Use of stereoselective transaminase in asymmetric synthesis of chiral amine
11965193 ยท 2024-04-23
Assignee
Inventors
- Zhanbing Cheng (Shanghai, CN)
- Tao Zhang (Shanghai, CN)
- Zhenhua Tian (Shanghai, CN)
- Shaonan Ding (Shanghai, CN)
Cpc classification
C12P17/182
CHEMISTRY; METALLURGY
C07C209/24
CHEMISTRY; METALLURGY
C07C211/27
CHEMISTRY; METALLURGY
C12Y206/01018
CHEMISTRY; METALLURGY
C07C229/08
CHEMISTRY; METALLURGY
C12P13/06
CHEMISTRY; METALLURGY
C07C209/24
CHEMISTRY; METALLURGY
C12P17/14
CHEMISTRY; METALLURGY
C07C229/08
CHEMISTRY; METALLURGY
International classification
Abstract
Use of a stereoselective transaminase in the asymmetric synthesis of a chiral amine. In particular, provided is use of a polypeptide in the production of a chiral amine or a downstream product using a chiral amine as a precursor. Further provided is a method for producing a chiral amine, comprising culturing a strain expressing the polypeptide so as to obtain a chiral amine. Further provided are novel prochiral compounds, a chiral amine production strain and a method for constructing the chiral amine production strain. The stereoselective transaminase has a broad substrate spectrum and thus has a broad application potential in the preparation of a chiral amine.
Claims
1. A compound of Formula II, a pharmaceutically acceptable salt thereof, or a stereoisomer thereof: ##STR00028## wherein, R.sub.1 is selected from the group consisting of none, oxo (?O), halogen, OH, NH.sub.2, substituted or unsubstituted C1-C.sub.8 alkyl, substituted or unsubstituted C.sub.3-C.sub.8 cycloalkyl, substituted or unsubstituted C.sub.1-C.sub.8 alkoxy, substituted and unsubstituted C.sub.3-C.sub.8 cycloalkoxy; R.sub.2 is selected from the group consisting of none, halogen, OH, NH.sub.2, substituted or unsubstituted C.sub.1-C.sub.8 alkyl, substituted or unsubstituted C.sub.3-C.sub.8 cycloalkyl, substituted or unsubstituted C.sub.1-C.sub.8 alkoxy, substituted and unsubstituted C.sub.3-C.sub.8 cycloalkoxy; X is selected from the group consisting of: C and N; Y is selected from the group consisting of: C, N, O, and S; wherein R.sub.2 is none when Y is O or S.
2. The compound of claim 1, the pharmaceutically acceptable salt thereof, or the stereoisomer thereof, wherein the compound of Formula II comprises the following compounds: ##STR00029##
Description
DETAILED DESCRIPTION
(1) After extensive and intensive studies, the inventors have unexpectedly discovered a polypeptide (w-transaminase) which can be used as a stereoselective catalyst to efficiently convert a prochiral carbonyl compound to an R stereoselective chiral amine. The w-transaminase according to the present invention has strict R stereoselectivity and a wide substrate spectrum, and has great application prospects in the production of chiral amines and chiral drugs. The present invention is completed on this basis.
DEFINITIONS
(2) Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one ordinary skill in the art of the invention.
(3) As used herein, when used in reference to a particular recited value, the term about means that the value can vary by no more than 1% from the recited value. For example, as used herein, the expression about 100 comprises all values between 99 and 101 (eg, 99.1, 99.2, 99.3, 99.4, etc.).
(4) As used herein, the term including or comprising (comprise) may be open, semi-closed, and closed. In other words, the term also includes essentially consisting of or consisting of.
(5) Unless otherwise defined, the following terms used in the specification and claims have meanings as commonly understood by a person skilled in the art. Unless otherwise stated, all patents, patent applications, and published materials cited herein are incorporated by reference in their entirety.
(6) It should be understood that the above brief description and the following detailed description are exemplary and explanatory only and are not restrictive of the subject matter of the invention. In the application, the singular used includes the plural unless otherwise specifically stated. It must be noted that the singular form used in the specification and claims includes the plural form of the referenced thing unless otherwise clearly stated in the context. It should also be noted that or, either is used to mean and/or unless otherwise stated. In addition, the term including or comprising (comprise) may be open, semi-closed, and closed. In other words, the term also includes essentially consisting of or consisting of.
(7) Definitions of standard chemical terms can be found in references (including Carey and Sundberg ADVANCED ORGANIC CHEMISTRY 4TH ED. Vols. A (2000) and B (2001), Plenum Press, New York). Unless otherwise stated, conventional methods within the skill of the art, such as mass spectrometry, NMR, IR, and UV/VIS spectroscopy and pharmacological methods, are used. Unless specifically defined, the terms used in the descriptions of analytical chemistry, organic synthetic chemistry, and medicinal and medicinal chemistry are known in the art. Standard techniques can be used in chemical synthesis, chemical analysis, drug preparation, formulation and delivery, and treatment of patients. For example, the reaction and purification can be performed according to a manufacturer's instruction for use of a kit, or according to a manner known in the art or the description of the invention. The techniques and methods described above can generally be implemented according to conventional methods well known in the art, based on descriptions in several summary and more specific literatures cited and discussed in the specification. In the specification, groups and their substituents may be selected by the skilled in the art to provide stable moieties and compounds.
(8) When a substituent is described by a conventional chemical formula written from left to right, the substituent also includes a chemically equivalent substituent obtained when the structural formula is written from right to left. For example, CH.sub.2O is equivalent to OCH.sub.2.
(9) The captions used herein are for organizational purposes only and should not be construed as restriction of the subject matter. All literatures or parts of literatures cited in the application, including but not limited to patents, patent applications, articles, books, operating manuals and papers, are incorporated herein by reference in their entirety.
(10) In front of certain chemical groups defined herein, a simplified symbol is used to represent the total number of carbon atoms present in the group. For example, C1-C6 alkyl refers to an alkyl group as defined below having a total of 1 to 6 carbon atoms. The total number of carbon atoms in the simplified symbol does not include the number of carbons that may be present in the substituents of the group.
(11) In addition to the foregoing, when used in the specification and claims of the present application, the following terms have the meanings indicated below, unless specifically stated otherwise.
(12) In the present application, the term halogen refers to fluorine, chlorine, bromine or iodine.
(13) Hydroxy refers to OH group.
(14) In the present application, as a group or part of another group (for example, used in a group such as a halogen-substituted alkyl group), the term alkyl refers to a fully saturated straight or branched hydrocarbon chain group, and consists of only carbon and hydrogen atoms, which has, for example, 1 to 7 carbon atoms, and is connected to the rest of the molecule by a single bond. For example, the term alkyl includes but is not limited to methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, sec-butyl, tert-butyl, n-pentyl, 2-methylbutyl, 2, 2-dimethylpropyl, n-hexyl, heptyl and the like.
(15) Polypeptide
(16) As used herein, the term polypeptide or polypeptide of the invention or polypeptide of the present invention or co-transaminase or stereoselective transaminase has same meaning, and is used interchangeably herein. All of them refer to a protein that catalyzes the production of chiral amines by a prechiral carbonyl compound. The polypeptide is not naturally existed in E. coli, which is an exogenous protein.
(17) Based on the knowledge of the prior art, it is not difficult for the ordinary skilled in the art to know that the change of a few amino acid residues in certain regions of a polypeptide, such as non-important regions, will not substantially change the biological activity. For example, the sequence obtained by appropriate substitution of certain amino acids do not affect the activity (see Watson et al., Molecular Biology of The Gene, Fourth Edition, 1987, The Benjamin/Cummings Pub. Co. P224). Thus, an ordinary skilled in the art would be able to perform such a substitution and ensure that the obtained molecule still has the desired biological activity.
(18) Therefore, in a specific embodiment, the polypeptide of the invention may be: (a1) a polypeptide having an amino acid sequence shown in SEQ ID NO: 1; or (b1) a polypeptide derived from the polypeptide having an amino acid sequence shown in SEQ ID NO: 1 and formed by substitution, deletion, or addition of one or more, preferably 1-20, more preferably 1-15, more preferably 1-10, more preferably 1-3, and most preferably one amino acid residue(s) in the amino acid sequence shown in SEQ ID NO: 1, and having the function of the polypeptide of (a1).
(19) In a preferred embodiment, the polypeptide is a polypeptide derived from the polypeptide having an amino acid sequence shown in SEQ ID NO: 1 and formed by substitution, deletion, or addition of one or more, preferably 1-20, more preferably 1-15, more preferably 1-10, more preferably 1-3, and most preferably one amino acid residue(s) at either end of the amino acid sequence shown in SEQ ID NO: 1, and having the function of the polypeptide of (a1).
(20) In a preferred embodiment, the amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1.
(21) In another preferred embodiment, the amino acid sequence of the polypeptide is any polypeptide sequence that has at least 70%, preferably at least 75%, 80%, 85%, 90%, and more preferably at least 95%, 96%, 97%, 98%, or 99% sequence identity of the amino acid sequence shown in SEQ ID NO: 1.
(22) In a specific embodiment, the polypeptide of the invention represents a protein having an amino acid sequence as shown in SEQ ID NO: 1, and the coding sequence thereof is shown as SEQ ID NO: 2.
(23) In the present invention, the polypeptide of the invention includes a mutant in which at most 20, preferably at most 10, still preferably at most 3, more preferably at most 2, and most preferably at most 1 amino acid is substituted by an amino acid of similar or close property in comparison with the polypeptide having an amino acid sequence as shown in SEQ ID NO: 1. These mutants with conservative variant are formed by amino acid substitutions as shown in the table below.
(24) TABLE-US-00001 Initial Representative Preferred residue substitution substitution Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Lys; Arg Gln Asp (D) Glu Glu Cys (C) Ser Ser Gln (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe Leu Leu (L) Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Leu; Val; Ile; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala Leu
(25) The present invention also provides the polynucleotide encoding the polypeptide of the present invention. The term polynucleotide encoding a polypeptide may include a polynucleotide that encodes the polypeptide, or a polynucleotide that also comprises additional coding and/or non-coding sequences.
(26) Therefore, as used herein, comprising, having or including includes containing, consisting mainly of, consisting essentially of, and consisting of. Consisting mainly of, consisting essentially of and consisting of are subordinate concepts of comprising, having or including.
(27) In a specific embodiment, the homology or sequence identity may be 80% or more, preferably 90% or more, more preferably 95%-98%, and most preferably 99% or more.
(28) Method for determining sequence homology or identity that are well known to the ordinary skilled in the art includes, but are not limited to: Computer Molecular Biology, edited by Lesk, A. M., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, edited by Smith, D. W., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, edited by Griffin, A. M. and Griffin, H. G., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987, and Sequence Analysis Primer, edited by Gribskov, M. and Devereux, J., M Stockton Press, New York, 1991 and Carillo, H. & Lipman, D., SIAM J. Applied Math., 48:1073(1988). The preferred method for determining identity is to obtain the greatest match between the sequences tested. Methods for determining identity are compiled into publicly available computer programs. Preferred computer program method for determining identity between two sequences includes, but are not limited to, the GCG software package (Devereux, J. et al., 1984), BLASTP, BLASTN, and FASTA (Altschul, S, F. et al., 1990). The BLASTX program is available to the public from NCBI and other sources (BLAST Handbook, Altschul, S. et al., NCBI NLM NIH Bethesda, Md. 20894; Altschul, S. et al., 1990). The well-known Smith Waterman algorithm can also be used to determine identity.
(29) The Use of the Polypeptide
(30) The inventors have unexpectedly discovered that the polypeptide of the present invention has a stereoselective transaminase (w-transaminase) activity and can be used to produce a chiral amine or a downstream product with chiral amine as precursor.
(31) In a specific embodiment, the polypeptide is: (a1) a polypeptide having an amino acid sequence shown in SEQ ID NO: 1; or (b1) a polypeptide derived from the polypeptide having an amino acid sequence shown in SEQ ID NO: 1 and formed by substitution, deletion, or addition of one or more, preferably 1-20, more preferably 1-15, more preferably 1-10, more preferably 1-3, and most preferably one amino acid residue(s) in the amino acid sequence shown in SEQ ID NO: 1, and having the function of the polypeptide of (a1).
(32) In a preferred embodiment, the chiral amine is formed by an asymmetric synthesis reaction of a prochiral carbonyl compound.
(33) In a preferred embodiment, the prochiral carbonyl compound is selected from the prochiral carbonyl compounds corresponding to the amino donors in Table 2 and the amino acceptor compounds in Table 3.
(34) Typically, the prochiral carbonyl compound is selected from the group consisting of:
(35) ##STR00012## ##STR00013##
(36) In a preferred embodiment, the polypeptide is a polypeptide derived from the polypeptide having an amino acid sequence shown in SEQ ID NO: 1 and formed by substitution, deletion, or addition of one or more, preferably 1-20, more preferably 1-15, more preferably 1-10, more preferably 1-3, and most preferably one amino acid residue(s) at either end of the amino acid sequence shown in SEQ ID NO: 1, and having the function of the polypeptide of (a1).
(37) Typically, the amino acid sequence of the polypeptide is shown in SEQ ID NO: 1.
(38) In a preferred embodiment, the chiral amine includes compounds 1a-8a or a pharmaceutically acceptable salt thereof:
(39) ##STR00014## ##STR00015##
(40) In a preferred embodiment, the downstream products with the chiral amine as precursor include: sitagliptin (compound 5a), raw material of a chiral acid resolving agent or a chiral drug intermediate (compound 1a), dolutegravir intermediate (compound 3a), raw material of a chiral drug intermediate (compound 2a, compound 4a), sitagliptin intermediate (compound 6a, compound 7a, compound 8a).
(41) Chiral Amine Producing Strain
(42) The inventors have unexpectedly discovered that a strain expressing the polypeptide of the invention can stereoselectively catalyzes the reaction shown in equation (I) to convert a prochiral carbonyl compound to a chiral amine (for example R-chiral amine).
(43) In a specific embodiment, the strain expresses the following polypeptide: (a1) a polypeptide having an amino acid sequence shown in SEQ ID NO: 1; or (b1) a polypeptide derived from the polypeptide having an amino acid sequence shown in SEQ ID NO: 1 and formed by substitution, deletion, or addition of one or more, preferably 1-20, more preferably 1-15, more preferably 1-10, more preferably 1-3, and most preferably one amino acid residue(s) in the amino acid sequence shown in SEQ ID NO: 1, and having the function of the polypeptide of (A).
(44) In another preferred embodiment, the polypeptide is a polypeptide derived from the polypeptide having an amino acid sequence shown in SEQ ID NO: 1 and formed by substitution, deletion, or addition of one or more, preferably 1-20, more preferably 1-15, more preferably 1-10, more preferably 1-3, and most preferably one amino acid residue(s) at either end of the amino acid sequence shown in SEQ ID NO: 1, and having the function of the polypeptide of (a1).
(45) In another preferred embodiment, the amino acid sequence of the polypeptide is as shown in SEQ ID NO: 1.
(46) In another preferred embodiment, the amino acid sequence of the polypeptide is any polypeptide sequence that has at least 70%, preferably at least 75%, 80%, 85%, 90%, and more preferably at least 95%, 96%, 97%, 98%, or 99% sequence identity of the amino acid sequence shown in SEQ ID NO: 1.
(47) In another preferred embodiment, the producing strain is a bacteria, preferably Escherichia coli (eg, E. coli BL21).
(48) Method for Producing Chiral Amines
(49) In the present invention, the stereoselective transaminase (w-transaminase) can be used in various forms. For example, resting cells or wet cells expressing the w-transaminase of the invention can be used. Various forms such as crude enzyme solution, pure enzyme, crude enzyme powder or immobilized enzyme can also be used.
(50) In a preferred embodiment, the method for producing chiral amines comprises: (a) carrying out a reaction shown in equation I to form a chiral amine in a liquid reaction system, using prochiral carbonyl compound as a substrate, in the presence of a prosthetic group and under the catalysis of stereoselective transaminase;
(51) ##STR00016## (b) optionally, isolating the chiral amine from the reaction system after the reaction of the previous step.
(52) In another preferred embodiment, the method for producing a chiral amine includes: 1) culturing the chiral amine producing strain of the invention under production conditions to obtain a chiral amine; 2) optionally isolating the chiral amine from the culture system of 1).
(53) In another preferred embodiment, an appropriate amount of pyridoxal phosphate is added in step 1) of the method for producing a chiral amine.
(54) Construction Method of Chiral Amine Producing Strain
(55) The inventors have unexpectedly discovered that a producing strain of chiral amine with high conversion rate can be constructed by modifying the strain to comprise an expression vector expressing the polypeptide of the invention or to integrate a gene expressing the polypeptide into its genome.
(56) In another specific embodiment, the method further comprises measuring the conversion rate of the obtained strain and/or the chiral amine yield to verify the obtained strain.
(57) The Main Advantages of the Invention are:
(58) (1) The new w-transaminase disclosed in the invention has strict R stereoselectivity and a wide substrate spectrum, showing industrial application prospects in the environmental production of chiral amines and unnatural amino acids.
(59) The present invention will be further illustrated below with reference to the specific examples. It is to be understood that these examples are for illustrative purposes only and are not intended to limit the scope of the invention. For the experimental methods in the following examples the specific conditions of which are not specifically indicated, they are performed under routine conditions, e.g., those described by Sambrook. et al., in Molecule Clone: A Laboratory Manual, New York: Cold Spring Harbor Laboratory Press, 1989, or as instructed by the manufacturers. Percentages and parts are by weight unless otherwise stated.
(60) The reagents and raw materials used in the invention are all commercially available. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by the ordinary skilled in the art to which the invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the methods and materials described herein are preferred.
Example 1 Mycobacterium neoaurum Transaminase
(61) Mycobacterium neoaurum (Mycobacterium sp. NRRL B-3805) was purchased from the collection center, and the collection number is CP011022.1:988057-989064. Primers for PCR were designed based on the sequence of the transaminase of Mycobacterium neoaurum (see Table 1).
(62) TABLE-US-00002 TABLE1 sequencelistofprimers MyTA-for TTAAGAAGGAGAtatacatATGAGCACAGGAACCTCCAACC (SEQIDNo:3) MyTA-Rev CTCGAGTGCGGCCGCaagcTTAGTATTCGATCGCTTCGATC (SEQIDNo:4)
(63) Mycobacterium transaminase genomic DNA was used as a template for PCR amplification. The PCR amplification was performed with PCR system comprising 2 ?L of 10?KOD-Plus PCR buffer, 1.2 ?L of 25 mM MgSO.sub.4, 2 ?L of 2 mM dNTP, 0.3 ?L of KOD-Plus PCR high fidelity enzyme, 0.5 ?L of DNA template (including 0.1 ?g of DNA template), 13 ?L of ddH.sub.2O, and 0.5 ?L (10 mmol/L) of both forward and reverse primers of gene clone in Table 1. The PCR amplification steps were: (1) pre-denaturing at 95? C. for 3 min; (2) denaturing at 98? C. for 15 s; (3) annealing at 55? C. for 30 s; (4) extending at 72? C. for 1 min; wherein steps (2) to (4) repeated 30 times; (5) continuing the extending at 72? C. for 10 minutes and cooling to 4? C. The PCR product was purified by agarose gel electrophoresis. The agarose gel DNA recovery kit was used to recover the target band in the 900-1200 bp to obtain a complete full-length Mycobacterium transaminase gene sequence. After DNA sequencing, the full-length was identified with a length of 1008 bp and named MyTA. Its nucleotide sequence and encoded amino acid sequence are shown as SEQ ID No: 2 and 1 in the sequence listing, respectively.
(64) TABLE-US-00003 SEQIDNo:1 MSTGTSNLVAVEPGAIREDTPPGSVIQYSDYELDHSSPFAGGVAWIEGEF LPAEDAKISIFDTGFGHSDLTYTVAHVWHGNIFRLGDHLDRLLDGARKLR LDAGYTKDELADITKQCVAMSQLRESFVNLTVTRGYGKRRGEKDLSKLTH QVYIYAIPYLWAFPPAEQIFGTTAIVPRHVRRAGRNTVDPTIKNYQWGDL TAASFEAKDRGARTAILLDSDNCVAEGPGFNVCIVKDGKLASPSRNALPG ITRKTVFELAEQMGIEATLRDVTSHELYEADELMAVTTAGGVTPINSLDG EPIGNGEPGEMTVAIRDRFWALMDEPGPLIEAIEY SEQIDNo:2 ATGAGCACAGGAACCTCCAACCTCGTGGCCGTCGAACCGGGAGCCATCCG GGAGGACACCCCGCCGGGGTCGGTGATCCAGTACAGCGATTACGAGCTGG ACCACAGCAGCCCGTTCGCCGGCGGCGTCGCCTGGATCGAAGGAGAGTTC CTGCCCGCGGAGGATGCCAAGATCTCCATCTTCGACACCGGCTTCGGGCA TTCCGATCTCACCTACACCGTCGCGCATGTGTGGCACGGCAACATCTTCC GGCTGGGGGATCACCTGGACCGACTGCTCGACGGGGCCCGCAAGCTGCGT CTGGACGCCGGTTACACCAAGGACGAGTTGGCCGATATCACCAAACAGTG CGTCGCGATGTCGCAGCTGCGCGAATCCTTCGTCAACCTCACCGTTACCC GGGGCTACGGAAAGCGAAGGGGCGAAAAGGATCTGTCCAAGCTGACCCAC CAGGTGTACATCTACGCCATCCCGTATCTGTGGGCGTTCCCCCCGGCCGA GCAGATCTTCGGCACCACCGCCATCGTGCCGCGCCATGTCCGTCGGGCCG GCCGCAACACGGTGGACCCGACCATCAAGAACTATCAGTGGGGCGATCTG ACCGCGGCCAGCTTCGAGGCCAAGGACCGCGGGGCCCGCACTGCCATCCT GCTCGACTCGGACAACTGTGTGGCCGAGGGGCCGGGTTTCAACGTCTGCA TCGTCAAGGATGGCAAGCTGGCCTCCCCGTCGCGAAATGCGTTGCCGGGC ATCACCCGCAAGACTGTTTTCGAACTCGCCGAGCAGATGGGCATCGAGGC CACCCTGCGCGATGTCACCAGCCACGAACTCTACGAGGCCGACGAGCTGA TGGCCGTCACCACCGCCGGCGGTGTCACCCCGATCAACTCCCTGGACGGC GAGCCGATCGGCAACGGTGAGCCCGGTGAGATGACGGTCGCCATCCGGGA CCGCTTCTGGGCGCTGATGGACGAGCCCGGCCCGCTGATCGAAGCGATCG AATACTGA
Example 2: Expression of the Enzyme
(65) The transaminase gene in Example 1 was linked to pET28a using an enzyme, and the restriction enzyme sites were Nde I & Hind III. The linked vector was transformed into host Escherichia coli BL21 competent cells. The constructed strains were seeded into TB medium, shaken at 200 rpm, at 30? C., and induced overnight with IPTG having a concentration of 0.1 mM. Then the strains were collected. Cells were resuspended in phosphate buffered (50 mM, pH 7.0), then were homogenized and disrupted. The expression effect was analyzed by SDS-PAGE.
Example 3 Synthesis of Compounds 6, 7, and 8
(66) 2,2-dimethyl-5-[2-(2,4,5-trifluorophenyl) acetyl]-[1,3] dioxane-4,6-dione (purchased from Jiangsu Baju Pharmaceutical Co., Ltd.) was suspended in 3 times toluene, and morpholine (1 eq) was slowly added under stirring. The reaction solution was stirred at room temperature for 1 h, and the temperature was raised to 110? C. under reflux for 16 h under nitrogen protection. TLC showed the reaction was complete and HPLC showed the starting material<1%. After cooling and concentrating, compound 6 was obtained.
(67) After test: .sup.1HNMR (400 MHz, DMSO-D6) ?7.52-7.45 (m, 1H), 7.40-7.33 (m, 1H), 3.91 (s, 2H), 3.76 (s, 2H), 3.53-3.51 (t, 4H), 3.44-3.42 (d, 2H), 3.41-3.32 (t, 2H).
(68) ##STR00017##
(69) Using the same synthetic method, compounds 7 and 8 were synthesized by replacing morpholine with N-methylpiperazine or piperazine, respectively.
Example 4 Substrate Profiles of Transaminase Amino Donors
(70)
1-(3-(trifluoromethyl)-5,6-dihydro-[1,2,4] triazolo[4,3-a] pyrazine-7 (8H)-yl)-4-(2,4,5-trifluorophenyl) butane-1,3-dione+amino donor.fwdarw.(3R)-3-amino-1-[3-(trifluoromethyl)-5,6-dihydro-1,2,4-triazolo[4,3-a] pyrazine-7 (8H)-yl]-4-(2,4,5-trifluorophenyl) butan-1-one+carbonyl compound of an amino donor after deaminationReaction Formula:
(71) Reaction Conditions:
(72) In 1 ml of 0.2M TEA-HCl buffer (pH 8.0), 0.1 ml of DMSO, 0.1 ml of 20 mM pyridoxal phosphate, 25 mg of 1-(3-(trifluoromethyl)-5,6-dihydro-[1,2,4] triazolo[4,3-a] pyrazine-7(8H)-yl)-4-(2,4,5-trifluorophenyl) butane-1,3-dione, 20 mg of amino donor, 0.5 ml of transaminase (with a protein concentration of 20 mg/mL) were added. After reacting at 45? C. for 6 hours, the reaction was terminated with acetonitrile. The conversion rates of the amino donors in the reaction systems were detected (see Table 2).
(73) TABLE-US-00004 TABLE 2 Conversion rates of different amino donors Amino donor conversion rate ?-Phenethylamine 31% ?-aminobutyric acid 2% Glycine 0 Alanine 3.6% Isopropylamine 35%
Example 5 Substrate Profiles of Transaminase Amino Receptors
(74)
Isopropylamine+amino receptor.fwdarw.acetone+amino compound of an amino receptor after ammonificationReaction Formula:
(75) Reaction Conditions:
(76) In 1 ml of 0.2M TEA-HCl buffer (pH 8.0), 0.1 ml of DMSO, 0.1 ml of 20 mM pyridoxal phosphate, 0.2 ml of 4M isopropylamine (pH 8.0), 20 mg of amino acceptor, 0.5 ml of transaminase (with a protein concentration of 20 mg/mL) were added. After reacting at 45? C. for 6 hours, the reaction was terminated with acetonitrile. The conversion rates of the amino receptors in the reactions were detected (see Table 3).
(77) TABLE-US-00005 TABLE 3 Conversion rates of different amino receptors Conversion Product Amino receptor rate ee value configuration
Example 6 Further Synthesis of Sitagliptin from Compound 6a
(78) Compound 6a after test: .sup.1111\1 MR (400 MHz, DMSO-D6) ?7.46-7.38 (m, 2H), 3.53-3.49 (m, 4H), 3.40-3.37 (t, 4H), 3.24-3.21 (t, 1H), 2.66-2.52 (d, 1H), 2.54-2.52 (d, 1H), 2.31-2.30 (d, 2H), 1.56 (s, 2H).
(79) Aqueous solution of lithium hydroxide (2-3 eq lithium hydroxide, 3 times of water) was prepared and compound 6a was added. After heating to 95? C., the reaction lasted for about 16 h. TLC showed that the basic reaction was completed. After cooling, dichloromethane was used for extraction and the raw materials were recovered. Slowly adjust the pH to 5.5-5.8 (<10? C.) with concentrated hydrochloric acid in the aqueous phase ice bath. Pale yellow solid of (R)-3-amino-4-(2,4,5-trifluorophenyl) butyric acid was obtained after filtration, washing and drying.
(80) (R)-3-amino-4-(2,4,5-trifluorophenyl) butyric acid was dissolved in 20 times aqueous solution of sodium hydroxide (10 eq NaOH), and boc anhydride (Di-tert-butyl dicarbonate) was added dropwise (3 eq) at a controlled temperature of 25?3? C., and continued the adding dropwise (0.3 eq) at 25-30? C. to use up the raw materials. HPLC was used to track the raw materials until they were <0.5%. The impurities were extracted twice with 5 times dichloromethane, and the dichloromethane was mixed and washed twice with water. After mixing the aqueous phases, the pH was adjusted to 2.5-3.0 at 10-20? C. with IN hydrochloric acid. After filtration, it was beaten with 50 times water. HPLC detection showed the single impurities were <0.1%. After vacuum drying at 20-25? C., the product Boc-(R)-3-amino-4-(2,4,5-trifluorophenyl) butyri acid was obtained.
(81) ##STR00027##
(82) The above detailed description of the invention is intended to enable the skilled in the art to understand and implement the content of the invention, but not to limit the protection scope of the invention. Any equivalent change or modification according to the spiritual essence of the invention should be within the protection scope of the present invention.
(83) All literatures mentioned in the present application are incorporated herein by reference, as though each one is individually incorporated by reference. In addition, it should also be understood that, after reading the above teachings of the present invention, those skilled in the art can make various changes or modifications, equivalents of which falls in the scope of claims as defined in the appended claims.