Detection of anti-p53 antibodies

11971407 ยท 2024-04-30

Assignee

Inventors

Cpc classification

International classification

Abstract

An in vitro method is disclosed for detecting an antibody to p53 (anti-p53 antibody) in a sample, the method comprising: incubating a sample to be analyzed with a p53 capture antigen and a p53 detection antigen, whereby a complex comprising the p53 capture antigen, the anti-p53 antibody and the p53 detection antigen is formed, separating the complex formed from unbound detection antigen and measuring the complex obtained via the detection antigen comprised therein, thereby detecting the anti-p53 antibody comprised in the sample.

Claims

1. An in vitro method for detecting an anti-tumor protein p53 (anti-p53) antibody in a sample having or suspected of having the anti-p53 antibody, the method comprising: a) incubating the sample with a p53 capture antigen and a p53 detection antigen, the p53 detection antigen comprising the peptide of SEQ ID NO:1 at least twice, whereby a complex comprising the p53 capture antigen, the anti-p53 antibody, and the p53 detection antigen is formed, b) separating the complex formed in (a) from unbound p53 detection antigen, and c) measuring the complex separated in step (b) via the p53 detection antigen comprised therein, thereby detecting the anti-p53 antibody.

2. The method according to claim 1, wherein the p53 capture antigen is capable of binding to a solid phase.

3. The method according to claim 2, wherein the p53 capture antigen is covalently bound to a first partner of a binding pair and wherein a second partner of said binding pair is bound to the solid phase.

4. The method according to claim 3, wherein the first partner of the binding pair is selected from the group consisting of hapten, biotin, a biotin analogue, DsF and a ligand for a receptor and wherein the second partner of said binding pair is selected from the group consisting of anti-hapten antibody, avidin, streptavidin, FimG DsF, and a ligand-receptor.

5. The method according to claim 2, wherein the p53 capture antigen is biotinylated and wherein the solid phase is coated with avidin or streptavidin.

6. The method according to claim 2, wherein the p53 capture antigen is bound to the solid phase.

7. The method according to claim 1, wherein the p53 detection antigen comprises a directly detectable label.

8. The method according to claim 7, wherein the directly detectable label is selected from the group consisting of a luminescent label, a fluorescent label, a chemiluminescent label and an electrochemiluminescent label.

9. The method according to claim 8, wherein the directly detectable label is selected from the group consisting of a chemiluminescent and an electrochemiluminescent label.

10. The method according to claim 1, wherein the p53 capture antigen comprises a peptide of SEQ ID NO: 1.

11. The method according to claim 1, wherein both the p53 capture antigen and the p53 detection antigen comprise a peptide of SEQ ID NO: 2.

12. The method according to claim 1, wherein the p53 detection antigen comprises both the peptides of SEQ ID NO:1 and of SEQ ID NO:2 at least twice.

13. The method according to claim 1, wherein the p53 detection antigen further comprises at least one multimerization domain and at least one polypeptide of SEQ ID NO:2, wherein the multimerization domain is a prokaryotic or eukaryotic chaperone selected from the group consisting of FKBP-type peptidyl-prolyl cis-trans isomerase (FkpA), Seventeen Kilodalton Protein (Skp), protein export chaperone SecB (SecB), heat shock protein 25 (Hsp25), macrophage infectivity potentiator (MIP), heat shock protein 60 (Hsp60/GroEL), caseinolytic mitochondrial matrix peptidase chaperone subunit B (ClpB) and caseinolytic mitochondrial matrix peptidase chaperone subunit X (ClpX).

14. The method according to claim 1, wherein the p53 detection antigen comprises an indirectly detectable label.

15. The method of claim 4, wherein the hapten is selected from the group consisting of biotin, a biotin analogue, sterols, a bile acid, a sexual hormone, a corticoid, a cardenolide, a cardenolide-glycoside, a bufadienolide, a steroid-sapogenine, a steroid alkaloid, and fluorescein.

16. The method of claim 15, wherein the biotin analogue is selected from the group consisting of aminobiotin, iminobiotin or desthiobiotin.

17. The method according to claim 1, wherein the p53 detection antigen further comprises at least one multimerization domain, wherein the multimerization domain is a prokaryotic or eukaryotic chaperone selected from the group consisting of FKBP-type peptidyl-prolyl cis-trans isomerase (FkpA), Seventeen Kilodalton Protein (Skp), protein export chaperone SecB (SecB), heat shock protein 25 (Hsp25), macrophage infectivity potentiator (MIP), heat shock protein 60 (Hsp60/GroEL), caseinolytic mitochondrial matrix peptidase chaperone subunit B (ClpB) and caseinolytic mitochondrial matrix peptidase chaperone subunit X (ClpX).

18. The method according to claim 13, wherein the p53 detection antigen comprises both the peptides of SEQ ID NO:1 and of SEQ ID NO:2 at least twice.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) FIG. 1 Assay principle of Elecsys anti-p53 assay

(2) The double antigen sandwich assay (DAGS) format is schematically depicted.=>detection of anti-p53 auto-antibodies present in the sample is accomplished via biotinylated capture antigen (binding to streptavidin coated to paramagnetic beads) and ruthenylated p53 detection antigen.

(3) FIG. 2 ROC-Blots

(4) For both assays analyzed, the receiver-operator-curves (ROCs) are given. The ROC for the MesaCup assay is depicted as an interrupted line, whereas the ROC for the assays disclosed in the present application is given as continuous/full line.

DETAILED DESCRIPTION OF THE INVENTION

(5) The present disclosure relates to an in vitro method for detecting an antibody to p53 (anti-p53 antibody) in a sample, the method comprising: a) incubating a sample to be analyzed with a p53 capture antigen and a p53 detection antigen, whereby a complex comprising the p53 capture antigen, the anti-p53 antibody and the p53 detection antigen is formed, b) separating the complex formed in (a) from unbound detection antigen, c) measuring the complex obtained in step (b) via the detection antigen comprised therein, thereby detecting the anti-p53 antibody comprised in the sample.

(6) In the following the terms anti-p53 (auto-) antibody, anti-p53 antibody or p53 antibody are used interchangeably. An anti-p53 antibody is an antibody that binds to the p53 polypeptide of SEQ ID NO: 3 or to a partial sequence thereof.

(7) As mentioned above the method according to the present invention requires the use of both, a p53 capture antigen and of a p53 detection antigen, respectively. An antibody to p53 present in a sample to be investigated binds to both these antigens, thereby forming a complex comprising the p53 capture antigen, the anti-p53 antibody and the p53 detection antigen.

(8) The term capture antigen is familiar to a person skilled in the art.

(9) In order to perform a double antigen sandwich immuno assay it is required that one provides an epitope at least twice, at least once on the capture antigen to mediate binding to a solid phase, and at least once on the detection antigen to allow for detection of the sandwich complex (antigen-antibody-antigen) formed.

(10) In one embodiment the p53 capture antigen is capable of binding to a solid phase.

(11) Materials for manufacturing a solid phase (solid support) are well-known in the art. and include, inter alia, commercially available column materials, polystyrene beads, latex beads, magnetic beads, colloid metal particles, glass and/or silicon chips and surfaces, nitrocellulose strips, membranes, sheets, duracytes, wells and walls of reaction trays, wells and walls of reaction vessels, plastic tubes etc.

(12) In one embodiment the solid phase is represented by the wells and walls of a microtitre plate.

(13) In one embodiment the solid phase is in the form of particles. The particle may be a microparticle which is or which comprises magnetic or ferromagnetic metals, alloys or compositions. In further embodiments, the solid phase material may have specific properties and e.g. be hydrophobic, or hydrophilic. In one embodiment of the present invention, the microparticles are paramagnetic microparticles and the separation of such particles in the measurement method according to the present disclosure is facilitated by magnetic forces. Magnetic forces are applied to pull the paramagnetic or magnetic particles out of the solution/suspension and to retain them as desired while liquid of the solution/suspension can be removed and the particles can e.g. be washed.

(14) As indicated above, in one embodiment the p53 capture antigen is capable of binding to a solid phase. In order for the capture antigen to be capable of binding to a solid phase it is preferred to employ a specific binding pair. One partner of such binding pair is bound to the capture antigen and the other partner of such binding pair is bound to the solid phase.

(15) A binding pair as used herein consists of two partners binding to each other with high affinity, i.e. with one nanomolar affinity or better. Embodiments for binding pairs are for example the binding pairs consisting of receptor and ligand, antigen and antibody, hapten and anti-hapten antibody, and binding pairs based on naturally occurring high affinity binding pairs.

(16) One example of a receptor-ligand binding pair is a pair consisting of a steroid hormone receptor and the corresponding steroid hormone.

(17) One further type of a binding pair which is suitable for the method according to the present invention is a hapten and anti-hapten antibody binding pair. A hapten is an organic molecule with a molecular weight of 100 to 2000 Dalton, preferably of 150 to 1000 Dalton. Such small molecule which if used as such is non-immunogenic but can be rendered immunogenic by coupling it to a carrier molecule and anti-hapten antibodies can be generated according to standard procedures. The hapten may be selected from the group comprising sterols, bile acids, sexual hormones, corticoids, cardenolides, cardenolide-glycosides, bufadienolides, steroid-sapogenines and steroid alkaloids, cardenolides and cardenolide-glycosides. Representatives of these substance classes are digoxigenin, digitoxigenin, gitoxigenin, strophanthidin, digoxin, digitoxin, ditoxin, strophanthin. Another suitable hapten is for example fluorescein.

(18) Examples of binding pairs based on naturally occurring high affinity binding pairs are biotin or biotin analogues such as aminobiotin, iminobiotin or desthiobiotin and avidin or streptavidin as well as the FimG and DsF binding pair. The biotin-(strept)avidin binding pair is well-known in the art. The basic principles of the FimG-DsF binding pair are e.g. described in WO2012/028697.

(19) In one embodiment the p53 capture antigen is covalently bound to a first partner of a binding pair and the second partner of said binding pair is bound to the solid phase.

(20) In one embodiment the first partner of the binding pair is selected from hapten, biotin or a biotin analogue such as aminobiotin, iminobiotin or desthiobiotin, DsF and the ligand for a receptor and the second partner of said binding pair is selected from anti-hapten antibody, avidin or streptavidin, FimG and a ligand-receptor.

(21) In one embodiment first partner of the binding pair is selected from hapten, biotin or a biotin analogue such as aminobiotin, iminobiotin or desthiobiotin and DsF, and the second partner of said binding pair is selected from anti-hapten antibody, avidin or streptavidin and FimG.

(22) In one embodiment first partner of the binding pair is selected from biotin or a biotin analogue, such as aminobiotin, iminobiotin or desthiobiotin, and DsF, and the second partner of said binding pair is selected from, avidin or streptavidin and FimG.

(23) In one embodiment first partner of the binding pair is biotin or a biotin analogue such as aminobiotin, iminobiotin or desthiobiotin and the second partner of said binding pair is selected from avidin or streptavidin.

(24) In one embodiment first partner of the binding pair is biotin and the second partner of said binding pair is streptavidin.

(25) In one embodiment the method according to the present invention is practiced with a p53 capture antigen that is biotinylated and a solid phase that is coated with avidin or streptavidin.

(26) It is, however, also possible to directly bind the capture antigen to a solid phase. In one embodiment the method according to the present invention is practiced with a p53 capture antigen that is bound to the solid phase.

(27) Antibodies are at least bi-valent, i.e. having the potential to bind with one arm to the capture antigen and with the other arm (or any of the other arms for multivalent antibodies) to the detection antigen.

(28) An antibody to p53 present in a sample to be investigated binds to both these antigens, thereby forming a complex comprising the capture antigen, the anti-p53 antibody and the detection antigen.

(29) The skilled artisan is familiar with the term detection antigen.

(30) The term detection antigen implies that this antigen can be detected. Such detection can be accomplished by various types of labels which are either directly or indirectly detactable.

(31) In one embodiment the method according to the present disclosure is a method wherein the p53 detection antigen comprises a directly detectable label.

(32) The term detectably labeled encompasses labels that can be directly or indirectly detected.

(33) Directly detectable labels either provide a detectable signal or they interact with a second label to modify the detectable signal provided by the first or second label, e.g. to give FRET (fluorescence resonance energy transfer). Labels such as fluorescent dyes and luminescent (including chemiluminescent and electrochemiluminescent) dyes (Briggs et al Synthesis of Functionalised Fluorescent Dyes and Their Coupling to Amines and Amino Acids, J. Chem. Soc., Perkin-Trans. 1 (1997) 1051-1058) provide a detectable signal and are generally applicable for labeling. In one embodiment detectably labeled refers to a label providing or inducible to provide a detectable signal, i.e. to a luminescent label, to a fluorescent label, to a chemiluminescent label or to an electrochemiluminescent label, respectively.

(34) In one embodiment according to the present disclosure the microparticle-based analyte-specific binding assay makes use of a chemiluminescent or an electrochemiluminescent label and a corresponding light detection system. The light produced by the label is measured and directly or indirectly indicates the presence or quantity of the analyte.

(35) Electrochemiluminescent (ECL) assays provide a sensitive and precise measurement of the presence and concentration of an analyte of interest. Such techniques use labels or other reactants that can be induced to luminesce when electrochemically oxidized or reduced in an appropriate chemical environment. Such electrochemiluminescense is triggered by a voltage imposed on a working electrode at a particular time and in a particular manner. The light produced by the label is measured and indicates the presence or quantity of the analyte. For a fuller description of such ECL techniques, reference is made to U.S. Pat. Nos. 5,221,605, 5,591,581, 5,597,910, PCT published application WO90/05296, PCT published application WO92/14139, PCT published application WO90/05301, PCT published application WO96/24690, PCT published application US95/03190, PCT application US97/16942, PCT published application US96/06763, PCT published application WO95/08644, PCT published application WO96/06946, PCT published application WO96/33411, PCT published application WO87/06706, PCT published application WO96/39534, PCT published application WO96/41175, PCT published application WO96/40978, PCT/US97/03653 and U.S. patent application Ser. No. 08/437,348 (U.S. Pat. No. 5,679,519). Reference is also made to a 1994 review of the analytical applications of ECL by Knight, et al. (Analyst, 1994, 119: 879-890) and the references cited therein. In one embodiment the method according to the present description is practiced using an electrochemiluminescent label.

(36) In one embodiment the directly detectable label (used to label the detection antigen in a method of the present disclosure) is selected from the group consisting of a luminescent label, a fluorescent label, a chemiluminescent label or an electrochemiluminescent label.

(37) In one embodiment the directly detectable label is a chemiluminescent or an electrochemiluminescent label.

(38) In one embodiment the double-antigen sandwich assay according to the present disclosure uses the full length p53 polypeptide of SEQ ID NO:3 both as the capture as well as the detection antigen.

(39) A synthetic peptide, representing at least one important epitope of p53 of the p53 polypeptide is of high utility in a method according to the present disclosure. Without wanting to be bound to theory, it may well be that such synthetic peptide sequence comprises an epitope that is bound by a significant percentage of those antibodies in a sample that also bind to the full-length p53 polypeptide. At the same time it may well be that those stretches of the p53 polypeptide that are rarely or not at all bound by an anti-p53 antibody (as e.g. comprised in a bodily fluid sample) are those sequence stretches that significantly contribute to the non-specific binding of antibodies, especially of the sticky IgM-class antibodies.

(40) In one embodiment the in vitro method for detection of anti-p53 antibodies according to the present invention is a double antigen sandwich immuno assay method wherein both the p53 capture antigen and the p53 detection antigen comprise a peptide of SEQ ID NO: 1.

(41) In one embodiment the in vitro method for detection of anti-p53 antibodies according to the present invention is a double antigen sandwich immuno assay method wherein both the p53 capture antigen and the p53 detection antigen comprise a peptide of SEQ ID NO: 2.

(42) In one embodiment the method for detection of anti-p53 antibodies according to the present invention is a double antigen sandwich immuno assay method wherein the peptides of SEQ ID NO:1 and of SEQ ID NO:2 are each comprised in both the p53 capture antigen and the p53 detection antigen.

(43) In one embodiment the peptides representing the relevant partial sequences of the p53 polypeptide used in a method for detection of anti-p53 antibodies according to the present invention are the peptides consisting of SEQ ID NO:1 and of SEQ ID NO:2, respectively.

(44) In one embodiment the method for detection of anti-p53 antibodies according to the present invention is a double antigen sandwich immuno assay method wherein the p53 detection antigen is a single polypeptide comprising both the peptides of SEQ ID NO:1 and of SEQ ID NO:2 at least twice.

(45) In one embodiment the method for detection of anti-p53 antibodies according to the present invention is a double antigen sandwich immuno assay method wherein the p53 detection antigen comprises a fusion polypeptide comprising at least one multimerization domain, at least one polypeptide of SEQ ID NO: 1 and at least one polypeptide of SEQ ID NO:2, wherein the multimerization domain is a prokaryotic or eukaryotic chaperone selected from the group consisting of FkpA, Skp, SecB, Hsp25, MIP, GroEL, ClpB and ClpX.

(46) In one embodiment the present disclosure relates to a fusion polypeptide comprising at least one multimerization domain, at least one polypeptide of SEQ ID NO:1 and at least one polypeptide of SEQ ID NO:2, wherein the multimerization domain is a prokaryotic or eukaryotic chaperone selected from the group consisting of FkpA, Skp, SecB, Hsp25, MIP, GroEL, ClpB and ClpX.

(47) The multimerization domain is preferably located at the N- and/or C-terminus of the fusion polypeptide, more preferably at the N-terminus. The multimerization domain is a polypeptide sequence which supports multimerization of individual fusion polypeptide molecules, wherein a multimer is formed which is comprised of a plurality of monomeric subunits, which are associated by non-covalent interactions. The monomeric subunits of the complex are genetic fusion proteins, wherein the individual amino acid residues are linked by peptide bonds. The monomeric subunits of the multimer are preferably identical.

(48) For example, the multimerization domain may be a dimerization domain, i.e. a domain which supports noncovalent association of two subunits, a trimerization domain, which supports non-covalent association of three subunits, a tetramerization domain or an even higher mukimerization domain. Preferably, the multimerization domain is a dimerization domain, a trimerization domain or a tetramerization domain.

(49) Multimerization domains may be selected from prokaryotic or eukaryotic chaperones, preferably from ATPindependent chaperones. Specific examples of multimerization domains are the proteins FkpA, Skp and SecB from E. coli or orthologs thereof from other prokaryotic organisms. FkpA is an ATP-independent periplasmic dimerization chaperone from E. coli. Skp is an ATP-independent periplasmic trimerization chaperone from E. coli. SecB is an ATPindependent cytosolic tetramerization chaperone from E. coli. Further suitable multimerization domains are heat shock proteins from eukaryotic or prokaryotic organisms, e.g. Hsp25, an ATP-independent eukaryotic cytosolic/nuclear oligomeric chaperone. A further suitable multimerization domain is MIP (macrophage infectivity potentiator), an ATP-independent dimerization chaperone which is structurally related with FkpA. ATP-dependent chaperones like GroEL, an ATP-dependent cytosolic heptamerisation chaperone from E. coli or ClpB, an ATP-dependent hexamerization chaperone from E. coli or ClpX are also suitable. Further, the multimerization domains may be selected from fragments or variants of the above polypeptides, which retain their ability of multimer formation.

(50) The individual polypeptide sequences of SEQ ID NO:1 and of SEQ ID NO:2, respectively, in the fusion polypeptide may be separated by spacer sequences. The spacer sequences are preferably sequences which are heterologous to the p53. For practical purposes, the spacer sequences are selected from sequences which barely if at all interfere with the use of the fusion polypeptide as an antigen for determining anti-p53 antibodies. This means that the spacer sequences are not immunologically reactive against the antibodies to be tested. E.g., the spacer sequences comprise glycine and/or serine residues. In one embodiment the spacer is a poly-glycine spacer. The length of the spacer sequence is preferably from 1-10 amino acids.

(51) Further, a spacer sequence may be present between the multimerization domain and the polypeptide of SEQ ID NO:1 and/or the polypeptide of SEQ ID NO:2.

(52) This spacer sequence may have a length of e.g. 1-100 amino acids. Preferably, this spacer sequence is as described above.

(53) In one embodiment the method according to the present disclosure is practiced with a p53 detection antigen comprising an indirectly detectable label.

(54) Indirectly detectably labeled refers, e.g. to a detection antigen comprising a hapten and to the detection of such haptenylated compound by an anti-hapten antibody carrying a directly detectable label or to the a detection antigen comprising an enzyme and to the detection of such enzyme by its corresponding enzymatic activity resulting in the conversion of an appropriate dye substrate. Various enzyme-substrate labels are available or disclosed (see e.g. U.S. Pat. No. 4,275,149). The enzyme generally catalyzes a chemical alteration of a chromogenic substrate that can be measured using various techniques. For example, the enzyme may catalyze a color change in a substrate, which can be measured spectrophotometrically. Alternatively, the enzyme may alter the fluorescence or chemiluminescence of the substrate. The chemiluminescent substrate becomes electronically excited by a chemical reaction and may then emit light which can be measured (using a chemiluminometer, for example) or donates energy to a fluorescent acceptor. Examples of enzymatic labels include luciferases (e.g., firefly luciferase and bacterial luciferase; U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, malate dehydrogenase, urease, peroxidase such as horseradish peroxidase (HRP), alkaline phosphatase (AP), (3-galactosidase, glucoamylase, lysozyme, saccharide oxidases (e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase), heterocyclic oxidases (such as uricase and xanthine oxidase), lactoperoxidase, microperoxidase, and the like. Techniques for conjugating enzymes to polypeptides are described in O'Sullivan et al Methods for the Preparation of Enzyme-Antibody Conjugates for use in Enzyme Immunoassay, in Methods in Enzym. (ed. by J. Langone & IT Van Vunakis), Academic Press, New York, 73 (1981) 147-166.

(55) Examples of enzyme-substrate combinations (U.S. Pat. Nos. 4,275,149; 4,318,980) include, for example: Horseradish peroxidase (HRP) with hydrogen peroxidase as a substrate, wherein the hydrogen peroxidase oxidizes a dye precursor (e.g., orthophenylene diamine (OPD) or 3,3,5,5-tetramethylbenzidine hydrochloride (TMB)); alkaline phosphatase (AP) with para-nitrophenyl phosphate as chromogenic substrate; and (3-D-galactosidase ((3-D-Gal) with a chromogenic substrate (e.g., p-nitro phenyl-(3-D-galactosidase) or fluorogenic substrate 4-methylumbelliferyl-(3-D-galactosidase.

(56) As mentioned above and as demonstrated in the Examples section, anti.p53 antibodies are most frequently found in CRC. In one embodiment the present invention relates to an in vitro method for diagnosing CRC by detecting an antibody to p53 (anti-p53 antibody) in a sample, the method comprising: a) incubating a sample to be analyzed with a p53 capture antigen and a p53 detection antigen, whereby a complex comprising the p53 capture antigen the anti-p53 antibody and the p53 detection antigen is formed, b) separating the complex formed in (a) from unbound detection antigen, c) measuring the complex obtained in step (b) via the detection antigen comprised therein, and d) diagnosing CRC if anti-p53 antibody is measured in the sample.

(57) Liquid samples can be used in a method for specific in vitro-detection of anti-p53 antibodies in a method according to the present disclosure. The sample may be known to comprise an anti-p53 antibody or it may be suspected of comprising an anti-p53 antibody. In one embodiment the sample for in vitro diagnosis used in a method according to the present disclosure is a body fluid selected from whole blood, blood serum, blood plasma, liquor, urine or saliva. In one embodiment the sample suspected of comprising or comprising an anti-p53 antibody is serum, plasma or liquor. In one embodiment the sample suspected of comprising or comprising an anti-p53 antibody is serum or plasma.

(58) The following examples and figures are provided to aid the understanding of the present invention, the true scope of which is set forth in the appended claims. It is understood that modifications can be made in the procedures set forth without departing from the spirit of the invention.

Example 1

(59) Capture and Detection Antigen Used for Detection of Anti-p53 Auto-Antibodies

(60) Various types of double antigen sandwich assay (DAGS) have been used.

(61) It is possible to perform the DAGS assay for detection of anti-p53 auto-antibodies present in a sample as an enzyme-linked immuno sorbent assay (ELISA) in microtitre plates.

(62) Synthetic peptides of SEQ ID NO:1 and SEQ ID NO:2, respectively proved to be advantageous. They could easily and reproduceably be synthesized and seemed to be appropriate due to the specific binding of anti-p53 antibodies thereto.

(63) For higher through-put and higher reproduceability an anti-p53 assay was developed running on the automated electrochemiluminescense-based analyzers from Roche Diagnostics, Mannheim, Germany.

(64) In one assays format two biotinylated peptides, one comprising the peptide of SEQ ID NO:1 and the other comprising the peptide of SEQ ID NO:2 are used as the capture antigen and the ruthenylated forms of both these peptides are used as the detection antigen.

(65) 1.1 The Biotinylated Peptides Used as Capture Antigen

(66) As mentioned above both the sequence of SED ID NO:1 and SEQ ID NO:2, respectively, appear to comprise epitopes preferably bound by anti p53 (auto-) antibodies. Synthetic peptides comprising these sequences plus a linker consisting of three times the dipeptide glutamic acid (E)-?-alanine (U) (=EU3) at their N-terminus were N-terminally coupled to activated biotin resulting in the two capture antigens jointly used in the Elecsys method described in more detail below. These biotinylated capture antigens were denominated as p53(11-35)[Bi(EU)3-11]amid and p53 (41-60)[Bi(EU)3-41]amid, respectively

(67) 1.2 The Ruthenylated Recombinant Fusion Protein Used as Detection Antigen

(68) It was found that it is possible to improve assay sensitivity by use of a multimeric detection antigen. The use of a multimeric antigen allows the binding of low affinity IgG-autoantibodies and/or also allows the binding of autoantibodies of the IgM type. To that end the p53 peptides of SEQ ID NO:1 (amino acids 11-35 of p53) and of SEQ ID NO:2 (amino acids 41-60 of p53) were expressed in E. coli as part of a recombinant polypeptide comprising Skp, SEQ ID NO:1 and SEQ ID NO:2 twice and an octa His-tag.

(69) The sequence of the recombinant p53-construct (SEQ ID NO:4) was as follows:

(70) TABLE-US-00001 MADKIAIVNMGSLFQQVAQKTGVSNTLENEFRGRASELQR METDLQAKMKKLQSMKAGSDRTKLEKDVMAQRQTFAQKAQ AFEQDRARRSNEERGKLVTRIQTAVKSVANSQDIDLVVDANAVAYNSSDV KDITADVLKQVKGGGSGGGSGGGSGGGSGGGSEPPLSQET FSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDP GPGGGSGGGSGGGSGGGSGGGSEPPLSQETFSDLWKLLPENNVLSPL PSQAMDDLMLSPDDIEQWFTEDPGPGGSHHHHHHHH

(71) The underlined parts of the sequence represent SEQ ID NO:1 and SEQ ID NO:2, respectively. The sequence part given in cursory writing corresponds to the sequence derived from the chaperone Skp. The octa-His-tag is at the C-terminus of this recombinant polypeptide as used in the p53 detection antigen.

(72) The recombinant polypeptide of SEQ ID NO:3 was produced according to procedures well known in the art and e.g. described in detail in EP 1 982 993 B1.

(73) Ruthenylation was performed according to standard procedures. In a typical protocol for ruthenylation the lysine ?-amino groups of the fusion protein are modified at protein concentrations of about 10 mg/ml with N-hydroxy-succinimide activated ruthenium labels. The label:protein molar ratio can be varied from 2:1 to 7:1, depending on the respective fusion protein an requirements for density of labels. The reaction buffer usually is 150 mM potassium phosphate (pH 8.0), 50 mM potassium chloride, 1 mM EDTA. The coupling or labeling reaction usually is carried out at room temperature for 10 minutes and stopped by adding buffered L-lysine to a final concentration of 10 mM. To avoid hydrolytic inactivation of the activated labels, the respective stock solutions are e.g. prepared in dried DMSO (seccosolv quality, Merck, Germany). DMSO concentrations up to 20% in the reaction buffer are well tolerated by the fusion protein of SEQ ID NO:4 as disclosed herein. After the coupling reaction, unreacted free label and the organic solvent was removed by passing the crude protein conjugate over a gel filtration column (Superdex 200 HiLoad).

(74) Due to the chaperon-part (Skp) of the p53-construct, the protein spontaneously trimerizes during elution from the Ni-NTA column in the controlled refolding and purification process. The resulting trimer is very stable and remains its configuration during rhutenylation and further processing.

Example 2

(75) Elecsys? Assay for Measurement of Anti-p53 Auto-Antibodies

(76) The assay principle of the Elecsys? assay for detection of anti-p53 antibodies is depicted in FIG. 1.

(77) In brief, the biotinylated capture antigen (the biotinylated peptides of Eample 1.1), the sample and the ruthenylated detection antigen (the labeled fusion protein of Example 1.2) are incubated to allow for formation of a complex of capture antigenanti-p53 antibodydetection antigen. Signal detection in the Elecsys? immunoassay is based on electrochemoluminiscence. The biotin-conjugated capture antigen is immobilized on the surface of streptavidin-coated magnetic beads, whereas the detection antigen bears a complexed ruthenium cation as the luminescent moiety. In the presence of anti-p53 antibodies, the chromogenic ruthenium complex is bridged to the solid phase and emits light at 620 nm after excitation at a platinum electrode. The signal output is in arbitrary light units.

(78) The following immunological reagents were used:

(79) TABLE-US-00002 Ruthenylated Biotinylated capture antigen Conc. detection antigen Conc. p53(11-35)[Bi(EU)3-11]amid 20 ng/ml rec.E.coli material 300 p53(41-60)[Bi(EU)3-41]amid 20 ng/ml Skp-(p53 peptides)x2- ng/ml BPRU

(80) 75 ?l of the capture antigen comprising both peptides, each at the above given concentration, 75 IA of the detection antigen and 20 ?l of sample were incubated for 9 min. Magnetic Elecsys? beads (30 ?l were added and incubated for 9 min to adsorb the complex of capture antigenant-p53 antibodydetection antigen.

(81) Signal measurement was performed on an Elecsys? e601 analyzer according to standard procedures.

(82) The buffer used for the capture antigen comprises the following components:

(83) TABLE-US-00003 Buffer component conc Kaliumdihydrogenphosphat 65 mM Di-Kaliumhydrogenphosphat 1? H2O 35 mM NaCl 150 mM N-Methylisothiazolon-HCl 0.01% Oxy-Pyrion 0.1% Polydocanol 0.25%

(84) pH 7.2

(85) The buffer used for the detection antigen comprises the following components:

(86) TABLE-US-00004 Buffer component conc MES 50 mM NaCl 150 mM N-Methylisothiazolon-HCl 0.01% Oxy-Pyrion 0.1% Polydocanol 0.25%

(87) pH 5.4

Example 3

(88) Detection of Anti-p53 Auto-Antibodies in Clinical Samples

(89) Samples from 463 patients were analyzed side by side for anti-p53 antibodies using the anti-p53 assay as described in Example 2 and the commercially available assay MESACUP Anti-p53 TEST distributed by MEDICAL & BIOLOGICAL LABORATORIES CO., LTD., KDX Nagoya, Japan. The later was used according to the instructions given by the manufacturer.

(90) TABLE-US-00005 Number of samples Elecsys Mesacup Sensitivity Sensitivity Colorectal cancer (CRC) 88 32.95% 39.77% Spezifit?t Spezifit?t Controls from CRC 43 97.60% 86.05% screening IBD (infectious bowel 128 96.90% 79.69% diseases) osteoarthritis 35 100% 80.00% Rheumatoid arthritis 27 96.30% 81.48% Liver cirrhosis 17 100% 70.59% Renal failure 18 100% 83.33% Autoimmun diseases 40 100% 90.00%

(91) As can be seen from the above table, the newly anti-p53 antibody assay detects a comparable amount or slightly less of anti-p53 positive samples in colorectal cancer patients as compared to the competitor assay.

(92) Strikingly the newly developed assay, however, is by far less prone to positive signals in disease entities not known to be associated with antibodies to p53.

(93) As shown in FIG. 2, the area under the curve (AUC) is better for the assays developed here as compared to a commercially available kit.

(94) Most likely the positive measurements found in patients with, controls from CRC screening, IBD (infectious bowel diseases), osteoarthritis, rheumatoid arthritis, liver cirrhosis, renal failure or autoimmun diseases represent false positive measurements. Only very few false positive samples are seen with the new assay, whereas the state of the art assay very often would lead to a false positive results. Obviously, some of the additional positives found with the competitor assay in the CRC cases shown above quite likely are false positives for anti-p53 competitor assay.

(95) The newly developed assay for the in vitro detection of anti-p53 antibodies as disclosed herein has a very good specificity. Such good specificity e.g. translates into less clinical work-up with patients erroneously found as anti-p53 antibody positive.