CD47-CAR-T CELLS
20190338028 ยท 2019-11-07
Inventors
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K16/00
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K14/70596
CHEMISTRY; METALLURGY
A61K39/464466
HUMAN NECESSITIES
A61K2239/38
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
C12N2740/16043
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K16/2896
CHEMISTRY; METALLURGY
International classification
C07K16/28
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
Abstract
The present invention provides a chimeric antigen receptor (CAR) fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) comprising V.sub.H and V.sub.L, wherein scFv has an activity against CD47, (ii) a transmembrane domain, (iii) at least one co-stimulatory domains, and (iv) an activating domain. In one embodiment, the scFv is derived from a humanized anti-CD47 antibody. The present invention also provides T cells modified to express the CAR of the present invention.
Claims
1. A chimeric antigen receptor fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) comprising VH and VL, wherein scFv is against CD47 tumor antigen, (ii) a transmembrane domain, (iii) a co-stimulatory domain of CD28, (iv) an activating domain.
2. The fusion protein of claim 1, wherein the scFv is derived from humanized CD47 antibody and comprises the amino sequences of SEQ ID NOs: 11 and 12, linked by a linker, or having at least 95% sequence identity thereof.
3. The fusion protein of claim 2, wherein the humanized scFv has the amino sequences of SEQ ID NO: 13.
4. The fusion protein of claim 1, wherein the scFv is derived from mouse CD47 antibody and comprises the amino sequences of SEQ ID NOs: 3 and 5, linked by a linker, or having at least 95% sequence identity thereof.
5. The fusion protein according to claim 1, wherein the co-stimulatory domain is selected from the group consisting of CD28, 4-1BB, ICOS-1, CD27, OX-40, DAP10 and GITR.
6. The fusion protein according to claim 1, wherein the co-stimulatory domain is CD28.
7. The fusion protein according to claim 1, wherein the activating domain is CD3-zeta.
8. The fusion protein according to claim 1, which has the amino acid sequence of SEQ ID NO: 10 or 14, or having at least 95% sequence identity.
9. The fusion protein according to claim 1, wherein (i) further comprises a second single-chain variable fragment (scFv) comprising a second VH and a second VL, wherein the second scFv is against EGFR tumor antigen.
10. The fusion protein according to claim 1, which has the amino acid sequence of SEQ ID NO: 17, or having at least 95% sequence identity.
11. A nucleic acid sequence encoding the fusion protein of claim 1.
12. A nucleic acid sequence encoding the fusion protein of claim 2.
13. T cells modified to express the fusion protein of claim 1.
14. T cells modified to express the fusion protein of claim 2.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0027] As used herein, adoptive cell therapy (ACT) is a treatment that uses a cancer patient's own T lymphocytes with anti-tumor activity, expanded in vitro and reinfused into the patient with cancer.
[0028] As used herein, affinity is the strength of binding of a single molecule to its ligand. Affinity is typically measured and reported by the equilibrium dissociation constant (KD or Kd), which is used to evaluate and rank order strengths of bimolecular interactions.
[0029] As used herein, a chimeric antigen receptor (CAR) means a fused protein comprising an extracellular domain capable of binding to an antigen, a transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain. The chimeric antigen receptor (CAR) is sometimes called a chimeric receptor, a T-body, or a chimeric immune receptor (CIR). The extracellular domain capable of binding to an antigen means any oligopeptide or polypeptide that can bind to a certain antigen. The intracellular domain means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
[0030] As used herein, a domain means one region in a polypeptide which is folded into a particular structure independently of other regions.
[0031] As used herein, a FLAG-tag, or FLAG octapeptide, or FLAG epitope, is a polypeptide protein tag that can be added to a protein using recombinant DNA technology, having the sequence motif DYKDDDDK (SEQ ID NO: 1). It can be fused to the C-terminus or the N-terminus of a protein, or inserted within a protein.
[0032] As used herein, the term humanized generally refers to a process of making an antibody or immunoglobulin binding proteins and polypeptides derived from a non-human species (e.g., mouse or rat) to be less immunogenic to humans, while still retaining antigen-binding properties of the original antibody, using genetic engineering techniques. In some embodiments, the binding domain(s) of an antibody or an immunoglobulin binding protein or polypeptide (e.g., light and heavy chain variable regions, Fab, scFv) are humanized. Non-human binding domains can be humanized using techniques known as CDR grafting, including reshaping, hyperchimerization, and veneering. If derived from a non-human source, other regions of the antibody or immunoglobulin binding proteins and polypeptides, such as the hinge region and constant region domains, can also be humanized.
[0033] As used herein, a single chain variable fragment (scFv) means a single chain polypeptide derived from an antibody which retains the ability to bind to an antigen. An example of the scFv includes an antibody polypeptide which is formed by a recombinant DNA technique and in which Fv regions of immunoglobulin heavy chain (H chain) and light chain (L chain) fragments are linked via a spacer sequence. Various methods for preparing an scFv are known to a person skilled in the art.
[0034] As used herein, a tumor antigen means a biological molecule having antigenecity, expression of which causes cancer.
Description
[0035] The present invention provides CD47-CAR and CD47-CAR-T cells that target CD47 tumor antigen which is highly overexpressed in many types of cancer such as ovarian, bladder, leukemia and lymphoma. The present invention designs CAR (chimeric antigen receptor)-T cells that bind to CD47 antigen. The invention uses ScFv (single chain variable fragment) from mouse CD47 antibody and humanized CD47 antibody to generate CD47-CAR-T cells for targeting different cancer cell lines. The CD47-CAR-T cells of the present invention have high cytotoxic activity against several cancer cells: pancreatic and ovarian cancer lines. The humanized scFv has an advantage in that it decreases potential immune response against mouse sequence in patients.
[0036] The present invention is directed to a chimeric antigen receptor (CAR) fusion protein comprising from N-terminus to C-terminus: (i) a single-chain variable fragment (scFv) comprising V.sub.H and V.sub.L, wherein scFv has a high affinity against CD47, (ii) a transmembrane domain, (iii) a co-stimulatory domain of CD28, and (iv) an activating domain. The CAR may further comprise a second scFv in (i), wherein the second scFv is against another tumor antigen such as Epidermal growth factor receptor (EGFR); such CAR is referred to as a bispecific CAR.
[0037] The CAR construct (
[0038] The CAR of the present invention comprises a single chain variable fragment (scFv) that binds specifically to human CD47. The heavy chain (H chain) and light chain (L chain) fragments of an anti-CD47 antibody are linked via a linker sequence. For example, a linker can be 5-20 amino acids. The scFv structure can be VL-linker-VH, or VH-linker-VL, from N-terminus to C-terminus.
[0039] The CAR of the present invention comprises a transmembrane domain which spans the membrane. The transmembrane domain may be derived from a natural polypeptide, or may be artificially designed. The transmembrane domain derived from a natural polypeptide can be obtained from any membrane-binding or transmembrane protein. For example, a transmembrane domain of a T cell receptor ? or ? chain, a CD3 zeta chain, CD28, CD3-epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, ICOS, CD154, or a GITR can be used. The artificially designed transmembrane domain is a polypeptide mainly comprising hydrophobic residues such as leucine and valine. It is preferable that a triplet of phenylalanine, tryptophan and valine is found at each end of the synthetic transmembrane domain. In preferred embodiments, the transmembrane domain is derived from CD28 or CD8, which give good receptor stability.
[0040] In the present invention, the co-stimulatory domain is selected from the group consisting of human CD28, 4-1BB (CD137), ICOS-1, CD27, OX 40 (CD137), DAP10, and GITR (AITR).
[0041] The endodomain (the activating domain) is the signal-transmission portion of the CAR. After antigen recognition, receptors cluster and a signal is transmitted to the cell. The most commonly used endodomain component is that of CD3-zeta (CD3 Z or CD3?), which contains 3 ITAMs. This transmits an activation signal to the T cell after antigen is bound. CD3-zeta may not provide a fully competent activation signal and additional co-stimulatory signaling may be needed. For example, one or more co-stimulating domains can be used with CD3-Zeta to transmit a proliferative/survival signal.
[0042] The CAR fusion protein optionally comprises a FLAG tag located at N-terminus to scFv, or C-terminus to scFv, or between V.sub.H and V.sub.L. The FLAG tag needs to be in extracellular domain, and not in the intracellular domain. In addition to FLAG tag, other tags may be used in the construct. FLAG tag is a preferred tag because it does not cause immunogenicity and has decreased level of cytokine secretion.
[0043] The CAR of the present invention may comprise a signal peptide N-terminal to the ScFv so that when the CAR is expressed inside a cell, such as a T-cell, the nascent protein is directed to the endoplasmic reticulum and subsequently to the cell surface, where it is expressed. The core of the signal peptide may contain a long stretch of hydrophobic amino acids that has a tendency to form a single alpha-helix. The signal peptide may begin with a short positively charged stretch of amino acids, which helps to enforce proper topology of the polypeptide during translocation. At the end of the signal peptide there is typically a stretch of amino acids that is recognized and cleaved by signal peptidase. Signal peptidase may cleave either during or after completion of translocation to generate a free signal peptide and a mature protein. The free signal peptides are then digested by specific proteases. As an example, the signal peptide may derive from human CD8 or GM-CSF, or a variant thereof having 1 or 2 amino acid mutations provided that the signal peptide still functions to cause cell surface expression of the CAR.
[0044] The CAR of the present invention may comprise a spacer sequence as a hinge to connect scFv with the transmembrane domain and spatially separate antigen binding domain from the endodomain. A flexible spacer allows to the binding domain to orient in different directions to enable its binding to a tumor antigen. The spacer sequence may, for example, comprise an IgG1 Fc region, an IgG1 hinge or a CD8 stalk, or a combination thereof. A human CD28 or CD8 stalk is preferred.
[0045] The present invention provides a nucleic acid encoding the CAR described above. The nucleic acid encoding the CAR can be prepared from an amino acid sequence of the specified CAR by a conventional method. A base sequence encoding an amino acid sequence can be obtained from the aforementioned NCBI RefSeq IDs or accession numbers of GenBenk for an amino acid sequence of each domain, and the nucleic acid of the present invention can be prepared using a standard molecular biological and/or chemical procedure. For example, based on the base sequence, a nucleic acid can be synthesized, and the nucleic acid of the present invention can be prepared by combining DNA fragments which are obtained from a cDNA library using a polymerase chain reaction (PCR).
[0046] The nucleic acid encoding the CAR of the present invention can be inserted into a vector, and the vector can be introduced into a cell. For example, a virus vector such as a retrovirus vector (including an oncoretrovirus vector, a lentivirus vector, and a pseudo type vector), an adenovirus vector, an adeno-associated virus (AAV) vector, a simian virus vector, a vaccinia virus vector or a Sendai virus vector, an Epstein-Barr virus (EBV) vector, and a HSV vector can be used. As the virus vector, a virus vector lacking the replicating ability so as not to self-replicate in an infected cell is preferably used.
[0047] For example, when a retrovirus vector is used, the process of the present invention can be carried out by selecting a suitable packaging cell based on a LTR sequence and a packaging signal sequence possessed by the vector and preparing a retrovirus particle using the packaging cell. Examples of the packaging cell include PG13 (ATCC CRL-10686), PA317 (ATCC CRL-9078), GP+E-86 and GP+envAm-12, and Psi-Crip. A retrovirus particle can also be prepared using a 293 cell or a 293T cell having high transfection efficiency. Many kinds of retrovirus vectors produced based on retroviruses and packaging cells that can be used for packaging of the retrovirus vectors are widely commercially available from many companies.
[0048] The present invention provides T cells modified to express the chimeric antigen receptor fusion protein as described above. CAR-T cells of the present invention bind to a human CD47 via the CAR, thereby a signal is transmitted into the cell, and as a result, the cell is activated. The activation of the cell expressing the CAR is varied depending on the kind of a host cell and an intracellular domain of the CAR, and can be confirmed based on, for example, release of a cytokine, improvement of a cell proliferation rate, change in a cell surface molecule, or the like as an index.
[0049] T cells modified to express the CAR can be used as a therapeutic agent for a disease. The therapeutic agent comprises the T cells expressing the CAR as an active ingredient, and may further comprise a suitable excipient. Examples of the excipient include pharmaceutically acceptable excipients known to a person skilled in the art.
[0050] The present invention demonstrates a high activity of CD47-CAR-T cells against cancer cell lines with a high expression of CD47. CD47-CAR-T cells of the present invention effectively killed ovarian, pancreatic and other cancer cells and produced high level of cytokines that correlated with expression of CD47 antigen. The present invention demonstrates that intra-tumor injection of CD47-CAR-T cells significantly decreased pancreatic BxPC3 xenograft tumor growth versus two controls: 1?PBS and CD24-CAR-T cells that were accompanied by increased human CD3 zeta IHC staining in CD47-CAR-T cell treated tumors versus control tumors.
[0051] The inventors have designed humanized CD47 ScFv that binds to human CD47 antigen by both ELISA and MC staining using human tumor samples. The humanized CD47 scFV has human frame sequences instead of mouse frame sequences flanking mouse CDR, and thus it decreases potential immune response against mouse ScFv. The humanized CD47 antibody has some mutations inside mouse CDR, which increases binding to CD47 antigen.
[0052] The humanized CD47-CAR-T cells of the present invention effectively killed cancer cell lines with a high expression of CD47 and did not kill and did not produce cytokines in CD47-negative cancer cells. Thus, mouse CD47-CAR-T cells and humanized CD47-CAR-T cells provides a cellular therapy for solid and hematological cancers.
[0053] This application shows a high specificity of CD47-CAR-T cells to CD47-positive cancer cells with a high expression of CD47 and an absence of CAR-T activity in target cells with low expression of CD47 such as Hela-CD19 cells. Thus, a therapeutic window exists where CD47-CAR-T cells affect only highly expressing CD-47 cells. In addition, CD47-CAR-T cells did not decrease mouse body weight, suggesting no toxic effect from CAR-T cells. Different approaches of CAR-T cell regulation such as switch-on, switch-off mechanisms; bi-specific CARs; regulation of cytokines involved in cytokine release syndrome and other approaches may be applied to increase safety and to overcome the major challenges of this CAR-T cell therapy.
[0054] Intra-tumor injection of CD47-CAR-T cells increases the safety of these cells. The majority of CD47-CAR-T cells are localized inside tumors and not in the blood. Thus, regional intra-tumor delivery of CD47-CAR-T cells is a feasible approach in clinic. Regional delivery of CD47-CAR-T cells may be advantageous for increased safety by direct delivery of CAR-T to tumors with less repressive effects of microenvironments and other mechanisms.
[0055] CD47 is also highly expressed in cancer stem cells, which are the most aggressive type of tumor cells. Thus, CD47-CAR-T cells can be used to target cancer stem cells. The present invention demonstrates an approach to target cancer cells with CD47-CAR-T cells. It demonstrates the high efficacy of CD47-CAR-T cells against cancer cells in vitro and in vivo and provides an anti-cancer cellular therapeutics.
[0056] Bispecific CD47- and another tumor antigen (EGFR, HER-2, VEGFR, etc.) CAR-T cells can be used for immunotherapy. The construct of the bispecific CAR-T cells contains a first scFv against CD47, and a second scFv against a second tumor antigen. CAR-T cells with bispecific antibodies can target cancer cells that overexpress two tumor antigens more effectively and specifically than CAR-T cells with one single antibody. Bispecific CAR-T cells can be advantageous when one tumor antigen becomes down-regulated, because the bispecific CAR-T cells can target the other tumor antigen. EGFR scFv is illustrated in Example 14 of the present application. HER-2 scFv is reported in Sadelain et al (J. Immunol. 2009, 183:5563-5574), VEGFR scFv is reported in Chinnasamy et al (J. Clin. Invest. 2010, 120 (11): 3953-3968); which are incorporated in reference in their entirety.
[0057] Combination of CD47-CAR-T with CAR-T targeting other tumor antigens or tumor microenvironment antigens (VEGFR-1-3) (dual CAR-T) can be used to enhance activity of monotherapy CD47-CAR.
[0058] CD47 CAR-T can be used in combination with different chemotherapy: checkpoint inhibitors; targeted therapies, small molecule inhibitors, and antibodies.
[0059] Tag-(FLAG tag or other tag) conjugated CD47 scFv can be used for CAR constructs.
[0060] Third generation CAR-T or other co-activation signaling domains can be used for the same CD47-scFv inside CAR.
[0061] CD47-CAR-T cells can be used to activate phagocytosis and block don't eat signaling.
[0062] The following examples further illustrate the present invention. These examples are intended merely to be illustrative of the present invention and are not to be construed as being limiting.
EXAMPLES
Materials and Methods
Example 1
Cell Lines
[0063] Hela cells were purchased from the ATCC (Manassas, Va.) and cultured in DMEM with 10% FBS and 1% penicillin/streptomycin. Hela-CD19 cells with stable expression of CD19 were maintained in DMEM with 10% FBS, puromycin and penicillin/streptomycin.as described in Berahovich, et al., Front. Biosci. (Landmark Ed.) 2017, 22, 1644-1654. Human peripheral blood mononuclear cells (PBMC) were isolated from whole blood obtained in the Stanford Hospital Blood Center (Stanford, Calif., USA) according to IRB-approved protocol using Ficoll-Paque solution (GE Healthcare, Chicago, Ill.). HEK293FT cells from AlStem (Richmond, Calif., USA) were cultured in DMEM containing 10% FBS and penicillin/streptomycin. SKOV-3 cell line was obtained from ATCC and cultured in RPMI plus 10% FBS and penicillin/streptomycin. Normal human keratinocytes were obtained from the Lonza company and cultured in keratinocyte medium (Lonza, Anaheim, Calif.) according to the manufacturer's protocol. BxPC3, PANC-1, A1847, A375, A549 and Hep-3 B were obtained from ATCC and cultured in DMEM with 10% FBS and penicillin/streptomycin. The cell lines were authenticated by flow cytometry in our laboratory, using cell-specific surface markers or by ATCC.
Example 2
CAR Constructs
[0064] CD47 ScFv from B6H12 antibody was inserted using Nhe I and Xho I s between CD8-alpha signaling peptide, and CD8-alpha hinge, with down-stream fused CD28 transmembrane domain, CD28 co-activation domain and CD3 activation domain. This CD47-CAR construct was flanked by Xba I and Eco R I sites in pCD510 lentiviral vector (Systems Bioscience, Palo Alto, Calif.). The same construct was done with humanized CD47 ScFv and Mock control ScFv of intracellular protein, called humanized CD47 and Mock-CAR, respectively. CD24 ScFv from Promab Biotechnologies (Richmond, Calif.) CD24 (clone 4F4E10) antibody was used as above for the CD24-CAR construct. The CAR were synthesized and sequenced in both directions by Syno Biological (Beijing, China).
Example 3
Generation of CAR-Encoding Lentivirus
[0065] The lentiviral CARs were used for generation of lentivirus using 293 FT cells, Lentivirus Packaging Mix and transfection agent (Alstem, Richmond, Calif.) as described in Berahovich, et al. The virus titers were determined by quantitative RT-PCR using the Lenti-X qRT-PCR kit (Takara Bio, Mountain View, Calif.) according to the manufacturer's protocol and the 7900HT thermal cycler (Thermo Fisher Scientific, South San Francisco, Calif.). The lentiviral titers were expressed in pfu/mL and ranged 1-10?10.sup.8 pfu/mL.
Example 4
Generation and Expansion of CAR-T Cells
[0066] PBMC were suspended at 1?10.sup.6 cells/mL in AIM V-AlbuMAX medium (Thermo Fisher) containing 10% FBS with 300 U/mL IL-2 (Thermo Fisher). PBMC were activated with an equal number of CD3/CD28 Dynabeads (Thermo Fisher), and cultured in non-treated 24-well plates. At 24 and 48 h, lentivirus was added to the cultures at a multiplicity of infection (MOI) of 5 with 1 ?L of TransPlus transduction enhancer (AlStem). The CAR-T cells were counted every 2-3 days and fresh medium with 300 U/mL IL-2 was added to the cultures to maintain the cell density at 1?10.sup.6 cells/mL.
Example 5
Flow Cytometry
[0067] To measure CAR expression, 5?10.sup.5 cells were suspended in 100 ?L of buffer (1?PBS with 0.5% BSA) and incubated on ice with 1 ?L of human serum (Jackson Immunoresearch, West Grove, Pa., USA) for 10 min. Then 1 ?L of allophycocyanin (APC)-labeled anti-CD3 (eBioscience, San Diego, Calif., USA), 2 ?L of 7-aminoactinomycin D (7-AAD, BioLegend, San Diego, Calif., USA), and 2 ?L of anti-F(ab)2 or its isotype control was added, and the cells were incubated on ice for 30 min. The cells were rinsed with buffer, and acquired on a FACSCalibur (BD Biosciences, San Jose, Calif.). Cells were analyzed first for light scatter versus 7-AAD staining, then the 7-AAD.sup.? live gated cells were plotted for CD3 staining versus F(ab)2 staining or isotype control staining. In some experiments anti-F(ab)2 staining alone was done. For the mouse tumor studies, 100 ?L of blood was stained at room temperature for 30 min with 1 ?L of APC anti-CD3, 2 ?L of fluorescein isothiocyanate (FITC)-labeled anti-CD8a (eBioscience), 2 ?L of 7-AAD. Erythrocytes were lysed with 3.5 mL of RBC lysing solution (150 mM NH.sub.4Cl, 10 mM NaHCO.sub.3, 1 mM EDTA pH 8), then leukocytes were collected by centrifugation and rinsed with 2 mL of cold buffer before acquisition. For expression of CD47, mouse B6H12 antibody from (BioLegend) that was used according to the manufacturer's protocol at 10 m/mL concentration. For expression of CD24, mouse CD24 clone 4F4E10 (Promab Biotechnologies, Richmond, Calif., USA) was used at 10m/mL. The isotype IgG1 isotype antibody was used at 10 ?g/mL from (BioLegend).
Example 6
Real-Time Cytotoxicity Assay (RTCA)
[0068] Adherent target cells were seeded into 96-well E-plates (Acea Biosciences, San Diego, Calif., USA) at 1?10.sup.4 cells per well and monitored in culture overnight with the impedance-based real-time cell analysis (RTCA) iCELLigence system (Acea Biosciences). The next day, the medium was removed and replaced with AIM V-AlbuMAX medium containing 10% FBS?1?10.sup.5 effector cells (CAR-T cells or non-transduced T cells), in triplicate. The cells were monitored for another 2 days with the RTCA system, and impedance was plotted over time. Cytolysis was calculated as (impedance of target cells without effector cellsimpedance of target cells with effector cells)?100/impedance of target cells without effector cells.
Example 7
Cytokine ELISA Assay
[0069] The target cells were cultured with the effector cells (CAR-T cells or non-transduced T cells) at a 1:1 ratio (1?10.sup.4 cells each) in U-bottom 96-well plates with 200 ?L of AIM V-AlbuMAX medium containing 10% FBS, in triplicate. After 16 h the top 150 ?L of medium was transferred to V-bottom 96-well plates and centrifuged at 300 g for 5 min to pellet any residual cells. In some experiments supernatant after RTCA assay at E:T=10:1 was used for cytokine ELISA assays. The supernatant was transferred to a new 96-well plate and analyzed by ELISA for human cytokine levels (IFN-gamma, IL-2, IL-6) using kits from Thermo Fisher (South San Francisco, Calif.) according to the manufacturer's protocol.
Example 8
Mouse Xenograft Tumor Growth
[0070] Six-week old male NSG mice (Jackson Laboratories, Bar Harbor, Me., USA) were housed and manipulated in strict accordance with the Institutional Animal Care and Use Committee (IACUC). Each mouse was injected subcutaneously with 2?10.sup.6 BxPC3 cells in sterile 1?PBS and then CAR-T cells were injected intratumorally with three doses: 2?10.sup.5 cells/mice; 2?10.sup.6 cells/mice; 2.8?10.sup.6 cells/mice doses at days 20, 27, and 34 respectively, and the xenograft tumor growth was analyzed. Tumor sizes were measured with calipers twice-weekly and tumor volume (in mm.sup.3) was determined using the formula W.sup.2L/2, where W is tumor width and L is tumor length. Tumors were excised and fixed in 4% paraformaldehyde, then embedded in paraffin wax and stained by immunohistochemistry. At the end of the intravenous CAR-T cell study, 100 ?L of blood was collected and stained with different antibodies by flow cytometry as indicated above.
Example 9
Immunohistochemistry (IHC) Staining
[0071] Tumor tissue sections (4 ?m) were incubated in xylenes twice for 10 min, then hydrated in graded alcohols and rinsed in 1?PBS. Antigen retrieval was performed for 20 min in a pressure cooker using 10 mM citrate buffer, pH 6.0. The sections were cooled, rinsed with PBS, incubated in a 3% H.sub.2O.sub.2 solution for 10 min, and then rinsed with 1?PBS. The tissue sections were incubated in goat serum for 20 min and then incubated with rabbit anti-cleaved caspase-3 (Asp175, Cell Signaling Technology, Danvers, Mass., USA) or rabbit IgG (Jackson Immunoresearch, West Grove, Pa., USA) at 0.2 ?g/mL overnight at 4? C. The sections were rinsed with PBS, incubated with biotin-conjugated goat anti-rabbit IgG for 10 min, rinsed with PBS, incubated with streptavidin-conjugated peroxidase for 10 min, and rinsed with PBS. Finally, the sections were incubated in DAB substrate solution for 2-5 min, immersed in tap water, counterstained with hematoxylin, rinsed with water, and dehydrated in graded alcohols and xylenes. Coverslips were mounted with glycerin. Images were acquired on a DMB5-2231PL microscope (Motic, Xiamen, China) with Images Plus 2.0. software.
Example 10
Humanization of CD47 Antibody
[0072] The mouse B6H12 CDR was used for humanization using IgBLAST (NCBI) software according to the methods described in Almagro, et al. (Front. Biosci., 2008, 13, 1619-1633). The human frames of human clones with the highest homology were used for humanized pairs. Mouse CDR were inserted into these clones and four different variants were generated for testing by ELISA.
Example 11
Binding Assay with Humanized and Mouse CD47 scFv
[0073] The mouse or humanized CD47 ScFv contained VL and VH sequences that were linked with G4Sx3 linker. The ScFvs were fused in frame with C-terminal human Fc inside pYD11 vector used for recombinant CD47 ScFv protein expression. The supernatant with mammalian expressed ScFv protein were used for binding assay at equal amount. All ScFv were checked by Western blotting with anti-human Fc antibody for expression. The human extracellular domain (19-41 amino-acids) of human CD47 protein (Gen Bank ID: NM_001777.3) was fused with mouse Fc and used for ELISA assay with CD47 ScFv. The OD reading at 450 nm was used for detecting binding. The in silico model was generated for humanized VH and VL sequences based on the mouse sequences.
Results
Statistical Analysis
[0074] Data were analyzed and plotted with Prism software (GraphPad, San Diego, Calif.). Comparisons between two groups were performed by unpaired Student's t test, and comparisons between three groups were performed by one-way ANOVA with Tukey's post-hoc test, except where noted. The difference was considered significant with p-value<0.05.
Example 12
Mouse CD47 ScFv CAR Construct Sequence
[0075] The amino acid sequences of all segments of CD47 CAR constructs used in our experiments are shown below. Each segment can be replaced with an amino acid sequence having at least 95% identity.
TABLE-US-00001 <HumanCD8Signalpeptide> SEQIDNO:2 MALPVTALLLPLALLLHAARP
[0076] <Nhe I site> This site is optional for cutting out scFv if desired, and can be replaced by other restriction enzyme site.
[0077] AS
[0078] Mouse anti-CD47 scFv (VH-Linker-VL)
TABLE-US-00002 <VH> SEQIDNO:3 EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPD KRLEWVATITSGGTYTYYPDSVKGRFTISRDNAKNTLYLQIDS LKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSS <linker> SEQIDNO:4 GGGGSGGGGSGGGGS <VL> SEQIDNO:5 DIVMTQSPATLSVTPGDRVSLSCRASQTISDYLHWYQQKSHES PRLLIKFASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVGVYYC QNGHGFPRTFGGGTKLEIK
[0079] <Xho I site> This site is optional for cutting out scFv if desired, and can be replaced by other restriction enzyme site.
[0080] LE
TABLE-US-00003 <CD8hinge> SEQIDNO:6 KPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVHTRGLDF ASDKP <TransmembraneDomainTM28> SEQIDNO:7 FWVLVVVGGVLACYSLLVTVAFIIFWV <Co-stimulatingdomainCD28> SEQIDNO:8 RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS <ActivationdomainCD3-zeta> SEQIDNO:9 RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRD PEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGK GHDGLYQGLSTATKDTYDALHMQALPPR MouseCD47ScFvCARsequencecanbeshownas SEQIDNO:10: MALPVTALLLPLALLLHAARPASEVQLVESGGDLVKPGGSLKL SCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPD SVKGRFTISRDNAKNTLYLQIDSLKSEDTAIYFCARSLAGNAM DYWGQGTSVTVSSGGGGSGGGGSGGGGSDIVMTQSPATLSVT PGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIKFASQSISGIP SRFSGSGSGSDFTLSINSVEPEDVGVYYCQNGHGFPRTFGGGT KLEIKLEKPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAVH TRGLDFASDKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRS RLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRS ADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP QRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR
[0081] A mock CAR with an scFv specific for an intracellular proteinand thus not reactive with intact cellscan be constructed in the same manner.
Example 13
Humanized CD47 ScFv CAR Construct Sequence
[0082] The bioinformatics approach was performed to humanize VH and VL of the mouse CD47 antibody B6H12 according to the method described by Almagro, et al., Front. Biosci. 2008, 13, 1619-1633; and Gilliland, et al., Methods Mol. Biol., 2012, 841, 321-349.
[0083] The amino acid sequence of all segments of humanized CD47 ScFv CAR construct used in our experiments are the same as those shown in Example 12, except the scFv of mouse anti-CD47 sequence is replaced with a humanized anti-CD47 sequence as shown below. Each segment can be replaced with an amino acid sequence having at least 95% sequence identity.
TABLE-US-00004 Humanizedanti-CD47scFv(VH-Linker-VL) <VH> SEQIDNO:11 EVQLVESGGGLVQPGGSLRLSCAASGFTFSGYGMSWVRQAPGKGLEWVAT ITSGGTYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSL AGNAMDYWGQGTLVTVSS <linker> SEQIDNO:4 GGGGSGGGGSGGGGS <VL> SEQIDNO:12 EIVLTQSPATLSLSPGERATLSCRASQSISDYLHWYQQKPGQAPRLLIYF ASQRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQGHGFPRTFGG GTKVEIK HumanizedCD47scFvisshownasSEQIDNo:13: EVQLVESGGGLVQPGGSLRLSCAASGFTFSGYGMSWVRQAPG KGLEWVATITSGGTYTYYPDSVKGRFTISRDNAKNSLYLQMNS LRAEDTAVYYCARSLAGNAMDYWGQGTLVTVSSGGGGSGGG GSGGGGSEIVLTQSPATLSLSPGERATLSCRASQSISDYLHWYQ QKPGQAPRLLIYFASQRATGIPARFSGSGSGTDFTLTISSLEPED FAVYYCQQGHGFPRTFGGGTKVEIK HumanizedCD47ScFvCARcanbeshownasSEQID NO:14: MALPVTALLLPLALLLHAARPASEVQLVESGGGLVQPGGSLRL SCAASGFTFSGYGMSWVRQAPGKGLEWVATITSGGTYTYYPD SVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARSLAGNA MDYWGQGTLVTVSSGGGGSGGGGSGGGGSEIVLTQSPATLSLS PGERATLSCRASQSISDYLHWYQQKPGQAPRLLIYFASQRATGI PARFSGSGSGTDFTLTISSLEPEDFAVYYCQQGHGFPRTFGGGT KVEIKLEKPTTTPAPRPPTPAPTIASQPLSLRPEASRPAAGGAV HTRGLDFASDKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKR SRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSR
Example 14
Bispecific EGFR-Flag-CD47-CD28-CD3 CAR Construct
[0084] The amino acid sequences of each segment of EGFR-Flag-CD47 ScFv CAR construct used in our experiments are the same as those shown in Example 12, except the scFv of EGFR, FLAG, and linker sequences are added at the N-terminal end of mouse anti-CD47 sequence as shown below. Each segment can be replaced with an amino acid sequence having at least 95% sequence identity.
TABLE-US-00005 Humananti-EGFRscFv(VH-Linker-VL-FLAG-Linker) <VH> SEQIDNO:15 EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQ GLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLR SEDTAVYYCAREEGPYCSSTSCYGAFDIWGQGTLVTVSS <linker> SEQIDNO:4 GGGGSGGGGSGGGGS <VL> SEQIDNO:16 QSVLTQDPAVSVALGQTVKITCQGDSLRSYFASWYQQKPGQA PTLVMYARNDRPAGVPDRFSGSKSGTSASLAISGLQSEDEADY YCAAWDDSLNGYLFGAGTKLTVL <FLAG> SEQIDNO:1 FLAGtagisoptional,forthepurposeofdetecting expression., <linker> SEQIDNO:4 BispecificEGFR-CD47ScFvCARsequencecanbe shownasSEQIDNO:17: MALPVTALLLPLALLLHAARPASEVQLVQSGAEVKKPGSSVKV SCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQK
Example 15
Mouse CD47-CAR-T Cells Kill CD47-Positive Cancer Cells
[0085] The CD47 ScFv was used to generate second generation CAR-T cells, CD47-CAR-T cells with CD28 co-stimulatory domain and CD zeta activation domain (
[0086] The CD47-CAR-T cells produced 11-2 cytokine against cancer cells that was significantly higher in SKOV3 cells, highly positive for CD47 than in A549 and Hep3B cells with lower expression of CD47 (
Example 16
CD47-CAR-T Cells Significantly Decrease BxPC3 Pancreatic Cancer Xenograft Tumor Growth
[0087] To test in vivo efficacy of CD47-CAR-T cells, we used BxPC3 pancreatic cancer cells. We compared CD47-CAR-T cytotoxicity with Mock CAR-T control cells and CD24-CAR-T cells.
[0088] In addition, CD47-CAR-T cells expressed a significantly higher level of cytokines: IFN-gamma, IL-2 versus Mock and CD24-CAR-T cells (
Example 17
Humanized CD47 ScFv Effectively Binds CD47 Antigen and Detects CD47 in Tumor Samples
[0089] A humanized version of CD 47 ScFv with a high affinity to the CD47 antigen is shown in
[0090] As to VL, the humanized version of CD47 antibody had three amino-acid changes in CDR2 and one amino acid changes in CDR3 region in VL versus mouse B6H12 (CDRs are all underlined and in italics, changes in CDR are shown in larger font and bold; CDR3 region is important for binding with antigen) (
[0091] We tested binding of humanized CD47 ScFv by ELISA (
Example 18
Humanized CD47-CAR-T Cells Effectively Kill Cancer Cells in a CD47dependent Manner
[0092] We tested humanized CD47-CAR T cells against CD47 high-expressing ovarian: SKOV-3, A1847 and pancreatic, BxPC3 cancer cell lines, and low-expressing Hela-CD19 cancer cell line (
Example 19
Bi-specific EGFR-CD47CAR-T Cells Kill Cancer Cells
[0093] We generated bi-specific CAR by linking EGFR (C10) human antibody scFv-FLAG with CD47 scFv using G4Sx3 linker. (see Example 14).
[0094] Bi-specific EGFR-CD47 CAR-T cells killed EGFR-negative MCF-7 cells demonstrating CD47-specific activity (
[0095] It is to be understood that the foregoing describes preferred embodiments of the present invention and that modifications may be made therein without departing from the scope of the present invention as set forth in the claims.