYP269Nucleicacidsequenceof CD3zetaintracellulardomein(CD3CYP),SEQIDNO:269CTTAGAGTGAAGTTCA GCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGA AGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAG GAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTG GGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAG GACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxiii. 129H-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)129H-CD28270 Nucleicacidsequenceof129H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(129H-CD28),SEQIDNO:270ATGGAAACCCCAGCGCAGCTTCTCT TCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTG AAGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCGTCAGCAGTGGTGGTTACTACTG GAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTTTATCTATTACACTGGGAGCACCA ACTACAACCCCTCCCTCAAGAGTCGAGTCTCCATATCAGTAGACACGTCCAAGAACCAGTTCTCCCTGAAG CTGAGCTCTGTGACCGCTGCGGACGCGGCCGTGTATTACTGTGCGAGAGATTATGACTGGAGCTTCCACTT TGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCG GTGGTGGTGGTTCCGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTATAGGAGACAGAGTC ACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCAGAAACCAGGGAAAGC CCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCATCAAGGTTCAGCGGCAGTGGAT CTGGGACAGAATTCACTCTCACAATCAGCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAG CATAATAGTTACCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAAGCTAGCGTGAAAGGGAAACA CCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCC TGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTC CTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGC CCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCG CGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTG GACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCT GTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGA GGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCAC ATGCAGGCCCTGCCCCCTCGCTAA lxxiv. 129L-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)129L-CD28271 Nucleicacidsequenceof129L-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(129L-CD28),SEQIDNO:271ATGGAAACCCCAGCGCAGCTTCTCT TCCTCCTGCTACTCTGGCTCCCAGATACCACCGGAGACATCCAGATGACCCAGTCTCCATCCTCCCTGTCT GCATCTATAGGAGACAGAGTCACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTA TCAGCAGAAACCAGGGAAAGCCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTGGGGTCCCAT CAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCAGCAGCCTGCAGCCTGAAGATTTT GCAACTTATTACTGTCTACAGCATAATAGTTACCCTCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAA AGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGCAGCTGCAGGAGTCGGGCC CAGGACTGGTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCGTCAGCAGTGGT GGTTACTACTGGAGCTGGATCCGGCAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTTTATCTATTACAC TGGGAGCACCAACTACAACCCCTCCCTCAAGAGTCGAGTCTCCATATCAGTAGACACGTCCAAGAACCAGT TCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACGCGGCCGTGTATTACTGTGCGAGAGATTATGACTGG AGCTTCCACTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGCTAGCGTGAAAGGGAAACA CCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCC TGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTC CTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGC CCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCG CGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTG GACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCT GTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGA GGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACA TGCAGGCCCTGCCCCCTCGCTAA lxxv. 272H-CD28H-CD28TM-BBCYP-CD3CYPCAR(includesleader)272H-BB272 Nucleicacidsequenceof272H-CD28H-CD28TM-BBCYP-CD3CYPCAR (includesleader)(272H-BB),SEQIDNO:272ATGGAAACCCCAGCGCAGCTTCTCTTC CTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCA GCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGGG TCCGCCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTAT GCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAA CAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCACT GGGGGTTTGACTACTGGGGCCAGGGAACCCTGGCTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGG CGGCTCCGGTGGTGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAG AGCCGGCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGAC TGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAGT CCCAGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGG ATGTTGGAGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAG ATTAAACTCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTG GGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCT GGGTGAAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACT CAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAAGCTTAGAGT GAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATC TAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCG CAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAG TGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAG CCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxvi. 272H-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)272H-CD28273 Nucleicacidsequenceof272H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(272H-CD28),SEQIDNO:273ATGGAAACCCCAGCGCAGCTTCTCT TCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTC CAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTG GGTCCGCCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCT ATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATG AACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCA CTGGGGGTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCG GCGGCTCCGGTGGTGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGA GAGCCGGCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGA CTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAG TCCCAGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAG GATGTTGGAGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGA GATTAAACTCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTT GGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTC TGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCC CACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGA AGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTA GGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCA GAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTG AGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCC ACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxvii. 272H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR(includesleader)272H-DAP10 274Nucleicacidsequenceof272H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR (includesleader)(272H-DAP10),SEQIDNO:274ATGGAAACCCCAGCGCAGCTTCTC TTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGG TCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCAC TGGGTCCGCCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACT CTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAA TGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACAT CACTGGGGGTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGG CGGCGGCTCCGGTGGTGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTG GAGAGCCGGCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTG GACTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGG AGTCCCAGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTG AGGATGTTGGAGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTG GAGATTAAACTCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTT TTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTT TCTGGGTGCTGTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCA GGCAGGGGCAAGCTTAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCA GCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACC CTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGAT AAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCT TTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxviii. 272L-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)272L-CD28 275Nucleicacidsequenceof272L-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(272L-CD28),SEQIDNO:275ATGGAAACCCCAGCGCAGCTTCTCT TCCTCCTGCTACTCTGGCTCCCAGATACCACCGGAGATATTGTGATGACCCAGACTCCACTCTCCCTGCCC GTCACCCCTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAA CACCTATTTGGACTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATC GGGCCTCTGGAGTCCCAGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGG GTGGAGGCTGAGGATGTTGGAGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGG GACACGACTGGAGATTAAAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGC AGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGA TTCATCTTCAGTCGCTATGGCATGCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGT TATATGGTATGATGGAAGTAATAAACTCTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACA ATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCG AGAGATTACTATGATAATAGTAGACATCACTGGGGGTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGT CTCCTCACTCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTT GGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTC TGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCC CACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGA AGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTA GGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCA GAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTG AGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCC ACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxix. 2592H-CD28H-CD28TM-BBCYP-CD3CYPCAR(includesleader)2592H-BB 276Nucleicacidsequenceof2592H-CD28H-CD28TM-BBCYP-CD3CYPCAR (includesleader)(2592H-BB),SEQIDNO:276ATGGAAACCCCAGCGCAGCTTCTCTT CCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAAGACTGGTGA AGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTACTACTGG AGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCACCTT CTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCCTGAAGC TGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGCAACTGG TACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGG CGGCGGCTCCGGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGACTCCAA AGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAGCAGAAA CCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAGGTTCAG TGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAACGTATT ACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAGCTAGCGTG AAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGT TGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAAACGGGGCA GAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAAGATGGC TGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAAGCTTAGAGTGAAGTTCAGCAGGAG CGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGG AGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAAC CCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAA AGGCGAGCGCCGGAGGGGCAAGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTA CGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxx. 2592H-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)2592H-CD28 277Nucleicacidsequenceof2592H-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(2592H-CD28),SEQIDNO:277ATGGAAACCCCAGCGCAGCTTCTC TTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAAGACTGGT GAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTACTACT GGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCACC TTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCCTGAA GCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGCAACT GGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGC GGCGGCGGCTCCGGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGACTCC AAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAGCAGA AACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAGGTTC AGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAACGTA TTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAGCTAGCG TGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTG GTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAA GAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATT ACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCAGCAGGAGC GCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGA GTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACC CTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAA GGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTA CGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxxi. 2592H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR(includesleader)2592H-DAP10 278Nucleicacidsequenceof2592H-CD28H-CD28TM-DAP10CYP-CD3CYPCAR (includesleader)(2592H-DAP10),SEQIDNO:278ATGGAAACCCCAGCGCAGCTTCT CTTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAAGACTGG TGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTACTAC TGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAGCAC CTTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCCTGA AGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGCAAC TGGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGG CGGCGGCGGCTCCGGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGACTC CAAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAGCAG AAACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAGGTT CAGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAACGT ATTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAGCTAGC GTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGT GGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGCTGTGCG CACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCAAGCTT AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCT CAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAA AGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCC TACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAG TACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxxii. 2592L-CD28H-CD28TM-CD28CYP-CD3CYPCAR(includesleader)2592L-CD28 279Nucleicacidsequenceof2592L-CD28H-CD28TM-CD28CYP-CD3CYPCAR (includesleader)(2592L-CD28),SEQIDNO:279ATGGAAACCCCAGCGCAGCTTCTC TTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGAGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTC TGTGACTCCAAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGT ACCAGCAGAAACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCC TCGAGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGC TGCAACGTATTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCA AAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGCAGCTGCAGGAGTCGGGC CCAAGACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGA TGGTTACTACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACA GTGGGAGCACCTTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAG TTCTCCCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCA TAGCAGCAACTGGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGCTAGCG TGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTG GTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAA GAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATT ACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCAGCAGGAGC GCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGA GTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGAAGAACC CTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAA GGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTA CGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC lxxxiii. signalpeptidesignal280Nucleidacidsequenceofsignalpeptide (signal),SEQIDNO:280ATGGAAACCCCAGCGCAGCTTCTCTTCCTCCTGCTACTCTGGCTCC CAGATACCACCGGA lxxxiv. T2AribosomalskipsequenceT2A281NucleicacidsequenceofT2A ribosomalskipsequence(T2A),SEQIDNO:281GGCTCCGGTGAGGGCAGAGGAAGTC TTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCT lxxxv. TruncatedCD19tCD19282NucleicacidsequenceofTruncatedCD19 (tCD19),SEQIDNO:282ATGCCACCTCCTCGCCTCCTCTTCTTCCTCCTCTTCCTCACCCCCAT GGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGGGAGATAACGCTGTGCTGCAGTGCCTCA AGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGGGAGTCCCCGCTTAAACCCTTCTTAAAA CTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCCCTGGCCATCTGGCTTTTCATCTTCAACGT CTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCCCCCCTCTGAGAAGGCCTGGCAGCCTGGCT GGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAATGTTTCGGACCTAGGTGGCCTGGGCTGT GGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTTCCGGGAAGCTCATGAGCCCCAAGCTGTATGT GTGGGCCAAAGACCGCCCTGAGATCTGGGAGGGAGAGCCTCCGTGTCTCCCACCGAGGGACAGCCTGAACC AGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCACACTCTGGCTGTCCTGTGGGGTACCCCCTGAC TCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACCCCAAGGGGCCTAAGTCATTGCTGAGCCTAGA GCTGAAGGACGATCGCCCGGCCAGAGATATGTGGGTAATGGAGACGGGTCTGTTGTTGCCCCGGGCCACAG CTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCTGACCATGTCATTCCACCTGGAGATCACTGCT CGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCTGGAAGGTCTCAGCTGTGACTTTGGCTTATCT GATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTTCAAAGAGCCCTGGTCCTGAGGAGGAAAAGAA AGCGAATGACTTAA lxxxvi. Ab129CDRH1Ab129CDR1283NucleicacidsequenceofAb129CDRH1 (Ab129CDR1),SEQIDNO:283GGTGGCTCCGTCAGCAGTGGTGGTTACTAC lxxxvii. Ab129CDRH2Ab129CDR2284NucleicacidsequenceofAb129CDRH2 (Ab129CDR2),SEQIDNO:284ATCTATTACACTGGGAGCACC lxxxviii. Ab129CDRH3Ab129CDR3285NucleicacidsequenceofAb129CDRH3 (Ab129CDR3),SEQIDNO:285GATTATGACTGGAGCTTCCACTTTGACTAC lxxxix. Ab129CDRL1Ab129CDR4286NucleicacidsequenceofAb129CDRL1 (Ab129CDR4),SEQIDNO:CAGGGCATTAGAAATGAT xc. Ab129CDRL2Ab129CDR5287NucleicacidsequenceofAb129CDRL2 (Ab129CDR5),SEQIDNO:287GCTGCATCC xci. Ab129CDRL3Ab129CDR6288NucleicacidsequenceofAb129CDRL3 (Ab129CDR6),SEQIDNO:288CTACAGCATAATAGTTACCCT xcii. Ab272CDRH1Ab272CDR1289NucleicacidsequenceofAb272CDRH1 (Ab272CDR1),SEQIDNO:289GGATTCATCTTCAGTCGCTATGGC xciii. Ab272CDRH2Ab272CDR2290NucleicacidsequenceofAb272CDRH2 (Ab272CDR2),SEQIDNO:290ATATGGTATGATGGAAGTAATAAA xciv. Ab272CDRH3Ab272CDR3291NucleicacidsequenceofAb272CDRH3 (Ab272CDR3),SEQIDNO:291GATTACTATGATAATAGTAGACATCACTGGGGGTTTGACTA C xcv. Ab272CDRL1Ab272CDR4292NucleicacidsequenceofAb272CDRL1 (Ab272CDR4),SEQIDNO:292AGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACAC CTATTTGGAC xcvi. Ab272CDRL2Ab272CDR5293NucleicacidsequenceofAb272CDRL2 (Ab272CDR5),SEQIDNO:293ACGCTTTCCTATCGGGCCTCT xcvii. Ab272CDRL3Ab272CDR6294NucleicacidsequenceofAb272CDRL3 (Ab272CDR6),SEQIDNO:294ATGCAACGTGTAGAGTTTCCTATCACC xcviii. Ab2592CDRH1Ab2592CDR1295NucleicacidsequenceofAb2592CDRH1 (Ab2592CDR1),SEQIDNO:295GGTGGCTCCATCAGTAGTGATGGTTAC xcix. Ab2592CDRH2Ab2592CDR2296NucleicacidsequenceofAb2592CDRH2 (Ab2592CDR2),SEQIDNO:296ATCTATTACAGTGGGAGCACC c. Ab2592CDRH3Ab2592CDR3297NucleicacidsequenceofAb2592CDRH3 (Ab2592CDR3),SEQIDNO:297GAATCCCCTCATAGCAGCAACTGGTACTCGGGCTTTGACT GC ci. Ab2592CDRL1Ab2592CDR4298NucleicacidsequenceofAb2592CDRL1 (Ab2592CDR4),SEQIDNO:298CAGAGCATTGGTAGTAGG cii. Ab2592CDRL2Ab2592CDR5299NucleicacidsequenceofAb2592CDRL2 (Ab2592CDR5),SEQIDNO:299TATGCTTCC ciii. Ab2592CDRL3Ab2592CDR6300NucleicacidsequenceofAb2592CDRL3 (Ab2592CDR6),SEQIDNO:300CATCAGAGTAGTAATTTACCATTCACT civ. leader_272H-CD28H-CD28TM-BBCYP-CD3CYP_T2A-tCD19272H-BB_tCD19301 Aminoacidsequenceofleader_272H-CD28H-CD28TM-BBCYP-CD3CYP_T2A- tCD19(272H-BB_tCD19),SEQIDNO:301METPAQLLFLLLLWLPDTTG2QVQLVESGGGVV QPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKNTLYLQM NSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLPVTPG EPASISCRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEAE DVGVYYCMQRVEFPITFGQGTRLEIKLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIF WVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELKLRVKFSRSADAPAYQQGQNQLYNELN LGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST ATKDTYDALHMQALPPRAGAKRSGSGEGRGSLLTCGDVEENPGPMPPPRLLFFLLFLTPMEVRPEEPLVVK VEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQ PGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEG EPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGIL HLQRALVLRRKRKRMT cv. leader_272H-CD28H-CD28TM-BBCYP-CD3CYP_T2A-tCD19272H-BB_tCD19302 Nucleicacidsequenceofleader_272H-CD28H-CD28TM-BBCYP-CD3CYP_T2A- tCD19(272H-BB_tCD19),SEQIDNO:302ATGGAAACCCCAGCGCAGCTTCTCTTCCTCCTG CTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGG GAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGGGTCCGCC AGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTATGCAGAC TCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGCCT GAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCACTGGGGGT TTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCC GGTGGTGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCGGC CTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGACTGGTACC TGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAGTCCCAGAC AGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTTGG AGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAGATTAAAC TCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTG GTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAA ACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGG AAGATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAAGCTTAGAGTGAAGTTC AGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACG AAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAA GGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATT GGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAA GGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCGGCGCCAAAAGGTCTGGCTCCGGTG AGGGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTATGCCACCTCCTCGCCTC CTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGA GGGAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTC GGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCC CTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCC CCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGA ATGTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTTCC GGGAAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATCTGGGAGGGAGAGCCTCC GTGTCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCACAC TCTGGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACCCC AAGGGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCCGGCCAGAGATATGTGGGTAATGGA GACGGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCTGA CCATGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCTGG AAGGTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTTCA AAGAGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cvi. leader_272H-CD28H-CD28TM-CD28CYP-CD3CYP_T2A-tCD19272H-CD28_tCD19303 Aminoacidsequenceofleader_272H-CD28H-CD28TM-CD28CYP-CD3CYP_T2A- tCD19(272H-CD28_tCD19),SEQIDNO:303METPAQLLFLLLLWLPDTTGQVQLVESGGGV VQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKNTLYLQ MNSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLSLPVTP GEPASISCRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKISRVEA EDVGVYYCMQRVEFPITFGQGTRLEIKLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFII FWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQNQLYNELN LGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLST ATKDTYDALHMQALPPRAGAKRSGSGEGRGSLLTCGDVEENPGPRMPPPRLLFFLLFLTPMEVRPEEPLVV KVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLGLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLC QPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWE GEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGIL HLQRALVLRRKRKRMT cvii. leader_272H-CD28H-CD28TM-CD28CYP-CD3CYP_T2A-tCD19272H-CD28_tCD19304 Nucleicacidsequenceofleader_272H-CD28H-CD28TM-CD28CYP-CD3CYP_T2A- tCD19(272H-CD28_tCD19),SEQIDNO:304ATGGAAACCCCAGCGCAGCTTCTCTTCCTCC TGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCT GGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGGGTCCG CCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTATGCAG ACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGAACAGC CTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCACTGGGG GTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGGCGGCT CCGGTGGTGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCG GCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGACTGGTA CCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAGTCCCAG ACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGGATGTT GGAGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAGATTAA ACTCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGC TGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTG AGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCG CAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCA GCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGA AGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAG GAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTG GGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAG GACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCGGCGCCAAAAGGTCTGGCTCCGGTGA GGGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTAGAATGCCACCTCCTCGCC TCCTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAA GAGGGAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTC TCGGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGC CCCTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGG CCCCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTG GAATGTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTT CCGGGAAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATCTGGGAGGGAGAGCCT CCGTGTCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCAC ACTCTGGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACC CCAAGGGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCCGGCCAGAGATATGTGGGTAATG GAGACGGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCT GACCATGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCT GGAAGGTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTT CAAAGAGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cviii. leader_272H-CD28H-CD28TM-DAP10CYP-CD3CYP_T2A-tCD19272H-DAP10_tCD19 305Aminoacidsequenceofleader_272H-CD28H-CD28TM-DAP10CYP-CD3CYP_ T2A-tCD19(272H-DAP10_tCD19),SEQIDNO:305METPAQLLFLLLLWLPDTTGQVQLVE SGGGVVQPGRSLRLSCAASGFIFSRYGMHWVRQAPGKGLKWVAVIWYDGSNKLYADSVKGRFTISRDNSKN TLYLQMNSLRAEDTAVYYCARDYYDNSRHHWGFDYWGQGTLVTVSSGGGGSGGGGSGGGGSDIVMTQTPLS LPVTPGEPASISCRSSRSLLDSDDGNTYLDWYLQKPGQSPQLLIYTLSYRASGVPDRFSGSGSGTDFTLKI SRVEAEDVGVYYCMQRVEFPITFGQGTRLEIKLEVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVT VAFIIFWVLCARPRRSPAQEDGKVYINMPGRGKLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDK RRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQ ALPPRAGAKRSGSGEGRGSLLTCGDVEENPGPMPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLK GTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGW TVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQ SLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLPRATA QDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLRRKRK RMT cix. leader_272H-CD28H-CD28TM-DAP10CYP-CD3CYP_T2A-tCD19272H-DAP10_tCD19 306Nucleicacidsequenceofleader_272H-CD28H-CD28TM-DAP10CYP-CD3CYP_ T2A-tCD19(272H-DAP10_tCD19),SEQIDNO:306ATGGAAACCCCAGCGCAGCTTCTCTT CCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCC AGCCTGGGAGGTCCCTGAGACTCTCCTGTGCAGCGTCTGGATTCATCTTCAGTCGCTATGGCATGCACTGG GTCCGCCAGGCTCCAGGCAAGGGGCTGAAATGGGTGGCAGTTATATGGTATGATGGAAGTAATAAACTCTA TGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAAGAACACGCTGTATCTGCAAATGA ACAGCCTGAGAGCCGAGGACACGGCTGTGTATTACTGTGCGAGAGATTACTATGATAATAGTAGACATCAC TGGGGGTTTGACTACTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTCTGGCGGCGG CGGCTCCGGTGGTGGTGGTTCCGATATTGTGATGACCCAGACTCCACTCTCCCTGCCCGTCACCCCTGGAG AGCCGGCCTCCATCTCCTGCAGGTCTAGTCGGAGCCTCTTGGATAGTGATGATGGAAACACCTATTTGGAC TGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTACACGCTTTCCTATCGGGCCTCTGGAGT CCCAGACAGGTTCAGTGGCAGTGGGTCAGGCACTGATTTCACACTGAAAATCAGCAGGGTGGAGGCTGAGG ATGTTGGAGTTTATTACTGCATGCAACGTGTAGAGTTTCCTATCACCTTCGGCCAAGGGACACGACTGGAG ATTAAACTCGAGGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTG GGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCT GGGTGCTGTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGC AGGGGCAAGCTTAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCT CTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTG AGATGGGGGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAG ATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTA CCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCG GCGCCAAAAGGTCTGGCTCCGGTGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCC GGCCCTATGCCACCTCCTCGCCTCCTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGA ACCTCTAGTGGTGAAGGTGGAAGAGGGAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCC CCACTCAGCAGCTGACCTGGTCTCGGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCA GGCCTGGGAATCCACATGAGGCCCCTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGG CTTCTACCTGTGCCAGCCGGGGCCCCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGG GCAGCGGGGAGCTGTTCCGGTGGAATGTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCC TCAGAGGGCCCCAGCTCCCCTTCCGGGAAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCC TGAGATCTGGGAGGGAGAGCCTCCGTGTCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACC TCACCATGGCCCCTGGCTCCACACTCTGGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCC CTCTCCTGGACCCATGTGCACCCCAAGGGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCC GGCCAGAGATATGTGGGTAATGGAGACGGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGT ATTATTGTCACCGTGGCAACCTGACCATGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCAC TGGCTGCTGAGGACTGGTGGCTGGAAGGTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTC CCTTGTGGGCATTCTTCATCTTCAAAGAGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cx. leader_2592H-CD28H-CD28TM-BBCYP-CD3CYP_T2A-tCD192592H-BB_tCD19 307Aminoacidsequenceofleader_2592H-CD28H-CD28TM-BBCYP- CD3CYP_T2A-tCD19(272H-BB_tCD19),SEQIDNO:307METPAQLLFLLLLWLPDTTGQ VQLQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRVAIS VDTSKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSSGGGGSGGGGSGGGGSEIVL TQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFTLTI NSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKASVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVT VAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELKLRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGL YQGLSTATKDTYDALHMQALPPRAGAKRSGSGEGRGSLLTCGEVEENPGPMPPPRLLFFLLFLTPMEVRPE EPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMG GFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDR PEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDR PARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLC SLVGILHLQRALVLRRKRKRMT cxi. leader_2592H-CD28H-CD28TM-BBCYP-CD3CYP_T2A-tCD192592H-BB_tCD19 308Nucleicacidsequenceofleader_2592H-CD28H-CD28TM-BBCYP- CD3CYP_T2A-tCD19(2592H-BB_tCD19),SEQIDNO:308ATGGAAACCCCAGCGCAGCT TCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAAGAC TGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTTAC TACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGGAG CACCTTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTCCC TGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCAGC AACTGGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGTTC TGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGTGA CTCCAAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACCAG CAGAAACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCGAG GTTCAGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGCAA CGTATTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAGCT AGCGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGT GGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAAAC GGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAGACCAGTACAAACTACTCAAGAGGAA GATGGCTGTAGCTGCCGATTTCCAGAAGAAGAAGAAGGAGGATGTGAACTGAAGCTTAGAGTGAAGTTCAG CAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAA GAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGG AAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGG GATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCACGGTCTCAGTACAGCCACCAAGG ACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCGGCGCCAAAAGGTCTGGCTCCGGTGAG GGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTATGCCACCTCCTCGCCTCCT CTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGG GAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGG GAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCCCT GGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCCCC CCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAAT GTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTTCCGG GAAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATCTGGGAGGGAGAGCCTCCGT GTCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCACACTC TGGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACCCCAA GGGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCCGGCCAGAGATATGTGGGTAATGGAGA CGGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCTGACC ATGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCTGGAA GGTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTTCAAA GAGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cxii. leader_2592H-CD28H-CD28TM-CD28CYP-CD3CYP_T2A-tCD192592H-CD28_tCD19 309Aminoacidsequenceofleader_2592H-CD28H-CD28TM-CD28CYP- CD3CYP_T2A-tCD19(2592H-CD28_tCD19),SEQIDNO:309METPAQLLFLLLLWLPDT TGQVQLQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRV AISVDTSKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSSGGGGSGGGGSGGGGSE IVLTQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDFT LTINSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKASVKGKHLCPSPLFPGPSKPFWVLVVGGVLACYSLL VTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQN QLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRAGAKRSGSGEFRGSLLTCGDVEENPGPMPPPRLLFFLLFLTPMEVRP EEPLVKVVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQM GGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKD RPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDD RPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCL CSLVGILHLQRALVLRRKRKRMT cxiii. leader_2592H-CD28H-CD28TM-CD28CYP-CD3CYP_T2A-tCD192592H-CD28_tCD19 310Nucleicacidsequenceofleader_2592H-CD28H-CD28TM-CD28CYP- CD3CYP_T2A-tCD19(2592H-CD28_tCD19),SEQIDNO:310ATGGAAACCCCAGCGCAG CTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAAG ACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTT ACTACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGG AGCACCTTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTC CCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCA GCAACTGGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGT TCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGT GACTCCAAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACC AGCAGAAACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCG AGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGC AACGTATTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAG CTAGCGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTG GTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAG GAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCA AGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCAGC AGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAG AGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGA AGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGG ATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGA CACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCGGCGCCAAAAGGTCTGGCTCCGGTGAGG GCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTATGCCACCTCCTCGCCTCCTC TTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGGG AGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGGG AGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCCCTG GCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCCCCC CTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAATG TTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTTCCGGG AAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATCTGGGAGGGAGAGCCTCCGTG TCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCACACTCT GGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACCCCAAG GGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCCGGCCAGAGATATGTGGGTAATGGAGAC GGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCTGACCA TGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCTGGAAG GTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTTCAAAG AGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cxiv. leader_2592H-CD28H-CD28TM-DAP10CYP-CD3CYP_T2A-tCD192592H-DAP10_tCD19 311Aminoacidsequenceofleader_2592H-CD28H-CD28TM-DAP10CYP- CD3CYP_T2A-tCD19(2592H-DAP10_tCD19),SEQIDNO:311METPAQLLFLLLLWLPD TTGQVQLQESGPRLVKPSQTLSLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSR VAISVDTSKNQFSLKLSSVTAADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSSGGGGSGGGGSGGGGS EIVLTQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGTDF TLTINSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKASVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYS LLVTVAFIIFWVLCARPRRSPAQEDGKVYINMPGRGKLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYD VLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDA LHMQALPPRAGAKRSGSGEGRGSLLTCGVEENPGPMPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVL QCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAW QPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRD SLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMWVMETGLLLP RATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCLCSLVGILHLQRALVLR RKRKRMT cxv. leader_2592H-CD28H-CD28TM-DAP10CYP-CD3CYP_T2A-tCD192592H-DAP10_tCD19 312Nucleicacidsequenceofleader_2592H-CD28H-CD28TM-DAP10CYP- CD3CYP_T2A-tCD19(2592H-DAP10_tCD19),SEQIDNO:312ATGGAAACCCCAGCGCAG CTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGACAGGTGCAGCTGCAGGAGTCGGGCCCAAG ACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAGTAGTGATGGTT ACTACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTATTACAGTGGG AGCACCTTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAGAACCAGTTCTC CCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATCCCCTCATAGCA GCAACTGGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAGGTGGTGGTGGT TCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCGAAATTGTGCTGACTCAGTCTCCAGACTTTCAGTCTGT GACTCCAAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTACACTGGTACC AGCAGAAACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGGGTCCCCTCG AGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGAAGATGCTGC AACGTATTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAAG CTAGCGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTG GTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGCT GTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGCA AGCTTAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAAC GAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGG GGGAAAGCCGCAGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGG AGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGT CTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCGGCGCCAA AAGGTCTGGCTCCGGTGAGGGCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTA TGCCACCTCCTCGCCTCCTCTTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTA GTGGTGAAGGTGGAAGAGGGAGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCA GCAGCTGACCTGGTCTCGGGAGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGG GAATCCACATGAGGCCCCTGGCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTAC CTGTGCCAGCCGGGGCCCCCCTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGG GGAGCTGTTCCGGTGGAATGTTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCCTCAGAGG GCCCCAGCTCCCCTTCCGGGAAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATC TGGGAGGGAGAGCCTCCGTGTCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCAT GGCCCCTGGCTCCACACTCTGGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCT GGACCCATGTGCACCCCAAGGGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCCGGCCAGA GATATGTGGGTAATGGAGACGGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTG TCACCGTGGCAACCTGACCATGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGC TGAGGACTGGTGGCTGGAAGGTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTCCCTTGTG GGCATTCTTCATCTTCAAAGAGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cxvi. leader_2592L-CD28H-CD28TM-CD28CYP-CD3CYP_T2A-tCD192592L-CD28_tCD19 313Aminoacidsequenceofleader_2592L-CD28H-CD28TM-CD28CYP- CD3CYP_T2A-tCD19(2592L-CD28_tCD19),SEQIDNO:313METPAQLLFLLLLWLPDT TGEIVLTQSPDFQSVTPKEKVTITCRASQSIGSRLHWYQQKPDQSPKLLIKYASQSFSGVPSRFSGSGSGT DFTLTINSLEAEDAATYYCHQSSNLPFTFGPGTKVDIKGGGGSGGGGSGGGGSQVQLQESGPRLVKPSQTL SLTCTVSGGSISSDGYYWSWIRQHPGKGLEWIGYIYYSGSTFYNPSLKSRVAISVDTSKNQFSLKLSSVTA ADTAVYYCARESPHSSNWYSGFDCWGQGTLVTVSSASVKGKHLCPSPLFPGPSKPFWVLVVVGVLACYSLL VTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKLRVKFSRSADAPAYQQGQN QLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDG LYQGLSTATKDTYDALHMQALPPRAGAKRSGSGEGRGSLLTCGDVEENPGPMPPPRLLFFLLFLTPMEVRP EEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHMRPLAIWLFIFNVSQQM GGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKD RPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDD RPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYLIFCL CSLVGILHLQRALVLRRKRKRMT cxvii. leader_2592L-CD28H-CD28TM-CD28CYP-CD3CYP_T2A-tCD192592L-CD28_tCD19 314Nucleicacidsequenceofleader_2592L-CD28H-CD28TM-CD28CYP- CD3CYP_T2A-tCD19(2592L-CD28_tCD19),SEQIDNO:314ATGGAAACCCCAGCGCAG CTTCTCTTCCTCCTGCTACTCTGGCTCCCAGATACCACCGGAGAAATTGTGCTGACTCAGTCTCCAGACTT TCAGTCTGTGACTCCAAAGGAGAAAGTCACCATCACCTGCCGGGCCAGTCAGAGCATTGGTAGTAGGTTAC ACTGGTACCAGCAGAAACCAGATCAGTCTCCAAAGCTCCTCATCAAGTATGCTTCCCAGTCCTTCTCAGGG GTCCCCTCGAGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACCCTCACCATCAATAGCCTGGAAGCTGA AGATGCTGCAACGTATTACTGTCATCAGAGTAGTAATTTACCATTCACTTTCGGCCCTGGGACCAAAGTGG ATATCAAAGGTGGTGGTGGTTCTGGCGGCGGCGGCTCCGGTGGTGGTGGTTCCCAGGTGCAGCTGCAGGAG TCGGGCCCAAGACTGGTGAAGCCTTCACAGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGCTCCATCAG TAGTGATGGTTACTACTGGAGCTGGATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCT ATTACAGTGGGAGCACCTTCTACAACCCGTCCCTCAAGAGTCGAGTTGCCATATCAGTGGACACGTCTAAG AACCAGTTCTCCCTGAAGCTGAGCTCTGTGACTGCCGCGGACACGGCCGTGTATTACTGTGCGAGAGAATC CCCTCATAGCAGCAACTGGTACTCGGGCTTTGACTGCTGGGGCCAGGGAACCCTGGTCACCGTCTCCTCAG CTAGCGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTG GTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAG GAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCA AGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCAAGCTTAGAGTGAAGTTCAGC AGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAG AGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGCAGAGAAGGA AGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGG ATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGA CACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCGCCGGCGCCAAAAGGTCTGGCTCCGGTGAGG GCAGAGGAAGTCTTCTAACATGCGGTGACGTGGAGGAGAATCCCGGCCCTATGCCACCTCCTCGCCTCCTC TTCTTCCTCCTCTTCCTCACCCCCATGGAAGTCAGGCCCGAGGAACCTCTAGTGGTGAAGGTGGAAGAGGG AGATAACGCTGTGCTGCAGTGCCTCAAGGGGACCTCAGATGGCCCCACTCAGCAGCTGACCTGGTCTCGGG AGTCCCCGCTTAAACCCTTCTTAAAACTCAGCCTGGGGCTGCCAGGCCTGGGAATCCACATGAGGCCCCTG GCCATCTGGCTTTTCATCTTCAACGTCTCTCAACAGATGGGGGGCTTCTACCTGTGCCAGCCGGGGCCCCC CTCTGAGAAGGCCTGGCAGCCTGGCTGGACAGTCAATGTGGAGGGCAGCGGGGAGCTGTTCCGGTGGAATG TTTCGGACCTAGGTGGCCTGGGCTGTGGCCTGAAGAACAGGTCCTCAGAGGGCCCCAGCTCCCCTTCCGGG AAGCTCATGAGCCCCAAGCTGTATGTGTGGGCCAAAGACCGCCCTGAGATCTGGGAGGGAGAGCCTCCGTG TCTCCCACCGAGGGACAGCCTGAACCAGAGCCTCAGCCAGGACCTCACCATGGCCCCTGGCTCCACACTCT GGCTGTCCTGTGGGGTACCCCCTGACTCTGTGTCCAGGGGCCCCCTCTCCTGGACCCATGTGCACCCCAAG GGGCCTAAGTCATTGCTGAGCCTAGAGCTGAAGGACGATCGCCCGGCCAGAGATATGTGGGTAATGGAGAC GGGTCTGTTGTTGCCCCGGGCCACAGCTCAAGACGCTGGAAAGTATTATTGTCACCGTGGCAACCTGACCA TGTCATTCCACCTGGAGATCACTGCTCGGCCAGTACTATGGCACTGGCTGCTGAGGACTGGTGGCTGGAAG GTCTCAGCTGTGACTTTGGCTTATCTGATCTTCTGCCTGTGTTCCCTTGTGGGCATTCTTCATCTTCAAAG AGCCCTGGTCCTGAGGAGGAAAAGAAAGCGAATGACTTAA cxviii. humanTIM-1TIM-1315AminoacidsequenceofTIM-1(TIM-1), SEQIDNO:315MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFT CQNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPP KVTTTPIVTTVPTVTTVRTSTTVPTTTTVPTTTVPTTMSIPTTTTVPTTMTVSTTTSVPTTTSIPTTTSVP VTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLW NNNQTQLFLEHSLLTANTTKGIYAGVCISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVE KEVQAEDNIYIENSLYATD
REFERENCES
[0383] References in this list are cited by number above and incorporated by reference in their entirety herein. [0384] 1. Zhang, L. et al. Intratumoral T cells, recurrence, and survival in epithelial ovarian cancer. N Engl J Med 348, 203-213, doi:10.1056/NEJMoa020177 (2003). [0385] 2. Coukos, G., Conejo-Garcia, J. R., Roden, R. B. & Wu, T. C. Immunotherapy for gynaecological malignancies. Expert Opin Biol Ther 5, 1193-1210, doi:10.1517/14712598.5.9.1193 (2005). [0386] 3. Hamanishi, J. et al. Programmed cell death 1 ligand 1 and tumor-infiltrating CD8.sup.4 T lymphocytes are prognostic factors of human ovarian cancer. Proc Natl Acad Sci USA 104, 3360-3365, doi: 10.1073/pnas.0611533104 (2007). [0387] 4. Kandalaft, L. E., Powell, D. J., Jr., Singh, N. & Coukos, G. Immunotherapy for ovarian cancer: what's next? J Clin Oncol 29, 925-933, doi: 10.1200/JCO.2009.27.2369 (2011). [0388] 5. Urba, W. J. & Longo, D. L. Redirecting T cells. N Engl J Med 365, 754-757, doi:10.1056/NEJMe1106965 (2011). [0389] 6. Maude, S. L. et al. Chimeric antigen receptor T cells for sustained remissions in leukemia. N Engl J Med 371, 1507-1517, doi:10.1056/NEJMoa1407222 (2014). [0390] 7. Khademi, M. et al. T Cell Ig.sup. and mucin-domain-containing molecule-3 (TIM-3) and TIM-1 molecules are differentially expressed on human Th1 and Th2 cells and in cerebrospinal fluid-derived mononuclear cells in multiple sclerosis. J Immunol 172, 7169-7176 (2004). [0391] 8. Mesri, M. et al. Inhibition of in vitro and in vive T cell responses by recombinant human Tim-1 extracellular domain proteins. Int Immunol 18, 473-484, doi: 10.1093/intimm/dxh388 (2006). [0392] 9. Kondratowicz, A. S. et al. T-cell immunoglobulin and mucin domain 1 (TIM-1) is a receptor for Zaire Ebolavirus and Lake Victoria Marburgvirus. Proc Natl Acad Sci USA 108, 8426-8431, doi:10.1073/pnas.1019030108 (2011). [0393] 10. Benard, J. et al. Characterization of a human ovarian adenocarcinoma line, IGROV1, in tissue culture and in nude mice. Cancer Res 45, 4970-4979 (1985). [0394] 11. Lengyel, E. et al. Epithelial ovarian cancer experimental models. Oncogene 33, 3619-3633, doi:10.1038/onc.2013.321 (2014). [0395] 12. Volk, A. et al. Comparison of three humanized mouse models for adoptive T cell transfer. J Gene Med 14, 540-548, doi:10.1002/jgm.2652 (2012). [0396] 13. von Bonin, M. et al. In vivo expansion of co-transplanted T cells impacts on tumor re-initiating activity of human acute myeloid leukemia in NSG mice. PLoS One 8, e60680, doi: 10.1371/journal.pone.0060680 (2013). [0397] 14. Ritchie, D. S. et al. Persistence and efficacy of second generation CAR T cell against the LeY antigen in acute myeloid leukemia. Mol Ther 21, 2122-2129, doi:10.1038/mt.2013.154 (2013). [0398] 15. Scholler, J. et al. Decade-long safety and function of retroviral-modified chimeric antigen receptor T cells. Sci Transl Med 4, 132ra153, doi: 10.1126/scitranslmed.3003761 (2012).