PROTEIN PURIFICATION USING A SPLIT INTEIN SYSTEM

20240132538 ยท 2024-04-25

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to protein purification, primarily in the chromatographic field. More closely, the invention relates to affinity chromatography using a split intein system with an improved C-intein tag and N-intein ligand, wherein the target protein may be purified as a tag-less end product with a native N-terminus.

    Claims

    1. An N-intein variant comprising at least one amino acid substitution of a native split intein wherein the N-intein protein variant sequence does not include an asparagine (N) in at least position 36 as measured from the initial catalytic cysteine and wherein the substituted amino acid provides increased alkaline stability as compared to the native N-intein protein sequence or a consensus N-intein sequence.

    2. The N-intein variant of claim 1, wherein the substituted amino acid that provides increased alkaline stability is histidine (H) or glutamine (Q).

    3. An N-intein protein variant of the wildtype N-intein domain of Nostoc punctiforme (Npu) wherein the wildtype Npu N-intein domain comprises the following sequence: CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDRGEQEVFE YCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRV (SEQ ID NO: 1), wherein the protein variant comprises an amino acid substitution of the asparagine (N) in at least position 36 of SEQ ID NO: 1 with an amino acid that increases alkaline stability of the N-intein protein variant as compared to alkaline stability of the wildtype N-intein domain and variants or the wildtype N-intein domain.

    4. The N-intein protein variant of claim 3, wherein the amino acid substitution that increases alkaline stability is histidine (H) or glutamine (Q).

    5. The N-intein protein variant according to claim 4, wherein the amino acid substitution that increases alkaline stability is histidine (H).

    6. An N-intein variant sequence comprising: TABLE-US-00009 (SEQIDNO:2) ALSYDTEILTVEYGFLPIGXIVEEXIEXTVYSVDXXGFVYTQPIAQWHNR GEQEVFEYXLEDGSIIRATXDHXFMTTDGXMLPIDEIFEXGLDLXQV wherein, X in positions 20, 35, 70, 73, and 95 are each independently selected from K, R or A; X in position 28 is C, A or S; X in position 36 is N, H or Q; X in position 25 is N or R; X is position 59 is D or C; X in position 80 is E or Q; and X in position 90 is Q, R or K; and wherein the alkaline stability is increased as compared to SEQ ID NO: 1.

    7. The N-intein variant sequence according to claim 6, wherein X in positions 20, 35, 70, 73, and 95 is R; X in position 28 is A; X in position 36 is H; X in position 25 is N; X in position 59 is D; X in position 80 is E; and X in position 90 is Q;

    8. The N-intein variant sequence according to claim 6, wherein X in positions 20, 35, 70, 73, and 95 is A; X in position 28 is A; X in position 36 is H; X in position 25 is N; X in position 59 is D; X in position 80 is E; and X in position 90 is Q;

    9. The N-intein variant sequence according to claim 6, wherein X in positions 20, 35, 70, 73, and 95 is K; X in position 28 is C; X in position 36 is H; X in position 25 is N; X in position 59 is D; X in position 80 is E; and X in position 90 is Q

    10. The N-intein variant sequence according to claim 6, wherein X in position 20, 35, 70, 73, and 95 is R; X in position 28 is A; X in position 36 is N; X in position 25 is N; X in position 59 is D; X in position 80 is E; and X in position 90 is Q.

    11. The N-intein variant sequence according to claim 6, wherein X in positions 20, 35, 70, 73, and 95 is K; X in position 28 is A; X in position 36 is N; X in position 25 is N; X in position 59 is D; X in position 80 is E; and X in position 90 is Q;

    12. The N-intein variant sequence according to claim 1, which is coupled to solid phase, such as a membrane, fiber, particle, bead or chip.

    13. The N-intein variant sequence according to claim 12, wherein the solid phased is a chromatography resin of natural or synthetic origin.

    14. The N-intein variant sequence according to claim 12, wherein the solid phase is a chromatography resin, such as a natural or synthetic resin, preferably a polysaccharide such as agarose.

    15. The N-intein variant sequence according to claim 13, wherein the solid phase is provided with embedded magnetic particles.

    16. The N-intein variant sequence according to claim 12, wherein the solid phase is a non-diffusion limited resin/fibrous material.

    17. The N-intein variant sequence according to claim 12, wherein the N-intein is coupled to the solid phase via a Lys-tail, comprising one or more Lys, on the C-terminal.

    18. The N-intein variant sequence according to claim 12, wherein the N-intein is coupled to the solid phase via a Cys-tail on the C-terminal.

    19. The N-intein variant sequence according to claim 12, wherein 0.2-2 ?mole/ml N-intein is coupled per ml solid phase, preferably chromatography resin (ml swollen gel).

    20. The N-intein sequence according to claim 1, wherein the N-intein is stabile under alkaline conditions corresponding to 0.05M-0.5M, preferably 0.1-0.5M NaOH.

    21. A C-intein variant sequence comprising the amino acid sequence: TABLE-US-00010 (SEQIDNO:3) VKIVSRKSLGVQNVYDIGVEKDHNFLLANGLIASN or sequences having at least 85% identity therewith.

    22. A vector comprising the C-intein according to claim 21, and a gene encoding a protein of interest (POI).

    23. A split intein system for affinity purification of a protein of interest (POI), comprising a N-intein variant sequence of a native N-intein and a C-intein, wherein the N-intein variant sequence has a N36H or N36Q mutation as compared to native N-intein.

    24. A Split intein system according to claim 23, comprising a N-intein sequence variant of claim 1 and a C intein variant sequence of SEQ ID NO: 3.

    25. A split intein system according to claim 23, wherein the C-intein and an additional tag is co-expressed with the POI.

    26. A split intein system according to claim 23, wherein the N-intein is immobilized to a solid phase and the solid phase is re-generated after cleavage of the POI from the solid phase.

    27. A split intein system according to claim 26, wherein the solid phase is re-generated under alkaline conditions, such as 0.05-0.5 M NaOH.

    28. A split intein system according to claim 26, wherein the solid phase is regenerated up to 100 cycles, such as up to 50 cycles.

    29. A chromatography column comprising a chromatography resin which comprises one or more N-intein variant sequence ligands, wherein the N-intein variant sequence is as defined in claim 1.

    30. A method for purification of a C-intein tagged protein of interest (POI), using the split intein system according to claim 23, wherein the N-intein is immobilized to a solid phase; comprising contacting the C-intein and N-intein at neutral pH, such as 6-8, and in the presence of divalent cations; washing said solid phase in the presence of divalent cations; addition of a chelator to allow spontaneous cleavage between C-intein and POI; collection of tagless POI; and re-generating said solid phase under alkaline conditions, such as 0.05-0.5M NaOH.

    31. The method for purification of a C-intein tagged protein of interest (POI), using the split intein system according to claim 23, wherein the N-intein is immobilized to a solid phase; comprising contacting the C-intein and N-intein at neutral pH, such as 6-8, preferably under high flow rate; washing said solid phase; collection of tagless POI after cleavage between C-intein and POI; and re-generating said solid phase under alkaline conditions, such as 0.05-0.5M NaOH.

    32. A method for purification of a protein of interest (POI), comprising the following steps: co-expressing a POI with a C-intein according SEQ ID NO 3 and an additional tag; binding said additional tag to its binding partner on a first solid phase; cleaving off the POI and the C-intein; binding said C-intein to an N-intein attached to a second solid phase at neutral pH and cleaving off said bound C-intein and N-intein from said POI; and re-generating said second solid phase under alkaline conditions, such as 0.05-0.5M NaOH.

    33. The method according to claim 32, wherein the additional tag is an affinity tag, ion exchange, hydrophobic interaction, solubility, multimodal.

    34. The method according to claim 30, the alkaline conditions are combined with chaotrope agents, such as guanidine or urea, and the solid phase may be regenerated up to 100 times.

    35. The method according to claim 30, wherein the POI's are: proteins requiring native or near native N-terminal sequences, for example therapeutic protein candidates, biologics, antibody fragments, antibody mimetics, enzymes, recombinant proteins or peptides, such as growth factors, cytokines, chemokines, hormones, antigen (viral, bacterial, yeast, mammalian) production, vaccine production, cell surface receptors, fusion proteins.

    36. The method according to claim 30, wherein more than 30%, preferably more than 50%, most preferably more than 80% yield of POI is achieved in less than 4 hours cleavage.

    37. The method according to claim 30, wherein the N-intein is immobilized on a chromatography resin, and wherein the static binding capacity is 0.2-2 ?mole/ml C-intein bound POI per settled ml resin.

    38. An N-intein variant according to claim 1, wherein all asparagine (N) amino acid residues are substituted with amino acid residue that provides increased alkaline stability as compared to the native N-intein protein sequence.

    39. An N-intein variant according to claim 1, wherein all asparagine (N) amino acid residues are substituted with amino acid residue that provides increased alkaline stability and wherein the cysteine at the first residue is substituted with any other amino acid.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0015] FIG. 1 is a graph showing the relative binding capacity for N-intein ligands according to the invention (A40, A41 and A48) coupled to an SPR biosensor chip.

    [0016] FIG. 2 is a staple diagram showing the relative binding capacity for N-intein ligands according to the invention (B72, B22, A48) and a comparative ligand (A53) coupled to an SPR sensor chip.

    [0017] FIG. 3 shows static binding capacity of the N-intein ligands of the invention. Amino acid analysis (AAA) is done by conventional method. A48 prototypes are coupled by epoxy chemistry to porous agarose particles.

    [0018] FIG. 4A is a chromatogram of the purification results of Experiment 6.

    [0019] FIG. 4B shows the SDS PAGE results from Experiment 6.

    [0020] FIG. 5 is a graph showing the relative binding capacity for N-intein ligands according to the invention (A40 and A48) coupled to an SPR biosensor chip.

    DETAILED DESCRIPTION OF THE INVENTION

    Definitions

    [0021] As used in the specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a functional group, an alkyl, or a residue includes mixtures of two or more such functional groups, alkyls, or residues, and the like.

    [0022] Ranges can be expressed herein as from about one particular value, and/or to about another particular value. When such a range is expressed, a further aspect includes from the one particular value and/or to the other particular value. Similarly, when values are expressed as approximations, by use of the antecedent about, it will be understood that the particular value forms a further aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint, and independently of the other endpoint. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as about that particular value in addition to the value itself. For example, if the value 10 is disclosed, then about 10 is also disclosed. It is also understood that each unit between two particular units are also disclosed. For example, if 10 and 15 are disclosed, then 11, 12, 13, and 14 are also disclosed.

    [0023] A weight percent (wt. %) of a component, unless specifically stated to the contrary, is based on the total weight of the formulation or composition in which the component is included.

    [0024] As used herein, the terms optional or optionally means that the subsequently described event or circumstance can or can not occur, and that the description includes instances where said event or circumstance occurs and instances where it does not.

    [0025] The term contacting as used herein refers to bringing two biological entities together in such a manner that the compound can affect the activity of the target, either directly; i.e., by interacting with the target itself, or indirectly; i.e., by interacting with another molecule, co-factor, factor, or protein on which the activity of the target is dependent. Contacting can also mean facilitating the interaction of two biological entities, such as peptides, to bond covalently or otherwise.

    [0026] As used herein, kit means a collection of at least two components constituting the kit. Together, the components constitute a functional unit for a given purpose. Individual member components may be physically packaged together or separately. For example, a kit comprising an instruction for using the kit may or may not physically include the instruction with other individual member components. Instead, the instruction can be supplied as a separate member component, either in a paper form or an electronic form which may be supplied on computer readable memory device or downloaded from an internet website, or as recorded presentation.

    [0027] As used herein, instruction(s) means documents describing relevant materials or methodologies pertaining to a kit. These materials may include any combination of the following: background information, list of components and their availability information (purchase information, etc.), brief or detailed protocols for using the kit, trouble-shooting, references, technical support, and any other related documents. Instructions can be supplied with the kit or as a separate member component, either as a paper form or an electronic form which may be supplied on computer readable memory device or downloaded from an internet website, or as recorded presentation. Instructions can comprise one or multiple documents, and are meant to include future updates.

    [0028] The term peptide, polypeptides and protein are used interchangeably herein and include proteins and fragments thereof. Polypeptides are disclosed herein as amino acid residue sequences. Those sequences are written left to right in the direction from the amino to the carboxy terminus. In accordance with standard nomenclature, amino acid residue sequences are denominated by either a three letter or a single letter code as indicated as follows: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic Acid (Asp, D), Cysteine (Cys, C), Glutamine (Gln, Q), Glutamic Acid (Glu, E), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), and Valine (Val, V). Peptides include any oligopeptide, polypeptide, gene product, expression product, or protein. A peptide is comprised of consecutive amino acids and encompasses naturally occurring or synthetic molecules.

    [0029] In addition, as used herein, the term peptide refers to amino acids joined to each other by peptide bonds or modified peptide bonds, e.g., peptide isosteres, etc. and may contain modified amino acids other than the 20 gene-encoded amino acids. The peptides can be modified by either natural processes, such as post-translational processing, or by chemical modification techniques which are well known in the art. Modifications can occur anywhere in the peptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. The same type of modification can be present in the same or varying degrees at several sites in a given polypeptide. Also, a given peptide can have many types of modifications. Modifications include, without limitation, linkage of distinct domains or motifs, acetylation, acylation, ADP-ribosylation, amidation, covalent cross-linking or cyclization, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of a phosphytidylinositol, disulfide bond formation, demethylation, formation of cysteine or pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristolyation, oxidation, pergylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, and transfer-RNA mediated addition of amino acids to protein such as arginylation. (See ProteinsStructure and Molecular Properties 2nd Ed., T. E. Creighton, W.H. Freeman and Company, New York (1993); Posttranslational Covalent Modification of Proteins, B. C. Johnson, Ed., Academic Press, New York, pp. 1-12 (1983)).

    [0030] As used herein, variant refers to a molecule that retains a biological activity that is the same or substantially similar to that of the original sequence. The variant may be from the same or different species or be a synthetic sequence based on a natural or prior molecule. Moreover, as used herein, variant refers to a molecule having a structure attained from the structure of a parent molecule (e.g., a protein or peptide disclosed herein) and whose structure or sequence is sufficiently similar to those disclosed herein that based upon that similarity, would be expected by one skilled in the art to exhibit the same or similar activities and utilities compared to the parent molecule. For example, substituting specific amino acids in a given peptide can yield a variant peptide with similar activity to the parent.

    [0031] In the context of the present invention, a substitution in a variant protein is indicated as: [original amino acid/position in sequence/substituted amino acid] For example, an asparagine (N) at position 36 of an amino acid sequence that has been mutated to a histidine (H) is indicated interchangeably as N36H or N36 to H.

    [0032] As used herein, the term protein of interest (POI) includes any synthetic or naturally occurring protein or peptide. The term therefore encompasses those compounds traditionally regarded as drugs, vaccines, and biopharmaceuticals including molecules such as proteins, peptides, and the like. Examples of therapeutic agents are described in well-known literature references such as the Merck Index (14th edition), the Physicians' Desk Reference (64th edition), and The Pharmacological Basis of Therapeutics (1st edition), and they include, without limitation, medicaments; substances used for the treatment, prevention, diagnosis, cure or mitigation of a disease or illness; substances that affect the structure or function of the body, or pro-drugs, which become biologically active or more active after they have been placed in a physiological environment.

    [0033] As used herein, isolated peptide or purified peptide is meant to mean a peptide (or a fragment thereof) that is substantially free from the materials with which the peptide is normally associated in nature, or from the materials with which the peptide is associated in an artificial expression or production system, including but not limited to an expression host cell lysate, growth medium components, buffer components, cell culture supernatant, or components of a synthetic in vitro translation system. The peptides disclosed herein, or fragments thereof, can be obtained, for example, by extraction from a natural source (for example, a mammalian cell), by expression of a recombinant nucleic acid encoding the peptide (for example, in a cell or in a cell-free translation system), or by chemically synthesizing the peptide. In addition, peptide fragments may be obtained by any of these methods, or by cleaving full length proteins and/or peptides.

    [0034] The word or as used herein means any one member of a particular list and also includes any combination of members of that list.

    [0035] The phrase nucleic acid as used herein refers to a naturally occurring or synthetic oligonucleotide or polynucleotide, whether DNA or RNA or DNA-RNA hybrid, single-stranded or double-stranded, sense or antisense, which is capable of hybridization to a complementary nucleic acid by Watson-Crick base-pairing. Nucleic acids of the invention can also include nucleotide analogs (e.g., BrdU), and non-phosphodiester internucleoside linkages (e.g., peptide nucleic acid (PNA) or thiodiester linkages). In particular, nucleic acids can include, without limitation, DNA, RNA, cDNA, gDNA, ssDNA, dsDNA or any combination thereof.

    [0036] As used herein, isolated nucleic acid or purified nucleic acid is meant to mean DNA that is free of the genes that, in the naturally-occurring genome of the organism from which the DNA of the invention is derived, flank the gene. The term therefore includes, for example, a recombinant DNA which is incorporated into a vector, such as an autonomously replicating plasmid or virus; or incorporated into the genomic DNA of a prokaryote or eukaryote (e.g., a transgene); or which exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR, restriction endonuclease digestion, or chemical or in vitro synthesis). It also includes a recombinant DNA which is part of a hybrid gene encoding additional polypeptide sequences. The term isolated nucleic acid also refers to RNA, e.g., an mRNA molecule that is encoded by an isolated DNA molecule, or that is chemically synthesized, or that is separated or substantially free from at least some cellular components, for example, other types of RNA molecules or peptide molecules.

    [0037] As used herein, extein refers to the portion of an intein-modified protein that is not part of the intein and which can be spliced or cleaved upon excision of the intein.

    [0038] Intein refers to an in-frame intervening sequence in a protein. An intein can catalyze its own excision from the protein through a post-translational protein splicing process to yield the free intein and a mature protein. An intein can also catalyze the cleavage of the intein-extein bond at either the intein N-terminus, or the intein C-terminus, or both of the intein-extein termini. As used herein, intein encompasses mini-inteins, modified or mutated inteins, and split inteins.

    [0039] As used herein, the term split intein refers to any intein in which one or more peptide bond breaks exists between the N-terminal intein segment and the C-terminal intein segment such that the N-terminal and C-terminal intein segments become separate molecules that can non-covalently reassociate, or reconstitute, into an intein that is functional for splicing or cleaving reactions. Any catalytically active intein, or fragment thereof, may be used to derive a split intein for use in the systems and methods disclosed herein. For example, in one aspect the split intein may be derived from a eukaryotic intein. In another aspect, the split intein may be derived from a bacterial intein. In another aspect, the split intein may be derived from an archaeal intein. Preferably, the split intein so-derived will possess only the amino acid sequences essential for catalyzing splicing reactions.

    [0040] As used herein, the N-terminal intein segment or N-intein refers to any intein sequence that comprises an N-terminal amino acid sequence that is functional for splicing and/or cleaving reactions when combined with a corresponding C-terminal intein segment. An N-terminal intein segment thus also comprises a sequence that is spliced out when splicing occurs. An N-terminal intein segment can comprise a sequence that is a modification of the N-terminal portion of a naturally occurring (native) intein sequence. Non-intein residues can also be genetically fused to intein segments to provide additional functionality, such as the ability to be affinity purified or to be covalently immobilized.

    [0041] As used herein, the C-terminal intein segment or C-intein refers to any intein sequence that comprises a C-terminal amino acid sequence that is functional for splicing or cleaving reactions when combined with a corresponding N-terminal intein segment. In one aspect, the C-terminal intein segment comprises a sequence that is spliced out when splicing occurs. In another aspect, the C-terminal intein segment is cleaved from a peptide sequence fused to its C-terminus. The sequence which is cleaved from the C-terminal intein's C-terminus is referred to herein as a protein of interest POI is discussed in more detail below. A C-terminal intein segment can comprise a sequence that is a modification of the C-terminal portion of a naturally occurring (native) intein sequence. For example, a C terminal intein segment can comprise additional amino acid residues and/or mutated residues so long as the inclusion of such additional and/or mutated residues does not render the C-terminal intein segment non-functional for splicing or cleaving.

    [0042] A consensus sequence is a sequence of DNA, RNA, or protein that represents aligned, related sequences. The consensus sequence of the related sequences can be defined in different ways, but is normally defined by the most common nucleotide(s) or amino acid residue(s) at each position. An example of a consensus sequence of the invention is the N-intein consensus sequence of SEQ ID NO: 6.

    [0043] As used herein, the term splice or splices means to excise a central portion of a polypeptide to form two or more smaller polypeptide molecules. In some cases, splicing also includes the step of fusing together two or more of the smaller polypeptides to form a new polypeptide. Splicing can also refer to the joining of two polypeptides encoded on two separate gene products through the action of a split intein.

    [0044] As used herein, the term cleave or cleaves means to divide a single polypeptide to form two or more smaller polypeptide molecules. In some cases, cleavage is mediated by the addition of an extrinsic endopeptidase, which is often referred to as proteolytic cleavage. In other cases, cleaving can be mediated by the intrinsic activity of one or both of the cleaved peptide sequences, which is often referred to as self-cleavage. Cleavage can also refer to the self-cleavage of two polypeptides that is induced by the addition of a non-proteolytic third peptide, as in the action of split intein system described herein.

    [0045] By the term fused is meant covalently bonded to. For example, a first peptide is fused to a second peptide when the two peptides are covalently bonded to each other (e.g., via a peptide bond).

    [0046] As used herein an isolated or substantially pure substance is one that has been separated from components which naturally accompany it. Typically, a polypeptide is substantially pure when it is at least 50% (e.g., 60%, 70%, 80%, 90%, 95%, and 99%) by weight free from the other proteins and naturally-occurring organic molecules with which it is naturally associated.

    [0047] Herein, bind or binds means that one molecule recognizes and adheres to another molecule in a sample, but does not substantially recognize or adhere to other molecules in the sample. One molecule specifically binds another molecule if it has a binding affinity greater than about 10.sup.5 to 10.sup.6 liters/mole for the other molecule.

    [0048] Nucleic acids, nucleotide sequences, proteins or amino acid sequences referred to herein can be isolated, purified, synthesized chemically, or produced through recombinant DNA technology. All of these methods are well known in the art.

    [0049] As used herein, the terms modified or mutated, as in modified intein or mutated intein, refer to one or more modifications in either the nucleic acid or amino acid sequence being referred to, such as an intein, when compared to the native, or naturally occurring structure. Such modification can be a substitution, addition, or deletion. The modification can occur in one or more amino acid residues or one or more nucleotides of the structure being referred to, such as an intein.

    [0050] As used herein, the term modified peptide, modified protein or modified protein of interest or modified target protein refers to a protein which has been modified.

    [0051] As used herein, operably linked refers to the association of two or more biomolecules in a configuration relative to one another such that the normal function of the biomolecules can be performed. In relation to nucleotide sequences, operably linked refers to the association of two or more nucleic acid sequences, by means of enzymatic ligation or otherwise, in a configuration relative to one another such that the normal function of the sequences can be performed. For example, the nucleotide sequence encoding a pre-sequence or secretory leader is operably linked to a nucleotide sequence for a polypeptide if it is expressed as a pre-protein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the coding sequence; and a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation of the sequence.

    [0052] Sequence homology can refer to the situation where nucleic acid or protein sequences are similar because they have a common evolutionary origin. Sequence homology can indicate that sequences are very similar. Sequence similarity is observable; homology can be based on the observation. Very similar can mean at least 70% identity, homology or similarity; at least 75% identity, homology or similarity; at least 80% identity, homology or similarity; at least 85% identity, homology or similarity; at least 90% identity, homology or similarity; such as at least 93% or at least 95% or even at least 97% identity, homology or similarity. The nucleotide sequence similarity or homology or identity can be determined using the Align program of Myers et al. (1988) CABIOS 4:11-17 and available at NCBI. Additionally or alternatively, amino acid sequence similarity or identity or homology can be determined using the BlastP program (Altschul et al. Nucl. Acids Res. 25:3389-3402), and available at NCBI. Alternatively or additionally, the terms similarity or identity or homology, for instance, with respect to a nucleotide sequence, are intended to indicate a quantitative measure of homology between two sequences.

    [0053] Alternatively or additionally, similarity with respect to sequences refers to the number of positions with identical nucleotides divided by the number of nucleotides in the shorter of the two sequences wherein alignment of the two sequences can be determined in accordance with the Wilbur and Lipman algorithm. (1983) Proc. Natl. Acad. Sci. USA 80:726. For example, using a window size of 20 nucleotides, a word length of 4 nucleotides, and a gap penalty of 4, and computer-assisted analysis and interpretation of the sequence data including alignment can be conveniently performed using commercially available programs (e.g., Intelligenetics? Suite, Intelligenetics Inc. CA). When RNA sequences are said to be similar, or have a degree of sequence identity with DNA sequences, thymidine (T) in the DNA sequence is considered equal to uracil (U) in the RNA sequence. The following references also provide algorithms for comparing the relative identity or homology or similarity of amino acid residues of two proteins, and additionally or alternatively with respect to the foregoing, the references can be used for determining percent homology or identity or similarity. Needleman et al. (1970) J. Mol. Biol. 48:444-453; Smith et al. (1983) Advances App. Math. 2:482-489; Smith et al. (1981) Nuc. Acids Res. 11:2205-2220; Feng et al. (1987) J. Molec. Evol. 25:351-360; Higgins et al. (1989) CABIOS 5:151-153; Thompson et al. (1994) Nuc. Acids Res. 22:4673-480; and Devereux et al. (1984) 12:387-395. Stringent hybridization conditions is a term which is well known in the art; see, for example, Sambrook, Molecular Cloning, A Laboratory Manual second ed., CSH Press, Cold Spring Harbor, 1989; Nucleic Acid Hybridization, A Practical Approach, Hames and Higgins eds., IRL Press, Oxford, 1985; see also FIG. 2 and description thereof herein wherein there is a sequence comparison.

    [0054] The terms plasmid and vector and cassette refer to an extrachromosomal element often carrying genes which are not part of the central metabolism of the cell and usually in the form of circular double-stranded DNA molecules. Such elements may be autonomously replicating sequences, genome integrating sequences, phage or nucleotide sequences, linear or circular, of a single- or double-stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a promoter fragment and DNA sequence for a selected gene product along with appropriate 3 untranslated sequence into a cell. Typically, a vector is a modified plasmid that contains additional multiple insertion sites for cloning and an expression cassette that contains a DNA sequence for a selected gene product (i.e., a transgene) for expression in the host cell. This expression cassette typically includes a 5 promoter region, the transgene ORF, and a 3 terminator region, with all necessary regulatory sequences required for transcription and translation of the ORF. Thus, integration of the expression cassette into the host permits expression of the transgene ORF in the cassette.

    [0055] The term buffer or buffered solution refers to solutions which resist changes in pH by the action of its conjugate acid-base range.

    [0056] The term loading buffer or equilibrium buffer refers to the buffer containing the salt or salts which is mixed with the protein preparation for loading the protein preparation onto a column. This buffer is also used to equilibrate the column before loading, and to wash to column after loading the protein.

    [0057] The term wash buffer is used herein to refer to the buffer that is passed over a column (for example) following loading of a protein of interest (such as one coupled to a C-terminal intein fragment, for example) and prior to elution of the protein of interest. The wash buffer may serve to remove one or more contaminants without substantial elution of the desired protein.

    [0058] The term elution buffer refers to the buffer used to elute the desired protein from the column. As used herein, the term solution refers to either a buffered or a non-buffered solution, including water.

    [0059] The term washing means passing an appropriate buffer through or over a solid support, such as a chromatographic resin.

    [0060] The term eluting a molecule (e.g. a desired protein or contaminant) from a solid support means removing the molecule from such material.

    [0061] The term contaminant or impurity refers to any foreign or objectionable molecule, particularly a biological macromolecule such as a DNA, an RNA, or a protein, other than the protein being purified, that is present in a sample of a protein being purified. Contaminants include, for example, other proteins from cells that express and/or secrete the protein being purified.

    [0062] The term separate or isolate as used in connection with protein purification refers to the separation of a desired protein from a second protein or other contaminant or mixture of impurities in a mixture comprising both the desired protein and a second protein or other contaminant or impurity mixture, such that at least the majority of the molecules of the desired protein are removed from that portion of the mixture that comprises at least the majority of the molecules of the second protein or other contaminant or mixture of impurities.

    [0063] The term purify or purifying a desired protein from a composition or solution comprising the desired protein and one or more contaminants means increasing the degree of purity of the desired protein in the composition or solution by removing (completely or partially) at least one contaminant from the composition or solution.

    N-intein Protein Variants

    [0064] The invention relates to affinity chromatography and affinity tag cleavage mechanisms in a single step using a split intein system according to the invention which cleaves with broad amino acid tolerance to generate a tag less protein of interest (POI) as end product. The two halves of the intein are the affinity ligand (N-intein) and the affinity tag (C-intein) and they associate rapidly. Immobilizing one half (N-intein) on a chromatography resin enables the capture of the other half (C-intein) coupled to the POI from solution. In the presence of Zn.sup.2+ ions, the cleavage reaction is inhibited, enabling a stable complex to form while impurities are washed away. After impurities are eliminated, a chelator or reducing agent is added, and the cleavage reaction proceeds, enabling collection of the POI, while the intein tag remains bound non-covalently to the cognate intein linked to the chromatography resin.

    [0065] Preferably the invention provides N-intein protein variant sequences of native split inteins or consensus sequences derived from native inteins and split inteins wherein, the N-intein variant is modified as compared to the native sequence or consensus sequence to eliminate all asparagine (N) amino acid residues present in the sequence. Preferably all such sequences do not include a Cysteine (C) at position 1 of the N-intein variant sequence.

    [0066] Preferably, the invention provides N-intein protein variant sequences that do not include an asparagine (N) at position 36 of the variant sequence. This position is calculated according to conventional clustal alignment with native split inteins starting from the initial catalytical cysteine which is number 1. This position is conserved to N in prior art and native N-intein sequences but the present inventors have found that this position can be mutated to an amino acid that provides increased alkaline stability as compared to the native N-intein protein sequence which is important as it gives tolerance to increased pH values during for example chromatographic procedures. Preferably an amino acid that provides increased alkaline stability is histidine (H or His) or glutamine (Q or Gln).

    [0067] Native intein are known in the art. A list of inteins is found in Table 1 below. All inteins have the potential to be made into split inteins while some inteins naturally exist in split form. All of the inteins found in the table either exist as split inteins or have the potential to be made into split inteins modified in accordance with the invention at position 36 such that the conserved N is replaced with another amino acid that imparts alkaline stability such as H or Q.

    TABLE-US-00001 TABLE 1 Naturally occurring Inteins Intein Name Organism Name Organism Description Eucarya APMV Pol Acanthomoeba polyphaga isolate = Rowbotham- Mimivirus Bradford, Virus, infects Amoebae, taxon: 212035 Abr PRP8 Aspergillus brevipes FRR2439 Fungi, ATCC 16899, taxon: 75551 Aca-G186AR PRP8 Ajellomyces capsulatus G186AR Taxon: 447093, strain G186AR Aca-H143 PRP8 Ajellomyces capsulatus H143 Taxon: 544712 Aca-JER2004 PRP8 Ajellomyces capsulatus (anamorph: strain = JER2004, taxon: 5037, Histoplasma capsulatum) Fungi Aca-NAm1 PRP8 Ajellomyces capsulatus NAm1 strain = NAm1, taxon: 339724 Ade-ER3 PRP8 Ajellomyces dermatitidis ER-3 Human fungal pathogen. taxon: 559297 Ade-SLH14081 PRP8 Ajellomyces dermatitidis SLH14081, Human fungal pathogen Afu-Af293 PRP8 Aspergillus fumigatus var. Human pathogenic fungus, ellipticus, strain Af293 taxon: 330879 Afu-FRR0163 PRP8 Aspergillus fumigatus strain Human pathogenic fungus, FRR0163 taxon: 5085 Afu-NRRL5109 PRP8 Aspergillus fumigatus var. Human pathogenic fungus, ellipticus, strain NRRL 5109 taxon: 41121 Agi-NRRL6136 PRP8 Aspergillus giganteus Strain NRRL Fungus, taxon: 5060 6136 Ani-FGSCA4 PRP8 Aspergillus nidulans FGSC A Filamentous fungus, taxon: 227321 Avi PRP8 Aspergillus viridinutans strain Fungi, ATCC 16902, FRR0577 taxon: 75553 Bci PRP8 Botrytis cinerea (teleomorph of Plant fungal pathogen Botryotinia fuckeliana B05.10) Bde-JEL197 RPB2 Batrachochytrium dendrobatidis Chytrid fungus, JEL197 isolate = AFTOL-ID 21, taxon: 109871 Bde-JEL423 PRP8-1 Batrachochytrium dendrobatidis Chytrid fungus, isolate JEL423 JEL423, taxon 403673 Bde-JEL423 PRP8-2 Batrachochytrium dendrobatidis Chytrid fungus, isolate JEL423 JEL423, taxon 403673 Bde-JEL423 RPC2 Batrachochytrium dendrobatidis Chytrid fungus, isolate JEL423 JEL423, taxon 403673 Bde-JEL423 eIF-5B Batrachochytrium dendrobatidis Chytrid fungus, isolate JEL423 JEL423, taxon 403673 Bfu-B05 PRP8 Botryotinia fuckeliana B05.10 Taxon: 332648 CIV RIR1 Chilo iridescent virus dsDNA eucaryotic virus, taxon: 10488 CV-NY2A Chlorella virus NY2A infects dsDNA eucaryotic ORF212392 Chlorella NC64A, which infects virus, taxon: 46021, Family Paramecium bursaria Phycodnaviridae CV-NY2A RIR1 Chlorella virus NY2A infects dsDNA eucaryotic Chlorella NC64A, which infects virus, taxon: 46021, Family Paramecium bursaria Phycodnaviridae CZIV RIR1 Costelytra zealandica iridescent dsDNA eucaryotic virus, virus Taxon: 68348 Cba-WM02.98 PRP8 Cryptococcus bacillisporus strain Yeast, human pathogen, WM02.98 (aka Cryptococcus taxon: 37769 neoformans gattii) Cba-WM728 PRP8 Cryptococcus bacillisporus strain WM728 Yeast, human pathogen, taxon: 37769 Ceu ClpP Chlamydomonas eugametos Green alga, taxon: 3053 (chloroplast) Cga PRP8 Cryptococcus gattii (aka Yeast, human pathogen Cryptococcus bacillisporus) Cgl VMA Candida glabrata Yeast, taxon: 5478 Cla PRP8 Cryptococcus laurentii strain Fungi, Basidiomycete yeast, CBS139 taxon: 5418 Cmo ClpP Chlamydomonas moewusii, strain Green alga, chloroplast gene, UTEX 97 taxon: 3054 Cmo RPB2 (RpoBb) Chlamydomonas moewusii, strain Green alga, chloroplast gene, UTEX 97 taxon: 3054 Cne-A PRP8 Filobasidiella neoformans Yeast, human pathogen (Fne-A PRP8) (Cryptococcus neoformans) Serotype A, PHLS 8104 Cne-AD PRP8 Cryptococcus neoformans Yeast, human pathogen, (Fne-AD PRP8) (Filobasidiella neoformans), ATCC32045, taxon: 5207 Serotype AD, CBS132). Cne-JEC21 PRP8 Cryptococcus neoformans var. Yeast, human pathogen, neoformans JEC21 serotype = D taxon: 214684 Cpa ThrRS Candida parapsilosis, strain Yeast, Fungus, taxon: 5480 CLIB214 Cre RPB2 Chlamydomonas reinhardtii Green algae, taxon: 3055 (nucleus) CroV Pol Cafeteria roenbergensis virus BV-PW1 taxon: 693272, Giant virus infecting marine heterotrophic nanoflagellate CroV RIR1 Cafeteria roenbergensis virus BV-PW1 taxon: 693272, Giant virus infecting marine heterotrophic nanoflagellate CroV RPB2 Cafeteria roenbergensis virus BV-PW1 taxon: 693272, Giant virus infecting marine heterotrophic nanoflagellate CroV Top2 Cafeteria roenbergensis virus BV-PW1 taxon: 693272, Giant virus infecting marine heterotrophic nanoflagellate Cst RPB2 Coelomomyces stegomyiae Chytrid fungus, isolate = AFTOL-ID 18, taxon: 143960 Ctr ThrRS Candida tropicalis ATCC750 Yeast Ctr VMA Candida tropicalis (nucleus) Yeast Ctr-MYA3404 VMA Candida tropicalis MYA-3404 Taxon: 294747 Ddi RPC2 Dictyostelium discoideum strain Mycetozoa (a social amoeba) AX4 (nucleus) Dhan GLT1 Debaryomyces hansenii CBS767 Fungi, Anamorph: Candida famata, taxon: 4959 Dhan VMA Debaryomyces hansenii CBS767 Fungi, taxon: 284592 Eni PRP8 Emericella nidulans R20 taxon: 162425 (anamorph: Aspergillus nidulans) Eni-FGSCA4 PRP8 Emericella nidulans (anamorph: Filamentous fungus, Aspergillus nidulans) FGSC A4 taxon: 162425 Fte RPB2 (RpoB) Floydiella terrestris, strain UTEX Green alga, chloroplast gene, 1709 taxon: 51328 Gth DnaB Guillardia theta (plastid) Cryptophyte Algae HaV01 Pol Heterosigma akashiwo virus 01 Algal virus, taxon: 97195, strain HaV01 Hca PRP8 Histoplasma capsulatum Fungi, human pathogen (anamorph: Ajellomyces capsulatus) IIV6 RIR 1 Invertebrate iridescent virus 6 dsDNA eucaryotic virus, taxon: 176652 Kex-CBS379 VMA Kazachstania exigua, formerly Yeast, taxon: 34358 Saccharomyces exiguus, strain CBS379 Kla-CBS683 VMA Kluyveromyces lactis, strain Yeast, taxon: 28985 CBS683 Kla-IFO1267 VMA Kluyveromyces lactis IFO1267 Fungi, taxon: 28985 Kla-NRRLY1140 Kluyveromyces lactis NRRL Y-1140 Fungi, taxon: 284590 VMA Lel VMA Lodderomyces elongisporus Yeast Mca-CBS113480 Microsporum canis CBS 113480 Taxon: 554155 PRP8 Nau PRP8 Neosartorya aurata NRRL 4378 Fungus, taxon: 41051 Nfe-NRRL5534 PRP8 Neosartorya fennelliae NRRL 5534 Fungus, taxon: 41048 Nfi PRP8 Neosartorya fischeri Fungi Ngl-FR2163 PRP8 Neosartorya glabra FRR2163 Fungi, ATCC 16909, taxon: 41049 Ngl-FRR1833 PRP8 Neosartorya glabra FRR1833 Fungi, taxon: 41049, (preliminary identification) Nqu PRP8 Neosartorya quadricincta, strain NRRL 4175 taxon: 41053 Nspi PRP8 Neosartorya spinosa FRR4595 Fungi, taxon: 36631 Pabr-Pb01 PRP8 Paracoccidioides brasiliensis Pb01 Taxon: 502779 Pabr-Pb03 PRP8 Paracoccidioides brasiliensis Pb03 Taxon: 482561 Pan CHS2 Podospora anserina Fungi, Taxon 5145 Pan GLT1 Podospora anserina Fungi, Taxon 5145 Pbl PRP8-a Phycomyces blakesleeanus Zygomycete fungus, strain NRRL155 Pbl PRP8-b Phycomyces blakesleeanus Zygomycete fungus, strain NRRL155 Pbr-Pb18 PRP8 Paracoccidioides brasiliensis Pb18 Fungi, taxon: 121759 Pch PRP8 Penicillium chrysogenuim Fungus, taxon: 5076 Pex PRP8 Penicillium expansum Fungus, taxon27334 Pgu GLT1 Pichia (Candida) guilliermondii Fungi, Taxon 294746 Pgu-alt GLT1 Pichia (Candida) guilliermondii Fungi Pno GLT1 Phaeosphaeria nodorum SN15 Fungi, taxon: 321614 Pno RPA2 Phaeosphaeria nodorum SN15 Fungi, taxon: 321614 Ppu DnaB Porphyra purpurea (chloroplast) Red Alga Pst VMA Pichia stipitis CBS 6054, Yeast taxon: 322104 Ptr PRP8 Pyrenophora tritici-repentis Pt-1C-BF Ascomycete fungus, taxon: 426418 Pvu PRP8 Penicillium vulpinum Fungus (formerly P. claviforme) Pye DnaB Porphyra yezoensis chloroplast, Red alga, cultivar U-51 organelle = plastid: chloroplast, taxon: 2788 Sas RPB2 Spiromyces aspiralis NRRL 22631 Zygomycete fungus, isolate = AFTOL-ID 185, taxon: 68401 Sca-CBS4309 VMA Saccharomyces castellii, strain Yeast, taxon: 27288 CBS4309 Sca-IFO1992 VMA Saccharomyces castellii, strain Yeast, taxon: 27288 IFO1992 Scar VMA Saccharomyces cariocanus, Yeast, taxon: 114526 strain = UFRJ 50791 Sce VMA Saccharomyces cerevisiae (nucleus) Yeast, also in Sce strains OUT7163, OUT7045, OUT7163, IFO1992 Sce-DH1-1A VMA Saccharomyces cerevisiae strain Yeast, taxon: 173900, also in DH1-1A Sce strains OUT7900, OUT7903, OUT7112 Sce-JAY291 VMA Saccharomyces cerevisiae JAY291 Taxon: 574961 Sce-OUT7091 VMA Saccharomyces cerevisiae Yeast, taxon: 4932, also in Sce OUT7091 strains OUT7043, OUT7064 Sce-OUT7112 VMA Saccharomyces cerevisiae Yeast, taxon: 4932, also in Sce OUT7112 strains OUT7900, OUT7903 Sce-YJM789 VMA Saccharomyces cerevisiae strain Yeast, taxon: 307796 YJM789 Sda VMA Saccharomyces dairenensis, strain Yeast, taxon: 27289, Also in CBS 421 Sda strain IFO0211 Sex-IFO1128 VMA Saccharomyces exiguus, Yeast, taxon: 34358 strain = IFO1128 She RPB2 (RpoB) Stigeoclonium helveticum, strain Green alga, chloroplast gene, UTEX 441 taxon: 55999 Sja VMA Schizosaccharomyces japonicus Ascomycete fungus, yFS275 taxon: 402676 Spa VMA Saccharomyces pastorianus Yeast, taxon: 27292 IFO11023 Spu PRP8 Spizellomyces punctatus Chytrid fungus, Sun VMA Saccharomyces unisporus, strain Yeast, taxon: 27294 CBS 398 Tgl VMA Torulaspora globosa, strain CBS Yeast, taxon: 48254 764 Tpr VMA Torulaspora pretoriensis, strain Yeast, taxon: 35629 CBS 5080 Ure-1704 PRP8 Uncinocarpus reesii Filamentous fungus Vpo VMA Vanderwaltozyma polyspora, Yeast, taxon: 36033 formerly Kluyveromyces polysporus, strain CBS 2163 WIV RIR1 Wiseana iridescent virus dsDNA eucaryotic virus, taxon: 68347 Zba VMA Zygosaccharomyces bailii, strain Yeast, taxon: 4954 CBS 685 Zbi VMA Zygosaccharomyces bisporus, strain Yeast, taxon: 4957 CBS 702 Zro VMA Zygosaccharomyces rouxii, strain Yeast, taxon: 4956 CBS 688 Eubacteria AP-APSE1 dpol Acyrthosiphon pisum secondary Bacteriophage, taxon: 67571 endosymbiot phage 1 AP-APSE2 dpol Bacteriophage APSE-2, Bacteriophage of Candidatus isolate = T5A Hamiltonella defensa, endosymbiot of Acyrthosiphon pisum, taxon: 340054 AP-APSE4 dpol Bacteriophage of Candidatus Bacteriophage, taxon: 568990 Hamiltonella defensa strain 5ATac, endosymbiot of Acyrthosiphon pisum AP-APSE5 dpol Bacteriophage APSE-5 Bacteriophage of Candidatus Hamiltonella defensa, endosymbiot of Uroleucon rudbeckiae, taxon: 568991 AP-Aaphi23 MupF Bacteriophage Aaphi23, Actinobacillus Haemophilus phage Aaphi23 actinomycetemcomitans Bacteriophage, taxon: 230158 Aae RIR2 Aquifex aeolicus strain VF5 Thermophilic chemolithoautotroph, taxon: 63363 Aave-AAC001 Acidovorax avenae subsp. citrulli taxon: 397945 Aave1721 AAC00-1 Aave-AAC001 RIR1 Acidovorax avenae subsp. citrulli taxon: 397945 AAC00-1 Aave-ATCC19860 Acidovorax avenae subsp. avenae Taxon: 643561 RIR1 ATCC 19860 Aba Hyp-02185 Acinetobacter baumannii ACICU taxon: 405416 Ace RIR1 Acidothermus cellulolyticus 11B taxon: 351607 Aeh DnaB-1 Alkalilimnicola ehrlichei MLHE-1 taxon: 187272 Aeh DnaB-2 Alkalilimnicola ehrlichei MLHE-1 taxon: 187272 Aeh RIR1 Alkalilimnicola ehrlichei MLHE-1 taxon: 187272 AgP-S1249 MupF Aggregatibacter phage S1249 Taxon: 683735 Aha DnaE-c Aphanothece halophytica Cyanobacterium, taxon: 72020 Aha DnaE-n Aphanothece halophytica Cyanobacterium, taxon: 72020 Alvi-DSM180 GyrA Allochromatium vinosum DSM 180 Taxon: 572477 Ama MADE823 phage uncharacterized protein Probably prophage gene, [Alteromonas macleodii Deep taxon: 314275 ecotype] Amax-CS328 DnaX Arthrospira maxima CS-328 Taxon: 513049 Aov DnaE-c Aphanizomenon ovalisporum Cyanobacterium, taxon: 75695 Aov DnaE-n Aphanizomenon ovalisporum Cyanobacterium, taxon: 75695 Apl-C1 DnaX Arthrospira platensis Taxon: 118562, strain C1 Arsp-FB24 DnaB Arthrobacter species FB24 taxon: 290399 Asp DnaE-c Anabaena species PCC7120, Cyanobacterium, Nitrogen- (Nostoc sp. PCC7120) fixing, taxon: 103690 Asp DnaE-n Anabaena species PCC7120, Cyanobacterium, Nitrogen- (Nostoc sp. PCC7120) fixing, taxon: 103690 Ava DnaE-c Anabaena variabilis ATCC29413 Cyanobacterium, taxon: 240292 Ava DnaE-n Anabaena variabilis ATCC29413 Cyanobacterium, taxon: 240292 Avin RIR1 BIL Azotobacter vinelandii taxon: 354 Bce-MCO3 DnaB Burkholderia cenocepacia MC0-3 taxon: 406425 Bce-PC184 DnaB Burkholderia cenocepacia PC184 taxon: 350702 Bse-MLS10 TerA Bacillus selenitireducens MLS10 Probably prophage gene, Taxon: 439292 BsuP-M1918 RIR1 B. subtilis M1918 (prophage) Prophage in B. subtilis M1918. taxon: 157928 BsuP-SPBc2 RIR1 B. subtilis strain 168 Sp beta c2 B. subtilis taxon 1423. SPbeta prophage c2 phage, taxon: 66797 Bvi IcmO Burkholderia vietnamiensis G4 plasmid = pBVIE03. taxon: 269482 CP-P1201 Thy1 Corynebacterium phage P1201 lytic bacteriophage P1201 from Corynebacterium glutamicum NCHU 87078. Viruses; dsDNA viruses, taxon: 384848 Cag RIR1 Chlorochromatium aggregatum Motile, phototrophic consortia Anoxygenic Cau SpoVR Chloroflexus aurantiacus J-10-fl phototroph, taxon: 324602 CbP-C-St RNR Clostridium botulinum phage C-St Phage, specific_host = Clostridium botulinum type C strain C-Stockholm, taxon: 12336 CbP-D1873 RNR Clostridium botulinum phage D Ssp. phage from Clostridium botulinum type D strain, 1873, taxon: 29342 Cbu-Dugway DnaB Coxiella burnetii Dugway 5J108-111 Proteobacteria; Legionellales; taxon: 434922 Cbu-Goat DnaB Coxiella burnetii MSU Goat Q177 Proteobacteria; Legionellales; taxon: 360116 Cbu-RSA334 DnaB Coxiella burnetii RSA 334 Proteobacteria; Legionellales; taxon: 360117 Cbu-RSA493 DnaB Coxiella burnetii RSA 493 Proteobacteria; Legionellales; taxon: 227377 Cce Hyp1-Csp-2 Cyanothece sp. ATCC 51142 Marine unicellular diazotrophic cyanobacterium, taxon: 43989 Cch RIR1 Chlorobium chlorochromatii CaD3 taxon: 340177 Ccy Hyp1-Csp-1 Cyanothece sp. CCY0110 Cyanobacterium, taxon: 391612 Ccy Hyp1-Csp-2 Cyanothece sp. CCY0110 Cyanobacterium, taxon: 391612 Cfl-DSM20109 DnaB Cellulomonas flavigena DSM 20109 Taxon: 446466 Chy RIR1 Carboxydothermus Thermophile, taxon = 246194 hydrogenoformans Z-2901 Ckl PTerm Clostridium kluyveri DSM 555 plasmid = pCKL555A, taxon: 431943 Cra-CS505 DnaE-c Cylindrospermopsis raciborskii CS-505 Taxon: 533240 Cra-CS505 DnaE-n Cylindrospermopsis raciborskii CS-505 Taxon: 533240 Cra-CS505 GyrB Cylindrospermopsis raciborskii CS-505 Taxon: 533240 Csp-CCY0110 Cyanothece sp. CCY0110 Taxon: 391612 DnaE-C Csp-CCY0110 Cyanothece sp. CCY0110 Taxon: 391612 DnaE-n Csp-PCC7424 Cyanothece sp. PCC 7424 Cyanobacterium, taxon: 65393 DnaE-c Csp-PCC7424 Cyanothece sp. PCC7424 Cyanobacterium, taxon: 65393 DnaE-n Csp-PCC7425 DnaB Cyanothece sp. PCC 7425 Taxon: 395961 Csp-PCC7822 Cyanothece sp. PCC 7822 Taxon: 497965 DnaE-n Csp-PCC8801 Cyanothece sp. PCC 8801 Taxon: 41431 DnaE-C Csp-PCC8801 Cyanothece sp. PCC 8801 Taxon: 41431 DnaE-n Cth ATPase BIL Clostridium thermocellum ATCC27405, taxon: 203119 Cth-ATCC27405 Clostridium thermocellum Probable prophage, TerA ATCC27405 ATCC27405, taxon: 203119 Cth-DSM2360 TerA Clostridium thermocellum DSM Probably prophage 2360 gene, Taxon: 572545 Cwa DnaB Crocosphaera watsonii WH 8501 taxon: 165597 (Synechocystis sp. WH 8501) Cwa DnaE-c Crocosphaera watsonii WH 8501 Cyanobacterium, (Synechocystis sp. WH 8501) taxon: 165597 Cwa DnaE-n Crocosphaera watsonii WH 8501 Cyanobacterium, (Synechocystis sp. WH 8501) taxon: 165597 Cwa PEP Crocosphaera watsonii WH 8501 taxon: 165597 (Synechocystis sp. WH 8501) Cwa RIR1 Crocosphaera watsonii WH 8501 taxon: 165597 (Synechocystis sp. WH 8501) Daud RIR1 Candidatus Desulforudis taxon: 477974 audaxviator MP104C Dge DnaB Deinococcus geothermalis Thermophilic, radiation DSM11300 resistant Dha-DCB2 RIR1 Desulfitobacterium hafniense DCB-2 Anaerobic dehalogenating bacteria, taxon: 49338 Dha-Y51 RIR1 Desulfitobacterium hafniense Y51 Anaerobic dehalogenating bacteria, taxon: 138119 Dpr-MLMSI RIR1 delta proteobacterium MLMS-1 Taxon: 262489 Dra RIR1 Deinococcus radiodurans R1, TIGR Radiation resistant, strain taxon: 1299 Dra Snf2-c Deinococcus radiodurans R1, TIGR Radiation and DNA damage strain resistent, taxon: 1299 Dra Snf2-n Deinococcus radiodurans R1, TIGR Radiation and DNA damage strain resistent, taxon: 1299 Dra-ATCC13939 Deinococcus radiodurans R1, Radiation and DNA damage Snf2 ATCC13939/Brooks & Murray resistent, taxon: 1299 strain Dth UDP GD Dictyoglomus thermophilum H-6-12 strain = H-6-12; ATCC 35947, taxon: 309799 Dvul ParB Desulfovibrio vulgaris subsp. taxon: 391774 vulgaris DP4 EP-Min27 Primase Enterobacteria phage Min27 bacteriphage of host = Escherichia coli 0157: H7 str. Min27 Fal DnaB Frankia alni ACN14a Plant symbiot, taxon: 326424 Fsp-CcI3 RIR1 Frankia species CcI3 taxon: 106370 Gob DnaE Gemmata obscuriglobus UQM2246 Taxon 114, TIGR genome strain, budding bacteria Gob Hyp Gemmata obscuriglobus UQM2246 Taxon 114, TIGR genome strain, budding bacteria Gvi DnaB Gloeobacter violaceus, PCC 7421 taxon: 33072 Gvi RIR1-1 Gloeobacter violaceus, PCC 7421 taxon: 33072 Gvi RIR1-2 Gloeobacter violaceus, PCC 7421 taxon: 33072 Hhal DnaB Halorhodospira halophila SL1 taxon: 349124 Kfl-DSM17836 DnaB Kribbella flavida DSM 17836 Taxon: 479435 Kra DnaB Kineococcus radiotolerans Radiation resistant SRS30216 LLP-KSY1 PolA Lactococcus phage KSY1 Bacteriophage, taxon: 388452 LP-phiHSIC Helicase Listonella pelagia phage phiHSIC taxon: 310539, a pseudotemperate marine phage of Listonella pelagia Lsp-PCC8106 GyrB Lyngbya sp. PCC 8106 Taxon: 313612 MP-Be DnaB Mycobacteriophage Bethlehem Bacteriophage, taxon: 260121 MP-Be gp51 Mycobacteriophage Bethlehem Bacteriophage, taxon: 260121 MP-Catera gp206 Mycobacteriophage Catera Mycobacteriophage, taxon: 373404 MP-KBG gp53 Mycobacterium phage KBG Taxon: 540066 MP-Mcjw1 DnaB Mycobacteriophage CJW1 Bacteriophage, taxon: 205869 MP-Omega DnaB Mycobacteriophage Omega Bacteriophage, taxon: 205879 MP-U2 gp50 Mycobacteriophage U2 Bacteriophage, taxon: 260120 Maer-NIES843 DnaB Microcystis aeruginosa NIES-843 Bloom-forming toxic cyanobacterium, taxon: 449447 Maer-NIES843 Microcystis aeruginosa NIES-843 Bloom-forming toxic DnaE-C cyanobacterium, taxon: 449447 Maer-NIES843 Microcystis aeruginosa NIES-843 Bloom-forming toxic DnaE-n cyanobacterium, taxon: 449447 Mau-ATCC27029 Micromonospora aurantiaca ATCC Taxon: 644283 GyrA 27029 Mav-104 DnaB Mycobacterium avium 104 taxon: 243243 Mav-ATCC25291 Mycobacterium avium subsp. avium Taxon: 553481 DnaB ATCC 25291 Mav-ATCC35712 Mycobacterium avium ATCC35712, taxon 1764 DnaB Mav-PT DnaB Mycobacterium avium subsp. taxon: 262316 paratuberculosis str. k10 Mbo Pps1 Mycobacterium bovis subsp. bovis strain = AF2122/97, AF2122/97 taxon: 233413 Mbo RecA Mycobacterium bovis subsp. bovis taxon: 233413 AF2122/97 Mbo SufB Mycobacterium bovis subsp. bovis taxon: 233413 (Mbo Pps1) AF2122/97 Mbo-1173P DnaB Mycobacterium bovis BCG Pasteur strain = BCG Pasteur 1173P 1173P2,, taxon: 410289 Mbo-AF2122 DnaB Mycobacterium bovis subsp. bovis strain = AF2122/97, AF2122/97 taxon: 233413 Mca MupF Methylococcus capsulatus Bath, prophage MuMc02, prophage MuMc02 taxon: 243233 Mca RIR1 Methylococcus capsulatus Bath taxon: 243233 Mch RecA Mycobacterium chitae IP14116003, taxon: 1792 Mcht-PCC7420 Microcoleus chthonoplastes Cyanobacterium, DnaE-1 PCC7420 taxon: 118168 Mcht-PCC7420 Microcoleus chthonoplastes Cyanobacterium, DnaE-2c PCC7420 taxon: 118168 Mcht-PCC7420 Microcoleus chthonoplastes Cyanobacterium, DnaE-2n PCC7420 taxon: 118168 Mcht-PCC7420 GyrB Microcoleus chthonoplastes PCC 7420 Taxon: 118168 Mcht-PCC7420 Microcoleus chthonoplastes PCC Taxon: 118168 RIR1-1 7420 Mcht-PCC7420 Microcoleus chthonoplastes PCC Taxon: 118168 RIR1-2 7420 Mex Helicase Methylobacterium extorquens AMI Alphaproteobacteria Mex TrbC Methylobacterium extorquens AMI Alphaproteobacteria Mfa RecA Mycobacterium fallax CITP8139, taxon: 1793 Mfl GyrA Mycobacterium flavescens Fla0 taxon: 1776, reference #930991 Mfl RecA Mycobacterium flavescens Fla0 strain = Fla0, taxon: 1776, ref. #930991 Mfl-ATCC14474 Mycobacterium flavescens, strain = ATCC14474, taxon: RecA ATCC14474 1776, ref #930991 Mfl-PYR-GCK DnaB Mycobacterium flavescens PYR-GCK taxon: 350054 Mga GyrA Mycobacterium gastri HP4389, taxon: 1777 Mga RecA Mycobacterium gastri HP4389, taxon: 1777 Mga SufB Mycobacterium gastri HP4389, taxon: 1777 (Mga Pps1) Mgi-PYR-GCK DnaB Mycobacterium gilvum PYR-GCK taxon: 350054 Mgi-PYR-GCK GyrA Mycobacterium gilvum PYR-GCK taxon: 350054 Mgo GyrA Mycobacterium gordonae taxon: 1778, reference number 930835 Min-1442 DnaB Mycobacterium intracellulare strain 1442, taxon: 1767 Min-ATCC13950 Mycobacterium intracellulare Taxon: 487521 GyrA ATCC 13950 Mkas GyrA Mycobacterium kansasii taxon: 1768 Mkas-ATCC12478 Mycobacterium kansasii ATCC 12478 Taxon: 557599 GyrA Mle-Br4923 GyrA Mycobacterium leprae Br4923 Taxon: 561304 Mle-TN DnaB Mycobacterium leprae, strain TN Human pathogen, taxon: 1769 Mle-TN GyrA Mycobacterium leprae TN Human pathogen, STRAIN = TN, taxon: 1769 Mle-TN RecA Mycobacterium leprae, strain TN Human pathogen, taxon: 1769 Mle-TN SufB Mycobacterium leprae Human pathogen, taxon: 1769 (Mle Pps1) Mma GyrA Mycobacterium malmoense taxon: 1780 Mmag Magn8951 Magnetospirillum magnetotacticum Gram negative, taxon: 272627 BIL MS-1 Msh RecA Mycobacterium shimodei ATCC27962, taxon: 29313 Msm DnaB-1 Mycobacterium smegmatis MC2 MC2 155, taxon: 246196 155 Msm DnaB-2 Mycobacterium smegmatis MC2 MC2 155, taxon: 246196 155 Msp-KMS DnaB Mycobacterium species KMS taxon: 189918 Msp-KMS GyrA Mycobacterium species KMS taxon: 189918 Msp-MCS DnaB Mycobacterium species MCS taxon: 164756 Msp-MCS GyrA Mycobacterium species MCS taxon: 164756 Mthe RecA Mycobacterium thermoresistibile ATCC19527, taxon: 1797 Mtu SufB (Mtu Pps1) Mycobacterium tuberculosis strains Human pathogen, taxon: 83332 H37Rv & CDC1551 Mtu-C RecA Mycobacterium tuberculosis C Taxon: 348776 Mtu-CDC1551 DnaB Mycobacterium tuberculosis, Human pathogen, taxon: 83332 CDC1551 Mtu-CPHL RecA Mycobacterium tuberculosis Taxon: 611303 CPHL_A Mtu-Canetti RecA Mycobacterium tuberculosis/ Taxon: 1773 strain = Canetti Mtu-EAS054 RecA Mycobacterium tuberculosis Taxon: 520140 EAS054 Mtu-F11 DnaB Mycobacterium tuberculosis, strain taxon: 336982 F11 Mtu-H37Ra DnaB Mycobacterium tuberculosis H37Ra ATCC 25177, taxon: 419947 Mtu-H37Rv DnaB Mycobacterium tuberculosis H37Rv Human pathogen, taxon: 83332 Mtu-H37Rv RecA Mycobacterium tuberculosis Human pathogen, taxon: 83332 H37Rv, Also CDC1551 Mtu-Haarlem DnaB Mycobacterium tuberculosis str. Taxon: 395095 Haarlem Mtu-K85 RecA Mycobacterium tuberculosis K85 Taxon: 611304 Mtu-R604 RecA-n Mycobacterium tuberculosis Taxon: 555461 98-R604 INH-RIF-EM Mtu-So93 RecA Mycobacterium tuberculosis Human pathogen, taxon: 1773 So93/sub_species = Canetti Mtu-T17 RecA-c Mycobacterium tuberculosis T17 Taxon: 537210 Mtu-T17 RecA-n Mycobacterium tuberculosis T17 Taxon: 537210 Mtu-T46 RecA Mycobacterium tuberculosis T46 Taxon: 611302 Mtu-T85 RecA Mycobacterium tuberculosis T85 Taxon: 520141 Mtu-T92 RecA Mycobacterium tuberculosis T92 Taxon: 515617 Mvan DnaB Mycobacterium vanbaalenii PYR-1 taxon: 350058 Mvan GyrA Mycobacterium vanbaalenii PYR-1 taxon: 350058 Mxa RAD25 Myxococcus xanthus DK1622 Deltaproteobacteria Mxe GyrA Mycobacterium xenopi strain taxon: 1789 IMM5024 Naz-0708 RIR1-1 Nostoc azollae 0708 Taxon: 551115 Naz-0708 RIR1-2 Nostoc azollae 0708 Taxon: 551115 Nfa DnaB Nocardia farcinica IFM 10152 taxon: 247156 Nfa Nfa 15250 Nocardia farcinica IFM 10152 taxon: 247156 Nfa RIR1 Nocardia farcinica IFM 10152 taxon: 247156 Nosp-CCY9414 Nodularia spumigena CCY9414 Taxon: 313624 DnaE-n Npu DnaB Nostoc punctiforme Cyanobacterium, taxon: 63737 Npu GyrB Nostoc punctiforme Cyanobacterium, taxon: 63737 Npu-PCC73102 Nostoc punctiforme PCC73102 Cyanobacterium, taxon: 63737, DnaE-c ATCC29133 Npu-PCC73102 Nostoc punctiforme PCC73102 Cyanobacterium, taxon: 63737, DnaE-n ATCC29133 Nsp-JS614 DnaB Nocardioides species JS614 taxon: 196162 Nsp-JS614 TOPRIM Nocardioides species JS614 taxon: 196162 Nsp-PCC7120 DnaB Nostoc species PCC7120, Cyanobacterium, Nitrogen- (Anabaena sp. PCC7120) fixing, taxon: 103690 Nsp-PCC7120 Nostoc species PCC7120, Cyanobacterium, Nitrogen- DnaE-c (Anabaena sp. PCC7120) fixing, taxon: 103690 Nsp-PCC7120 Nostoc species PCC7120, Cyanobacterium, Nitrogen- DnaE-n (Anabaena sp. PCC7120) fixing, taxon: 103690 Nsp-PCC7120 RIR1 Nostoc species PCC7120, Cyanobacterium, Nitrogen- (Anabaena sp. PCC7120) fixing, taxon: 103690 Oli DnaE-c Oscillatoria limnetica str. Solar Lake Cyanobacterium, taxon: 262926 Oli DnaE-n Oscillatoria limnetica str. Solar Lake Cyanobacterium, taxon: 262926 PP-PhiEL Helicase Pseudomonas aeruginosa phage Phage infects Pseudomonas phiEL aeruginosa, taxon: 273133 PP-PhiEL ORF11 Pseudomonas aeruginosa phage phage infects Pseudomonas phiEL aeruginosa, taxon: 273133 PP-PhiEL ORF39 Pseudomonas aeruginosa phage Phage infects Pseudomonas phiEL aeruginosa, taxon: 273133 PP-PhiEL ORF40 Pseudomonas aeruginosa phage phage infects Pseudomonas phiEL aeruginosa, taxon: 273133 Pfl Fha BIL Pseudomonas fluorescens Pf-5 Plant commensal organism, taxon: 220664 Plut RIR1 Pelodictyon luteolum DSM 273 Green sulfur bacteria, Taxon 319225 Pma-EXH1 GyrA Persephonella marina EX-H1 Taxon: 123214 Pma-ExH1 DnaE Persephonella marina EX-H1 Taxon: 123214 Pna RIR1 Polaromonas naphthalenivorans taxon: 365044 CJ2 Pnuc DnaB Polynucleobacter sp. taxon: 312153 QLW-P1DMWA-1 Posp-JS666 DnaB Polaromonas species JS666 taxon: 296591 Posp-JS666 RIR1 Polaromonas species JS666 taxon: 296591 Pssp-A1-1 Fha Pseudomonas species A1-1 Psy Fha Pseudomonas syringae pv. tomato Plant (tomato) pathogen, str. DC3000 taxon: 223283 Rbr-D9 GyrB Raphidiopsis brookii D9 Taxon: 533247 Rce RIR1 Rhodospirillum centenum SW taxon: 414684, ATCC 51521 Rer-SK121 DnaB Rhodococcus erythropolis SK121 Taxon: 596309 Rma DnaB Rhodothermus marinus Thermophile, taxon: 29549 Rma-DSM4252 DnaB Rhodothermus marinus DSM 4252 Taxon: 518766 Rma-DSM4252 DnaE Rhodothermus marinus DSM 4252 Thermophile, taxon: 518766 Rsp RIR1 Roseovarius species 217 taxon: 314264 SaP-SETP12 dpol Salmonella phage SETP12 Phage, taxon: 424946 SaP-SETP3 Helicase Salmonella phage SETP3 Phage, taxon: 424944 SaP-SETP3 dpol Salmonella phage SETP3 Phage, taxon: 424944 SaP-SETP5 dpol Salmonella phage SETP5 Phage, taxon: 424945 Sare DnaB Salinispora arenicola CNS-205 taxon: 391037 Sav RecG Helicase Streptomyces avermitilis MA-4680 taxon: 227882, ATCC 31267 Sel-PC6301 RIR1 Synechococcus elongatus PCC 6301 taxon: 269084 Berkely strain 6301~equivalent name: Ssp PCC6301~synonym: Anacystis nudulans Sel-PC7942 DnaE-c Synechococcus elongatus PC7942 taxon: 1140 Sel-PC7942 DnaE-n Synechococcus elongatus PC7942 taxon: 1140 Sel-PC7942 RIR1 Synechococcus elongatus PC7942 taxon: 1140 Sel-PCC6301 DnaE-c Synechococcus elongatus PCC6301 Cyanobacterium, and PCC7942 taxon: 269084, Berkely strain 6301~equivalent name: Synechococcus sp. PCC 6301~synonym: Anacystis nudulans Sel-PCC6301 DnaE-n Synechococcus elongatus PCC6301 Cyanobacterium, taxon: 269084 Berkely strain 6301~equivalent name: Synechococcus sp. PCC 6301~synonym: Anacystis nudulans Sep RIR1 Staphylococcus epidermidis RP62A taxon: 176279 ShP-Sfv-2a-2457T-n Shigella flexneri 2a str. 2457T Putative bacteriphage Primase ShP-Sfv-2a-301-n Shigella flexneri 2a str. 301 Putative bacteriphage Primase ShP-Sfv-5 Primase Shigella flexneri 5 str. 8401 Bacteriphage, isolation_source_ epidemic, taxon: 373384 SoP-SO1 dpol Sodalis phage SO-1 Phage/isolation_source = Sodalis glossinidius strain GA-SG, secondary symbiont of Glossina austeni (Newstead) Spl DnaX Spirulina platensis, strain C1 Cyanobacterium, taxon: 1156 Sru DnaB Salinibacter ruber DSM 13855 taxon: 309807, strain = DSM 13855; M31 Sru PolBc Salinibacter ruber DSM 13855 taxon: 309807, strain = DSM 13855; M31 Sru RIR1 Salinibacter ruber DSM 13855 taxon: 309807, strain = DSM 13855; M31 Ssp DnaB Synechocystis species, strain Cyanobacterium, taxon: 1148 PCC6803 Ssp DnaE-c Synechocystis species, strain Cyanobacterium, taxon: 1148 PCC6803 Ssp DnaE-n Synechocystis species, strain Cyanobacterium, taxon: 1148 PCC6803 Ssp DnaX Synechocystis species, strain Cyanobacterium, taxon: 1148 PCC6803 Ssp GyrB Synechocystis species, strain Cyanobacterium, taxon: 1148 PCC6803 Ssp-JA2 DnaB Synechococcus species JA-2- Cyanobacterium, Taxon: 3Ba(2-13) 321332 Ssp-JA2 RIR1 Synechococcus species JA-2- Cyanobacterium, Taxon: 3Ba(2-13) 321332 Ssp-JA3 DnaB Synechococcus species JA-3-3Ab Cyanobacterium, Taxon: 321327 Ssp-JA3 RIR1 Synechococcus species JA-3-3 Ab Cyanobacterium, Taxon: 321327 Ssp-PCC7002 DnaE-c Synechocystis species, strain PCC Cyanobacterium, taxon: 32049 Ssp-PCC7002 DnaE-n Synechocystis species, strain PCC 7002 Cyanobacterium, taxon: 32049 Ssp-PCC7335 RIR1 Synechococcus sp. PCC 7335 Taxon: 91464 StP-Twort ORF6 Staphylococcus phage Twort Phage, taxon 55510 Susp-NBC371 DnaB Sulfurovum sp. NBC37-1 taxon: 387093 Intein Taq-Y51MC23 DnaE Thermus aquaticus Y51MC23 Taxon: 498848 Taq-Y51MC23 RIR1 Thermus aquaticus Y51MC23 Taxon: 498848 Tcu-DSM43183 Thermomonospora curvata DSM Taxon: 471852 RecA 43183 Tel DnaE-c Thermosynechococcus elongatus Cyanobacterium, taxon: 197221 BP-1 Tel DnaE-n Thermosynechococcus elongatus Cyanobacterium, BP-1 Ter DnaB-1 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter DnaB-2 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter DnaE-1 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter DnaE-2 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter DnaE-3c Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter DnaE-3n Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter GyrB Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter Ndse-1 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter Ndse-2 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter RIR1-1 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter RIR1-2 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter RIR1-3 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter RIR1-4 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter Snf2 Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Ter Thy X Trichodesmium erythraeum Cyanobacterium, taxon: 203124 IMS101 Tfus RecA-1 Thermobifida fusca YX Thermophile, taxon: 269800 Tfus RecA-2 Thermobifida fusca YX Thermophile, taxon: 269800 Tfus Tfu2914 Thermobifida fusca YX Thermophile, taxon: 269800 Thsp-K90 RIR1 Thioalkalivibrio sp. K90mix Taxon: 396595 Tth-DSM571 RIR1 Thermoanaerobacterium Taxon: 580327 thermosaccharolyticum DSM 571 Tth-HB27 DnaE-1 Thermus thermophilus HB27 thermophile, taxon: 262724 Tth-HB27 DnaE-2 Thermus thermophilus HB27 thermophile, taxon: 262724 Tth-HB27 RIR1-1 Thermus thermophilus HB27 thermophile, taxon: 262724 Tth-HB27 RIR1-2 Thermus thermophilus HB27 thermophile, taxon: 262724 Tth-HB8 DnaE-1 Thermus thermophilus HB8 thermophile, taxon: 300852 Tth-HB8 DnaE-2 Thermus thermophilus HB8 thermophile, taxon: 300852 Tth-HB8 RIR1-1 Thermus thermophilus HB8 thermophile, taxon: 300852 Tth-HB8 RIR1-2 Thermus thermophilus HB8 thermophile, taxon: 300852 Tvu DnaE-c Thermosynechococcus vulcanus Cyanobacterium, taxon: 32053 Tvu DnaE-n Thermosynechococcus vulcanus Cyanobacterium, taxon: 32053 Tye RNR-1 Thermodesulfovibrio yellowstonii taxon: 289376 DSM 11347 Tye RNR-2 Thermodesulfovibrio yellowstonii taxon: 289376 DSM 11347 Archaea Ape APE0745 Aeropyrum pernix K1 Thermophile, taxon: 56636 Cme-boo Pol-II Candidatus Methanoregula boonei taxon: 456442 6A8 Fac-Fer1 RIR1 Ferroplasma acidarmanus, strain Fer1, eats iron taxon: 97393 and taxon 261390 Fac-Ferl SufB Ferroplasma acidarmanus strain fer1, eats (Fac Pps1) iron, taxon: 97393 Fac-TypeI RIR1 Ferroplasma acidarmanus type I, Eats iron, taxon 261390 Fac-typeI SufB Ferroplasma acidarmanus Eats iron, taxon: 261390 (Fac Pps1) Hma CDC21 Haloarcula marismortui ATCC taxon: 272569, 43049 Hma Pol-II Haloarcula marismortui ATCC taxon: 272569, 43049 Hma PolB Haloarcula marismortui ATCC taxon: 272569, 43049 Hma TopA Haloarcula marismortui ATCC taxon: 272569 43049 Hmu-DSM12286 Halomicrobium mukohataei DSM taxon: 485914 (Halobacteria) MCM 12286 Hmu-DSM12286 Halomicrobium mukohataei DSM Taxon: 485914 PolB 12286 Hsa-R1 MCM Halobacterium salinarum R-1 Halophile, taxon: 478009, strain = R1; DSM 671 Hsp-NRC1 CDC21 Halobacterium species NRC-1 Halophile, taxon: 64091 Hsp-NRC1 Pol-II Halobacterium salinarum NRC-1 Halophile, taxon: 64091 Hut MCM-2 Halorhabdus utahensis DSM 12940 taxon: 519442 Hut-DSM12940 Halorhabdus utahensis DSM 12940 taxon: 519442 MCM-1 Hvo PolB Haloferax volcanii DS70 taxon: 2246 Hwa GyrB Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa MCM-1 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa MCM-2 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa MCM-3 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa MCM-4 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa Pol-II-1 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa Pol-II-2 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa PolB-1 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa PolB-2 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa PolB-3 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa RCF Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa RIR1-1 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa RIR1-2 Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa Top6B Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Hwa rPol A Haloquadratum walsbyi DSM Halophile, taxon: 362976, 16790 strain: DSM 16790 = HBSQ001 Maeo Pol-II Methanococcus aeolicus Nankai-3 taxon: 419665 Maeo RFC Methanococcus aeolicus Nankai-3 taxon: 419665 Maeo RNR Methanococcus aeolicus Nankai-3 taxon: 419665 Maeo-N3 Helicase Methanococcus aeolicus Nankai-3 taxon: 419665 Maeo-N3 RtcB Methanococcus aeolicus Nankai-3 taxon: 419665 Maeo-N3 UDP GD Methanococcus aeolicus Nankai-3 taxon: 419665 Mein-ME PEP Methanocaldococcus infernus ME thermophile, Taxon: 573063 Mein-ME RFC Methanocaldococcus infernus ME Taxon: 573063 Memar MCM2 Methanoculleus marisnigri JR1 taxon: 368407 Memar Pol-II Methanoculleus marisnigri JR1 taxon: 368407 Mesp-FS406 PolB-1 Methanocaldococcus sp. FS406-22 Taxon: 644281 Mesp-FS406 PolB-2 Methanocaldococcus sp. FS406-22 Taxon: 644281 Mesp-FS406 PolB-3 Methanocaldococcus sp. FS406-22 Taxon: 644281 Mesp-FS406-22 LHR Methanocaldococcus sp. FS406-22 Taxon: 644281 Mfe-AG86 Pol-1 Methanocaldococcus fervens AG86 Taxon: 573064 Mfe-AG86 Pol-2 Methanocaldococcus fervens AG86 Taxon: 573064 Mhu Pol-II Methanospirillum hungateii JF-1 taxon 323259 Mja GF-6P Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja Helicase Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja Hyp-1 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja IF2 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja KlbA Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja PEP Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja Pol-1 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja Pol-2 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja RFC-1 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja RFC-2 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja RFC-3 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja RNR-1 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja RNR-2 Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja RtcB Methanococcus jannaschii Thermophile, DSM 2661, (Mja Hyp-2) (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja TFIIB Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja UDP GD Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja r-Gyr Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja rPol A Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mja rPol A Methanococcus jannaschii Thermophile, DSM 2661, (Methanocaldococcus jannaschii taxon: 2190 DSM 2661) Mka CDC48 Methanopyrus kandleri AV19 Thermophile, taxon: 190192 Mka EF2 Methanopyrus kandleri AV19 Thermophile, taxon: 190192 Mka RFC Methanopyrus kandleri AV19 Thermophile, taxon: 190192 Mka RtcB Methanopyrus kandleri AV19 Thermophile, taxon: 190192 Mka VatB Methanopyrus kandleri AV19 Thermophile, taxon: 190192 Mth RIR1 Methanothermobacter Thermophile, delta H strain thermautotrophicus (Methanobacterium thermoautotrophicum) Mvu-M7 Helicase Methanocaldococcus vulcanius M7 Taxon: 579137 Mvu-M7 Pol-1 Methanocaldococcus vulcanius M7 Taxon: 579137 Mvu-M7 Pol-2 Methanocaldococcus vulcanius M7 Taxon: 579137 Mvu-M7 Pol-3 Methanocaldococcus vulcanius M7 Taxon: 579137 Mvu-M7 UDP GD Methanocaldococcus vulcanius M7 Taxon: 579137 Neq Pol-c Nanoarchaeum equitans Kin4-M Thermophile, taxon: 228908 Neq Pol-n Nanoarchaeum equitans Kin4-M Thermophile, taxon: 228908 Nma-ATCC43099 Natrialba magadii ATCC 43099 Taxon: 547559 MCM Nma-ATCC43099 Natrialba magadii ATCC 43099 Taxon: 547559 PolB-1 Nma-ATCC43099 Natrialba magadii ATCC 43099 Taxon: 547559 PolB-2 Nph CDC21 Natronomonas pharaonis DSM 2160 taxon: 348780 Nph PolB-1 Natronomonas pharaonis DSM 2160 taxon: 348780 Nph PolB-2 Natronomonas pharaonis DSM 2160 taxon: 348780 Nph rPol A Natronomonas pharaonis DSM 2160 taxon: 348780 Pab CDC21-1 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab CDC21-2 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab IF2 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab KlbA Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab Lon Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab Moaa Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab Pol-II Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab RFC-1 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab RFC-2 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab RIR1-1 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab RIR1-2 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab RIR1-3 Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Pab RtcB Pyrococcus abyssi Thermophile, strain Orsay, (Pab Hyp-2) taxon: 29292 Pab VMA Pyrococcus abyssi Thermophile, strain Orsay, taxon: 29292 Par RIR1 Pyrobaculum arsenaticum DSM 13514 taxon: 340102 Pfu CDC21 Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu IF2 Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu KlbA Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu Lon Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu RFC Pyrococcus furiosus Thermophile, DSM3638, taxon: 186497 Pfu RIR1-1 Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu RIR1-2 Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu RtcB Pyrococcus furiosus Thermophile, taxon: 186497, (Pfu Hyp-2) DSM3638 Pfu TopA Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pfu VMA Pyrococcus furiosus Thermophile, taxon: 186497, DSM3638 Pho CDC21-1 Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho CDC21-2 Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho IF2 Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho KlbA Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho LHR Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho Lon Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho Pol I Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho Pol-II Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho RFC Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho RIR1 Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho RadA Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho RtcB Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 (Pho Hyp-2) Pho VMA Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Pho r-Gyr Pyrococcus horikoshii OT3 Thermophile, taxon: 53953 Psp-GBD Pol Pyrococcus species GB-D Thermophile Pto VMA Picrophilus torridus, DSM 9790 DSM 9790, taxon: 263820, Thermoacidophile Smar 1471 Staphylothermus marinus F1 taxon: 399550 Smar MCM2 Staphylothermus marinus F1 taxon: 399550 Tac-ATCC25905 Thermoplasma acidophilum, ATCC Thermophile, taxon: 2303 VMA 25905 Tac-DSM1728 VMA Thermoplasma acidophilum, Thermophile, taxon: 2303 DSM1728 Tag Pol-1 Thermococcus aggregans Thermophile, taxon: 110163 (Tsp-TY Pol-1) Tag Pol-2 Thermococcus aggregans Thermophile, taxon: 110163 (Tsp-TY Pol-2) Tag Pol-3 Thermococcus aggregans Thermophile, taxon: 110163 (Tsp-TY Pol-3) Tba Pol-II Thermococcus barophilus MP taxon: 391623 Tfu Pol-1 Thermococcus fumicolans Thermophilem, taxon: 46540 Tfu Pol-2 Thermococcus fumicolans Thermophile, taxon: 46540 Thy Pol-1 Thermococcus hydrothermalis Thermophile, taxon: 46539 Thy Pol-2 Thermococcus hydrothermalis Thermophile, taxon: 46539 Tko CDC21-1 Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko CDC21-2 Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko Helicase Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko IF2 Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko KlbA Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko LHR Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko Pol-1 Pyrococcus/Thermococcus Thermophile, taxon: 69014 (Pko Pol-1) kodakaraensis KOD1 Tko Pol-2 Pyrococcus/Thermococcus Thermophile, taxon: 69014 (Pko Pol-2) kodakaraensis KOD1 Tko Pol-II Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko RFC Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko RIR1-1 Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko RIR1-2 Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko RadA Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko TopA Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tko r-Gyr Thermococcus kodakaraensis Thermophile, taxon: 69014 KOD1 Tli Pol-1 Thermococcus litoralis Thermophile, taxon: 2265 Tli Pol-2 Thermococcus litoralis Thermophile, taxon: 2265 Tma Pol Thermococcus marinus taxon: 187879 Ton-NA1 LHR Thermococcus onnurineus NA1 Taxon: 523850 Ton-NA1 Pol Thermococcus onnurineus NA1 taxon: 342948 Tpe Pol Thermococcus peptonophilus strain SM2 taxon: 32644 Tsi-MM739 Lon Thermococcus sibiricus MM 739 Thermophile, Taxon: 604354 Tsi-MM739 Pol-1 Thermococcus sibiricus MM 739 Taxon: 604354 Tsi-MM739 Pol-2 Thermococcus sibiricus MM 739 Taxon: 604354 Tsi-MM739 RFC Thermococcus sibiricus MM 739 Taxon: 604354 Tsp AM4 RtcB Thermococcus sp. AM4 Taxon: 246969 Tsp-AM4 LHR Thermococcus sp. AM4 Taxon: 246969 Tsp-AM4 Lon Thermococcus sp. AM4 Taxon: 246969 Tsp-AM4 RIR1 Thermococcus sp. AM4 Taxon: 246969 Tsp-GE8 Pol-1 Thermococcus species GE8 Thermophile, taxon: 105583 Tsp-GE8 Pol-2 Thermococcus species GE8 Thermophile, taxon: 105583 Tsp-GT Pol-1 Thermococcus species GT taxon: 370106 Tsp-GT Pol-2 Thermococcus species GT taxon: 370106 Tsp-OGL-20P Pol Thermococcus sp. OGL-20P taxon: 277988 Tthi Pol Thermococcus thioreducens Hyperthermophile Tvo VMA Thermoplasma volcanium GSS1 Thermophile, taxon: 50339 Tzi Pol Thermococcus zilligii taxon: 54076 Unc-ERS PFL uncultured archaeon Gzfos13E1 isolation_source = Eel River sediment, clone = GZfos13E1, taxon: 285397 Unc-ERS RIR1 uncultured archaeon GZfos9C4 isolation source = Eel River sediment, taxon: 285366, clone = GZfos9C4 Unc-ERS RNR uncultured archaeon GZfos10C7 isolation source = Eel River sediment, clone = GZfos10C7, taxon: 285400 Unc-MetRFS MCM2 uncultured archaeon (Rice Cluster I) Enriched methanogenic consortium from rice field soil, taxon: 198240

    [0068] The split inteins of the disclosed compositions or that can be used in the disclosed methods can be modified, or mutated, inteins. A modified intein can comprise modifications to the N-terminal intein segment, the C-terminal intein segment, or both. The modifications can include additional amino acids at the N-terminus the C-terminus of either portion of the split intein, or can be within the either portion of the split intein. Table 2 shows a list of amino acids, their abbreviations, polarity, and charge.

    TABLE-US-00002 TABLE 2 List of Amino Acids 3-Letter 1-Letter Amino Acid Code Code Polarity Charge Alanine Ala A nonpolar neutral Arginine Arg R Basic polar positive Asparagine Asn N polar neutral Aspartic acid Asp D acidic polar negative Cysteine Cys C nonpolar neutral Glutamic acid Glu E acidic polar negative Glutamine Gln Q polar neutral Glycine Gly G nonpolar neutral Histidine His H Basic polar Positive (10%) Neutral (90%) Isoleucine Ile I nonpolar neutral Leucine Leu L nonpolar neutral Lysine Lys K Basic polar positive Methionine Met M nonpolar neutral Phenylalanine Phe F nonpolar neutral Proline Pro P nonpolar neutral Serine Ser S polar neutral Threonine Thr T polar neutral Tryptophan Trp W nonpolar neutral Tyrosine Tyr Y polar neutral Valine Val V nonpolar neutral

    [0069] Preferably, the invention provides an N-intein protein variant of the native N-intein domain of Nostoc punctiforme (Npu) wherein the native N-intein domain has the following sequence:

    TABLE-US-00003 (SEQIDNO:1) CLSYETEILTVEYGLLPIGKIVEKRIECTVYSVDNNGNIYTQPVAQWHDR GEQEVFEYCLEDGSLIRATKDHKFMTVDGQMLPIDEIFERELDLMRV
    wherein the protein variant comprises an amino acid substitution of the asparagine (N) at position 36 of SEQ ID NO: 1 with an amino acid that increases alkaline stability of the N-intein protein variant as compared to alkaline stability of the native N-intein of SEQ ID NO:1.

    [0070] Preferably, the invention provides an N-intein protein variant of SEQ ID NO: 1 wherein the protein variant comprises an amino acid substitution of the cysteine (C) at position 1 of SEQ ID NO: 1 to any other amino acid that is not cysteine in addition to an amino acid substitution of the asparagine (N) at position 36 of SEQ ID NO: 1 with an amino acid that increases alkaline stability of the N-intein protein variant as compared to alkaline stability of the native N-intein of SEQ ID NO:1.

    [0071] The invention also provides an N-intein protein variant of a reference protein wherein the reference protein has at least about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 1 and preferably wherein the reference protein has at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 1, and wherein the N-intein protein variant of the invention comprises an amino acid substitution of the asparagine (N) at position 36 of the reference protein with an amino acid that increases alkaline stability of the N-intein protein variant as compared to alkaline stability of the native N-intein of SEQ ID NO: 1.

    [0072] In another embodiment the N-intein comprises the amino acid sequence of SEQ ID NO: 2 which is a N-intein consensus derived sequence. An N-intein variant sequences based on SEQ ID NO: 2 also comprise an amino acid at position 36 other than N that increases alkaline stability of the N-intein protein variant as compared to alkaline stability of the native N-intein of SEQ ID NO: 1. Preferably the amino acid that increases stability alkaline stability is an amino acid that are less sensitive to deamidation as compared to aparagine (N). The amino acid sequence of SEQ I D NO: 2 is as follows:

    TABLE-US-00004 (SEQIDNO:2) ALSYDTEILTVEYGFLPIGXIVEEXIEXTVYSVDXXGFVYTQPIAQWHNR GEQEVFEYXLEDGSIIRATXDHXFMTTDGXMLPIDEIFEXGLDLXQV [0073] wherein [0074] X in positions 20, 35, 70, 73, and 95 are each independently selected from K, R or A; [0075] X in position 28 is C, A or S; [0076] X in position 36 is N, H or Q; [0077] X in position 25 is N or R; [0078] X is position 59 is D or C; [0079] X in position 80 is E or Q; and [0080] X in position 90 is Q, R or K.

    [0081] Preferred embodiments of N-inteins in accordance with the invention are selected from the group of N-intein variants referred to herein as A48, B22, B72 and A41 wherein:

    A48 has the sequence of of SEQ ID NO: 2 wherein: [0082] X in positions 20, 35, 70, 73, and 95 is R; [0083] X in position 28 is A; [0084] X in position 36 is H; [0085] X in position 25 is N; [0086] X in position 59 is D; [0087] X in position 80 is E; and [0088] X in position 90 is Q;
    B22 has the sequence of SEQ ID NO: 2, wherein: [0089] X in positions 20, 35, 70, 73, and 95 is A; [0090] X in position 28 is A; [0091] X in position 36 is H; [0092] X in position 25 is N; [0093] X in position 59 is D; [0094] X in position 80 is E; and [0095] X in position 90 is Q;
    B72 has the sequence of SEQ ID NO: 2, wherein: [0096] X in positions 20, 35, 70, 73, and 95 is K; [0097] X in position 28 is C; [0098] X in position 36 is H; [0099] X in position 25 is N; [0100] X in position 59 is D; [0101] X in position 80 is E; and [0102] X in position 90 is Q
    A40 has the sequence of SEQ ID NO: 2, wherein: [0103] X in position 20, 35, 70, 73, and 95 is R; [0104] X in position 28 is A; [0105] X in position 36 is N; [0106] X in position 25 is N; [0107] X in position 59 is D; [0108] X in position 80 is E; and [0109] X in position 90 is Q.
    A41 has the sequence of SEQ ID NO: 2, wherein: [0110] X in positions 20, 35, 70, 73, and 95 is K; [0111] X in position 28 is A; [0112] X in position 36 is N; [0113] X in position 25 is N; [0114] X in position 59 is D; [0115] X in position 80 is E; and [0116] X in position 90 is Q;
    Comparative ligand A53, has the sequence of SEQ ID NO: 2 wherein: [0117] X in positions 20, 35, 70, 73, and 95 is K; [0118] X in position 28 is C; [0119] X in position 36 is N; [0120] X in position 25 is N; [0121] X in position 59 is D; [0122] X in position 80 is E; and [0123] X in position 90 is Q.

    [0124] The N-intein of the invention may be coupled to solid phase, such as a membrane, fiber, particle, bead or chip. The solid phase may be a chromatography resin of natural or synthetic origin, such as a natural or synthetic resin, preferably a polysaccharide such as agarose. The solid phase, such as a chromatography resin, may be provided with embedded magnetic particles. In another embodiment the solid phase is a non-diffusion limited resin/fibrous material.

    [0125] In this case the solid phase may be formed from one or more polymeric nanofibre substrates, such as electrospun polymer nanofibres. Polymer nanofibres for use in the present invention typically have mean diameters from 10 nm to 1000 nm. The length of polymer nanofibres is not particularly limited. The polymer nanofibres can suitably be monofilament nanofibres and may e.g. have a circular, ellipsoidal or essentially circular/ellipsoidal cross section. Typically, the one or more polymer nanofibres are provided in the form of one or more non-woven sheets, each comprising one or more polymer nanofibers. A non-woven sheet comprising one or more polymer nanofibres is a mat of said one or more polymer nanofibres with each nanofibre oriented essentially randomly, i.e. it has not been fabricated so that the nanofibre or nanofibres adopts a particular pattern. Non-woven sheets typically have area densities from 1 to 40 g/m2. Non-woven sheets typically have a thickness from 5 to 120 ?m. The polymer should be a polymer suitable for use as a chromatography medium, i.e. an adsorbent, in a chromatography method. Suitable polymers include polyamides such as nylon, polyacrylic acid, polymethacrylic acid, polyacrylonitrile, polystyrene, polysulfones e.g. polyethersulfone (PES), polycaprolactone, collagen, chitosan, polyethylene oxide, agarose, agarose acetate, cellulose, cellulose acetate, and combinations thereof.

    [0126] The N-intein according to the invention may be immobilized on a solid support in a very high degree, 0.2-2 ?mole/ml N-intein is coupled per ml resin (swollen gel).

    [0127] The N-intein according to the invention may be coupled to the solid phase via a Lys-tail, comprising one or more Lys, such as at least two, on the C-terminal. Alternatively, the N-intein is coupled to the solid phase via a Cys-tail on the C-terminal.

    C-intein Protein Variants

    [0128] Preferably the invention also provides a C-intein comprising the following sequence SEQ ID NO 3 as follows:

    TABLE-US-00005 (SEQIDNO:3) VKIVSRKSLGVQNVYDIGVEKDHNFLLANGLIASN [0129] or sequences having at least 50%, 60%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity therewith and preferably sequences having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity therewith.

    [0130] It will be appreciated that selection of the N-intein and C-intein can be from the same wild type split intein (e.g., both from Npu, or a variant of either the N- or C-intein, or alternatively can be selected from different wild type split inteins or the consensus split intein sequences, as it has been discovered that the affinity of a N-fragment for a different C-fragment (e.g., Npu N-fragment or variant thereof with Ssp C-fragment or variant thereof) still maintains sufficient binding affinity for use in the disclosed methods.

    Vectors Comprising Intein Variants of the Invention

    [0131] In a third aspect, the invention relates to a vector comprising the above C-intein of SEQ ID NO: 3 and a gene encoding a protein of interest (POI). Also disclosed herein are vectors comprising nucleic acids encoding the C-terminal intein segment, as well as cell lines comprising said vectors. As used herein, plasmid or viral vectors are agents that transport the disclosed nucleic acids, such as those encoding a C-terminal intein segment and a peptide of interest, into a cell without degradation and include a promoter yielding expression of the gene in the cells into which they can be delivered. In one example, a C-terminal intein segment and peptide of interest are derived from either a virus or a retrovirus. Retroviral vectors are able to carry a larger genetic payload, i.e., a transgene or marker gene, than other viral vectors and for this reason are a commonly used vector. However, they are not as useful in non-proliferating cells. Adenovirus vectors are relatively stable and easy to work with, have high titers, and can be delivered in aerosol formulation, and can transfect non-dividing cells. Pox viral vectors are large and have several sites for inserting genes; they are thermostable and can be stored at room temperature.

    Split Intein Systems

    [0132] Preferably, the invention provides a split intein system for affinity purification of a protein of interest (POI), comprising a N-intein and C-intein as described above.

    [0133] Preferably the N-intein comprises a N36H mutation for increased alkaline stability.

    [0134] Preferably the N-intein is attached to a solid phase and the C-intein is co-expressed with the POI and used as a tag for affinity purification of the POI. Vice versa is also possible, ie attaching the C-intein to a solid phase and using the N-intein as a tag, but the former is preferred.

    [0135] The alkaline stability of the N-intein ligand in the split intein system according to the invention enables be re-generation after cleavage of the POI from the solid phase, under alkaline conditions, such as 0.05-0.5 M NaOH. The solid phase may be regenerated up to 100 times.

    [0136] In one embodiment the C-intein and an additional tag is co-expressed with the POI. The additional tag may be any conventional chromatography tag, such as an IEX tag or an affinity tag.

    Methods of Purifying a Protein of Interest (POI)

    [0137] In a fifth aspect the invention relates to a method for purification of a protein of interest (POI), using the split intein system according to the invention, comprising association of the C-intein and N-intein at neutral pH, such as 6-8, and in the presence of divalent cations (which impairs spontaneous cleavage); washing said solid phase in the presence of divalent cations; addition of a chelator to allow spontaneous cleavage between C-intein and POI; collection of tagless POI; and re-generating said solid phase under alkaline conditions, such as 0.5M NaOH.

    [0138] This protocol is suitable for protein non-sensitive for Zn. The advantages are long contact times are allowed with the resin and addition of large sample volume. Sample loading could be made for long times, such as up to 1.5 hours.

    [0139] According to the invention more than 30% yield, preferably 50%, most preferably more than 80% of POI is achieved in less than 4 hours cleavage.

    [0140] The invention enables a high ligand density when the N-intein is immobilized to a solid phase. Preferably the N-intein is attached to a chromatography resin, such as agarose or any other suitable resin for protein purification. According to the invention it is possible to achieve a static binding capacity of 0.2-2 ?mole/ml C-intein bound POI per settled ml resin.

    Affinity Tags

    [0141] The invention also relates to a method for purification of a protein of interest (POI), comprising the following steps: co-expressing a POI with a C-intein according to the invention and an additional tag; binding said additional tag to its binding partner on a solid phase; cleaving off the POI and the C-intein; binding said C-intein to an N-intein attached to a solid phase at neutral pH and cleaving off said bound C-intein and N-intein from said POI; and re-generating said solid phase under alkaline conditions, such as 0.5M NaOH. The purpose of this twin tag: increased purity (enables dual affinity purification), solubility, detectability.

    [0142] Affinity tags can be peptide or protein sequences cloned in frame with protein coding sequences that change the protein's behavior. Affinity tags can be appended to the N- or C-terminus of proteins which can be used in methods of purifying a protein from cells. Cells expressing a peptide comprising an affinity tag can be expressed with a signal sequence in the supernatant/cell culture medium. Cells expressing a peptide comprising an affinity tag can also be pelleted, lysed, and the cell lysate applied to a column, resin or other solid support that displays a ligand to the affinity tags. The affinity tag and any fused peptides are bound to the solid support, which can also be washed several times with buffer to eliminate unbound (contaminant) proteins. A protein of interest, if attached to an affinity tag, can be eluted from the solid support via a buffer that causes the affinity tag to dissociate from the ligand resulting in a purified protein, or can be cleaved from the bound affinity tag using a soluble protease. As disclosed herein, the affinity tag is cleaved through the self-cleaving mechanism of the C-intein segment in the active intein complex.

    [0143] Examples of affinity include, but are not limited to, maltose binding protein, which can bind to immobilized maltose to facilitate purification of the fused target protein; Chitin binding protein, which can bind to immobilized chitin; Glutathione S transferase, which can bind to immobilized glutathione; poly-histidine, which can bind to immobilized chelated metals; FLAG octapeptide, which can bind to immobilized anti-FLAG antibodies.

    [0144] Affinity tags can also be used to facilitate the purification of a protein of interest using the disclosed modified peptides through a variety of methods, including, but not limited to, selective precipitation, ion exchange chromatography, binding to precipitation-capable ligands, dialysis (by changing the size and/or charge of the target protein) and other highly selective separation methods.

    [0145] In some aspects, affinity tags can be used that do not actually bind to a ligand, but instead either selectively precipitate or act as ligands for immobilized corresponding binding domains. In these instances, the tags are more generally referred to as purification tags. For example, the ELP tag selectively precipitates under specific salt and temperature conditions, allowing fused peptides to be purified by centrifugation. Another example is the antibody Fc domain, which serves as a ligand for immobilized protein A or Protein G-binding domains.

    Proteins of Interest

    [0146] Target proteins for all protocols are: any recombinant proteins, especially proteins requiring native or near native N-terminal sequences, for example therapeutic protein candidates, biologics, antibody fragments, antibody mimetics, protein scaffolds, enzymes, recombinant proteins or peptides, such as growth factors, cytokines, chemokines, hormones, antigen (viral, bacterial, yeast, mammalian) production, vaccine production, cell surface receptors, fusion proteins.

    [0147] The invention will now be described more closely in association with some non-limiting examples and the accompanying drawings.

    EXAMPLES

    Experiment 1: Alkali Stability of N-intein Ligands of the Invention

    [0148] The N-intein ligands A40, A41 and A48 according to the invention were immobilized on Biacore? CM5 sensor chips (Cytiva, Sweden) in an amount sufficient to give an immobilized level of about 450 Response Units (RU) or higher. To follow the relative binding capacity of a C-intein tagged POI to the immobilized surface, 20 ?g/ml C-intein (SEQ ID NO: 3) tagged Green Fluorescent Protein (GFP) was flowed over the chip for 1 minute and the signal strength was noted. The surface was then cleaned-in-place (CIP), i.e. flushed with 100 mM NaOH, 4 M Guanidine-HCl for 10 minutes at room temperature 22?3? C. This was repeated for 50 cycles and the immobilized ligand alkaline stability was followed as the relative loss of relative C-intein tagged GFP binding capacity (signal strength) after each cycle.

    [0149] The results are shown in FIG. 1 and indicate that the ligand A48 (with the N36H mutation) has an improved alkaline stability compared to the ligands A41 and A40. The alkaline stability was further improved compared to native sequences. In addition, a N36H mutation significantly improved alkali stability as compared to wild type Npu N-intein sequence (A52 with a CIA mutation as compared to SEQ ID NO: 1).

    The relative remaining binding capacity after 50 CIP cycles (%) was 55% for A40 and A41 while it was 69% for A48. Alkali stability using 0.5M NaOH is shown in FIG. 5.
    FIG. 5 shows the results for A40 and A48 during 20 cycles. Relative remaining binding capacity (%)
    CIP: 2 min. 100 mM NaOH, 4 M Gdn-HCl, followed by 2 min. 0.5 M NaOH.

    Experiment 2: Alkali Stability of N-intein Ligands of the Invention

    [0150] The purified N-intein ligands A53, B72, B22 and A48 were immobilized on Biacore? CM5 sensor chips (Cytiva, Sweden) in an amount sufficient to give an immobilized level of about 450 Response Units (RU) or higher. To follow the relative binding capacity of an uncleavable C-intein tagged POI to the immobilized surface, 20 ?g/ml uncleavable C-intein (SEQ ID NO 3) tagged IL-1b was flowed over the chip for 1 minute and the signal strength was noted. The surface was then cleaned-in-place (CIP), i.e. flushed with 100 mM NaOH, 4 M Guanidine-HCl for 10 minutes at room temperature 22?3? C. This was repeated for 50 cycles and the immobilized ligand alkaline stability was followed as the relative loss of uncleavable C-intein tagged IL-1b binding capacity (signal strength) after each cycle.

    [0151] The results are shown in FIG. 2 and indicate that all three ligands with N36H mutations, (A48, B22 and B72) have improved alkaline stability compared to the ligand A53. The relative remaining binding capacity after 50 CIP cycles (%) for A53 was only 20% while it was 28% for B72, 30% for B22 and 35% for A48.

    Experiment 3: Immobilization of N-intein Ligand A48 to Agarose Gel Resin

    [0152] 5 millilitres epoxy activated cross-linked activated gel resin was added into a polyproylene test-tube. 2.7 millilitres, corresponding to 135 milligram N-intein ligand A48 having a C-terminal Lys-tail in phosphate buffer was added into the tube followed by addition of 1.3 millilitres of phosphate buffer (pH 12.1) to adjust the agarose resin slurry to be about 50% and then 2 gram sodium sulfate was added. The pH of the resulting reaction mixture was adjusted to 11.5. And the reaction mixture was heated up to 33? C. in a shaking table and kept shaking at 33? C. for 4 hours. Then the slurry was transferred to glass filter and washed with 10 millilitres of distilled water 3 times. After washing, the gel was transferred into the three-neck round bottom flask (RBF) and 5 millilitres of Tris buffer (pH 8.6) with 375 microlitres thioglycerol was added. The reaction mixture was at the shaking table at 45? C. for 2 hours. After the reaction, the slurry was transferred to glass filter. The gel was washed with 5 millilitres of basic wash buffer 3 times and then 5 millilitres of acidic wash buffer 3 times. Repeated this base/acid wash another 2 times, in total 18 washes in this step. Then the gel resin was washed with 5 millilitres of distilled water 10 times. The washed and drained gel was kept in 20% ethanol in fridge before analysis.

    [0153] The dry weight of gel resin was determined by measuring the weight of 1 millilitre of gel. In the sample preparation, 2 gram of drained gel resin mixed well with 2 gram of water to give about 50% resin slurry and then the slurry was added into the 1 mL Teflon cube. Then vacuum was applied to drain the gel in the cube and thus 1 mL of gel was obtained. Transfer the gel onto the dry weight balance. The weight was determined after 35 minutes with drying temperature set at 105? C.

    [0154] Amino acid analysis was measured after the dry weight determination. With the corresponding dry weights and information of the size and primary amino sequence of the protein the ligand density could be derived in mg/mL gel resin.

    Results for the coupled agarose resin was a dry-weight of 90.6 mg/ml and with a ligand content of 18.4 mg/ml which corresponds to 1.38 umole/ml.

    Experiment 4: Static Binding Capacity in Relation to Ligand Density

    [0155] The proposed capacity method presented herein can measure binding capacity of the resin in test tubes.

    Reaction Setup

    [0156] Briefly, prototype resin with immobilized A48 ligand with various ligand densities and dual tagged test-protein A43 (SEQ ID NO: 5) were separately diluted in assay buffer (2? PBS) to 2.5% resin slurry and 0.4 mg/mL, respectively. 50 ?L of the 2.5% resin slurry was added to an ILLUSTRA? microspin column followed by addition of 150 ?L diluted A43 (SEQ ID NO: 5). The reactions were allowed to incubate with 1450 rpm shaking at 22? C. for a 2 hour fixed timepoint before centrifuged at 3000 rcf for 1 min.

    SDS-PAGE

    [0157] Centrifuged samples (containing cleaved protein and unbound non-cleaved protein) were mixed 1:1 with 2? SDS-PAGE reducing sample buffer, boiled for 5 minutes at 95? C. and subjected to SDS-PAGE (18 ?L loaded). A C-intein tagged test-protein, A43 (SEQ ID NO: 5) standard was added (usually a five-point standard between 18.75-300 ?g/mL) in order to be able to calculate concentrations from the densitometric volumes. Gels were coomassie stained for 60 min (?100 mL/gel) followed by destaining for 120-180 min at room temperature with gentle agitation (until background is completely clear). Densitometric quantification of the uncleaved/unbound and cleaved test-protein was performed with the IQ TL software. The densitometric raw data was then exported to Microsoft Excel.

    SBC Calculations

    [0158] Since the test-protein input in the reactions are known we can indirectly calculate the static binding capacity (SBC) by the following equation:

    [00001] SBC mg mL = ( input amount in .Math.g - unbound amount in .Math.g ) resin volume ( .Math.L )

    [0159] FIG. 3 shows static binding capacity of the N-intein ligands of the invention. Amino acid analysis (AAA) done by conventional method. The A48 prototypes were coupled by epoxy chemistry to porous agarose particles.

    Experiment 5: Purification of Elongation Factor G Without and With Zn Protocol

    [0160] Elongation factor G, (Ef-G) from Thermoanaerobacter tengcongensis was purified in this example using a resin prototype with immobilized ligand A48. C-intein (SEQ ID NO 3) tagged EfG was expressed intracellularly in E. coli strain BL21 (DE3).

    [0161] Frozen cell-pellet after fermentation harvest was thawed and resuspended with extraction buffer, (20 mM Tris-HCl, pH 8.0) by magnetic stirring. DNAse I (bovine pancreas) and 1 mM MgSO.sub.4 was added followed by addition of lysozyme (hen egg). After stirring for 30 minutes at room temperature the resuspended and lysozyme treated cell suspension was heated in a water-bath to 70-75? C. and kept at this temperature for 5 minutes. After cooling the extract briefly on ice, the extract was clarified by centrifugation.

    [0162] Purification using a Zn-free protocol was done on an ?KTA? Avant system at 2 ml/min during sample loading and washing and then at 1 ml/min. A 1 ml HiTrap? column containing immobilized A48 ligand was used. Equilibration and binding of the C-intein tagged target protein was done in a 20 mM MES buffer supplemented with 100 mM NaCl at pH 6.3 and the sample was adjusted to pH 6.3 using 2M Acetic acid. Column wash after sample application and subsequent elutions were done with a 20 mM Tris-HCl buffer supplemented with 400 mM NaCl at pH 8.0. After column washing the flow was stopped for 4 hours of incubation at room temperature and then cleaved EfG was eluted. A second stop in flow was added to allow a second elution, which was done after additional 16 hours of incubation.

    [0163] 17.8 mg pure, tag-free EfG was eluted after 4 hours incubation on the HiTrap? column. The mass difference between eluted protein and CIPed protein was equal to the mass of the C-intein tag according to mass spectrometry analysis. The purity according to SDS-PAGE was high as well as in SEC-analysis on Superdex? 200 Increase. The total protein amount was calculated from the theoretical UV absorption coefficent at 280 nm and the UV-signal on diluted elution and CIP fractions.

    [0164] The purification was repeated using a protocol including Zn-ions to the equilibration buffer and the clarified sample. The final Zn-concentration was 1.6 mM. The flowrate was reduced to 0.5 ml/min during sample application and then increased to 1 ml/imn during wash and elution. Wash and elution was done with a 50 mM Tris-HCl, 20 mM imidazole buffer pH 7.5. Only one elution peak was collected in this purification and that was after 4 hours of incubation after column washing.

    [0165] 16.6 mg pure, tag-free EfG was eluted after 4 hours incubation on the HiTrap? column. The purity according to a SEC-analysis on Superdex? 200 Increase was 92%. The total protein amount was calculated from the theoretical UV absorption coefficent at 280 nm and the UV-signal on diluted elution fractions.

    Experiment 6: Purification of IL-1?

    [0166] A 1 ml HiTrap? column containing immobilized A48 ligand was used for purification of the C-intein tagged target protein IL-1? (SEQ ID NO: 5) expressed intracellularly in E. coli BL21 (DE3) and lysed by sonication. Soluble protein were harvested by centrifugation and loaded onto a 1 mL HiTrap? column immobilized with the A48 ligand. The Zn-free protocol (as in Experiment 4) was used on an ?KTA? Avant system at 4 ml/min (600 cm/h linear flow rate) during sample loading and washing. The run was then paused for 4 h before initiating flow again at 1 mL/min to elute the cleaved protein (4 h cleavage fraction). The run was then paused again for an additional 12 h before starting the flow at 1 mL/min to elute the protein that had not been cleaved after 4 h. Equilibration and binding of the wash and elution was performed with one single buffer. A chromatogram from the purification is shown in FIG. 4A. The start material, flow through, wash fractions, 4 h and 16 h elution fractions were subjected to SDS-PAGE and Coomassie staining and subsequent analysis using IQTL software (FIG. 4B).

    [0167] 9.4 mg cleaved IL-1? was eluted after 4 hours incubation on the HiTrap? column followed by an additional 1.1 mg after 16 h. The purity was 99.5 (4 hours) and 99.8% (16 hours) according to SDS-PAGE analysis. The total protein amount was calculated from the theoretical UV absorption coefficient of the cleaved protein at 280 nm.

    Experiment 7: Purification of Receptor Binding Domain of SARS-COV-2

    [0168] The receptor binding domain (RBD) of SARS-COV-2 NCBI tagged with C-intein was expressed in ExpiHEK cells and secreted into the cell culture medium. Approximately 210 mL supernatant was loaded onto a 1 mL HiTrap column with immobilized A48 ligand and without any addition of salts or other additives to the cell culture supernatant using an ?KTA? Avant FPLC system. Sample application and wash was performed at 4 mL/min (load time ?52.5 min (600 cm/h linear flow rate)) followed by 6 column volumes of wash followed by a pause/hold step for 4 h. The elution phase was performed at 1 mL/min. The column was left for additional 68 h followed by a second elution. A single 40 mM phosphate buffer pH 7.4 buffer supplemented with 300 mM NaCl was used for all chromatography steps.

    [0169] The theoretical absorbance 0.1% coefficient was used to determine protein concentration and yield within the Unicorn? software (Cytiva Sweden AB). Purity was determined by densitometric SDS-PAGE analysis. For this experiment a total of 14.1 mg cleaved protein was obtained with a purity above 96%. Theoretical molecular weight was ?25 kDa while experimental SDS-PAGE analysis indicates a molecular weight of 33 kDa which is explained by two glycosylations and was also determined by mass spectrometry analysis.

    [0170] The CCT-RBD protein has the following sequence:

    TABLE-US-00006 (SEQIDNO:4) [00001]embedded image Signalsequence-boldunderline. CCT-tag-dottedunderline. RBDdomainisdoubleunderlined. HisTag-dashedunderline

    [0171] The purity results from the cleaved protein are found in Table 3.

    TABLE-US-00007 TABLE 3 Elution cleavage time Purity Yield target protein 4 h 4 hours 96.5% 4.9 milligram 72 h 72 hours 99.4% 9.2 milligram

    Experiment 8: Tandem Tagging and Affinity Purification on Two Columns

    [0172] E. coli BL21(DE3) was transformed with the A43 expression plasmid TwinStrep? and C-intein (SEQ ID NO 3) tagged IL-1b and plated on an agar plate containing 50 ?g/ml Kanamycin. The next day, a single colony was picked and grown in 5 ml of Luria-Bertani (LB) broth to OD600 0.6. The culture was transferred to 200 ml LB broth containing the same antibiotics and grown at 37? C. until OD600 was 0.6. Protein expression was induced at 22? C. for 16 hours by the addition of Isopropyl b-D-1-thiogalactopyranoside (IPTG, 0.5 mM). After expression, the cells were harvested by centrifugation at 4,000?g for 15 minutes and stored at ?80? C. until use.

    [0173] For purification, the cell pellets were resuspended in Buffer A1 (100 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, pH 8.0) at 10 ml per gram wet-weight and disrupted by ultra-sonication (Sonics Vibracell, microtip, 30% amplitude, 2 sec on, 4 sec off, 3 min in total).

    [0174] The supernatant containing the soluble fraction was collected after centrifugation at 40,000?g for 20 minutes at 4? C. and passed through a 5 ml HiTrap? column, Streptactin? XT (GE Healthcare, Sweden). The column was washed with the same Buffer A1 until the UV-absorbance at 280 nm was below 20 mAU. Bound C-intein tagged IL-1b was eluted in Buffer B1 (100 mM Tris-HCl, 150 mM NaCl, 1 mM EDTA, 50 mM Biotin, pH 8.0) and collected.

    [0175] Purified protein was immediately applied to a 1 ml HiTrap? column packed with a resin containing immobilized N-intein ligand A48 without adding the inhibitor ZnCl.sub.2. The cleaved, tag-free IL-1b was collected in the flow-through.

    TABLE-US-00008 (SEQIDNO:5) [00002]embedded image TwinStrep-dottedunderlining CCT-boldunderlining IL1b(test-protein)-underlined

    [0176] The patent and scientific literature referred to herein establishes the knowledge that is available to those with skill in the art. All United States patents and published or unpublished United States patent applications cited herein are incorporated by reference. All published foreign patents and patent applications cited herein are hereby incorporated by reference. All other published references, documents, manuscripts and scientific literature cited herein are hereby incorporated by reference.

    [0177] While this invention has been particularly shown and described with references to preferred embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims. It should also be understood that the embodiments described herein are not mutually exclusive and that features from the various embodiments may be combined in whole or in part in accordance with the invention