SMALL MOLECULE BCL-2 FUNCTIONAL CONVERTERS AS CANCER THERAPEUTICS
20190336469 ยท 2019-11-07
Assignee
Inventors
- Siva K. Kolluri (Corvallis, OR, US)
- Prasad R. Kopparapu (Houston, TX, US)
- Martin Pearce (Independence, OR, US)
Cpc classification
A61K31/519
HUMAN NECESSITIES
A61K31/519
HUMAN NECESSITIES
A61K31/167
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
A61K38/16
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
International classification
A61K31/341
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
Abstract
Methods for inducing growth inhibition or apoptosis of Bcl-2-expressing cells and treatments of Bcl-2 expressing cancers are provided. Additionally, assays for agents that can induce apoptosis of Bcl-2 expressing cells are disclosed.
Claims
1. A method for inducing growth inhibition or apoptosis of a Bcl-2-expressing cell, comprising contacting a Bcl-2-expressing cell with an agent that exposes the BH3 domain of Bcl-2 thereby converting Bcl-2 into a pro-apoptotic protein and activating the intrinsic apoptosis pathway.
2-5. (canceled)
6. A method of treating Bcl-2-expressing cancer in a subject, comprising administering to a subject in need of cancer treatment, a therapeutically effective amount of an agent that exposes the BH3 domain of Bcl-2 thereby converting Bcl-2 into a pro-apoptotic protein.
7-10. (canceled)
11. The method of claim 6, wherein the cancer is breast cancer, blood cancer, lymphoma, or lung cancer.
12. The method of claim 6, further comprising administering an effective amount of an agent that increases Bcl-2 expression.
13. The method of claim 6, wherein the method is used in combination with radiation therapy.
14. The method of claim 6, further comprising administering an effective amount of folate or leucovorin.
15. The method of claim 6, wherein the cancer is resistant to paclitaxel.
16. (canceled)
17. The method of claim 1, wherein the agent is a compound of Formula (I): ##STR00064## or an isomer, tautomer, hydrate, or salt thereof, wherein: Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; and Ar.sup.2 is H, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl.
18. The method of claim 17, wherein the compound of Formula (I) is N-2-benzyl-N-1-(4-butylphenyl)-N-2-(methylsulfonyl) glycinamide.
19. The method of claim 1, wherein the agent is 5-chloro-N-(2-ethoxyphenyl)-2-[(4-methoxybenzoyl)amino]-benzamide.
20. The method of claim 1, wherein the agent is a compound of Formula (II): ##STR00065## or an isomer, tautomer, hydrate, or salt thereof, wherein: Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; Ar.sup.2 is optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl; and R.sup.1, R.sup.2, R.sup.3, and R4 are independently H, halogen, optionally substituted C1-C8 alkyl, optionally substituted C1-C8 alkenyl, optionally substituted C1-C8 alkynyl, O(C1-C8 alkyl), or C(O)NHR, wherein R is optionally substituted C1-C8 alkyl, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl.
21. The method of claim 20, wherein the compound of Formula (II) is 3,5-dichloro-N-(2-ethoxyphenyl)-2-[(3-nitrobenzoyl)amino]benzamide or 2-[(4-methoxybenzoyl)-amino]-N-(2-{[(2-methoxyphenyl)amino]carbonyl}phenyl)benzamide.
22. The method of claim 1, wherein the agent is a compound of Formula (III): ##STR00066## or an isomer, tautomer, hydrate, or salt thereof, wherein: Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; R.sup.1 and R.sup.2 are independently H, halogen, optionally substituted C1-C8 alkyl, optionally substituted C1-C8 alkenyl, optionally substituted C1-C8 alkynyl, O(C1-C8 alkyl), or C(O)NHR, wherein R is optionally substituted C1-C8 alkyl, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl; or together with the carbon atoms to which each is attached, R.sup.1 and R.sup.2 form an optionally substituted 6-membered cycle; Y is COOH, CONH.sub.2, optionally substituted C6-C10 aryl, optionally substituted C5-C10 heteroaryl, or C(O)X; and X is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl.
23. The method of claim 22, wherein the compound of Formula (III) is 2-[(2-methoxy-5-nitrobenzyl)thio]-3-phenyl-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4(3H)-one or 2-({2-[1-(2-methoxyethyl)-2,5-dimethyl-1H-pyrrol-3-yl]-2-oxoethyl}thio)-5,6-dimethyl-3-phenylthieno[2,3-d]pyrimidin-4(3H)-one.
24. The method of claim 1, wherein the cell is a cancer cell.
25. The method of claim 24, wherein the cancer cell is resistant to paclitaxel.
26. The method of claim 6, wherein the agent is a compound of Formula (I): ##STR00067## or an isomer, tautomer, hydrate, or salt thereof, wherein: Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; and Ar.sup.2 is H, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl.
27. The method of claim 26, wherein the compound of Formula (I) is N-2-benzyl-N-1-(4-butylphenyl)-N-2-(methylsulfonyl)glycinamide.
28. The method of claim 6, wherein the agent is 5-chloro-N-(2-ethoxyphenyl)-2-[(4-methoxybenzoyl)amino]-benzamide.
29. The method of claim 6, wherein the agent is a compound of Formula (II): ##STR00068## or an isomer, tautomer, hydrate, or salt thereof, wherein: Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; Ar.sup.2 is optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl; and R.sup.1, R.sup.2, R.sup.3, and R4 are independently H, halogen, optionally substituted C1-C8 alkyl, optionally substituted C1-C8 alkenyl, optionally substituted C1-C8 alkynyl, O(C1-C8 alkyl), or C(O)NHR, wherein R is optionally substituted C1-C8 alkyl, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl.
30. The method of claim 29, wherein the compound of Formula (II) is 3,5-dichloro-N-(2-ethoxyphenyl)-2-[(3-nitrobenzoyl)amino]benzamide or 2-[(4-methoxy-benzoyl)-amino]-N-(2-{[(2-methoxyphenyl)amino]carbonyl}phenyl)benzamide.
31. The method of claim 6, wherein the agent is a compound of Formula (III): ##STR00069## or an isomer, tautomer, hydrate, or salt thereof, wherein: Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; R.sup.1 and R.sup.2 are independently H, halogen, optionally substituted C1-C8 alkyl, optionally substituted C1-C8 alkenyl, optionally substituted C1-C8 alkynyl, O(C1-C8 alkyl), or C(O)NHR, wherein R is optionally substituted C1-C8 alkyl, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl; or together with the carbon atoms to which each is attached, R.sup.1 and R.sup.2 form an optionally substituted 6-membered cycle; Y is COOH, CONH.sub.2, optionally substituted C6-C10 aryl, optionally substituted C5-C10 heteroaryl, or C(O)X; and X is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl.
32. The method of claim 31, wherein the compound of Formula (III) is 2-[(2-methoxy-5-nitrobenzyl)thio]-3-phenyl-5,6,7,8-tetrahydro[1]benzothieno[2,3-d]pyrimidin-4(3H)-one or 2-({2-[1-(2-methoxyethyl)-2,5-dimethyl-1H-pyrrol-3-yl]-2-oxoethyl}thio)-5,6-dimethyl-3-phenylthieno[2,3-d]pyrimidin-4(3H)-one.
33. The method of claim 6, further comprising administering an effective amount of paclitaxel.
Description
DESCRIPTION OF THE DRAWINGS
[0069] The foregoing aspects and many of the attendant advantages of this invention will become more readily appreciated as the same become better understood by reference to the following detailed description, when taken in conjunction with the accompanying drawings, wherein:
[0070]
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
[0134]
[0135]
[0136]
[0137]
[0138]
[0139]
[0140]
[0141]
[0142]
[0143]
[0144]
[0145]
[0146]
[0147]
[0148]
[0149]
[0150]
[0151]
[0152]
[0153]
[0154]
[0155]
[0156]
[0157]
[0158]
[0159]
[0160]
[0161]
[0162]
[0163]
[0164]
[0165]
[0166]
[0167]
DETAILED DESCRIPTION OF THE INVENTION
[0168] There is a great deal of interest in developing small molecule inhibitors of Bcl-2 for cancer therapy. This is due to the role of Bcl-2 family of proteins in regulating cellular survival and resistance to cancer therapies.
[0169] The Bcl-2 functional conversion from its anti-apoptotic form to a pro-apoptotic form is induced by binding of orphan nuclear receptor, Nur77. Nur77 or Nur77-derived peptide NuBCP-9 bind to the unstructured loop domain of Bcl-2 and expose its BH3 domain, which converts Bcl-2 from an anti-apoptotic protein into a pro-apoptotic (pro-death) protein. Based on this functional conversion mechanism, the inventors discovered that small molecules that mimic the functional activity of NuBCP-9 peptide can accomplish such conversion of Bcl-2 (
[0170] The three specific goals of this research are to 1) identify small molecules that can preferentially induce apoptosis in Bcl-2-overexpressing triple negative breast cancer cells, 2) test if these small molecules interact with Bcl-2, expose its BH3 domain and induce Bcl-2-dependent cell death, and 3) establish the efficacy of the identified small molecules in human primary and metastatic triple negative breast cancer xenograft mouse models.
[0171] To address these goals, the inventors designed a screening assay using human triple negative breast cancer cells (MDA-MB-231) with Bcl-2 overexpression along with their vector controls and screened small molecule libraries of either existing drugs or novel small molecules for Bcl-2-dependent effects on cell survival. Small molecules identified by this approach were revalidated based on their ability to preferentially induce cell death in Bcl-2 overexpressing MDA-MB-231 cells as compared to their vector control cells. Thus, the work invention provides methods for identification and testing of small molecule BFCs that have the potential in treating stubborn cancers that are dependent on Bcl-2 expression, methods for inducing apoptosis in cancer cells by BFCs, and methods of treatment of Bcl-2-overexpressing cancers or cancers that depend on Bcl-2 with small molecule BFCs.
1. Small Molecule Functional Converters of Bcl-2
[0172] In one aspect, provided herein are methods for inhibiting growth and/or inducing apoptosis of a Bcl-2-expressing cells, comprising treating or contacting a Bcl-2-expressing cells with an agent that exposes the BH3 domain of Bcl-2 thereby converting Bcl-2 into a pro-apoptotic protein and activating the intrinsic apoptosis pathway. In some embodiments, the cell is ex vivo. In other embodiments, the cell is in vivo, e.g., a human tumor cell.
[0173] In another aspect, provided herein methods of treating Bcl-2-expressing cancers in a subject comprising administering to a subject with a Bcl-2-expressing cancer a therapeutically effective amount of an agent that exposes the BH3 domain of Bcl-2 thereby converting Bcl-2 into a pro-apoptotic protein. In some embodiments, the cancer is selected from blood cancer, breast cancer, and lung cancer. In certain embodiments, the cancer is non-small cell lung cancer or triple-negative breast cancer.
[0174] In some embodiments, the agent of the methods of the invention is a small molecule, i.e., an organic compound with the molecular weight of about 900 daltons or less. In certain embodiments, the agent of the methods of the invention is a small molecule mimic of NuBCP-9 peptide. As used herein, a small molecule mimic of NuBCP-9 peptide is a small molecule that mimics binding of NuBCP-9 peptide to the loop domain of Bcl-2. In some embodiments, the small molecule mimic of NuBCP-9 peptide is non-peptidic.
[0175] There is a great deal of interest in developing small molecule inhibitors of Bcl-2 for cancer therapy. This is due to the role of Bcl-2 family of proteins in regulating cellular survival and resistance to cancer therapies. However, a new mechanism by which Bcl-2 is converted into a pro-death molecule was demonstrated using a 9 amino acid peptide, NuBCP-9 derived from the orphan nuclear receptor Nur77. This functional conversion mechanism has a great deal of advantages as compared to inhibition, for cancer therapy. The inventors hypothesized sought to discover and develop small molecule mimetics of Nur77 or NuBCP-9 to selectively target cancers expressing Bcl-2. For this a functional screen was designed using triple negative breast cancer cells MDA-MB-231 with high and low expression of Bcl-2. The inventors found a number of small molecules that can selectively induce death in cells with high expression of Bcl-2. These small molecules could be further developed as successful therapies for treating cancers expressing Bcl-2 protein.
[0176] In cancer cells, the Bcl-2 family of proteins promotes cellular survival often by upregulation of its anti-death members (References 1-4). This phenomenon has made the Bcl-2 family of proteins an attractive target for developing targeted therapies in particular cancer types (Reference 5). As cancer cells depend on one or more of these Bcl-2 proteins for survival and development of resistance, targeting them makes an attractive proposal for drug development (Reference 5). The anti-apoptotic Bcl-2 proteins Bcl-2, Bcl-xL, Mcl-1, Bcl-w and Bfl-1 inhibit apoptosis by neutralizing the BH3 domains of pro-apoptotic proteins. This interaction happens between the BH3 domain of pro-apoptotic proteins and a groove formed by helices 2 (BH3) and parts of 3, 4, 5 (BH1) and 8 (BH2) of the anti-apoptotic proteins (Reference 5). This pocket is usually targeted by inhibitors to neutralize the protection mechanisms of the anti-apoptotic proteins (Reference 6). To inhibit the over-expression of anti-apoptotic proteins, numerous efforts to develop anti-sense molecules, peptide based inhibitors and small molecule inhibitors are at various stages of development (Reference 7-10).
[0177] There have been multiple approaches employed in the discovery of inhibitors of anti-apoptotic proteins (Reference 11). Screening assays were designed using small molecule screens and structure-based methodologies to identify an array of small molecules and peptides with various degrees of activity and specificity (Reference 12-15). While some peptides were based on the BH3 domains of pro-apoptotic proteins some were derived from completely different mechanism like NuBCP-9 from Nur77 protein (Reference 16-18). Whether peptide or small molecule, the goal of these inhibitors is to displace pro-apoptotic family members and restore the apoptotic pathway. Small molecules have an edge over peptides, in that, they are more stable and can be made cell-permeable making them easy to test their activity in animal models. Various techniques have been used to design high throughput screening assays for the discovery of small molecules that can disrupt the interaction between the hydrophobic groove of the anti-apoptotic proteins with the a helix of the pro-apoptotic proteins (Reference 19). Fluorescence polarization assays detected the very first small molecule disruptor of Bcl-xL/Bak BH3 and Bcl-xL/BAD BH3 by competitive binding, revealing the BH3I class of small molecules that could induce apoptosis (References 16, 20). Of note are the ABT-737 series of compounds that were initially discovered by high throughput biochemical screening; ABT-263 and ABT-199 are advancing in clinical trials showing efficacy in Bcl-2 dependent cancers (References 21-25). However, when a specific chemical inhibitor is used to block the activity of one protein, the cancer cells over-express other anti-apoptotic proteins as a resistance mechanism to avoid cell death (References 26-28). Pan chemical inhibitors that block multiple anti-apoptotic Bcl-2 members will likely have systemic toxicity.
[0178] A disadvantage to using inhibitors of the Bcl-2 family is that resistance is highly likely, and therefore, novel mechanisms of targeting the Bcl-2 proteins are desirable. Nur77 an orphan nuclear receptor interacts with Bcl-2 in mitochondria and changes its conformation exposing its BH3 domain (Reference 17). This was further demonstrated using a peptide derived from Nur77; NuBCP-9, a 9 amino acid peptide which binds to the loop domain of the Bcl-2 protein and changes its conformation to expose its BH3 domain. This exposure of the BH3 domain makes the Bcl-2 protein a pro-apoptotic protein (Reference 18). What sets apart this functional conversion of Bcl-2 from its inhibitors is that this changed conformation of Bcl-2 not just disrupts the interaction of anti-apoptotic Bcl-2 with its pro-apoptotic binding partners but Bcl-2 now acts like a pro-apoptotic protein wherein it can neutralize other anti-apoptotic proteins and activate multi-domain pro-apoptotic proteins. NuBCP-9 was also shown to be targeting Bcl-B in addition to Bcl-2 (Reference 29). Therefore this functional conversion mechanism could be a better alternative to inhibitors which are susceptible to resistance due to over-expression of anti-apoptotic proteins not inhibited in the treatment regimen. The use of NuBCP-9 peptide is limited with the use of cell penetrating peptide (CPP) due to stability issues in vivo and to achieve a desirable pharmacokinetic profile (Reference 30). There is however some promising developments in the delivery of NuBCP-9 peptide using polymeric nanoparticles (Reference 31, 32). The inventors hypothesized that small molecule functional converters of Bcl-2 could be developed to use as therapeutics in Bcl-2 dependent and Bcl-2 expressing cancers.
[0179] In some embodiments, provided herein are methods for identification of small molecule agents, or BFCs, that can selectively convert Bcl-2 protein from its anti-apoptotic form into its pro-apoptotic form. In certain embodiments, the method is a method of screening for an agent that converts Bcl-2 from an anti-apoptotic protein into a pro-apoptotic protein, comprising: [0180] (a) contacting a first population of cells with an agent, wherein the first population of cells expresses or overexpresses Bcl-2; [0181] (b) determining the cell viability of the first population of cells; [0182] (c) contacting a second population cells with the agent, wherein the second population of cells has no expression of Bcl-2 or expression of Bcl-2 lower than first cell population; and [0183] (d) determining the cell viability of the second population of cells; [0184] (e) comparing the cell viability of the first and second populations of cells to determine whether the agent converts Bcl-2 from an anti-apoptotic protein into a pro-apoptotic protein.
[0185] In some embodiments, identification of the selective BFCs is accomplished by screening of libraries of compounds using the assays provided herein. An exemplary library is the LOPAC, 1280 is a chemical library of 1280 pharmacologically active compounds. The master library plate consists of 80 compounds per 96 well plate at 10 mM concentration dissolved in DMSO. A screening plate was made by diluting the master plate to yield 1 mM concentration, so as to treat the cells at a final concentration of 10 M. Screening this library would reveal if any known therapeutics specifically target Bcl-2 and if they are effective in treating Bcl-2 overexpressing cancers.
[0186] Another exemplary embodiment, is the ChemBridge DIVERset library, a more diverse library with a broad range of pharmacophore structural diversity. The ChemBridge library was also prepared by diluting the master plate from 10 mM to 1 mM in a 96 well plate format with 80 compounds per plate.
[0187] In some embodiments, in vitro methods of screening for agents that convert Bcl-2 from its anti-apoptotic to its pro-apoptotic form are provided. In certain embodiments, the screening methods comprise contacting a first population of cells expressing or overexpressing Bcl-2 and a second population of cells, wherein the second population does not express Bcl-2 or expresses less Bcl-2 compared to the first population of cells, with the agent and comparing cell viability of the two cell populations.
[0188] In one example, a triple negative breast cancer cell line, MDA-MB-231, was used for screening these libraries. The MDA-MB-231 cells were transfected to stably express high levels of Bcl-2 (MDA-MB-231/Bcl-2) along with their vector controls (MDA-MB-231/Vector) (
[0189] Hits from the primary screen were reconfirmed using the compounds from the library plates. About 15 hits from LOPAC library and about 240 hits from ChemBridge library were retested for confirmation. Of the 15 hits from LOPAC library only 5 hits were reconfirmed and of the 240 hits from the ChemBridge library only 26 were reconfirmed. The reconfirmed compounds were then re-ordered in higher amounts to be revalidated. Of the re-ordered compounds only 2 compounds from the LOPAC screen and 6 compounds from the ChemBridge library were revalidated. The structure and IUPAC names of these revalidated compounds are given in Table 1. These compounds were further characterized for their role in changing conformation of Bcl-2 and inducing apoptosis in a Bcl-2 dependent way.
[0190] In order to optimize the revalidated compounds for better potency and drug like properties, structural analogs were tested in a similar manner as the initial screening. The closest structural analogs were selected based on the availability from the chemical suppliers at the time of revalidation. Table 2 contains the structural analogs of BFC1103 along with their IUPAC names. Of the analogs of BFC1103, only BFC1103 showed Bcl-2 dependency and thus was selected for further characterization.
TABLE-US-00001 TABLE 1 Revalidated hits form LOPAC and ChemBridge Libraries Name IUPAC Name Structure Methotrexate (2S)-2-[[4-[(2,4 diaminopteridin-6- yl)methylmethylamino] benzoyl]amino] pentanedioc acid
TABLE-US-00002 TABLE 2 Structural analogs of BFC1103. Six structural analogs (A-F) were obtained from ChemBridge. Analogs were selected based on subtle changes in side group chemistry. Name IUPAC Name Structure BFC1103-A N~2~-benzyl-N~1~-(3,4- dimethylphenyl)-N~2- (methylsulfonyl) glycinamide
TABLE-US-00003 TABLE 3 Structural analogs of BFC1108. Six structural analogs (A-F) were obtained from ChemBridge. Analogs were selected based on subtle changes in side group chemistry. Name IUPAC Name Structure BFC1108-A 3-chloro-4-ethoxy-N-(2- ethoxyphenyl)-benzamide
TABLE-US-00004 TABLE 4 Structural analogs of BFC1110. Eight structural analogs (A-H) were obtained from ChemBridge. Analogs were selected based on subtle changes in side group chemistry. Name IUPAC Name Structure BFC1110-A 2-[(2-methoxy-5- nitrobenzyl)thio]-3-phenyl- 5,6,7,8-tetrahydro[1]benzo- thieno[2,3-d]pyrimidin-4(3 H)-one
TABLE-US-00005 TABLE 5 Structural analogs of BFC1111. Eight structural analogs (A-H) were obtained from ChemBridge. Analogs were selected based on subtle changes in side group chemistry. Name IUPAC Name Structure BFC1111-A 2-[(4-nitrobenzyl)thio]-3- phenyl-5,6,7,8-tetra- hydro[1]benzothieno[2,3- d]pyrimidin-4(3H)-one
[0191] In some embodiments, the agent of the methods disclosed herein is a structural analog of compound BFC1103. Such structural analogs of compound BFC1103 include compounds of Formula (I):
##STR00046##
its isomer, tautomer, hydrate, or salt,
wherein: [0192] Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; and [0193] Ar.sup.2 is H, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl.
[0194] In other embodiments, the agent of the methods disclosed herein is a structural analog of compound BFC1108. Such structural analogs of compound BFC1108 include compounds of Formula (II):
##STR00047## [0195] its isomer, tautomer, hydrate, or salt, [0196] wherein: [0197] Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; [0198] Ar.sup.2 is optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl; and [0199] R.sup.1, R.sup.2, R.sup.3, and R.sup.4 are independently H, halogen, optionally substituted C1-C8 alkyl, optionally substituted C1-C8 alkenyl, optionally substituted C1-C8 alkynyl, O(C1-C8 alkyl), or C(O)NHR, wherein R is optionally substituted C1-C8 alkyl, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl.
[0200] In certain embodiments, the agent of the methods disclosed herein is a structural analog of compound BFC1110 or BFC1111. Such structural analogs include compounds of Formula (III):
##STR00048## [0201] its isomer, tautomer, hydrate, or salt, [0202] wherein: [0203] Ar.sup.1 is optionally substituted C6-C10 aryl or optionally substituted C5-C10 heteroaryl; [0204] R.sup.1 and R.sup.2 are independently H, halogen, optionally substituted C1-C8 alkyl, optionally substituted C1-C8 alkenyl, optionally substituted C1-C8 alkynyl, O(C1-C8 alkyl), or C(O)NHR, wherein R is optionally substituted C1-C8 alkyl, optionally substituted C6-C10 aryl, or optionally substituted C5-C10 heteroaryl; or together with the carbon atoms to which each is attached, R.sup.1 and R.sup.2 form an optionally substituted 6-membered cycle; [0205] Y is COOH, CONH.sub.2, optionally substituted C6-C10 aryl, optionally substituted C5-C10 heteroaryl, or C(O)X; and [0206] X is optionally substituted C6-C10 aryl, optionally substituted C5-C10 heteroaryl, or optionally substituted C3-C10 heteroaryl.
[0207] As used herein, the terms alkyl, alkenyl, and alkynyl include straight-chain, branched-chain and cyclic monovalent hydrocarbyl radicals, and combinations of these, which contain only C and H when they are unsubstituted. Examples include methyl, ethyl, isobutyl, cyclohexyl, cyclopentylethyl, 2-propenyl, 3-butynyl, and the like. The total number of carbon atoms in each such group is sometimes described herein, e.g., when the group can contain up to ten carbon atoms it can be represented as 1-10 C or as C1-C10 or C1-10. The term heteroalkyl, heteroalkenyl, and heteroalkynyl, as used herein, mean the corresponding hysrocarbons wherein one or more chain carbon atoms have been replaced by a heteroatom. Exemplary heteroatoms include N, O, S, and P. When heteroatoms are allowed to replace carbon atoms, for example, in heteroalkyl groups, the numbers describing the group, though still written as e.g. C3-C10, represent the sum of the number of carbon atoms in the cycle or chain plus the number of such heteroatoms that are included as replacements for carbon atoms in the cycle or chain being described.
[0208] Typically, the alkyl, alkenyl, and alkynyl substituents of the invention contain 1-10 carbon atoms (alkyl) or 2-10 carbon atoms (alkenyl or alkynyl). Preferably, they contain 1-8 carbon atoms (alkyl) or 2-8 carbon atoms (alkenyl or alkynyl). Sometimes they contain 1-4 carbon atoms (alkyl) or 2-4 carbon atoms (alkenyl or alkynyl). A single group can include more than one type of multiple bond, or more than one multiple bond; such groups are included within the definition of the term alkenyl when they contain at least one carbon-carbon double bond, and are included within the term alkynyl when they contain at least one carbon-carbon triple bond.
[0209] Alkyl, alkenyl, and alkynyl groups can be optionally substituted to the extent that such substitution makes sense chemically. Typical substituents include, but are not limited to, halogens (F, Cl, Br, I), O, NCN, NOR, NR, OR, NR.sub.2, SR, SO.sub.2R, SO.sub.2NR.sub.2, NRSO.sub.2R, NRCONR.sub.2, NRC(O)OR, NRC(O)R, CN, C(O)OR, C(O)NR.sub.2, OC(O)R, C(O)R, and NO.sub.2, wherein each R is independently H, C1-C8 alkyl, C2-C8 heteroalkyl, C1-C8 acyl, C2-C8 heteroacyl, C2-C8 alkenyl, C2-C8 heteroalkenyl, C2-C8 alkynyl, C2-C8 heteroalkynyl, C6-C10 aryl, or C5-C10 heteroaryl, and each R is optionally substituted with halogens (F, Cl, Br, I), O, NCN, NOR, NR, OR, NR.sub.2, SR, SO.sub.2R, SO.sub.2NR.sub.2, NRSO.sub.2R, NRCONR.sub.2, NRC(O)OR, NRC(O)R, CN, C(O)OR, C(O)NR.sub.2, OC(O)R, C(O)R, and NO.sub.2, wherein each R is independently H, C1-C8 alkyl, C2-C8 heteroalkyl, C1-C8 acyl, C2-C8 heteroacyl, C6-C10 aryl or C5-C10 heteroaryl. Alkyl, alkenyl and alkynyl groups can also be substituted by C1-C8 acyl, C2-C8 heteroacyl, C6-C10 aryl or C5-C10 heteroaryl, each of which can be substituted by the substituents that are appropriate for the particular group.
[0210] While alkyl as used herein includes cycloalkyl and cycloalkylalkyl groups, the term cycloalkyl is used herein to describe a carbocyclic non-aromatic group that is connected via a ring carbon atom, and cycloalkylalkyl is used to describe a carbocyclic non-aromatic group that is connected to the molecule through an alkyl linker. Similarly, heterocyclyl is used to identify a non-aromatic cyclic group that contains at least one heteroatom as a ring member and that is connected to the molecule via a ring atom, which may be C or N; and heterocyclylalkyl may be used to describe such a group that is connected to another molecule through an alkylene linker. As used herein, these terms also include rings that contain a double bond or two, as long as the ring is not aromatic.
[0211] Aromatic or aryl substituent or moiety refers to a monocyclic or fused bicyclic moiety having the well-known characteristics of aromaticity; examples include phenyl and naphthyl. Similarly, heteroaromatic and heteroaryl refer to such monocyclic or fused bicyclic ring systems which contain as ring members one or more heteroatoms. Suitable heteroatoms include N, O, and S, inclusion of which permits aromaticity in 5-membered rings as well as 6-membered rings. Typical heteroaromatic systems include monocyclic C5-C6 aromatic groups such as pyridyl, pyrimidyl, pyrazinyl, thienyl, furanyl, pyrrolyl, pyrazolyl, thiazolyl, oxazolyl, and imidazolyl, and fused bicyclic moieties formed by fusing one of these monocyclic groups with a phenyl ring or with any of the heteroaromatic monocyclic groups to form a C8-C10 bicyclic group such as indolyl, benzimidazolyl, indazolyl, benzotriazolyl, isoquinolyl, quinolyl, benzothiazolyl, benzofuranyl, pyrazolopyridyl, quinazolinyl, quinoxalinyl, cinnolinyl, and the like. Any monocyclic or fused ring bicyclic system which has the characteristics of aromaticity in terms of electron distribution throughout the ring system is included in this definition. It also includes bicyclic groups where at least the ring which is directly attached to the remainder of the molecule has the characteristics of aromaticity. Typically, the ring systems contain 5-12 ring member atoms. Preferably the monocyclic heteroaryls contain 5-6 ring members, and the bicyclic heteroaryls contain 8-10 ring members.
[0212] Aryl and heteroaryl moieties may be substituted with a variety of substituents including C1-C8 alkyl, C2-C8 alkenyl, C2-C8 alkynyl, C5-C12 aryl, C1-C8 acyl, and heteroforms of these, each of which can itself be further substituted; other substituents for aryl and heteroaryl moieties include halogens (F, Cl, Br, I), OR, NR.sub.2, SR, SO.sub.2R, SO.sub.2NR.sub.2, NRSO.sub.2R, NRCONR.sub.2, NRC(O)OR, NRC(O)R, CN, C(O)OR, C(O)NR.sub.2, OC(O)R, C(O)R, and NO.sub.2, wherein each R is independently H, C1-C8 alkyl, C2-C8 heteroalkyl, C2-C8 alkenyl, C2-C8 heteroalkenyl, C2-C8 alkynyl, C2-C8 heteroalkynyl, C6-C10 aryl, C5-C10 heteroaryl, C7-C12 arylalkyl, or C6-C12 heteroarylalkyl, and each R is optionally substituted as described above for alkyl groups. The substituent groups on an aryl or heteroaryl group may of course be further substituted with the groups described herein as suitable for each type of such substituents or for each component of the substituent. Thus, for example, an arylalkyl substituent may be substituted on the aryl portion with substituents described herein as typical for aryl groups, and it may be further substituted on the alkyl portion with substituents described herein as typical or suitable for alkyl groups.
[0213] Optionally substituted, as used herein, indicates that the particular group being described may have one or more hydrogen substituents replaced by a non-hydrogen substituent. In some optionally substituted groups or moieties, all hydrogen substituents are replaced by a non-hydrogen substituent. If not otherwise specified, the total number of such substituents that may be present is equal to the number of H atoms present on the unsubstituted form of the group being described. Where an optional substituent is attached via a double bond, such as a carbonyl oxygen or oxo (O), the group takes up two available valences, so the total number of substituents that may be included is reduced according to the number of available valences
REFERENCES
[0214] 1. Tsujimoto, Y., Finger, L. R., Yunis, J., Nowell, P. C. & Croce, C. M. Cloning of the chromosome breakpoint of neoplastic B cells with the t(14;18) chromosome translocation. Science 226, 1097-1099 (1984). [0215] 2. Tsujimoto, Y., Cossman, J., Jaffe, E. & Croce, C. M. Involvement of the bcl-2 Gene in Human Follicular Lymphoma. Science 228, 1440-1443 (1985). [0216] 3. Vaux, D. L., Cory, S. & Adams, J. M. Bcl-2 gene promotes hemopoietic cell survival and cooperates with c-myc to immortalize pre-B cells. Nature 335, 440-442 (1988). [0217] 4. Sattler, M. et al. Structure of Bcl-xL-Bak peptide complex: Recoginition between regulators of apoptosis. Science 275, 983-986 (1997). [0218] 5. Kang, M. H. & Reynolds, C. P. BCL-2 inhibitors: targeting mitochondrial apoptotic pathways in cancer therapy. Clin. Cancer Res. 15, 1126-1132 (2009). [0219] 6. Degterev, A. et al. Identification of small-molecule inhibitors of interaction between the BH3 domain and Bcl-xL. Nat Cell Biol 3, 173-82 (2001). [0220] 7. Enyedy, I. J. et al. Discovery of small-molecule inhibitors of Bcl-2 through structure based computer screening. J Med Chem 44, 4313-24 (2001). [0221] 8. Kitada, S. et al. Discovery, characterization, and structure-activity relationships studies of proapoptotic polyphenols targeting B-cell lymphocyte/leukemia-2 proteins. J Med Chem 46, 4259-64 (2003). [0222] 9. Nguyen, M. et al. Small molecule obatoclax (GX15-070) antagonizes MCL-1 and overcomes MCL-1-mediated resistance to apoptosis. Proc Natl Acad Sci USA 104, 19512-7 (2007). [0223] 10. Oltersdorf, T. et al. An inhbitor of Bcl-2 family proteins induces regression of solid tumours. Nature 435, 677-681 (2005). [0224] 11. Berg, T. Small-molecule inhibitors of protein-protein interactions. Curr. Op. Drug Disc. Dev. 11, 666-674 (2008). [0225] 12. Petros, A. M. et al. Discovery of a potent and selective Bcl-2 inhibitor using SAR by NMR. BioorgMed Chem Lett 20, 6587-91 (2010). [0226] 13. Walensky, L. D. et al. Activation of apoptosis in vivo by a hydrocarbon-stapled BH3 helix. Science 305, 1466-70 (2004). [0227] 14. Wang, G. et al. Structure-based design of potent small-molecule inhibitors of antiapoptotic Bcl-2 proteins. J Med Chem 49, 6139-42 (2006). [0228] 15. Qian, J. et al. Discovery of novel inhibitors of Bcl-xL using multiple high-throughput screening platforms. Anal. Biochem. 328, 131-138 (2004). [0229] 16. Degeretev, A. et al. Identification of small molecule inhibitors of interaction between the BH3 domain and BCL-XL. Nature Cell Biol. 3, 173-182 (2001). [0230] 17. Lin, B. et al. Conversion of Bcl-2 from protector to killer by interaction with nuclear orphan receptor Nur77/TR3. cell 116, 527-540 (2004). [0231] 18. Kolluri, S. K. et al. A short Nur77-derived peptide converts Bcl-2 from a protector to a killer. Cancer Cell 14, 285-298 (2008). [0232] 19. Zhai, D., Jin, C., Satterthwait, A. C. & Reed, J. C. Comparison of chemical inhibitors of antiapoptotic BCL-2 family proteins. Cell Death Diff. 13, 1419-1421 (2006). [0233] 13. Tzung, S. P. et al. Antimycin A mimics a cell-death-inducing Bcl-2 homology domain 3. Nat CellBiol 3, 183-91 (2001). [0234] 20. Zhai, D. et al. High-throughput fluorescence polarization assay for chemical library screening against anti-apoptotic Bcl-2 family member Bcl-2. Journal of Biomolecular Screening 17, 350-360 (2012). [0235] 21. Tse, C. et al. ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor. Cancer Res 68, 3421-8 (2008). [0236] 22. Wilson, W. H. et al. Navitoclax, a targeted high-affinity inhibitor of BCL-2, in lymphoid malignancies: a phase 1 dose-escalation study of safety, pharmacokinetics, pharmacodynamics, and antitumour activity. Lancet Oncol. 11, 1149-59 (2010). [0237] 23. Gandhi, L. et al. Phase I study of Navitoclax (ABT-263), a novel Bcl-2 family inhibitor, in patients with small-cell lung cancer and other solid tumors. J Clin Oncol 29, 909-16 (2011). [0238] 24. Roberts, A. W. et al. Substantial susceptibility of chronic lymphocytic leukemia to BCL2 inhibition: Results of Phase 1 study of navitoclax (ABT-263) in patients with relapsed or refractory disease. J Clin Onc (2011). [0239] 25. Konopleva, M. et al. Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia. Cancer Cell 10, 375-388 (2006). [0240] 26. Lin, X. et al. Seed analysis of off-target siRNAs reveals an essential role of MCL-1 in resistance to the small-molecule Bcl-2/Bcl-xL inhibitor ABT-737. Oncogene 26, 3972-3979 (2007). [0241] 27. van Delft, M. F. et al. The BH3 mimetic ABT-737 targets selective Bcl-2 proteins and efficiently induces apoptosis via Bak/Bax if Mcl-1 is neutralized. Cancer Cell 10, 389-399 (2006). [0242] 28. Yecies, D., Carlson, N. E., Deng, J. & Letai, A. Acquired resistance to ABT-737 in lymphoma cells that up-regulate MCL-1 and BFL-1. Blood 115, 3304-13 (2010). [0243] 29. Luciano, F. et al. Nur77 converts phenotype of Bcl-B, an antiapoptotic protein expressed in plasma cells and myeloma. Blood 109, 3849-3855 (2007). [0244] 30. Watkins, C. L. et al. Co-operative membrane disruption between cell-penetrating peptide and cargo: implications for the therapeutic use of the Bcl-2 converter peptide D-NuBCP-9-r8. Mol. Ther. J. Am. Soc. Gene Ther. 19, 2124-2132 (2011). [0245] 31. Kumar, M. et al. Intracellular delivery of peptide cargos using iron oxide based nanoparticles: studies on antitumor efficacy of a BCL-2 converting peptide, NuBCP-9. Nanoscale 6, 14473-14483 (2014). [0246] 32. Kumar, M. et al. Novel polymeric nanoparticles for intracellular delivery of peptide Cargos: antitumor efficacy of the BCL-2 conversion peptide NuBCP-9. Cancer Res. 74, 3271-3281 (2014).
2. Methotrexate Functionally Converts Bcl-2 into a Pro-Apoptotic Protein
[0247] In some embodiments, the agent of the methods disclosed herein is methotrexate (MTX) or a methotrexate analog. In certain embodiments, the methotrexate analog is a compound of Formula (IV):
##STR00049##
its isomer, tautomer, hydrate, or salt,
wherein: [0248] R.sup.1 is H, C1-C8 alkyl, C1-C8 alkenyl, or C1-C8 alkynyl; [0249] R.sup.2 is H, C1-C8 alkyl, C1-C8 alkenyl, or C1-C8 alkynyl; [0250] R.sup.10 is H or R.sup.10 and R.sup.2, taken together, form an oxo group (O); [0251] R.sup.3, R.sup.4, R.sup.5, and R.sup.6 are independently H, halogen, C1-C8 alkyl, C1-C8 alkenyl, C1-C8 alkynyl, or R.sup.5 and R.sup.6, together with the carbon atoms to which each is attached, form a 5 or 6-membered aromatic or heteroaromatic ring; [0252] R.sup.9 is H or R.sup.9 and R.sup.1 form a C1-C3 alkylene; [0253] Y is NH.sub.2 or OH; [0254] X is N or C; and Z is OH, NH.sub.2, OR.sup.8, or
##STR00050##
wherein R.sup.8 is H or C1-C8 alkyl, n is 1 or 2, and R7 is H, OH, NH.sub.2, or C1-C8 alkyl.
[0255] To identify small molecules that can serve as functional converters of Bcl-2 and hence induce apoptosis in Bcl-2 over-expressing cancers, the inventors designed a screening assay using Bcl-2 over-expressing cell lines. MDA-MB-231 cells expressing high or low Bcl-2 were used in an assay for screening library compounds. MTX was identified as one of the lead molecules in the screen that selectively induced apoptosis in MDA-MB-231 cells with increased expression of Bcl-2. MTX effects with respect to Bcl-2 expression were further characterized. The result of the library screening was reproduced in the subsequent validation assay for MTX (
[0256] Knockdown of Bcl-2 in MDA-MB-468 cells diminished the apoptotic effect of MTX (
[0257] In certain embodiments, the small molecule Bcl-2 functional converters, for example, MTX and MTX analogs disclosed herein induce apoptosis under hypoxic conditions, as described below. It was tested if Bcl-2 dependent induction of apoptosis would also occur under hypoxic conditions. A significant reduction in viability of Jurkat/Bcl-2 cells compared to their Vector control (
[0258] The effect of MTX on the clonogenic survival of MDA-MB-231 cells was determined. Following treatment with 10 M MTX, MDA-MB-231/Bcl-2 cells formed significantly fewer colonies by 60%, compared to vector controls (
Methotrexate Interaction with Bcl-2
[0259] To evaluate whether the apoptotic action of MTX was due to conformational change in the Bcl-2 protein, converting its function to a pro-apoptotic one, the inventors used a Bcl-2 BH3 domain antibody to recognize the change in conformation of Bcl-2 between vehicle and MTX treated MDA-MB-231/Bcl-2 cells (
Methotrexate Induces Mitochondrial Intrinsic Death Pathway
[0260] In order to further probe the mechanism of MTX induced cell death, MEF cells with or without Bax or Bak were treated with MTX and their viability was determined. Wild type MEF cells were most effected by MTX, with only about 30% being viable. Bax.sup./ MEF and Bak.sup./ MEF also had reduced viability to about 40%. However, viability of Bax.sup./ Bak.sup./ MEF (DKO) cells was not effected in comparison to the cells having Bax or Bak (
Efficacy of Methotrexate in an In Vivo Model
[0261] The MDA-MB-231/Bcl2 cell line was used in a xenograft study using NOD SCID mice to test MTX effect using an in vivo model. MTX treated mice had significant inhibition of tumor growth by 15 days of treatment with 100 mg/kg dose of MTX, compared to the vehicle treated mice (
Discovery of Methotrexate Analogs that Induce Bcl-2-Dependent Cell Death.
[0262] In certain embodiments, agent of the methods for inducing apoptosis in a cell or the methods of cancer treatment is a methotrexate (MTX) or MTX analog, for example, a compound of Table 6.
[0263] A number of methotrexate analogs were tested in MDA-MB-231 cells with low or high expression of Bcl-2. The cells were treated with different concentrations of the analogs for 48 or 72 hours. This led to the identification of compounds that induced apoptosis in Bcl-2-dependent manner with higher affinity than the parental compound Table 6 lists exemplary MTX analogs that can be used in the methods disclosed herein. Table 7 shows the minimal effective concentrations that induced Bcl-2-dependent reduction in cell viability in Bcl-2 low and high expressing Jurkat lymphoma cells that were plated and treated for 72 hours with various concentrations of methotrexate analogs.
TABLE-US-00006 TABLE 6 Structures of methotrexate analogs that were tested for Bcl-2 dependent apoptosis. Compound Structure MTX
TABLE-US-00007 TABLE 7 Minimal effective concentrations of exemplary MTX analogs that induced Bcl-2-dependent reduction in cell viability (n/d means no reduction was detected at concentrations tested). Bcl-2 dependent effects in Jurkat Lymphoma Lowest effective Compound MW cells dose (uM) MTX Yes 0.01 1 440 Yes 0.01 2 523 Yes 0.001 3 426 Yes 10.0 4 455 No n/d 5 472 Yes 0.01 6 490 Yes 0.01 7 353 No n/d 8 480 Yes 0.01 9 523 Yes 1.0 10 480 Yes 0.1 11 505 Yes 0.001 12 337 No n/d
[0264] It was found that methotrexate directly interacts with Bcl-2. This interaction results in a change in the phenotype of Bcl-2 from anti-apoptotic to pro-apoptotic. This functional conversion of Bcl-2 resulted in induction of apoptosis in cancer cells expressing Bcl-2. There was minimal or no cell death in cancer cells expressing either low Bcl-2 or in Bcl-2 knockout cells. Also, MTX spared normal breast epithelial cells of both mouse and human origin. Bcl-2 dependence was observed in triple negative breast cancer (TNBCs) cells, MDA-MB-231, over-expressing Bcl-2. It is evident that TNBCs are challenging to treat because of the absence of growth hormones and other reliable molecular targets that can distinguish them from normal tissue. In another TNBC cell line, MDA-MB-468, the inventors transiently knocked down Bcl-2 and found that the apoptotic effect of MTX diminished. The inventors showed this phenomenon in estrogen receptor positive breast cancer cells, MCF-7, as well as in Jurkat T-cell lymphocytes, suggesting that for the apoptotic inducing action of MTX, presence of Bcl-2 protein is sufficient, independent of the cancer cell type.
[0265] The finding that MTX binds to the loop domain of Bcl-2, inducing change in its conformation and reversal of its function, will have implications in the prognosis and treatment of diseases where MTX is currently used. This also lays the foundation for the study of Bcl-2 protein in those diseases. Many drugs under development fail to work under hypoxic conditions. When MTX was tested under hypoxic conditions it was not only effective in inducing cell death but it was also dependent on Bcl-2. Bcl-2 over-expression results in more aggressive tumors and the invasive capacity of tumor cells increases, resulting in metastasis. MTX treatment could reduce the invasiveness of Bcl-2 over-expressing TNBC cells, rendering its use in metastatic and aggressive cancers. The use of MTX in Bcl-2 positive tumors is of immense utility as the side effects caused by inhibition of its classical folate synthesis pathway targets are alleviated by supplementing with folate or leucovorin. Even at saturating concentrations of 1 M folate, MTX induced Bcl-2 dependent apoptosis. The inventors tested other chemotherapeutic drugs for breast cancer and only MTX was found to induce Bcl-2 dependent apoptosis. The loop domain of Bcl-2 acts as a regulator of its activity. The function of Bcl-2 is reversed when the loop is phosphorylated, cleaved by caspases or interacting with other proteins like p53 and Nur77. Inventors found that MTX interacts with the loop domain of Bcl-2 exposing its BH3 domain. This change in conformation of Bcl-2 by MTX was seen both in vitro and in vivo. The inventors also verified this interaction by showing the alteration in proteolysis of the loop domain of Bcl-2 in the presence of MTX. MTX could also compete with NuBCP-9 in its affinity to interact with the loop domain of Bcl-2. This raises questions of whether MTX interacts with other proteins that have unstructured loop domain similar to Bcl-2. Investigation on these lines could potentially unravel other pathways or diseases where MTX could be used. MTX induced an intrinsic mitochondrial apoptotic pathway by functional conversion of Bcl-2. Bax activation upon treatment with MTX was seen both in vitro and in vivo. MTX demonstrated potent anti-tumor activity in an orthotopic breast cancer model. The Bcl-2 over-expressing MDA-MB-231 cells were used in the generation of the tumors in the mammary fat pad and, as expected, the arising tumors were quite aggressive. This in vivo experiment only serves as a proof of concept model since the half-life of MTX is different in mice (0.5 h) and humans (7-10 h).
[0266] Current small molecule therapeutics under development target Bcl-2 by inhibiting its pro-survival function. This is accomplished by binding to its hydrophobic grove thus inhibiting other pro-apoptotic proteins from binding to it. Of the numerous small molecules under development, ABT-199 stands out among them. However, ABT-199 has hit roadblocks due to development of resistance by multiple mechanisms. There have been mutations in the Bcl-2 binding region of ABT-199 rendering it ineffective. Additionally, over-expression of other Bcl-2 family proteins like Mcl-1 has led to resistance. Here the inventors show MTX targets Bcl-2 different from the Bcl-2 inhibitors. MTX doesn't inhibit Bcl-2 but actually converts it into a pro-death protein. MTX has been traditionally used as a chemotherapeutic along with cyclophosphamide and 5-fluorouracil. A clinical study showed this cocktail (CMF) had better outcome in Bcl-2 positive cancers as opposed to Bcl-2 negative cancers. Herein, the inventors show that MTX alone is effective in inducing apoptosis in Bcl-2 positive cancers. Fluorouracil was shown to reduce Bcl-2 expression in gastric cancer cells and hence should be used in combination with other drugs and not MTX. In another clinical study, Bcl-2 positive breast cancer patients had better responses to MTX. There was no clear-cut correlation between Bcl-2 expression and chemotherapy response in patients likely due to use of MTX in the chemotherapy cocktail (Cyclophosphamide-MTX-Fluorouracil). This study may clear that doubt and warrant the use of MTX as a targeted therapeutic. The nature of MTX binding to the loop domain of Bcl-2 is discussed below.
[0267] In certain embodiments, the methods for inducing apoptosis or the methods for treatment of cancer disclosed are used in combination with other cancer therapy, for example, radiation therapy. There are numerous occasions where Bcl-2 is upregulated due to radiation therapy, chemotherapy, or prolonged use of other targeted cancer drugs. MTX can be used in combination with these treatments to increase their efficacy. Since MTX is effectively tested in low doses for long term use in certain indications, it could be tested for cancer treatment to avoid relapse. MTX can be a cost effective targeted therapy ready to be used in clinics.
[0268] In some embodiments, the methods for treatment of cancer disclosed herein further comprising administering a folate or leucovorin. It is known in the art that the side effects of MTX dosing are well studied and can be easily overcome by supplementing with leucovorin or folic acid. MTX can be used at a low dose and yet its bioavailability could be as high as 70%. Polymorphisms in the RCF1 gene could be screened in patients to predict therapeutic response. There are also new formulations of MTX for improved bioavailability and convenience of administration.
[0269] In conclusion, the inventors demonstrated that MTX, which has been used for over 5 decades as a drug, interacts with Bcl-2, changing it into a pro-apoptotic protein to induce apoptosis. Thus, the studies disclosed herein discovered a new mechanism of action of MTX and identified it as a Bcl-2 targeted therapeutic.
3. Small Molecule Bcl-2 Functional Converter BFC1108 for Breast Cancer Therapy
[0270] In certain embodiments, the agent of the methods for inducing apoptosis in a cell or the methods of cancer treatment is compound BFC1108 or its structural analog, for example, a compound of Formula (III).
[0271] To screen for small molecules that can specifically target and induce apoptosis in Bcl-2 expressing cancer cells, a viability assay was employed. MDA-MB-231 cells stably expressing high levels of Bcl-2 (MDA-MB-231/Bcl-2) were used along with cell with low expression of Bcl-2, e.g., its vector controls (MDA-MB-231/Vectors). A DIVERset library from ChemBridge was used to treat these cells in a 24 h viability assay. Compounds were shortlisted and retested based on Bcl-2 dependent effect on viability.
[0272] The lead compound BFC1108 (
Anti-Tumorigenic Effects of BFC1108
[0273] The effects of BFC1108 on clonogenic survival of MDA-MB-231 cells were determined. When exposed to BFC1108, MDA-MB-231/Bcl-2 cells formed fewer colonies compared to their vector controls (
[0274] BFC1108 Induces Conformational Change in Bcl-2
[0275] When Bcl-2 interacts with orphan receptor Nur77/TR3 or with p53, its conformation is changed. This type of interaction causes exposure of its own BH3 domain, leading to reversal of its function from anti-apoptotic to pro-apoptotic. This changed conformation of Bcl-2 can be detected by a Bcl-2-BH3 domain antibody. When MDA-MB-231/Bcl-2 cells were treated with BFC1108 and analyzed using flow cytometry, changed conformation of Bcl-2 was detected (
BFC1108 Induces Intrinsic Mitochondrial Death Pathway
[0276] To further validate that the changed conformation of Bcl-2 initiates the intrinsic apoptotic pathway, the requirement of Bax and/or Bak for the apoptotic action of BFC1108 was tested. In MEF cells treated with BFC1108, the inventors observed no effect on viability in DKO MEFs, whereas Bax.sup./ MEF and Bak.sup./ MEF have diminished viability, just as WT MEFs are susceptible to BFC1108 (
BFC1108 Suppresses Bcl-2 Over-Expressing Breast Cancer In Vivo
[0277] To test the potency of BFC1108 in vivo, orthotopic breast cancer xenografts derived from MDA-MB-231/Bcl-2 cells were treated with BFC1108 for 4 weeks via intraperitoneal route. BFC1108 significantly reduced the growth of a xenograft tumor (
Efficacy of BFC1108 in a Lung Metastatic Model
[0278] Next, the efficacy of BFC1108 in suppressing breast cancer lung metastasis was evaluated. LMD231 cells are lung metastatic cells derived from triple negative breast cancer tumors of MDA-MB-231 cells. LMD231 cells are thus pre-programmed to form only lung metastatic tumors. LMD231 cells were engineered to stably express luciferase to aid in the detection of metastasis. LMD231-Luc cells, when injected through the tail vein, formed lung metastasis in 2 weeks. Doses of 100 mg/kg BFC1108 were given, 4 times a week by intraperitoneal injections. By the end of 7 weeks, BFC1108 suppressed the growth of lung metastasis (
[0279] In this study, a class of small molecule Bcl-2 functional converter (BFC1108 and its structural analogs) was found that can suppress primary and metastatic breast cancers in mouse xenograft models. This study provides a proof of concept for targeting Bcl-2, using small molecules that do not inhibit its function but rather alters it to therapeutic advantage.
[0280] It was demonstrated herein that BFC1108 induces apoptosis in cancer cells as long as they express Bcl-2. This induction of apoptosis is due to the interaction of BFC1108 with the loop domain of Bcl-2. This interaction resulted in exposure of the BH3 domain of Bcl-2, making it a pro-apoptotic protein. BFC1108 is also dependent on the presence of Bax and/or Bak for inducing the mitochondrial cell death pathway. More importantly, BFC1108 could suppress breast cancer in a mouse model of Bcl-2 high-expression. Where most cancer therapeutics would fail, due to Bcl-2 over-expression, BFC1108 was potent in significantly inducing apoptosis. BFC1108 also suppressed the growth of breast cancer lung metastasis, indicating its utility in comprehensively treating cancers prone to metastasis or metastatic cancer dependent on Bcl-2.
4. Small Molecule Bcl-2 Functional Converters for Breast Cancer Lung Metastasis Screening of Small Molecules Targeting Bcl-2
[0281] A library consisting of structurally diverse small molecules was used to screen for small molecules that induce death in cells with higher Bcl-2 expression. A viability assay was employed to screen the library compounds in triple negative breast cancer cell line, MDA-MB-231, with either high or low expression levels of Bcl-2. The lead compound BFC1103 (
[0282] It was further tested if this Bcl-2 dependent induction of apoptosis by BFC1103 would occur under hypoxic conditions. A significant reduction in viability of MDA-MB-231 with increased Bcl-2 expression compared to the control cells was seen (
BFC1103 Interaction with Bcl-2
[0283] The inventors determined if the Bcl-2 dependent apoptotis induced by BFC1103 is due to change in conformation of Bcl-2, converting its function from an anti-apoptotic to a pro-apoptotic protein. A a Bcl-2 BH3 domain antibody that specifically recognizes Bcl-2 with changed conformation was employed. Following treatment with BFC1103, changed conformation of Bcl-2 of was detected in MDA-MB-231/Bcl-2 cells (
BFC1103 Induces Mitochondrial Intrinsic Death Pathway
[0284] To determine if BFC1103 induced cell death is dependent on the presence of Bax or Bak, mouse embryonic fibroblast cells (MEFs) with or without the expression of Bax or Bak were uesd. Upon exposure to BFC1103, wild type MEF cells, MEF cells without Bax or Bak expression had significant reduction in their viability compared to the double knockout (DKO) MEFs (
Efficacy of BFC1103 in a Breast Cancer Lung Metastatic Model
[0285] The inventors next determined the efficacy of BFC1103 in suppressing breast cancer lung metastasis. LMD231 cells are metastatic cells derived from lung metastasis of MDA-MB-231 cells. LMD231 cells are pre-programmed to form only lung metastasis when introduced in mice. LMD231 cells were engineered to stably express luciferase (LMD231-Luc) for easy detection in nude mice. Approximately 200,000 LMD231-Luc cells were injected into the tail vein of 5 week old nude mice and lung metastasis could be detected in 2 weeks. BFC1103 was dosed at 50 mg/kg by the intraperitoneal route for 6 days per week. By the end of 7 weeks, BFC1103 significantly suppressed the growth of lung metastasis (
[0286] Thus, a new class of small molecule Bcl-2 functional converters, compound BFC1103 and its structural analogs, that can suppress breast cancer lung metastases was found. Current cancer therapies that target the Bcl-2 protein inhibit the anti-apoptotic function of Bcl-2. In this study, a novel way of targeting Bcl-2 using small molecules that functionally convert the function of Bcl-2 from an anti-apoptotic to a pro-apoptotic protein was shown. The inventors demonstrated that BFC1103 can successfully suppress triple negative breast cancer lung metastasis in a mouse model.
[0287] It was shown herein that BFC1103 induces apoptosis in multiple cancer cell types expressing Bcl-2. The potency of BFC1103 increases with the increase in levels of Bcl-2 expression. This Bcl-2 dependent action of BFC1103 could be a great tool for treating refractory and resistant cancers that rely on Bcl-2. BFC1103 induced a change in conformation of Bcl-2, which correlated with an induction of apoptosis. This induction of apoptosis follows the mitochondrial intrinsic death pathway. The data suggest that BFC1103 has an affinity towards the loop domain of Bcl-2. Thus, BFC1103 mimics Nur77 or NuBCP-9 in interacting with the loop domain of Bcl-2, resulting in a change in its conformation and an induction of apoptosis. BFC1103 and its structural analogs have potential for treating highly metastatic cancers expressing Bcl-2.
5. Bcl-2 Functional Converters (BFCs) as Therapeutics for Chemo-Resistant Lung and Breast Cancers
[0288] In some embodiments, disclosed herein are methods of treating Bcl-2-expressing cancer in a subject, comprising administering to a subject in need of Bcl-2 expressing cancer treatment, a therapeutically effective amount of an agent that exposes the BH3 domain of Bcl-2 thereby converting Bcl-2 into a pro-apoptotic protein, wherein the cancer is chemotherapy-resistant cancer. In some embodiments, the cancer is chemotherapy-resistant breast or chemotherapy-resistant lung cancer. In other embodiments, the cancer is resistant to commonly used cancer chemotherapeutics such as paclitaxel or doxorubicin. In other embodiments, the cancer is resistant to more than one cancer chemotherapeutic agent.
[0289] To ascertain if Bcl-2 is implicated in paclitaxel resistance and determine if Bcl-2 functional converters can be used to selectively kill paclitaxel resistant cancer, the inventors developed paclitaxel resistant lines. Initially paclitaxel sensitive lines were identified (H460) (termed parental) through use of viability assay. The sensitive parental line was treated with paclitaxel once a week for 48 hours and allowed to recover for a period of 6 weeks. As a result, H460 parental and resistant lines were treated with paclitaxel 1-10 nM for 48 hours and imaging indicated that parental line was responsive and resistant line was not (
[0290] Changes in expression of Bcl-2 family members are a potential mechanism of resistance. Assessment of changes in the expression of Bcl-2 family of proteins identified an increase in expression of Bcl-2 in the paclitaxel resistant cell line (
[0291] To determine if H460 paclitaxel resistant cells with elevated Bcl-2 expression were susceptible to Bcl-2 targeting, cells were treated with Bcl-2 functional converters and viability assessed. Treatment with BFC1108, BFC1111, BFC1103 all reduced viability of resistant line preferentially (
[0292] To determine if BFCs could target and preferentially kill other types of therapy resistant cancer, paclitaxel and doxorubicin resistant triple negative breast cancer cell lines were derived. MDA-MB-468 parental and resistant lines were treated with paclitaxel and viability was assessed after 72 hours, the derived resistant line viability was unaffected by 50 nM, however parental line was sensitive (
[0293] To determine if paclitaxel and doxorubicin resistant triple negative breast cancer cells could be preferentially targeted by BFCs viability assays were performed. MDA-MB-468 paclitaxel resistant cells were preferentially killed by BFC1108 in a dose dependent manner (
[0294] To determine if BFCs can target therapy resistant lung cancer cells in vivo, a zebrafish xenograft model was used. BFC20A, B18 and MTX led to a reduction in paclitaxel resistant H460 growth in vivo. (
6. Structural Basis of Methotrexate Binding to Bcl-2
[0295] In some embodiments, the small molecule Bcl-2 functional converter of the methods disclosed herein, for example, MTX or MTX analog, induces apoptosis and/or reduces viability of a cell by binding to a six amino acid-segment (SEQ ID NO 1) of the Bcl-2 loop domain (SEQ ID NO 2) thereby converting Bcl-2 into a pro-apoptotic protein and activating the intrinsic apoptosis pathway within the cell. In some instances, binding of the small molecule to the peptide sequence exposes the BH3 domain of Bcl-2 thereby the small molecule Bcl-2 converter is a small molecule mimic of NuBCP-9 peptide. In other embodiments, a small molecule mimic of NuBCP-9 peptide is a small molecule that binds to the six amino acid-segment (SEQ ID NO 1) of the Bcl-2 loop domain SEQ ID NO 2).
TABLE-US-00008 SEQIDNO1: EWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAP GAAAGPALSPVP SEQIDNO2: HTPHPA
[0296] In certain embodiments, screening for small molecule Bcl-2 functional converters that bind to the HTPHPA sequence, or amino acid residues number 55-60, of the Bcl-2 loop domain is accomplished by nuclear magnetic resonance (NMR). In some embodiments, the NMR screening is done by titrating a small molecule agent into solution of a 15N-13C uniformly labeled Bcl-2 loop domain and monitoring chemical shift perturbations by 15N-1H heteronuclear single quantum coherence (HSQC), analyzing of the chemical shift perturbations of His55 and His58 as a function of the molecule concentration, plotting hyperbolic binding curves, and determining the binding affinity of the small molecule.
[0297] In an exemplary experiment, NMR was used to identify the residues of the Bcl-2 loop that are involved in binding to methotrexate (MTX). Complete backbone assignments of the Bcl-2 loop domain were obtained using .sup.13C-direct detect experiments due to an exceptionally high number of proline residues, which compose 20% of the 62 amino acid Bcl-2 loop domain (
[0298] Unlabeled MTX was titrated into .sup.15N-.sup.13C uniformly labeled Bcl-2 loop domain and chemical shift perturbations were monitored by .sup.15N-.sup.1H heteronuclear single quantum coherence (HSQC) (
[0299] The K.sub.d values were determined to be 5.1 mM and 11.4 mM for His55 and His58, respectively. Both yield Hill coefficients close to 1.0, indicating a lack of cooperativity. Importantly, NMR titration of the Bcl-2 loop domain with the NuBCP-9 peptide shows the same Bcl-2 residues undergoing chemical shift perturbations as titration with MTX (
[0300] Additionally, the NMR data provides insight into the structure and dynamics of the Bcl-2 loop domain in its free and bound forms. Limited .sup.1H chemical shift dispersion in the HSQC (
[0301] These results demonstrate that methotrexate interacts with residues 55-60 in the loop domain of Bcl-2 and exposes its BH3 domain. The interaction was demonstrated by NMR as well as altered proteolysis of the loop domain of Bcl-2 in the presence of methotrexate. Although the loop domain is unstructured, residues 50-62 show some motional restriction. It is predicted that this restriction results in smaller change in entropy upon methotrexate binding and enhanced affinity.
[0302] Preferred embodiments of this invention are described herein, including the best mode known to the inventors for carrying out the invention. Variations, changes, modifications and substitution of equivalents on those preferred embodiments will become apparent to those of ordinary skill in the art upon reading the foregoing description. The inventors expect skilled artisans to employ such variations, changes, modifications and substitution of equivalents as appropriate, and the inventors intend for the invention to be practiced otherwise than specifically described herein. Those of skill in the art will readily recognize a variety of non-critical parameters that could be changed, altered or modified to yield essentially similar results. Accordingly, this invention includes all modifications and equivalents of the subject matter recited in the claims appended hereto as permitted by applicable law. Moreover, any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context.
[0303] While each of the elements of the present invention is described herein as containing multiple embodiments, it should be understood that, unless indicated otherwise, each of the embodiments of a given element of the present invention is capable of being used with each of the embodiments of the other elements of the present invention and each such use is intended to form a distinct embodiment of the present invention.
[0304] The referenced patents, patent applications, and scientific literature referred to herein are hereby incorporated by reference in their entirety as if each individual publication, patent or patent application were specifically and individually indicated to be incorporated by reference. Any conflict between any reference cited herein and the specific teachings of this specification shall be resolved in favor of the latter. Likewise, any conflict between an art-understood definition of a word or phrase and a definition of the word or phrase as specifically taught in this specification shall be resolved in favor of the latter.
[0305] As can be appreciated from the disclosure above, the present invention has a wide variety of applications. The invention is further illustrated by the following examples, which are only illustrative and are not intended to limit the definition and scope of the invention in any way.
Examples
1. Screening for Small Molecule Functional Converters of Bcl-2
[0306] The aim of this study was to find safe targeted therapeutics for hard to treat cancers that utilize Bcl-2 for their survival, and resistance to conventional treatments. In this study, the inventors found small molecules that specifically induce cell death in triple negative breast cancer cells MDA-MB-231 over-expressing Bcl-2, compared to their Bcl-2 low expressing control cells. A viability assay was set up to screen small molecule library in MDA-MB-231 cells with high and low Bcl-2 expression. The inventors found methotrexate and iodoacetamide from the LOPAC library to selectively induce more cell death in high-Bcl-2 expressing MDA-MB-231 cells. The inventors also found six novel small molecules that induced Bcl-2 specific reduction in viability of MDA-MB-231 cells expressing high levels of Bcl-2. These small molecules can be further developed into novel therapeutics to treat cancers expressing Bcl-2 and as combination treatments with other therapeutics that induce Bcl-2 expression.
Screening Library
[0307] The LOPAC1280 library of pharmacologically active compounds was obtained from Sigma, Inc. Master library plates were diluted in DMSO to a 1 mM concentration for a 1:100 addition to media and final DMSO concentration of 1% (v/v) for screening. ChemBridge library consisting of 50,000 active pharmacophores was purchased from ChemBridge (San Diego, Calif.). Master library plates were diluted to 1 mM concentration for a final DMSO concentration of 1% (v/v) in the screening assay. For validations 10 mg of each hit compound was ordered form respective supplier and 20 mM stocks in DMSO were made. All subsequent in vitro testing was done under 0.1% (v/v) DMSO concentration.
Cell Culture
[0308] MDA-MB-231 cells were cultured in Dulbecco's Modified Eagle Medium (DMEM) with L-glutamine (Mediatech Inc., VA) supplemented with 10% FBS (Tissue Culture Biologicals, CA), 100 IU/mL penicillin, and 100 g/ml streptomycin (Mediatech Inc., VA) in a humidified 5% C02 incubator. Cells were cultured under 80% confluency and passaged once in 3 days.
Generation of Breast Cancer Cell Lines Stably Overexpressing Bcl-2
[0309] MDA-MB-231 and MCF-7 breast cancer cell lines stably overexpressing Bcl-2 were generated via electroporation and subsequent clonal expansion in G418-containing media. For MDA-MB-231 cells, 510.sup.6 cells per transfection were suspended in 400 L of DMEM and electroporation with a Gene Pulser Xcell (Biorad, Hercules, Calif.) using an exponential decay protocol set with the following parameters (Voltage=280 V, capacitance=500 F, resistance (Q)=cm) in a 2 mm electroporation cuvette (Biorad, Hercules, Calif.). Cells were electroporated in the presence of either 2.5 g pcDNA (MDA-MB-231/Vector) or 2.5 g BCL-2 (MDA-MB-231/Bcl-2). For MCF-7 cells (MCF-7/Vector and MCF-7/Bcl-2), the same conditions described above were used, except that the electroporation voltage was 250 V and capacitance was 950 F. For all electroporations, the actual voltages delivered did not vary significantly from the initial voltage delivery setting. After electroporation, cells were seeded into 150 cm.sup.2 cell culture dishes at a density of 310.sup.5 cells/plate in a volume of 15 mL. The following day, 5 mL of 10% DMEM containing 4G418 (Omega Scientific, Tarzana, Calif.) was added such that the final concentrations were 900 g/mL and 750 g/mL for transfected MDA-MB-231 and MCF-7 cells, respectively. For both MDA-MB-231 and MCF-7 cells, an additional transfection was performed with a GFP-expression vector to verify successful DNA uptake under the given electroporation conditions and were discarded after confirming GFP expression with an inverted Zeiss microscope with GFP-fluorescence monitoring capabilities. During formation of colonies (2 weeks), dead cells were removed by aspiration and media was replaced with G418-containing every 4-5 days. Sufficiently sized single, isolated colonies (15 per transfection) were selected by surrounding colonies with a hydrophobic barrier from a wax pen, light trypsinization, and transfer to 24 well platers. Individual colonies were expanded thereafter in G418 containing media to 6 well plates and then 100 cm.sup.2 dishes, after which cells were harvested for freezer stocks and whole cell lysates, as well as continued propagation as needed. Levels of Bcl-2 overexpression present in the selected clones, several lines were chosen for use in small molecule screening and secondary validation of hits, during which time continued Bcl-2 overexpression was monitored by western blot from fresh whole cell lysates prepared every 1-2 weeks. Several pcDNA vector transfected cell lines were chosen as controls for screening and hit validation.
Compound Treatments
[0310] Library plates were spun down in a centrifuge and thawed in a desiccator before opening in the cell culture hood in dark. All treatments were done in cells plated in black opaque plates. Treatments were done in dark as a precaution for light sensitivity of novel small molecules. DMSO was used as solvent for dilution of compounds.
Screening Assays
[0311] To screen for Bcl-2 selective compounds, MDA-MB-231 cells (MDA-MB-231/Vector and MDA-MB-231/Bcl-2) were plated at 4000 cells per well in a 96 well black opaque plate. The day after plating the cells, treatment from the library plates was done so as to add 1 L of the compound into the cells, resulting in 10 M concentration. For non-specific negative control, 25 nM of staurosporin was used. Treatments were done at 10% serum conditions for 24 h. Post treatment viability was assessed by CellTiter Glo Cell Viability assay (Promega Inc., Madison, Wis.) as per manufacturer instructions.
Data Analysis
[0312] Viability for test compounds in each cell line (MDA-MB-231/Vector and MDA-MB-231/Bcl-2) was normalized to their respective vehicle treatments. Compounds that had at least 20% less viability in the MDA-MB-231/Bcl-2 cell line than the MDA-MB-231/Vector cell line were selected as initial hits and shortlisted for revalidation. Revalidated compounds were reordered for further testing and characterization. All data analyses were performed using Microsoft Excel.
2. Demonstration That Methotrexate Functionally Converts Bcl-2 into A Pro-Apoptotic Protein
Cell Culture
[0313] MDA-MB-231, MCF-7, HepG2, ZR-75-1, A375, MEFs and H460 were cultured in DMEM with L-glutamine (Mediatech Inc., Manassas, Va.) supplemented with 10% fetal bovine serum (Tissue Culture Biologicals, Tulare, Calif.) with 10,000 U/mL penicillin streptomycin (Mediatech Inc., Manassas, Va.) in a humidified chamber with 5% CO.sub.2. LNCaP cells were cultured in RPMI 1640 (Mediatech Inc., Manassas, Va.). MCF10-A cells were cultured in DMEM/F-12 with appropriate supplements. All cells were passaged once in every 3 days.
Generation of Stable Cell Lines
[0314] MDA-MB-231 and MCF-7 breast cancer cell lines stably overexpressing Bcl-2 were generated via electroporation and subsequent clonal expansion in G418-containing media. MDA-MB-231 cell clones with sufficiently high expression of Bcl-2 (MDA-MB-231/Bcl-2) determined by western blotting was selected for screening along with their vector controls (MDA-MB-231/Vector). Similarly MCF-7 cells clones were selected for characterization of lead molecules.
Chemicals
[0315] The LOPAC1280 library of pharmacologically active compounds was obtained from Sigma, Inc (St. Louis, Mo.). All subsequent dilutions were made in DMSO. Folate was obtained from VWR, all other chemotherapeutic drugs were obtained from Cayman chemicals.
Viability and Apoptotic Assays
[0316] Cell viability was determined using CellTiter Glo Luminescent Cell Viability Assay (Promega, Madison, Wis.) as per manufacturer instructions. DAPI stain was used to assess apoptosis. Colony forming assays were performed as described previously.
Antibodies and Stains
[0317] Bcl-2 BH3 antibody was obtained from Abgent, CA. Bcl-2 antibody was obtained from Santa Cruz, Calif. Ki-67 and H&E was obtained from Cell signaling. JC-1 dye was obtained from Roche, CA.
Bcl-2 knockdown
[0318] For Bcl-2 knockdown experiments, MDA-MB-468 cells were seeded at 4,000 cells per well in a 96 well black plate. The day after seeding, cells were subjected to Bcl-2 knockdown with 25 ng siRNAs (Dharmacon Research, Lafayette, Colo.) or 25 ng control siRNA against luciferase (Dharmacon Research, Lafayette, Colo.) using Dharmafect as transfecting reagent. After 72 h of transfection time, cells were treated with indicated compounds for 48 h and viability was assayed with CellTiter Glo Luminescent Cell Viability Assay (Promega, Madison, Wis.).
Invasion Assay
[0319] Invasion assay was performed using BD transwell invasion assay kit. MDA-MB-231 cells were treated for 16 h at 10 M concentration and membrane was stained with prolong anti-fade DAPI stain and number of cells invaded were counted under a fluorescent microscope.
Limited Proteolysis Assay
[0320] GST-Bcl-2 and GST only fragments (60 g) were incubated with 0.1% DMSO or BFC1103 (50 M) for 1 h and proteolyzed by 3 g/ml of trypsin for 1, 2, 4 and 8 min. Reactions were quenched by the addition of laemmli buffer. The resulting protease cleavage fragments were resolved on a 12% SDS-PAGE gel and visualized by coomassie blue staining.
Co-IP Experiments
[0321] For CoIP experiments, HEK293T cells were plated in a 6 well plate and transfected with indicated expression plasmids by lipofectamine. The total amount of DNA was maintained at 2.5 g. After 12 h of transfection, cells were treated with DMSO or 10 M MTX for 16 h. The cells were then lysed on ice using RIPA buffer with freshly added protease inhibitor cocktail (Complete, mini, EDTA-free protease inhibitor cocktail, Roche, Inc.). The lysis buffer contained either DMSO or 10 M MTX. Cell lysates were incubated on ice for 30 min and then spun at 14,000 rpm for 30 min at 4 C. Cleared lysates were incubated with Bcl-2 antibody (sc-509, Santacruz) and incubated at 4 C. for 2-4 h end-over-end mixing. After incubation a volume of sepharose beads (sc-2003, Santacruz) were added to each sample and left end-over-end mixing overnight at 4 C. The beads were then washed four times with RIPA buffer containing either DMSO or 10 M and then solubilized in laemmli buffer. Proteins were analyzed on 10-12% SDS-PAGE and immunoblotted with mouse polyclonal anti-Bcl-2 (sc-509, Santacruz), mouse polyclonal anti-GFP (33-2600, Thermofisher).
Xenograft Experiments
[0322] All animal experiments were performed as per approved protocols from the IACUC at Oregon State University. 5 week old NOD.SCID mice were procured from Jackson Labs. Treatments were started once palpable tumors were detected. MTX was treated twice a week at 100 mg/kg dose. Body weight was measured twice a week. Tumor burden was measured twice a week using digital calipers.
Statistical Analysis
[0323] The statistical significance of difference between groups was analyzed by two-sided unpaired non-parametric student t test with Mann-Whitney test. Results were considered significant at p<0.05.
3. Small Molecule Bcl-2 Functional Converter BFC1108 for Breast Cancer Therapy Cell Culture
[0324] MDA-MB-231, MCF-7, HepG2, ZR-75-1, A375, MEFs and H460 were cultured in DMEM with L-glutamine (Mediatech) supplemented with 10% fetal bovine serum (tissue culture biologicals) with 10,000 U/mL penicillin streptomycin (Mediatech) in a humidified chamber with 5% CO.sub.2. LNCaP cells were cultured in RPMI 1640 (Mediatech). MCF10-A cells were cultured in DMEM/F-12 with appropriate supplements. All cells were passaged once in every 3 days.
Generation of Stable Cell Lines
[0325] MDA-MB-231 and MCF-7 breast cancer cell lines stably overexpressing Bcl-2 were generated via electroporation and subsequent clonal expansion in G418-containing media. MDA-MB-231 cell clones with sufficiently high expression of Bcl-2 (MDA-MB-231/Bcl-2) determined by western blotting was selected for screening along with their vector controls (MDA-MB-231/Vector). Similarly MCF-7 cells clones were selected for characterization of lead molecules.
Chemicals
[0326] ChemBridge library was order from ChemBridge Corp, CA. All subsequent dilutions were made in DMSO.
Viability Assays
[0327] Cell titer glo assay (Promega, CA) was used for assessing viability as per manufacturer instructions. DAPI stain was used to assess apoptosis.
Antibodies
[0328] Bcl-2 BH3 antibody was obtained from Abgent, CA. Bcl-2 antibody was obtained from Santa Cruz, Calif. Ki-67 and H& E was obtained from Cell signaling. JC-1 was obtained from Roche, CA.
Bcl-2 Knockdown
[0329] For Bcl-2 knockdown experiments, MDA-MB-468 cells were seeded at 4,000 cells per well in a 96 well black plate. The day after seeding, cells were subjected to Bcl-2 knockdown with 25 ng siRNAs (Dharmacon Research, Lafayette, Colo.) or 25 ng control siRNA against luciferase (Dharmacon Research, Lafayette, Colo.) using Dharmafect as transfecting reagent. After 72 h of transfection time, cells were treated with indicated compounds for 48 h and viability was assayed with CellTiter Glo Luminescent Cell Viability Assay (Promega, Madison, Wis.).
Limited Proteolysis Assay
[0330] GST-Bcl-2 and GST only fragments (60 g) were incubated with 0.1% DMSO or BFC1103 (50 M) for 1 h and proteolyzed by 3 g/ml of trypsin for 1, 2, 4 and 8 min. Reactions were quenched by the addition of laemmli buffer. The resulting protease cleavage fragments were resolved on a 12% SDS-PAGE gel and visualized by coomassie blue staining.
Animal Experiments
[0331] All animal experiments were performed as per approved protocols from the IACUC at Oregon State University. For the mammary fat pad xenograft study, 5 week old NOD.SCID mice were procured form Jackson labs. About 10.sup.6 cells were injected into both the lower flanks of mammary fat pad in PBS. Palpable tumors were detected in 4 weeks after which treatment with BFC1108 at 100 mg/kg twice a week continued till end of the study. Tumor mass was measured using digital calipers twice a week along with body weight. At the end of the study mice were euthanized and tumors were collected for immunohistochemical analysis.
[0332] For the lung metastatic study, 5 week old Nude mice were procured from Jackson Labs. About 200,000 LMD231-Luc2 cells in PBS were injected into the tail vein. Lung metastasis could be detected in 2 weeks' time. Treatments with BFC1108 at 100 mg/kg, 4 times a week, were started a day after the cells were injected. Body weight was measured twice a week. Bioluminescence was measured once a week while the mice are under anesthesia. At the end of the study mice were euthanized and lung tissues were dissected and fixed for immunohistochemical analysis.
Statistical Analysis
[0333] The statistical significance of difference between groups was analyzed by two-sided unpaired non-parametric student t test with Mann-Whitney test. Results were considered significant at p<0.05.
4. Small Molecule Bcl-2 Functional Converters for Breast Cancer Lung Metastasis Cell Culture
[0334] MDA-MB-231, MCF-7, HepG2, ZR-75-1, A375, MEFs, LMD231 and H460 were cultured in DMEM with L-glutamine (Mediatech Inc., Manassas, Va.) supplemented with 10% fetal bovine serum (Tissue Culture Biologicals, Tulare, Calif.) with 10,000 U/mL penicillin streptomycin (Mediatech Inc., Manassas, Va.) in a humidified chamber with 5% CO.sub.2. LNCaP cells were cultured in RPMI 1640 (Mediatech Inc., Manassas, Va.). MCF10-A cells were cultured in DMEM/F-12 with appropriate supplements as previously described23 (Mediatech Inc., Manassas, Va.). All cells were passaged once in every 3 days.
Generation of Bcl-2 Stable Cell Lines
[0335] MDA-MB-231 and MCF-7 breast cancer cell lines stably overexpressing Bcl-2 were generated via electroporation and subsequent clonal expansion in G418-containing media. MDA-MB-231 cell clones with sufficiently high expression of Bcl-2 (MDA-MB-231/Bcl-2) determined by western blotting was selected for screening along with their vector controls (MDA-MB-231/Vector). Similarly MCF-7 cells clones were selected for characterization of lead molecules.
Chemicals
[0336] ChemBridge library was ordered from www.Hit2lead.com (ChemBridge corp, San Diego, Calif.). Master library plates were diluted in DMSO to achieve 1 mM stocks for a final DMSO concentration of 1% (v/v). Validations were done with reordered compounds that were dissolved in DMSO to get master stocks of 20 mM. The final concentration of DMSO was always maintained under 0.1% (v/v) in all cell culture assays.
Viability and Apoptotic Assays
[0337] CellTiter Glo Luminescent Cell Viability Assay (Promega, Madison, Wis.) was used for assessing viability as per manufacturer instructions. DAPI stain was used to assess apoptosis. Colony forming assays were performed as described previously.
Antibodies
[0338] Bcl-2 BH3 antibody was obtained from Abgent (San Diego, Calif.). Bcl-2 antibody was obtained from Santa Cruz Biotechnology (Dallas, Tex.). Ki-67 and H&E was obtained from Cell Signaling Technology (Danvers, Mass.). JC-1 kit was obtained from Roche, USA.
Bcl-2 Knockdown
[0339] For Bcl-2 knockdown experiments, MDA-MB-468 cells were seeded at 4,000 cells per well in a 96 well black plate. The day after seeding, cells were subjected to Bcl-2 knockdown with 25 ng siRNAs (Dharmacon Research, Lafayette, Colo.) or 25 ng control siRNA against luciferase (Dharmacon Research, Lafayette, Colo.) using Dharmafect as transfecting reagent. After 72 h of transfection time, cells were treated with indicated compounds for 48 h and viability was assayed with CellTiter Glo Luminescent Cell Viability Assay (Promega, Madison, Wis.).
Limited Proteolysis Assay
[0340] GST-Bcl-2 loop71 and GST only fragments (60 g) were incubated with 0.1% DMSO or BFC1103 (50 M) for 1 h and proteolyzed by 3 g/ml of trypsin for 1, 2, 4 and 8 min. Reactions were quenched by the addition of Laemmli buffer. The resulting protease cleavage fragments were resolved on a 12% SDS-PAGE gel and visualized by Coomassie blue staining.
Metastatic Model and Bioluminescence Analysis
[0341] For experimental lung metastases model, LMD-231 cells derived from MDA-MB-231 that repeatedly colonized lungs were used23. Lenti viral particles with luciferase expression vector (GenTarget, San Diego, Calif.) was used to transduce LMD-231 cells to obtain high luciferase expressing clone after clonal expansion. The stable expression of luciferase was monitored for 7 weeks in vitro before using in animal experiments.
[0342] All animal experiments were performed as per approved protocols from the IACUC at Oregon State University. 5 week old nude mice were procured from Jackson Labs (Bar Harbor, Me.). Treatments were started a day after the LMD-Luc cells (200,000 cells suspended in DPBS) were injected into the lateral tail vein. Body weight was measured twice a week. Bioluminescence was measured twice a week using IVIS Lumina II (PerkinElmer, Waltham, Mass.) as per manufacturer instructions, while the mice were under anesthesia.
Statistical Analysis
[0343] The statistical significance of difference between groups was analyzed by two-sided unpaired non-parametric student t test with Mann-Whitney test. Results were considered significant at p<0.05.
5. Bcl-2 Functional Converters (BFCs) as Therapeutics for Chemo-Resistant Lung and Breast Cancers
Cell Culture
[0344] Cell lines were obtained from ATCC and maintained according to manufacturer's instructions. The human lung cancer cell line NCI-H460, H69AR (ATCC) were cultured in RPMI medium (Corning) containing 10% FBS. The human breast cancer cell line MDA-MB-231 was cultured in DMEM medium (Corning) containing 10% FBS. All cell lines were maintained at 5% CO.sub.2 and 37 C. Paclitaxel resistant H460 cells were derived by treating cells once a week over 6 weeks, initially with 1 nM paclitaxel and then increasing dose incrementally up to 100 nM. Once resistance was confirmed, paclitaxel was withdrawn from the cells. Resistance to paclitaxel was maintained without presence of paclitaxel measured up to 2 months. A parental line was maintained for a similar number of passages as the resistant line. All experiments were performed using cells that had not been treated with paclitaxel in at least three passages.
Viability Assays
[0345] Cells of interest were plated at 2000 cells per well in 96-well black tissue culture plate and allowed to adhere to the plate overnight. Viability assays were performed using 10% serum medium unless otherwise stated. Drugs were diluted in supplemented tissue culture medium and added at increasing concentrations, with DMSO as a vehicle control. Cells were then incubated for either 48 hour or 72 hours in presence of the compound, Promega Titer Glo was added to the wells at the assay end point according to manufacturer's protocol. Luminescence was measured using Tropix TR717 Microplate luminometer. Percentage of viable cells is relative to vehicle (100%). As a complementary viability assay, eBioscience Fixable Viability Dye eFluor 660(65-0864) was used to stain dead cells and analyzed using flow cytometry.
Western Blotting
[0346] Analysis of protein abundance was performed by Western blot according to standard techniques. Briefly cell lysates were collected using RIPA buffer with protease inhibitor, and then quantified using BCA assay. Some cell lysates were collected using 2 Laemmli buffer directly. Samples were boiled for 5 min and ran on SDS PAGE 12% and transferred to PVDF membranes by semi-dry transfer. Blots were probed using following antibodies, Bcl-2 (SantaCruz, sc-509), GAPDH (SantaCruz, sc-365062), Mcl-1 (Invitrogen, PA5-27597), Bcl-XL (Biosource, AHO0222), Cleaved Capase 3 Asp175 (Cell Signaling, 9661).
Real Time-Quantitative PCR
[0347] Total RNA was prepared using total RNA kit (Omega BioTek, Norcross, Ga.). The first strand cDNA was synthesized using Transcriptor kit (Roche, Indianapolis, Ind.). Real-time qPCR was done using FastStart Universal SYBR Green master mix (Roche) in 7500 Fast PCR system (Applied Biosystems) according to the manufacturer's protocol. The human GAPDH was used as a target.
Annexin V for Apoptosis with Flow Cytometry
[0348] Cells were seeded into 6 well tissue culture plates to give approximately 50% confluence and allowed to attach overnight. The cells were then treated for a period of time indicated in figure legend with the appropriate compound at various concentrations (see figure legends). An Annexin V-conjugate PerCP-eFluor 710 apoptosis detection kit was used as described by the manufacturer's protocol (eBioscience 88-8008). Harvesting of cells included collection of floating and attached cells following trypsinization. Data were acquired using an CytoFLEX S flow cytometer (Beckman Coulter, Brea, Calif.) and 10,000 events on the PC5.5 channel were analyzed using CytExpert software (Beckman Coulter). For Nur77 GFP tagged annexin V analysis, GFP positive population were selected and then Annexin V+population was determined. For each sample, 10,000 GFP+ events were collected. Annexin V positive cell population was considered to be the apoptotic population, and the percent of annexin V positive cell population was used to determine the extent of apoptosis.
Xenograft Study
[0349] Zebrafish (Danio rerio) were housed at the Sinnhuber Aquatic Research Laboratory at Oregon State University in accordance with Institutional Animal Care and Use Committee protocols. Adult 5D Tropical zebrafish were maintained under standard laboratory conditions of 281 C. on a 14 hr light/10 hr dark photoperiod in fish water consisting of reverse osmosis water supplemented with a commercially available salt solution (0.6%, Instant Ocean, UnitedPet Group, Inc., Blacksburg, Va., USA). Collected eggs were staged according to Kimmel et al. At 24 hours post fertilization (hpf), zebrafish embryos were maintained in E3 media with phenylthiourea (0.003%, Sigma, USA).
[0350] For transplantations, H460 cells were labeled with a CM-DiI dye (Thermo Fisher Sci.) according to the manufacturer's protocol and suspended to a concentration of 210.sup.7 cells/mL. Cell suspension was loaded into a borosilicate glass needle pulled from a pipette by a micropipette puller (Sutter Instrument, Novato, Calif.). Approximately 100-200 H460 cells were transplanted into the yolk of 48 hpf embryos by air-driven micro-pressure injector as described. After transplantation, embryos recovered overnight at 33 C. without light.
[0351] For imaging, zebrafish xenografts were anesthetized by emersion in 0.2 mg/mL Tricaine E3 media and imbedded in 0.8% (w/v) low melting point agarose on a glass bottom 96-well plate. A Zeiss LSM 780 confocal microscope with a 10 objective was used to capture fluorescent cells at 1 and 4 day post injection (dpi). Images were captured as z-stacks with wide-field settings. H460 cancer growth was analyzed using Fiji (Fiji is Just Imagej) software. Images were processed by making a maximum projection image of the z-stack and using a median filter. Cancer area was calculated by creating a binary mask from thresholds with the Otsu algorithm and calculating the total area of the resulting segmented objects. Increases in total area from 1 to 4 dpi were considered cancer growth.
[0352] While illustrative embodiments have been illustrated and described, it will be appreciated that various changes can be made therein without departing from the spirit and scope of the invention.