CIS-REPLICON CONSTRUCT
20240123049 ยท 2024-04-18
Assignee
Inventors
- Shoutao ZHANG (Zhengzhou, Henan, CN)
- Qiang MA (Zhengzhou, Henan, CN)
- Qingnan TIAN (Zhengzhou, Henan, CN)
- Tian WANG (Zhengzhou, Henan, CN)
- Yonghui HUANG (Zhengzhou, Henan, CN)
- Guotao LIU (Zhengzhou, Henan, CN)
- Zhen TIAN (Zhengzhou, Henan, CN)
Cpc classification
C12N2770/20034
CHEMISTRY; METALLURGY
C12N9/127
CHEMISTRY; METALLURGY
C12N15/64
CHEMISTRY; METALLURGY
C12Y207/07048
CHEMISTRY; METALLURGY
C12N2770/36143
CHEMISTRY; METALLURGY
A61K2039/55555
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
C12N2770/36122
CHEMISTRY; METALLURGY
International classification
Abstract
Provided is a new-type cis-replicon construct for efficiently expressing a target protein, which comprises an RNA polymerase coding unit and a target protein coding unit. The replicon construct can drive the replication of the target protein coding unit and reduce or avoid the replication and expression of the RNA polymerase, thereby effectively improving the expression of the target protein and reducing the expression of the non-target protein.
Claims
1. An expression construct of cis-replicon, comprising an RNA polymerase coding unit and a target protein coding unit, wherein the RNA polymerase coding unit comprises a nucleic acid fragment encoding an RNA polymerase, and the target protein coding unit comprises an insertion site (such as a multiple cloning site) for a target protein coding fragment and/or a nucleic acid fragment encoding the target protein; and the construct is capable of expressing the RNA polymerase and replicating itself dependent on the RNA polymerase in a target cell to provide a template for expressing the target protein; preferably, the replication of the target protein coding unit is more efficiently than the replication of the RNA polymerase coding unit; and more preferably, only the target protein coding unit is replicated.
2. The expression construct according to claim 1, which is DNA or RNA, preferably RNA, including single-stranded RNA or double-stranded RNA, such as single-stranded RNA, particularly positive strand (+) single-stranded RNA.
3. The expression construct according to claim 1, which is linear or circular; particularly, the construct is a linear RNA, wherein a 5 cap structure or an IRES sequence is provided in the 5 end of the RNA to drive translation of downstream coding sequence; or the construct is a circular RNA, wherein an IRES sequence is provided upstream of the RNA polymerase coding unit to drive translation of the RNA polymerase coding unit.
4. The expression construct according to claim 1, comprising replication initiating elements located both upstream and downstream of the target protein coding unit, wherein the replication initiating elements dependent on the RNA polymerase for the replication of the target protein coding unit; wherein the RNA polymerase coding unit is preferably not located between the upstream replication initiating element and downstream replication initiating element.
5. The expression construct according to claim 4, wherein the upstream replication initiating element comprises a CSE1 and/or CSE3 sequence, preferably CSE1 and CSE3 sequences, and more preferably CSE1, CSE2 and CSE3 sequences; and/or the downstream replication initiating element comprises a CSE4 sequence.
6. The expression construct according to claim 1, wherein the target protein coding unit is located downstream or upstream of the RNA polymerase coding unit.
7. The expression construct according to claim 1, wherein the target protein coding unit is located upstream of the RNA polymerase coding unit, and the target protein and the RNA polymerase are expressed as a fusion protein with a linker between the target protein and the RNA polymerase, wherein the linker comprises a fragment encoding a protease recognition site, and the RNA polymerase is released after the fusion protein is recognized and cleaved by a protease; and preferably, the protease recognition site is a 2A peptide sequence.
8. The expression construct according to claim 1, wherein the target protein coding unit is located upstream of the RNA polymerase coding unit, and an IRES sequence is provided between the target protein coding unit and the RNA polymerase coding unit to drive translation of the RNA polymerase coding unit.
9. The expression construct according to claim 1, wherein the target protein coding unit is located upstream of the RNA polymerase coding unit, and a self-cleaving HDV-like ribozyme is located between the target protein and the RNA polymerase.
10. The expression construct according to claim 1, wherein the target protein coding unit is located downstream of the RNA polymerase coding unit, wherein the construct, in the 5-3 direction, comprises a 5 cap structure or an IRES sequence to drive translation of downstream coding sequence, the RNA polymerase coding unit, the upstream replication initiating element, the target protein coding unit and the downstream replication initiating element.
11. The expression construct according to claim 10, wherein the construct, in the 5-3 direction, comprises (1) a 5 UTR sequence comprising a 5 cap structure; (2) one or more nucleotide sequences encoding the RNA polymerase; (3) a 5 end recognition sequence and a subgenomic promoter (SGP) that guide the replication of the RNA replicon; (4) a multiple cloning site and/or a target gene or heterologous nucleotide sequence controlled by the subgenomic promoter; (5) a 3 end recognition sequence that guides the replication of the RNA replicon; and (6) a 3 UTR and 3 polyA that ensure the stability of RNA and the effective replication of the target gene.
12. The expression construct according to claim 1, which is DNA, wherein a subgenomic promoter (SGP) is located upstream of the RNA polymerase coding unit.
13. The expression construct according to claim 1, wherein the RNA polymerase is a viral replicase, particularly a replicase of an alphavirus, preferably, the alphavirus is selected from the group consisting of Semliki Forest virus, Barmah Forest virus, Chikungunya virus, O'nyong'nyong virus, Ross River virus, Bebaru virus, Getah virus, Sagiyama virus, Mayaro virus, Una virus, Venezuelan equine encephalitis complex or Venezuelan equine encephalitis virus, Cabassou virus, Everglades virus, Mucambo virus, Tonate virus, Pixuna virus, Mosso das pedras virus, Rio Negro virus, Western equine encephalitis complex or Western equine encephalitis virus, Sindbis virus, Aura virus, Whataroa virus, Highlands J virus, Fort Morgan virus, Buggy Creek virus, Eastern equine encephalitis virus, Middelburg virus, Trocara virus, Kyzylagach virus, Ndumu virus, Babanki virus, Norwegian salmonid alphavirus, Salmon pancreatic disease virus, sleeping disease virus and Southern elephant seal virus; and more preferably, the alphavirus is selected from the group consisting of Semliki Forest virus, Venezuelan equine encephalitis virus, Sindbis virus and Chikungunya virus.
14. The expression construct according to claim 10, wherein the 5 cap structure is a natural 5 cap or a 5 cap analog.
15. The expression construct according to claim 1, comprising a 5 UTR derived from the 5 UTR of any gene or a mutant thereof, preferably a 5 UTR derived from the same virus as which the RNA polymerase derived from.
16. The expression construct according to claim 1, wherein the replication initiating element is capable of being recognized by the RNA polymerase and guiding the replication of the RNA polymerase; and preferably, the replication initiating element and the RNA polymerase are derived from the same virus or from different viruses, more preferably from the same virus.
17. The expression construct according to claim 1, comprising a 3 UTR derived from the 3 UTR of any gene or a mutant thereof, preferably a 3 UTR derived from the same virus as which the RNA polymerase derived from.
18. The expression construct according to claim 1 comprising a 3 poly(A).
19. The expression construct according to claim 11, wherein the subgenomic promoter is derived from the promoter of a viral structural protein, and preferably, the subgenomic promoter and the RNA polymerase are derived from the same virus.
20. A vector comprising or encoding the expression construct according to claim 1.
21. A pharmaceutical composition comprising the expression construct according to claim 1, wherein the target protein is a therapeutic protein.
22. A vaccine composition comprising the expression construct according to claim 1, herein the target protein is an antigen capable of eliciting a protective immune response, such as an antigen derived from humans, animals, plants, viruses, bacteria and/or parasites.
23. A method for expressing a target protein, comprising introducing the expression construct according to claim 1 into a target cell, wherein the target cell expresses the target protein from the construct.
24. A method of immunization comprising inoculating a subject in need thereof with the expression construct according to claim 1.
Description
BRIEF DESCRIPTION OF DRAWINGS
[0081] In order to more clearly illustrate the technical solutions in the embodiments of the present disclosure or the prior art, the accompanying drawings used in the embodiments will be briefly introduced below. Obviously, the accompanying drawings in the following description are only some embodiments of the present disclosure. For those of ordinary skill in the art, other drawings can also be obtained based on these drawings without any creative effort.
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
DETAILED DESCRIPTION
Terms
[0090] The term replicon in the present disclosure refers to a unit capable of independent replication, which comprises one or more elements required for replication and may be DNA or RNA. Cis-replicon means that the elements required for replication are located on the same polynucleotide chain, which can be linear or circular. Trans-replicon means that the elements required for replication are located on different polynucleotide chains.
[0091] The term target protein coding unit in the present disclosure refers to a polynucleotide fragment comprising the target protein coding sequence and/or an insertion site (such as a multiple cloning site) into which a target protein coding sequence is to be inserted. The term RNA polymerase coding unit refers to a polynucleotide fragment comprising an RNA polymerase coding sequence.
[0092] The term replication in the present disclosure refers to the generation of a polynucleotide chain identical to the full length or fragment of a template polynucleotide chain by using RNA polymerase. In some embodiments, the replication involves replication of a sequence between an upstream replication initiating element and a downstream replication initiating element, resulting in multiple identical copies.
[0093] The term replication initiating element in the present disclosure refers to a polynucleotide fragment that can be recognized by RNA polymerase (e.g., viral replicase) and initiates replication.
[0094] The term upstream/downstream of . . . described herein should be understood in the 5-3 direction for a specific polynucleotide sequence to define upstream and downstream.
[0095] Alphavirus
[0096] In the present disclosure, the term alphavirus should be broadly understood and includes any virus particle having the characteristics of an alphavirus. Alphaviruses have characteristics including the presence of (+) strand RNA that encodes genetic information suitable for replication in host cells, including replicase, etc. Further characterization of alphavirus is described in, for example, Strauss & Strauss, Microbiol. Rev., 1994, Vol. 58, pp. 491-562; Gould et al., 2010, Antiviral Res., Vol. 87, pp. 111-124; Jonathan Rupp et al., 2015, J. Gen. Virology, Vol. 96, pp. 2483-2500; Kathryn Carpentier et al., Curr Opin Virol, 2018, Vol. 28, pp. 53-60; Luis Carrasco et al., Viruses, 2018, Vol. 10, p. 70; Rebecca Brown et al., Viruses, 2018, Vol. 10, p. 89; Autumn Holmes et al., PLoS Pathog, 2020, Vol. 16, e1008876, et al. The term alphavirus includes alphaviruses found in nature and any variants or derivatives thereof.
[0097] Alphaviruses found in nature are preferably selected from the group consisting of Semliki Forest virus complex or Semliki Forest virus, Barmah Forest virus, Chikungunya virus, O'nyong'nyong virus, Ross River virus, Bebaru virus, Getah virus, Sagiyama virus, Mayaro virus, Una virus, Venezuelan equine encephalitis complex or Venezuelan equine encephalitis virus, Cabassou virus, Everglades virus, Mucambo virus, Tonate virus, Pixuna virus, Mosso das pedras virus, Rio Negro virus, Western equine encephalitis complex or Western equine encephalitis virus, Sindbis virus, Aura virus, Whataroa virus, Highlands J virus, Fort Morgan virus, Buggy Creek virus, Eastern equine encephalitis virus, Middelburg virus, Trocara virus, Kyzylagach virus, Ndumu virus, Babanki virus, Norwegian salmonid alphavirus, Salmon pancreatic disease virus, sleeping disease virus and Southern elephant seal virus, etc.
[0098] More preferably, the alphavirus is selected from the group consisting of Semliki Forest virus complex or its virus types described above including Semliki Forest virus, Western Equine Encephalitis complex or its virus types described above including Sindbis virus, Venezuelan equine encephalitis complex or its virus types described above including Venezuelan equine encephalitis virus.
[0099] In some embodiments of the present disclosure, the alphavirus is not an alphavirus found in nature, but an alphavirus modified by genetic engineering. Generally, alphaviruses not found in nature are variants or derivatives of alphaviruses found in nature, which differ from alphaviruses found in nature in at least one mutation in the nucleotide sequence (i.e., genomic RNA). Mutations in the nucleotide sequence may be selected from insertions, substitutions or deletions of one or more nucleotides compared to alphaviruses found in nature. A mutation in a nucleotide sequence may or may not be related to a mutation in the polypeptide or protein encoded by the nucleotide sequence. For example, Erkuden Casales et al. used puromycin to screen the double-mutant replicase R649H/P718T of SFV expression vector, which expressed a level of (3-galactose similar to that of the parental vector, and could maintain a stable high expression level during at least 10 passages (Erkuden Casales et al., Virology, 2008, Vol. 376, pp. 242-251). Toey Nivitchanyong et al. performed point mutation on the non-structural protein (nsP) P726S to construct two non-cytopathic and replication-active virus strains of Sindbis virus, TE and 633, which can sustainably express heterologous genes after infecting baby hamster kidney (BHK) cells and Chinese hamster ovary (CHO) cells (Toey Nivitchanyong et al., Virus Res., 2009, Vol. 141, pp. 1-12).
[0100] Characterization of Replicase Constructs
[0101] The genome of alphavirus has 2 open reading frames, and the first ? part near the 5 end encodes four non-structural proteins (nsP1-4) called non-structural regions. In the process of infecting cells, the non-structural proteins at the 5 end are first translated into a large polyprotein, which produces the replicase complex required for RNA replication and transcription, and uses genomic RNA as a template to synthesize the negative strand. This process occurs within 3-4 hours after cell infection, and then only positive strand RNA will be synthesized.
[0102] The cis-replicon RNA construct of the present disclosure contains an open reading frame (ORF) encoding alphavirus replicase. In the present disclosure, nonstructural protein is any one or more individual nonstructural proteins (nsP1, nsP2, nsP3, nsP4) derived from alphavirus, or a polyprotein comprising the polypeptide sequence of more than one nonstructural protein derived from alphavirus, such as nsP1234. In the examples, nonstructural protein refers to nsP123.
[0103] nsP1 is a guanine-7-methyltransferase (also known as a viral cap enzyme) with methyltransferase and guanylyltransferase activities, as well as a membrane anchoring function for the replication complex. Its methyltransferase domain catalyzes the addition of the methyl group of S-adenosylmethionine to the GTP molecule to form a covalent m7GMP-nsP1 intermediate product. After nsP2 removes the 5-?-phosphate on the positive-strand RNA molecule, the m7GMP part is transferred to the RNA molecule by the guanosyltransferase activity of nsP1, forming a 0-type cap structure, m7GpppA (Leevi Kaariainen & Tero Ahola, 2002, Vol. 71, pp. 187-222; Maija K. Pietila et al., 2017, Vol. 234, pp. 44-57; Autumn T. LaPointe et al., mBio., 2018, Vol. 9, pp. e02342-18).
[0104] nsP2 is the largest replicase protein and is an RNA-binding protein with nucleoside-triphosphatase (NTPase), RNA helicase and protease activities, which can open RNA double strands and assist nsP1 protein to complete the capping process. The protease activity of nsP2 also plays an important role in the decomposition of replicase into non-structural proteins (Ellen G. Strauss et al., Virology, 1992, Vol. 191, pp. 932-940; M Gomez de Cedron et al., FEBS Lett, 1999, Vol. 448, pp. 19-22; Leevi Kaariainen & Tero Ahola, 2002, Vol. 71, pp. 187-222; Maija K. Pietila et al., 2017, Vol. 234, pp. 44-57).
[0105] nsP3 is a phosphorylated protein consisting of three domains: N-terminal conserved domain with phosphatase activity and nucleic acid binding ability, alphavirus unique domain (AUD) and C-terminal hypervariable domain (HVD) (Farhana Abu Bakar et al., Viruses., 2018, Vol. 10, p. 71). The function of nsP3 is poorly understood and is known as one of the more mysterious nsPs. In recent years, nsP3 has been found to interact with several host proteins, including stress granule-associated proteins, DEAD-box family proteins, heat shock proteins, and kinases, and may regulate protein poly/mono-ADP ribosylation (Tyler Lark et al., Front Microbiol, 2017, Vol. 8, p. 2652; Maija K. Pietila et al., 2017, Vol. 234, pp. 44-57; Benjamin Gotte et al., Viruses, 2018, Vol. 10, p. 105). Furthermore, nsP3 may also be involved in neurovirulence with Old World alphaviruses such as SFV (Benjamin Gotte et al., Viruses, 2018, Vol. 10, p. 105).
[0106] nsP4 contains an RNA-dependent RNA polymerase (RdRp) domain at the C-terminus and is the most conserved protein in alphaviruses. As the main catalytic core of the alphavirus replication complex, nsP4 forms a replication complex (RC) together with host proteins and other nsPs (such as nsP123+nsP4), and synthesizes (?) strand RNA using the viral (+) strand as a template. After nsP123 is cleaved into nsP1, nsP2 and nsP3, it can form a tetramer with nsP4, which no longer has the function of synthesizing negative-strand RNA, but it can use negative-strand RNA as a template to participate in the replication of genomic RNA and the transcription of 26S subgenomic RNA. Purified nsP4 also has terminal adenylyltransferase activity, which may generate a poly(A) tail at the 3 end of the genome (Maija K. Pietila et al., 2017, Vol. 234, pp. 44-57; Farhana Abu Bakar et al., Viruses., 2018, Vol. 10, p. 71).
[0107] The origin of the replicase is not limited to any particular alphavirus. In a preferred embodiment, the alphavirus replicase is derived from Semliki Forest virus (SFV), including naturally occurring Semliki Forest virus or variants thereof. In an alternative preferred embodiment, the replicase is derived from Sindbis virus (SINV), including naturally occurring Sindbis virus or variants thereof. In an alternative preferred embodiment, the replicase is derived from Venezuelan Equine Encephalitis virus (VEEV), including naturally occurring VEEV or variants thereof.
[0108] UTR
[0109] The term untranslated region or UTR refers to a region that is transcribed but not translated into an amino acid sequence, or the corresponding region in an RNA molecule such as mRNA. The 5 UTR and 3 UTR of alphavirus contain distinct core promoter elements for negative- and positive-strand RNA synthesis. The alphavirus capped 5 UTR contains a promoter element, translational regulatory sequences, and structures of innate immune defense (Jennifer L. Hyde et al., Virus Research, 2015, Vol. 206, pp. 99-107).
[0110] The alphavirus 5 UTR contains core promoter elements that act together with other cis-acting elements downstream and within the 3 UTR to regulate the synthesis of positive- and negative-strands (Kulasegaran Shylini et al., 2009, J Virol., pp. 8327-8339). The adenylated 3 UTR of alphaviruses contains highly conserved viral replication sequence elements, elements that determine cell tropism, and conserved binding regions that affect viral RNA stability (Jennifer L. Hyde et al., Virus Res, 2015, pp. 99-107). The common conserved sequence (CSE) of 19 nucleotides at the end of poly(A) is the promoter for the synthesis of the negative-strand (Kuhn et al., J Virol, 1990, pages 1465-1476), and poly(A) tail and CSE together support the synthesis and efficient translation of the negative-strand, which is a necessary step for virus replication.
[0111] Preferably, the cis-RNA replicon of the present disclosure comprises a 5 UTR of non-viral origin, particularly non-alphavirus origin such as human (3-globin 5 UTR, which can improve translation efficiency while allowing replicase not to amplify the RNA encoding the replicase region. In one embodiment, the RNA comprises a 5 UTR derived from a eukaryote. A 5 UTR according to the present disclosure may comprise any combination of more than one nucleic acid sequence, optionally separated by a linker.
[0112] Preferably, the cis-RNA replicon of the present disclosure comprises a 3 UTR of an alphavirus, and the 3 UTR is active, which can ensure the stability of RNA and the effective replication of the target gene.
[0113] Poly(A) Sequence
[0114] The cis-RNA construct of the present disclosure comprises a 3 poly(A) sequence. During alphavirus replication, the replication complex and the poly(A) tail interact via the poly(A) binding protein (PABP), so the poly(A) tail requires at least 11-12 residues to effectively generate negative-strand RNA. The synthesis of the negative-strand replicates with comparable efficiency on RNA templates with poly(A) tails containing 25 or 34 adenylate residues; however, the efficiency of negative-strand synthesis decreases significantly (>70%) when the tail size is reduced to 20 residues, and decreases further when the tail size is reduced to 10 residues. Deletion of the 3 poly(A) tail severely inhibits the generation of negative-strand RNA. The negative-strand RNA synthesis of a template RNA without a 3 poly(A) tail is only 4% of that of a template RNA containing 25 3-terminal adenine residues (Hardy and Rice, 2005, J Virol, Vol. 79, pp. 4630-4639).
[0115] In addition, the poly(A) sequence also affects the function of RNA stability and protein translation in transfected eukaryotic cells. A 3poly(A) sequence of approximately 120 A nucleotides has been reported to have beneficial effects on RNA levels in transfected eukaryotic cells as well as protein levels translated from the open reading frame upstream of the 3poly(A) sequence (Nadine Bangel-Ruland, J Gene Med, 2013, Vol. 15, pp. 414-426). Furthermore, the use of segmented poly(A), such as poly(A) 2?60_G or poly(A) 2?60_T, can significantly reduce plasmid recombination in E. coli without any negative effect on mRNA half-life and protein expression. This poly(A) tail is characterized in that it consists of at least two A-containing elements, each defined as a nucleotide sequence consisting of 40-60 adenine nucleotides, separated by spacer elements of varying length. Compared to conventional homogeneous poly(A) tails, segmented poly(A) tails have a higher potential in terms of recombinant plasmid and resulting mRNA properties (half-life and translation efficiency) (Zeljka Trepotec et al.; RNA, 2019 25, pp. 507-518).
[0116] According to the present disclosure, in an embodiment, the 3poly(A) sequence comprises or consists essentially of or consists of at least 11, preferably at least 25, preferably at least 34, preferably at least 69, preferably at least 100, and preferably at most 500, preferably at most 400, preferably at most 300, preferably at most 200, especially at most 150 A nucleotides, especially about 120 A nucleotides. In the present disclosure, at least 50%, preferably at least 75%, of the poly(A) sequence are A nucleotides, but the remaining nucleotides are allowed to be nucleotides other than A nucleotides, such as U nucleotides (uridylic acid), G nucleotides (guanylic acid), C nucleotides (cytidylic acid), in order to form a segmented poly(A) tail.
[0117] Codon Optimization
[0118] The use of 3-letter codons for mRNA means that 64 possible codons encode 20 amino acids and a translation stop signal. The degeneracy of the genetic code means that in several triplet genetic codes encoding the same amino acid, the first and second bases are mostly the same, but the third base is different. There are multiple codons for the same amino acid, and since tRNAs randomly recognize codons within the ribosomal A site, codons can be defined as optimal based on the efficiency of selecting a suitable homologous tRNA from the cytoplasmic pool of tRNAs. Codon frequencies used vary across the biological world, and codon bias correlates with tRNA levels in Escherichia coli, Saccharomyces cerevisiae, C. elegans, Drosophila, and eukaryotes (Gavin Hanson et al., Nat Rev Mol Cell Biol., 2018, Vol. 19, pp. 20-30). The main strategy of codon optimization is to increase translation elongation by overcoming constraints associated with species-specific differences in codon utilization and tRNA abundance. There are several methods for redesigning gene coding, such as using biased codons, avoiding rare codons with low utilization rates, simplifying the secondary structure of mRNA after gene transcription, removing motifs that are not conducive to high-efficiency expression, adding motifs that are conducive to high-efficiency expression, and adjusting GC content, etc. In addition to codon usage bias, the combination efficiency of codons also needs to be considered. In most cases, the effect of using only high-frequency codons will not be the best, and the combination of high-frequency and sub-high-frequency codons is considered to be better (Vincent P Mauro et al., BioDrugs., 2018, p. 32, pp. 69-81). In some embodiments of the present disclosure, the codons of the open reading frame contained by the RNA molecule may be different from the corresponding codons from which the open reading frame originated, and will be optimized according to different species, referred to as codon optimization. In summary, codon optimization can be performed on the open reading frames encoding the replicase and the expressed exogenous protein of the present disclosure, respectively.
[0119] Conserved Sequence Element (CSE)
[0120] In the present disclosure, the term conserved sequence element or CSE refers to a nucleotide sequence found in alphavirus RNA. These sequence elements are termed conserved because orthologs exist in the genomes of different alphaviruses, and orthologous CSEs of different alphaviruses preferably share a high percentage of sequence and/or similar secondary or tertiary structure. Four conserved sequence elements (CSEs) are found in the alphavirus genome, which perform specific functions during viral RNA replication. In one embodiment, the replicon according to the present disclosure comprises one or more conserved sequence elements (CSEs) (Strauss & Strauss, Microbiol. Rev., 1994, Vol. 58, pp. 491-562). For example, in Sindbis virus, the first 44 nucleotides of the positive strand 5 UTR form a conserved stem-loop structure, and its complementary sequence is located at the 3 end of the negative strand, which is a promoter for synthesizing positive-strand RNA with negative-strand RNA as a template. CSE2 is a conserved stem-loop structure formed by the front 51 nucleotides of the nsP1 protein coding sequence, and is a co-promoter for synthesizing negative-strand RNA with positive-strand RNA as a template. CSE3 is 24 nucleotides at the end of the nsP4 protein and is a promoter for transcription of subgenomic mRNA. CSE4 is 19 nucleotides at the 3 end of RNA and is a promoter for synthesizing negative-strand RNA with positive-strand RNA as a template (Hardy and Rice, J. Virol., 2005, Vol. 79, pp. 4630-4639).
[0121] In an embodiment, the alphavirus 5 replication recognition sequence and the alphavirus 3 replication recognition sequence are capable of guiding the replication of the RNA replicon in the presence of replicase. Thus, when present alone or preferably together, these recognition sequences guide the replication of the RNA replicon in the presence of replicase. Without wishing to be bound by any particular theory, it is understood that alphavirus conserved sequence elements are recognition sequences that guide RNA replicon replication in the presence of replicase. In an embodiment, the replicon recognition sequences are generally referred to as CSE 1 and 2. Furthermore, in an alternative embodiment, the replicase and conserved sequence elements may be from different alphaviruses.
[0122] CSE-1, CSE-2, CSE-3 and CSE-4 described herein include variants thereof that retain their ability to initiate replication.
[0123] Subgenomic Promoter (SGP)
[0124] In the present disclosure, the term subgenomic promoter or SGP refers to a nucleic acid sequence 5 upstream of a nucleic acid sequence (e.g., a coding sequence), which controls the transcription of the nucleic acid sequence by providing a recognition and binding site for replicase. In a particular embodiment, the RNA replicon according to the present disclosure comprises a subgenomic promoter. The SGP described herein includes variants thereof that retain their ability to initiate transcription of downstream genes.
[0125] Preferably, the replicase encoded by the present replicon is an alphavirus replicase capable of recognizing a subgenomic promoter.
[0126] Preferably, the subgenomic promoter according to the present disclosure is the promoter of the alphavirus structural protein, comprising highly conserved CSE3 in the alphavirus, that is, at least 24 nucleotides at the end of the non-structural protein nsP4 (taking Sindbis virus as an example), which can effectively initiate the transcription of subgenomic RNA. In some embodiments, the SGP is the same as or overlaps with or comprises CSE3.
[0127] Heterologous Nucleic Acid Sequence
[0128] In one embodiment, the cis-replicon RNA comprises at least one nucleic acid sequence not derived from an alphavirus. According to the present disclosure, the term heterologous or exogenous refers to the situation where the nucleic acid sequence is not homologous to the alphavirus genome nucleic acid sequence. Preferably, the heterologous nucleic acid sequence is under the control of an alphavirus subgenomic promoter. More preferably, the heterologous nucleic acid sequence is located downstream of a subgenomic promoter. The alphavirus subgenomic promoter is very efficient and thus suitable for high levels of heterologous gene expression (Kenneth Lundstrom, Molecules, 2018, Vol. 23, p. 3310).
[0129] Target Protein
[0130] The target protein referred to herein is the protein encoded by the target gene coding unit. In one embodiment, the RNA replicon according to the present disclosure comprises an open reading frame encoding a target peptide or target protein. Preferably, the target protein is encoded by a heterologous nucleic acid sequence. Preferably, the target gene is under the control of a subgenomic promoter. More preferably, the target gene is located downstream of a subgenomic promoter.
[0131] The term internal ribosome entry site (IRES) in the present disclosure refers to a sequence that can recruit ribosomes to initiate translation of downstream genes, and can mediate the internal initiation of translation when present between two coding sequences.
[0132] The replicon provided by the present disclosure may encode single or multiple proteins. Multiple proteins can be encoded as fusion expressed proteins or separately expressed proteins. For separately expressed proteins, one or more of these proteins can be provided with an upstream IRES, or the ORFs of multiple proteins can be constructed in the replicon while keeping each ORF under the control of a subgenomic promoter. In addition, an autocatalytic protease such as foot-and-mouth disease virus 2A protein can also be added to these proteins for separation (Strauss & Strauss, Microbiol. Rev., 1994, volume 58, pp. 491-562).
[0133] The term 2A peptide or 2A self-cleaving peptide in the present disclosure refers to a fragment of about 18-22 amino acids, which can induce self-cleavage of recombinant proteins containing 2A peptide in cells. In some embodiments of the present disclosure, the nucleic acid fragment encoding the 2A peptide is present between the target gene coding unit and the RNA polymerase coding unit.
[0134] The term HDV-like ribozyme or Hepatitis Delta Virus (HDV) ribozyme (HDVr) in the present disclosure refers to a class of ribozymes with self-cleavage function. The HDV ribozyme catalyzes the cleavage of the phosphodiester bond between the substrate nucleotide or oligonucleotide and the 5-hydroxyl of the ribozyme, thereby breaking the host polynucleotide strand from the cleavage site. In some embodiments of the present disclosure, the HDV-like ribozyme is present between the target gene coding unit and the RNA polymerase coding unit.
[0135] The target protein encoded by the replicon of the present disclosure may also be an immunogenic compound or an antigenic epitope or cytokine for therapeutic or protective purposes. The term antigen or immunogen refers to a substance capable of eliciting the production of antibodies, any substance capable of eliciting an immune response. Antigens are preferably products derived from naturally occurring antigens, such as from allergens, viruses, bacteria, fungi, parasites and other infectious agents and pathogens, and tumor antigens. The term cytokine refers to a class of small molecular proteins with a wide range of biological activities that are synthesized and secreted by immune cells (such as monocytes, macrophages, T cells, B cells, NK cells, etc.) and certain non-immune cells (endothelial cells, epidermal cells, fibroblasts, etc.) upon stimulation, including interleukins, interferons, tumor necrosis factor superfamily, colony-stimulating factors, chemokines, growth factors, etc.
[0136] When a biological entity (such as replicase, virus, subgenomic promoter (SGP)) is used herein, the meaning includes not only its wild-type form, but also variant forms that retain the function of the biological entity.
[0137] Safety Features of Embodiments of the Present Disclosure
[0138] Preferably, the system of the present disclosure does not contain any alphavirus structural proteins, such as capsid protein C, membrane glycoproteins E1, E2 and E3, and 6K protein.
[0139] Preferably, after the host cell is inoculated with the cis-replicon RNA of the present disclosure, the host cell does not produce virus particles, e.g., progeny virus particles.
[0140] Preferably, the replicon cannot drive the replication of the replicase itself, but can only drive the replication of the target gene RNA.
[0141] DNA of the Present Disclosure
[0142] The present disclosure provides DNA encoding the replicon of the present disclosure. In a preferred embodiment, the DNA provided by the present disclosure is a plasmid. As used herein, the term plasmid refers to a DNA molecule outside the chromosome (or nucleoid) in organisms such as bacteria, yeast and actinomycetes, which has the ability to replicate autonomously and expresses the genetic information it carries, and is a closed circular double-stranded DNA molecules.
[0143] Methods for Preparing RNA
[0144] Any RNA molecule according to the present disclosure can be obtained by in vitro transcription. In vitro transcribed RNA (IVT-RNA) can be obtained by in vitro transcription from nucleic acid molecules, especially DNA molecules. The 5 cap can be obtained by adding a cap-analogue to an in vitro transcription reaction, and the poly(A) tail is encoded by a poly(dT) sequence on the DNA template. Alternatively, capping and poly(A) tailing can also be achieved by enzymatic reactions after the transcripts are obtained. In vitro transcription methods are known to those skilled in the art, and various in vitro transcription kits are commercially available.
[0145] Vaccine Adjuvant
[0146] In some embodiments, the immunostimulatory properties of mRNA can be improved by adding adjuvants to enhance the efficacy of mRNA vaccines. These approaches include using traditional adjuvants as well as novel approaches that exploit the inherent immunogenicity of mRNA or the immunomodulatory proteins it encodes. The compositions of the present disclosure may comprise one or more adjuvants.
[0147] Adjuvants can be added to vaccines to stimulate an immune system response. Exemplary adjuvants include but are not limited to biological adjuvants such as mycobacteria (Mycobacterium tuberculosis, bacille Calmette-Gu?rin (BCG)), Corynebacterium parvum, Bordetella pertussis, gram-negative bacillus endotoxin, interleukin-1, interleukin-2, interleukin-12, interferon-?, etc.; inorganic adjuvants such as aluminum hydroxide, alum, aluminum phosphate, etc.; synthetic adjuvants such as double-chain polyinosinic acid, cytidylic acid, double-chain polyadenosine acid, etc.; oil agents such as peanut oil emulsified adjuvant, mineral oil, vegetable oil, lanolin, etc.; and immune activation proteins such as CD70, CD40L and TLR4, etc.
[0148] RNA Drug Delivery System
[0149] Cell membranes are mainly composed of a lipid bilayer of zwitterionic and negatively charged phospholipids, where the polar heads of the phospholipids point towards the aqueous environment and the hydrophobic tails form the hydrophobic core. Various ion pumps and ion channels help maintain a negative potential (?40 to ?80 mV) across the cell membrane to control the balance of most essential metal ions such as K.sup.+, Na.sup.+, Ca.sup.+ and Mg.sup.+. RNA must cross the cell membrane to reach the cytoplasm, and the negative potential across the cell membrane creates a strong barrier for highly negatively charged RNA molecules. In addition to the cell membrane barrier, RNA also faces the problem of degradation of extracellular ribonucleic acid present in large quantities in the skin and blood. Naked RNA molecules are rapidly degraded in organisms, do not accumulate in target tissues after systemic administration, and cannot penetrate target cells even if they reach target tissues, so a delivery system is required.
[0150] In an embodiment, the RNA pharmaceutical composition of the present disclosure comprises at least one cation-containing complex. The pharmaceutical composition according to the present disclosure can be encapsulated in polyplex (PP), lipoplex (LP), lipid nanoparticle (LNP), or cationic nanoemulsion (CNE).
[0151] In a preferred embodiment of the present disclosure, polymer is, for example, polyplex (PP), which is formed by electrostatic interaction of polyethyleneimine (PEI) with negatively charged nucleic acids. PEI is a group of linear or branched polyethylenimine polymers that have a strong affinity for nucleic acids and have a proton sponge effect that promotes endosomal escape, protecting nucleic acids from enzymatic degradation (Thomas D?moulins et al., Nanomedicine, 2016, Vol. 12, pp. 711-722).
[0152] In a preferred embodiment of the present disclosure, negatively charged mRNA and positively charged cationic liposomes are assembled through electrostatic interaction to form a multilayer vesicular complex, namely lipoplex (LP), in which the encapsulated mRNA is not easily degraded by RNase and can be successfully delivered into cells. DOTAP (1,2-dioleoyloxy-3-(trimethyl ammonium)propane), DOPE (1,2-dioleoyl-sn-glycero-3-phosphoethanol amine) and DOTMA (N-(1-(2,3-dioleyloxy)propyl)-N,N,N-trimethylammonium) are proven effective delivery vehicles. Cationic lipids are commonly used in mRNA vaccinations because they not only encapsulate mRNA, but can also be used as immunogens and are considered as adjuvants for vaccines (Yasmin Granot et al., Seminars in Immunology, 2017, Vol. 34, No. pp. 68-77).
[0153] In a preferred embodiment of the present disclosure, the mRNA is present in a lipid nanoparticle (LNP), which typically comprises (1) an ionizable or cationic lipid or polymeric material with tertiary amines or quaternary amines, which can promote self-assembly into virus-sized (?100 nm) particles, is used to encapsulate polyanionic mRNA and allows endosomes to release mRNA into the cytoplasm; (2) an auxiliary phospholipid, which is generally a zwitterionic lipid, such as DSPC (1,2-distearoyl-sn-glycero-3-phosphocholine), DOPE (1,2-dioleoyl-sn-glycero-3-phosphoethanolamine) or POPE (1-palmitoyl-2-oleoylphosphatidylethanolamine). Auxiliary phospholipids serve as the backbone of liposomes, similar to lipids in cell membranes, and contribute to the formation and disruption of lipid bilayers to facilitate endosomal escape. Some phospholipids have polymorphic characteristics, which can change from lamellar to hexagonal phase when entering endosomes, and promote the release of mRNA from liposomes; (3) cholesterol, to stabilize the lipid bilayer of LNP and improve particle stability, which enhances the stability of particles and promotes membrane fusion; (4) lipid-linked polyethylene glycol (PEG), making nanoparticles have a hydration layer and improves colloidal stability, which can reduce non-specific interactions with serum proteins, circumvent absorption through the reticuloendothelial system and prolong the half-life of formulations (Norbert Pardi et al., 2018, Nat Rev Drug Discov., Vol. 17, pp. 261-279; Piotr S. Kowalski et al., Mol Ther, 2019, p. 27 vol., pp. 710-728).
[0154] In a preferred embodiment of the present disclosure, the mRNA is present in a cationic nanoemulsion (CNE) made of squalene, nonionic sorbitan ester surfactant, sorbitan trioleate (Span 85) or sorbitan monostearate (Span 60), cationic lipid DOTAP, etc., which can be used in the preparation of vaccines (Jesse H. Erasmus et al., Mol Ther., 2018, Vol. 26, pp. 2507-2522).
[0155] Methods for Producing Protein
[0156] The present disclosure provides a method for producing a protein in a cell comprising steps of: obtaining an RNA construct for expressing an exogenous protein comprising a 5 cap for driving translation of the replicase, a 3poly(A) for enhancing mRNA stability, and an open reading frame encoding the exogenous protein, and transfecting the RNA construct into the cell.
[0157] In the method of the present disclosure, any system according to the present disclosure, or a kit according to the present disclosure, or a pharmaceutical composition according to the present disclosure may be used. The RNA can be used in the form of a pharmaceutical composition, or as naked RNA, for example, for electroporation or lipofection, and the like.
[0158] The present disclosure provides a method for producing a protein in an organism, comprising the steps of: obtaining an RNA construct for expressing an exogenous protein comprising a 5 cap for driving translation of the replicase, a 3 poly(A) for enhancing mRNA stability, and an open reading frame encoding the exogenous protein, and administering to a subject in need thereof the RNA construct. The medicaments of the present disclosure can be used in prophylactic as well as therapeutic methods of treating a subject.
[0159] Vaccination
[0160] The term immunization or vaccination generally refers to the process of treating a subject for therapeutic or prophylactic reasons. Treatment, especially prophylactic treatment, is preferably or is intended to include treatment aimed at inducing or enhancing an immune response in a subject against one or more antigens. According to the present disclosure, if it is desired to induce or enhance an immune response by using RNA as described herein, the immune response may be elicited or enhanced by RNA. In one embodiment, the present disclosure provides prophylactic treatment, which preferably is or includes vaccination of a subject. One embodiment of the present disclosure is particularly suitable for vaccination, wherein the replicon encodes as target protein a pharmaceutically active peptide or protein, which is an immunologically active compound or antigen. The medicaments of the present disclosure can be administered to a subject, e.g., for treatment of a subject, including vaccination of a subject. The term subject relates to vertebrates, especially mammals including humans.
[0161] Administration Method
[0162] A medicament of the present disclosure may be administered to a subject by any suitable route.
[0163] For example, the medicament could be administered systemically, and administration can be performed in various ways, such as intravenously, subcutaneously, intradermally, intramuscularly or by inhalation. Alternatives for administration to muscle tissue or skin include, but are not limited to, intradermal, intranasal, intraocular, intraperitoneal, intravenous, interstitial, buccal, transdermal or sublingual administration, and the like.
Examples
I. Materials and Methods
[0164] (1) Construction of DNA Vectors Carrying a Trans-Replicon, a Traditional Cis-Replicon and a Cis-Replicon of the Present Disclosure
[0165] The sequences of some elements used in the example are as follows:
TABLE-US-00001 5capstructure:7-methylguanosinecapstructure (m7Gppp,Cap0) 5UTR(derivedfromhumanalphaglobin): (SEQIDNO:1) actcttctggtccccacagactcagagagaacccacc CSE1(derivedfromSemlikiForestVirus(SFV)of thealphavirusgenus): (SEQIDNO:2) atggcggatgtgtgacatacacgacgccaaaagattttgttccag CSE2(derivedfromSemlikiForestVirus(SFV)of thealphavirusgenus): (SEQIDNO:3) gcaggtcacaccaaatgaccatgcaaatgccagagcattttcgcacctg gc SGP(CSE3)(derivedfromSemlikiForestVirus (SFV)ofthealphavirusgenus): (SEQIDNO:4) acctctacggoggtcctag CSE4(derivedfromSemlikiForestVirus(SFV)of thealphavirusgenus): (SEQIDNO:5) attggtttttaatatttcc 3UTR(derivedfromSemlikiForestVirus(SFV) ofthealphavirusgenus): (SEQIDNO:6) gttagggtaggcaatggcattgatatagcaagaaaattgaaaacagaaa aagttagggtaagcaatggcatataaccataactgtataacttgtaaca aagcgcaacaagacctgcgcaattggccccgtggtccgcctcacggaaa ctcggggcaactcatattgacacattaattggcaataattggaagctta cataagcttaattcgacgaataattggatttttattttattttgcaatt ggtttttaatatttcc
[0166] Replicase (derived from Semliki Forest Virus (SFV) of the alphavirus genus), its amino acid sequence is:
TABLE-US-00002 (SEQIDNO:7) MAAKVHVDIEADSPFIKSLQKAFPSFEVESLQVTPNDHANARAFSHLAT KLIEQETDKDTLILDIGSAPSRRMMSTHKYHCVCPMRSAEDPERLVCYA KKLAAASGKVLDREIAGKITDLQTVMATPDAESPTFCLHTDVTCRTAAE VAVYQDVYAVHAPTSLYHQAMKGVRTAYWIGFDTTPFMFDALAGAYPTY ATNWADEQVLQARNIGLCAASLTEGRLGKLSILRKKQLKPCDTVMFSVG STLYTESRKLLRSWHLPSVFHLKGKQSFTCRCDTIVSCEGYVVKKITMC PGLYGKTVGYAVTYHAEGFLVCKTTDTVKGERVSFPVCTYVPSTICDQM TGILATDVTPEDAQKLLVGLNQRIVVNGRTQRNTNTMKNYLLPIVAVAF SKWAREYKADLDDEKPLGVRERSLTCCCLWAFKTRKMHTMYKKPDTQTI VKVPSEFNSFVIPSLWSTGLAIPVRSRIKMLLAKKTKRELIPVLDASSA RDAEQEEKERLEAELTREALPPLVPIAPAETGVVDVDVEELEYHAGAGV VETPRSALKVTAQPNDVLLGNYVVLSPQTVLKSSKLAPVHPLAEQVKII THNGRAGRYQVDGYDGRVLLPCGSAIPVPEFQALSESATMVYNEREFVN RKLYHIAVHGPSLNTDEENYEKVRAERTDAEYVFDVDKKCCVKREEASG LVLVGELTNPPFHEFAYEGLKIRPSAPYKTTVVGVFGVPGSGKSAIIKS LVTKHDLVTSGKKENCQEIVNDVKKHRGLDIQAKTVDSILLNGCRRAVD ILYVDEAFACHSGTLLALIALVKPRSKVVLCGDPKQCGFFNMMQLKVNF NHNICTEVCHKSISRRCTRPVTAIVSTLHYGGKMRTTNPCNKPIIIDTT GQTKPKPGDIVLTCFRGWVKQLQLDYRGHEVMTAAASQGLTRKGVYAVR QKVNENPLYAPASEHVNVLLTRTEDRLVWKTLAGDPWIKVLSNIPQGNF TATLEEWQEEHDKIMKVIEGPAAPVDAFQNKANVCWAKSLVPVLDTAGI RLTAEEWSTIITAFKEDRAYSPVVALNEICTKYYGVDLDSGLFSAPKVS LYYENNHWDNRPGGRMYGFNAATAARLEARHTFLKGQWHTGKQAVIAER KIQPLSVLDNVIPINRRLPHALVAEYKTVKGSRVEWLVNKVRGYHVLLV SEYNLALPRRRVTWLSPLNVTGADRCYDLSLGLPADAGRFDLVFVNIHT EFRIHHYQQCVDHAMKLQMLGGDALRLLKPGGSLLMRAYGYADKISEAV VSSLSRKFSSARVLRPDCVTSNTEVFLLFSNFDNGKRPSTLHQMNTKLS AVYAGEAMHTAGCAPSYRVKRADIATCTEAAVVNAANARGTVGDGVCRA VAKKWPSAFKGEATPVGTIKTVMCGSYPVIHAVAPNFSATTEAEGDREL AAVYRAVAAEVNRLSLSSVAIPLLSTGVFSGGRDRLQQSLNHLFTAMDA TDADVTIYCRDKSWEKKIQEAIDMRTAVELLNDDVELTTDLVRVHPDSS LVGRKGYSTTDGSLYSYFEGTKFNQAAIDMAEILTLWPRLQEANEQICL YALGETMDNIRSKCPVNDSDSSTPPRTVPCLCRYAMTAERIARLRSHQV KSMVVCSSFPLPKYHVDGVQKVKCEKVLLFDPTVPSVVSPRKYAASTTD HSDRSLRGFDLDWTTDSSSTASDTMSLPSLQSCDIDSIYEPMAPIVVTA DVHPEPAGIADLAADVHPEPADHVDLENPIPPPRPKRAAYLASRAAERP VPAPRKPTPAPRTAFRNKLPLTFGDFDEHEVDALASGITFGDFDDVLRL GRAGAYIFSSDTGSGHLQQKSVRQHNLQCAQLDAVEEEKMYPPKLDTER EKLLLLKMQMHPSEANKSRYQSRKVENMKATVVDRLTSGARLYTGADVG RIPTYAVRYPRPVYSPTVIERFSSPDVAIAACNEYLSRNYPTVASYQIT DEYDAYLDMVDGSDSCLDRATFCPAKLRCYPKHHAYHQPTVRSAVPSPF QNTLQNVLAAATKRNCNVTQMRELPTMDSAVFNVECFKRYACSGEYWEE YAKQPIRITTENITTYVTKLKGPKAAALFAKTHNLVPLQEVPMDRFTVD MKRDVKVTPGTKHTEERPKVQVIQAAEPLATAYLCGIHRELVRRLNAVL RPNVHTLFDMSAEDFDAIIASHFHPGDPVLETDIASFDKSQDDSLALTG LMILEDLGVDQYLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTL FINTVLNITIASRVLEQRLTDSACAAFIGDDNIVHGVISDKLMAERCAS WVNMEVKIIDAVMGEKPPYFCGGFIVFDSVTQTACRVSDPLKRLFKLGK PLTAEDKQDEDRRRALSDEVSKWFRTGLGAELEVALTSRYEVEGCKSIL IAMATLARDIKAFKKLRGPVIHLYGGPRLVR
[0167] (1) The DNA sequences of each fragment required for the construction of the replicon in the present disclosure were synthesized by Sangon Bioengineering (Shanghai) Co., Ltd., and inserted into the mammalian expression vector pVAX1 (purchased from Invitrogen) by homologous recombination to construct pVAX1-cis-SFV-neo cis-replicon plasmid (the structure is shown in
[0168] The pVAX1-cis-SFV-neo obtained after construction contains the following sequence:
TABLE-US-00003 5UTR: (SEQIDNO:8) actcttctggtccccacagactcagagagaacccacc NSP1: (SEQIDNO:9) atggccgccaaagtgcatgttgatattgaggctgacagcccattcatcaagtctttgcagaaggcatttccgtcgttcgaggtggagtcattgc aggtcacaccaaatgaccatgcaaatgccagagcattttcgcacctggctaccaaattgatcgagcaggagactgacaaagacacactcatc ttggatatcggcagtgcgccttccaggagaatgatgtctacgcacaaataccactgcgtatgccctatgcgcagcgcagaagaccccgaaa ggctcgtatgctacgcaaagaaactggcagcggcctccgggaaggtgctggatagagagatcgcaggaaaaatcaccgacctgcagacc gtcatggctacgccagacgctgaatctcctaccttttgcctgcatacagacgtcacgtgtgtacggcagccgaagtggccgtataccagga cgtgtatgctgtacatgcaccaacatcgctgtaccatcaggcgatgaaaggtgtcagaacggcgtattggattgggtttgacaccaccccgttt atgtttgacgcgctagcaggcgcgtatccaacctacgccacaaactgggccgacgagcaggtgttacaggccaggaacataggactgtgt gcagcatccttgactgagggaagactcggcaaactgtccattctccgcaagaagcaattgaaaccttgcgacacagtcatgttctcggtagg atctacattgtacactgagagcagaaagctactgaggagctggcacttaccctccgtattccacctgaaaggtaaacaatcctttacctgtagg tgcgataccatcgtatcatgtgaagggtacgtagttaagaaaatcactatgtgccccggcctgtacggtaaaacggtagggtacgccgtgac gtatcacgcggagggattcctagtgtgcaagaccacagacactgtcaaaggagaaagagtctcattccctgtatgcacctacgtcccctcaa ccatctgtgatcaaatgactggcatactagcgaccgacgtcacaccggaggacgcacagaagttgttagtgggattgaatcagaggatagtt gtgaacggaagaacacagcgaaacactaacacgatgaagaactatctgcttccgattgtggccgtcgcatttagcaagtgggcgagggaat acaaggcagaccttgatgatgaaaaacctctgggtgtccgagagaggtcacttacttgctgctgcttgtgggcatttaaaacgaggaagatgc acaccatgtacaagaaaccagacacccagacaatagtgaaggtgccttcagagtttaactcgttcgtcatcccgagcctatggtctacaggcc tcgcaatcccagtcagatcacgcattaagatgcttttggccaagaagaccaagcgagagttaatacctgttctcgacgcgtcgtcagccagg gatgctgaacaagaggagaaggagaggttggaggccgagctgactagagaagccttaccacccctcgtccccatcgcgccggcggaga cgggagtcgtcgacgtcgacgttgaagaactagagtatcacgcaggtgca NSP2: (SEQIDNO:10) ggggtcgtggaaacacctcgcagcgcgttgaaagtcaccgcacagccgaacgacgtactactaggaaattacgtagttctgtccccgcaga ccgtgctcaagagctccaagttggcccccgtgcaccctctagcagagcaggtgaaaataataacacataacgggagggccggccgttacc aggtcgacggatatgacggcagggtcctactaccatgtggatcggccattccggtccctgagtttcaagctttgagcgagagcgccactatg gtgtacaacgaaagggagttcgtcaacaggaaactataccatattgccgttcacggaccgtcgctgaacaccgacgaggagaactacgag aaagtcagagctgaaagaactgacgccgagtacgtgttcgacgtagataaaaaatgctgcgtcaagagagaggaagcgtcgggtttggtgt tggtgggagagctaaccaaccccccgttccatgaattcgcctacgaagggctgaagatcaggccgtcggcaccatataagactacagtagt aggagtctttggggttccgggatcaggcaagtctgctattattaagagcctcgtgaccaaacacgatctggtcaccagcggcaagaaggag aactgccaggaaatagtcaacgacgtgaagaagcaccgcggactggacatccaggcaaaaacagtggactccatcctgctaaacgggtgt cgtcgtgccgtggacatcctatatgtggacgaggctttcgcttgccattccggtactctgctagccctaattgctcttgttaaacctcggagcaa agtggtgttatgcggagaccccaagcaatgcggattcttcaatatgatgcagcttaaggtgaacttcaaccacaacatctgcactgaagtatgt cataaaagtatatccagacgttgcacgcgtccagtcacggccatcgtgtctacgttgcactacggaggcaagatgcgcacgaccaacccgt gcaacaaacccataatcatagacaccacaggacagaccaagcccaagccaggagacatcgtgttaacatgcttccgaggctgggtaaagc agctgcagttggactaccgtggacacgaagtcatgacagcagcagcatctcagggcctcacccgcaaaggggtatacgccgtaaggcag aaggtgaatgaaaatcccttgtatgcccctgcgtcggagcacgtgaatgtactgctgacgcgcactgaggataggctggtgtggaaaacgct ggccggcgatccctggattaaggtcctatcaaacattccacagggtaactttacggccacattggaagaatggcaagaagaacacgacaaa ataatgaaggtgattgaaggaccggctgcgcctgtggacgcgttccagaacaaagcgaacgtgtgttgggcgaaaagcctggtgcctgtcc tggacactgccggaatcagattgacagcagaggagtggagcaccataattacagcatttaaggaggacagagcttactctccagtggtggc cttgaatgaaatttgcaccaagtactatggagttgacctggacagtggcctgttttctgccccgaaggtgtccctgtattacgagaacaaccact gggataacagacctggtggaaggatgtatggattcaatgccgcaacagctgccaggctggaagctagacataccttcctgaaggggcagt ggcatacgggcaagcaggcagttatcgcagaaagaaaaatccaaccgctttctgtgctggacaatgtaattcctatcaaccgcaggctgccg cacgccctggtggctgagtacaagacggttaaaggcagtagggttgagtggctggtcaataaagtaagagggtaccacgtcctgctggtga gtgagtacaacctggctttgcctcgacgcagggtcacttggttgtcaccgctgaatgtcacaggcgccgataggtgctacgacctaagtttag gactgccggctgacgccggcaggttcgacttggtctttgtgaacattcacacggaattcagaatccaccactaccagcagtgtgtcgaccac gccatgaagctgcagatgcttgggggagatgcgctacgactgctaaaacccggcggcagcctcttgatgagagcttacggatacgccgat aaaatcagcgaagccgttgtttcctccttaagcagaaagttctcgtctgcaagagtgttgcgcccggattgtgtcaccagcaatacagaagtgt tcttgctgttctccaactttgacaacggaaagagaccctctacgctacaccagatgaataccaagctgagtgccgtgtatgccggagaagcca tgcacacggccgggtgt NSP3: (SEQIDNO:11) gcaccatcctacagagttaagagagcagacatagccacgtgcacagaagcggctgtggttaacgcagctaacgcccgtggaactgtaggg gatggcgtatgcagggccgtggcgaagaaatggccgtcagcctttaagggagaagcaacaccagtgggcacaattaaaacagtcatgtgc ggctcgtaccccgtcatccacgctgtagcgcctaatttctctgccacgactgaagcggaaggggaccgcgaattggccgctgtctaccggg cagtggccgccgaagtaaacagactgtcactgagcagcgtagccatcccgctgctgtccacaggagtgttcagcggcggaagagatagg ctgcagcaatccctcaaccatctattcacagcaatggacgccacggacgctgacgtgaccatctactgcagagacaaaagttgggagaaga aaatccaggaagccatagacatgaggacggctgtggagttgctcaatgatgacgtggagctgaccacagacttggtgagagtgcacccgg acagcagcctggtgggtcgtaagggctacagtaccactgacgggtcgctgtactcgtactttgaaggtacgaaattcaaccaggctgctattg atatggcagagatactgacgttgtggcccagactgcaagaggcaaacgaacagatatgcctatacgcgctgggcgaaacaatggacaaca tcagatccaaatgtccggtgaacgattccgattcatcaacacctcccaggacagtgccctgcctgtgccgctacgcaatgacagcagaacgg atcgcccgccttaggtcacaccaagttaaaagcatggtggtttgctcatcttttcccctcccgaaataccatgtagatggggtgcagaaggtaa agtgcgagaaggttctcctgttcgacccgacggtaccttcagtggttagtccgcggaagtatgccgcatctacgacggaccactcagatcgg tcgttacgagggtttgacttggactggaccaccgactcgtcttccactgccagcgataccatgtcgctacccagtttgcagtcgtgtgacatcg actcgatctacgagccaatggctcccatagtagtgacggctgacgtacaccctgaacccgcaggcatcgcggacctggcggcagatgtgc atcctgaacccgcagaccatgtggacctcgagaacccgattcctccaccgcgcccgaagagagctgcataccttgcctcccgcgcggcgg agcgaccggtgccggcgccgagaaagccgacgcctgccccaaggactgcgtttaggaacaagctgcctttgacgttcggcgactttgacg agcacgaggtcgatgcgttggcctccgggattactttcggagacttcgacgacgtcctgcgactaggccgcgcgggtgca NSP4: (SEQIDNO:12) tatattttctcctcggacactggcagcggacatttacaacaaaaatccgttaggcagcacaatctccagtgcgcacaactggatgcggtcgag gaggagaaaatgtacccgccaaaattggatactgagagggagaagctgttgctgctgaaaatgcagatgcacccatcggaggctaataag agtcgataccagtctcgcaaagtggagaacatgaaagccacggtggtggacaggctcacatcgggggccagattgtacacgggagcgga cgtaggccgcataccaacatacgcggttcggtacccccgccccgtgtactcccctaccgtgatcgaaagattctcaagccccgatgtagcaa tcgcagcgtgcaacgaatacctatccagaaattacccaacagtggcgtcgtaccagataacagatgaatacgacgcatacttggacatggtt gacgggtcggatagttgcttggacagagcgacattctgcccggcgaagctccggtgctacccgaaacatcatgcgtaccaccagccgact gtacgcagtgccgtcccgtcaccctttcagaacacactacagaacgtgctagcggccgccaccaagagaaactgcaacgtcacgcaaatg cgagaactacccaccatggactcggcagtgttcaacgtggagtgcttcaagcgctatgcctgctccggagaatattgggaagaatatgctaa acaacctatccggataaccactgagaacatcactacctatgtgaccaaattgaaaggcccgaaagctgctgccttgttcgctaagacccacaa cttggttccgctgcaggaggttcccatggacagattcacggtcgacatgaaacgagatgtcaaagtcactccagggacgaaacacacagag gaaagacccaaagtccaggtaattcaagcagcggagccattggcgaccgcttacctgtgcggcatccacagggaattagtaaggagacta aatgctgtgttacgccctaacgtgcacacattgtttgatatgtcggccgaagactttgacgcgatcatcgcctctcacttccacccaggagacc cggttctagagacggacattgcatcattcgacaaaagccaggacgactccttggctcttacaggtttaatgatcctcgaagatctaggggtgg atcagtacctgctggacttgatcgaggcagcctttggggaaatatccagctgtcacctaccaactggcacgcgcttcaagttcggagctatga tgaaatcgggcatgtttctgactttgtttattaacactgttttgaacatcaccatagcaagcagggtactggagcagagactcactgactccgcct gtgcggccttcatcggcgacgacaacatcgttcacggagtgatctccgacaagctgatggcggagaggtgcgcgtcgtgggtcaacatgg aggtgaagatcattgacgctgtcatgggcgaaaaacccccatatttttgtgggggattcatagtttttgacagcgtcacacagaccgcctgccg tgtttcagacccacttaagcgcctgttcaagttgggtaagccgctaacagctgaagacaagcaggacgaagacaggcgacgagcactgag tgacgaggttagcaagtggttccggacaggcttgggggccgaactggaggtggcactaacatctaggtatgaggtagagggctgcaaaag tatcctcatagccatggccaccttggcgagggacattaaggcgtttaagaaattgagaggacctgttatacacctctatggaggaccccgtct agtaaggtga CSE1: (SEQIDNO:13) atggcggatgtgtgacatacacgacgccaaaagattttgttccag CSE2: (SEQIDNO:14) gcaggtcacaccaaatgaccatgcaaatgccagagcattttcgcacctggc CSE3: (SEQIDNO:15) acctctacggcggtcctag Multiplecloningsite(MCS): (SEQIDNO:16) atcgatatgcatttataaggatcccctaggcgatcg 3UTR: (SEQIDNO:17) gttagggtaggcaatggcattgatatagcaagaaaattgaaaacagaaaaagttagggtaagcaatggcatataaccataactgtataacttgt aacaaagcgcaacaagacctgcgcaattggccccgtggtccgcctcacggaaactcggggcaactcatattgacacattaattggcaataat tggaagcttacataagcttaattcgacgaataattggatttttattttattttgca CSE4: (SEQIDNO:18) attggtttttaatatttcc PolyA: (SEQIDNO:19) aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
[0169] (2) The enhanced green fluorescent protein (EGFP) coding region or the luciferase reporter gene (Luc) were homologously recombined into the multiple cloning site region at the 3 end of the subgenomic promoter of the modified expression vector pVAX1, the traditional cis-replicon vector pVAX1-cis-SFV, the trans-replicon vector pVAX1-trans-SFV, and the cis-replicon vector pVAX1-cis-SFV-neo of the present disclosure, to construct pVAX1-EGFP/Luc, pVAX1-cis-SFV-EGFP/Luc, pVAX1-trans-SFV-EGFP/Luc, and pVAX1-cis-SFV-neo-EGFP/Luc, respectively.
[0170] (3) The receptor binding domain (RBD) in the spike protein of SARS-CoV-2 was homologously recombined into the modified expression vector pVAX1 and the cis-replicon pVAX1-cis-SFV-neo by inserting into the multiple cloning site region at the 3 end of the subgenomic promoter to construct pVAX1-RBD and pVAX1-cis-SFV-neo-RBD.
[0171] (4) The vectors obtained from the construction described in (1)-(3) were subjected to in vitro transcription using the HiScribe? T7 ARCA mRNA Kit (with Tailing) (New England Biolabs, MA, USA) according to the instructions, and then RNA was collected to detect the RNA concentration by Nanodrop 2000 ultra-micro spectrophotometer (Thermo Fisher Scientific, MA, USA). The prepared RNA was stored in a ?80 degree refrigerator for later use.
[0172] (5) RNA Transfection
[0173] All cell culture media, fetal bovine serum (FBS), antibiotics and other supplements in this example were provided by Thermo Fisher Scientific, USA. The RNA obtained from in vitro transcription was subjected to RNA liposome transfection using the transfection reagent Lipofectamine Messenger MAX (Thermo Fisher Scientific, MA, USA) according to the manufacturer's instructions.
[0174] (6) Detection of Green Fluorescent Protein Signal
[0175] In order to evaluate the level of exogenous protein (green fluorescent protein) expressed by different RNA replicons, the RNA obtained from in vitro transcription of pVAX1-EGFP (without replicons, as a control), pVAX1-cis-SFV-EGFP, pVAX1-trans-SFV-EGFP, and pVAX1-cis-SFV-neo-EGFP according to the method described in (5) were transfected into hamster kidney fibroblasts (BHK-21) (purchased from Cell Bank of Type Culture Collection Committee, Chinese Academy of Sciences) in 96-well plate in equal amounts. After 48 hours, the green fluorescence intensity was observed under the microscope and the images were recorded.
[0176] (7) Luciferase Activity Assay
[0177] In order to evaluate the level of exogenous protein (luciferase) expressed by different RNA replicons, the RNA obtained by in vitro transcription of pVAX1-Luc (without replicons, as a control), pVAX1-cis-SFV-Luc, pVAX1-trans-SFV-Luc, and pVAX1-cis-SFV-neo-Luc according to the method described in (5) were transfected into BHK-21 cells in 96-well plate in equal amounts. The firefly luciferase was detected using Bright-Glo (Promega, Madison, USA) detection reagent, and bioluminescence was measured using an EnSpire multi-function microplate reader (PerkinElmer, MA, USA). Data were expressed as relative luciferase units [RLU], background signal (readout from untransfected cells) subtracted.
[0178] (8) Detection of Protein Expression
[0179] The RNA obtained by in vitro transcription of pVAX1-RBD and pVAX1-cis-SFV-neo-RBD were transfected into BHK-21 cells in 24-well plate in equal amounts, and the cells were collected 48 hours later. The expression of RBD of SARS-CoV-2 was detected and analyzed by Western Blot, and the antibody used was the RBD antibody against SARS-CoV-2 produced by Beijing SinoBiological Co., Ltd.
[0180] (9) Pseudovirus Neutralization Assay
[0181] A pseudotyped lentiviral luciferase reporter system was used to evaluate the neutralization ability of sera from inoculated animals against SARS-CoV-2.
[0182] Specifically, the SARS-CoV-2 pseudotyped virus was produced by co-transfecting 293T cells with the lentiviral packaging plasmid pCMV delta R8.2, the expression plasmid pCDH-CMV-luc encoding the luciferase reporter gene, and a plasmid pcDNA3.1-Spike expressing the Spike protein of SARS-CoV-2, and the treatment ratio for transfection was 1:1.5:1. The virus-containing medium was collected by centrifugation, filtered through a 0.45 ?m membrane, and then stored at ?80? C. for future use.
[0183] For the neutralization assay, serial dilutions of the heat-inactivated sera to be tested were first incubated with SARS-CoV-2 pseudotyped virus for 1 hour, and then the serum-virus mixture was transferred to 293T-hACE2 cells pre-seeded on cell culture plates. Cells were lysed after 48 h, and luciferase activity was determined with Bright-Glo (Promega, Madison, USA) detection reagent. IC50 neutralization titers were then calculated using GraphPad Prism (version 8.4).
[0184] (10) Immunization of Mice
[0185] BALB/c mice aged 6-8 weeks were purchased from the Experimental Animal Center of Henan Province and raised in an SPF level animal laboratory. All experiments were approved by the Life Science Ethics Review Committee of Zhengzhou University.
[0186] The mice were injected intramuscularly with the liposome-encapsulated RNA obtained by in vitro transcription of pVAX1-RBD (control) and pVAX1-cis-SFV-neo-RBD (experimental group), and boosted with equal doses of RNA on days 14 and 28 after the initial immunization. Serum samples were collected 35 days after the initial immunization, heat-inactivated at 56? C. for 30 min, and stored at ?80? C. The control group of immunized mice was injected with PBS, or liposome-encapsulated RNA obtained by in vitro transcription of pVAX1 plasmid. Five mice were used in both the experimental group and the control group, and the experimental results were expressed as mean?SEM. The comparison between groups was performed by the Mann-Whitney U test, and statistical analysis was performed by GraphPad Prism (version 8.4) software.
II. Results and Analysis
[0187] 1. The RNA obtained by in vitro transcription of expression vector pVAX1-EGFP, the traditional cis-replicon vector pVAX1-cis-SFV-EGFP, the trans-replicon vector pVAX1-trans-SFV-EGFP (containing the corresponding replicase), and the cis-replicon vector pVAX1-cis-SFV-neo-EGFP of the present disclosure were transfected into BHK-21 cells in 96-well plate in equal amounts using Lipofectamine MessengerMAX?. After 48 hours, the ability of various replicons to express green fluorescent protein (EGFP) was compared.
[0188] The results are shown in
[0189] 2. The RNA obtained by transcription of the traditional expression vector pVAX1-Luc, the traditional cis-replicon pVAX1-cis-SFV-Luc, the trans-replicon pVAX1-trans-SFV-Luc (containing the corresponding replicase), and the cis-replicon pVAX1-cis-SFV-neo-Luc of the present disclosure were transfected into BHK-21 cells in 96-well plate in equal amounts using Lipofectamine MessengerMAX?. After 48 hours, the luciferase activity was detected with the Bright-Glo luciferase assay system, and the ability of various replicons to express luciferase (Luc) was compared. The experimental results were expressed as mean?SEM, and the comparison between groups was performed by the Mann-Whitney U test.
[0190] The results are shown in
[0191] 3. The RNA obtained by in vitro transcription of pVAX1-RBD/pVAX1-cis-SFV-neo-RBD was transfected using the transfection reagent Lipofectamine Messenger MAX into BHK-21 cells for 48 hours to detect the expression level. The results of Western Blot are shown in
[0192] 4. The mice were immunized with 100 ng of RNA obtained by in vitro transcription of pVAX1-SFV-RBD and pVAX1-cis-SFV-neo-RBD after encapsulation in liposomes, and boosted with equal doses of RNA on days 14 and 28 after the initial immunization. Serum samples were collected 35 days after the initial immunization, and the anti-RBD IgG titers in the serum were measured by ELISA (coating antigen was recombinant RBD protein). In the control group, mice were immunized with PBS or mRNA in vitro transcribed from pVAX1. The experimental results were compared with the mean?SEM of three independent experiments, and the comparison between groups was performed by the Mann-Whitney U test. In the ELISA experiment, the titer of the antiserum with no responses was designated as 1 for statistical analysis.
[0193] The results are shown in
[0194] 5. The mice were immunized with 100 ng of RNA obtained by in vitro transcription of pVAX1-SFV-RBD and pVAX1-RBD after encapsulation in liposomes, and boosted with equal doses of RNA on days 14 and 28 after the initial immunization. Serum samples were collected 35 days after the initial immunization, and serum neutralization titers were determined by pseudovirus neutralization assay. In the control group, mice were immunized with PBS or RNA transcribed in vitro from pVAX1. The experimental results were compared with the mean?SEM of three independent experiments, and the comparison between groups was performed by the Mann-Whitney U test. In the neutralization experiment, if the undiluted serum still did not show any neutralizing effect, its titer was assigned as 1 for statistical analysis.
[0195] The results are shown in
[0196] The above-mentioned embodiments are only for describing the preferred mode of the present disclosure, and are not intended to limit the scope of the present disclosure. Without departing from the design spirit of the present disclosure, various modifications and improvements made by those skilled in the art to the technical solution of the present disclosure shall fall within the scope of protection defined by the claims of the present disclosure.