High affinity B7-H6 antibodies and antibody fragments
11952425 ยท 2024-04-09
Assignee
Inventors
Cpc classification
C07K16/468
CHEMISTRY; METALLURGY
C07K2319/033
CHEMISTRY; METALLURGY
C07K16/2809
CHEMISTRY; METALLURGY
A61K39/001102
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
A61K47/6803
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
A61K51/1027
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
A61K51/10
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
Abstract
Provided herein, in some embodiments, are antibodies, antigen-binding antibody fragments, chimeric antigen receptors (CARs) and bispecific T cell engagers (BiTEs) that bind specifically to B7 homolog 6. Also provided herein are methods of using the same and cells comprising the same.
Claims
1. An antibody or antigen-binding antibody fragment that binds specifically to B7 homolog 6 (B7-H6) which comprises either of the following: I. (a) a heavy chain variable region comprising, (i) a CDR1 of SEQ ID NO: 31, (ii) a CDR2 of SEQ ID NO: 32, and (iii) a CDR3 of SEQ ID NO: 33; and (b) a light chain variable region comprising, (i) a CDR1 of SEQ ID NO: 34, (ii) a CDR2 of SEQ ID NO: 35, and (iii) a CDR3 of SEQ ID NO: 36; or II. (a) a heavy chain variable region comprising, (i) a CDR1 of SEQ ID NO: 22, (ii) a CDR2 of SEQ ID NO: 23, and (iii) a CDR3 of SEQ ID NO: 24; and (b) a light chain variable region comprising, (i) a CDR1 of SEQ ID NO: 25, (ii) a CDR2 of SEQ ID NO: 26, and (iii) a CDR3 of SEQ ID NO: 27.
2. The antibody or antigen-binding antibody fragment of claim 1, wherein: the antibody of (i) comprises a variable heavy chain having an amino acid sequence at least 90% identical to SEQ ID NO: 20 and a variable light chain having an amino acid sequence at least 90% identical to SEQ ID NO: 20; or the antibody of (ii) comprises a variable heavy chain having an amino acid sequence at least 90% identical to SEQ ID NO: 29 and a variable light chain having an amino acid sequence at least 90% identical to SEQ ID NO: 30.
3. The antibody, or antigen-binding antibody fragment, of claim 1, wherein the antibody is a full-length antibody or the antigen-binding fragment comprises a scFv fragment.
4. The antibody, or antigen-binding antibody fragment, of claim 1, wherein the antibody, or antigen-binding antibody fragment, is conjugated to a synthetic molecule.
5. The antibody, or antigen-binding antibody fragment, of claim 4, wherein the antibody, or antigen-binding antibody fragment, is a chimeric antigen receptor and the synthetic molecule comprises a transmembrane domain and an intracellular signaling domain.
6. The antibody, or antigen-binding antibody fragment, of claim 5, further comprising the intracellular domain of a costimulatory protein receptor.
7. The antibody, or antigen-binding antibody fragment of claim 4, wherein the antibody, or antigen-binding antibody fragment, is a bi-specific T-cell engager and the synthetic molecule comprises an antigen binding domain which binds to a T-cell antigen.
8. The antibody, or antigen-binding antibody fragment of claim 4, wherein the synthetic molecule is a label, a cytotoxic agent or a therapeutic radioisotope.
9. A nucleic acid encoding the antibody, or antigen-binding antibody fragment of claim 1 or a CAR or bi-specific T-cell engager comprising said antibody, or antigen-binding antibody fragment or a vector comprising said nucleic acid.
10. A recombinant cell comprising a CAR or bi-specific T-cell engager comprising an antibody, or antigen-binding antibody fragment according to claim 1.
11. A pharmaceutical composition or kit comprising the antibody, or antigen-binding antibody fragment of claim 1 and a pharmaceutically acceptable carrier.
12. A pharmaceutical composition or kit comprising the recombinant cell of claim 10 and a pharmaceutically acceptable carrier.
13. A chimeric antigen receptor comprising (a) an antigen-binding antibody fragment of claim 1, (b) a transmembrane domain, and (c) an intracellular signaling domain.
14. The chimeric antigen receptor of claim 13, wherein the intracellular signaling domain is a T cell receptor intracellular signaling domain.
15. The chimeric antigen receptor of claim 13, further comprising a transmembrane domain or an intracellular signaling domain of a costimulatory protein receptor, and/or the chimeric receptor further comprises a hinge domain.
16. A recombinant immune cell comprising the chimeric antigen receptor claim 13.
17. A bi-specific T-cell engager comprising (a) an antigen-binding antibody fragment of claim 1, and (b) an antigen binding domain that binds to a T-cell antigen.
18. A method, comprising administering an effective amount of the antibody, or antigen-binding antibody fragment of claim 1, or a bi-specific T-cell engager or a chimeric antigen receptor comprising said antibody, or antigen-binding antibody fragment to a subject in need thereof, wherein said subject has a disease characterized by B7-H6-expressing cells.
19. The method of claim 18, wherein (i) the effective amount is an amount effective to kill or reduce, in a subject, growth of cells expressing B7 homolog 6; (ii) the effective amount is an amount effective to kill or reduce, in a subject, growth of cancer cells expressing B7 homolog 6; (iii) the subject has myeloid leukemia, acute nonlymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, breast cancer, cervical cancer, clear cell renal cell carcinoma, dermatofibrosarcoma protuberans, gastric sarcoma, gastrointestinal stromal tumor, glioblastoma, leiomyosarcoma, invasive ductal breast carcinoma, malignant fibrous histiocytoma, melanoma, ovarian serous surface papillary carcinoma, pancreatic cancer, prostate cancer, T-cell acute lymphoblastic leukemia or T-cell lymphoma; (iv) the effective amount is an amount effective to induce an immune response, in the subject, against cells expressing B7 homolog 6; (v) the subject has an autoimmune disorder; (iv) the subject has Sjogren's syndrome; and/or (vi) the method includes co-administering a second therapeutic agent.
20. The method of claim 18, wherein said antibody or antigen-binding antibody fragment, or a bi-specific T-cell engager or a chimeric antigen receptor comprising said antibody or antigen-binding antibody fragment is expressed by a recombinant cell.
21. The chimeric antigen receptor of claim 15, wherein the hinge domain is a CD28 or CD8 hinge region.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
DESCRIPTION
(9) Provided herein are antibodies and antigen-binding antibody fragments that bind specifically to B7 homolog 6 (B7-H6), which is expressed on various types of primary human tumors, including leukemia, lymphoma, and gastrointestinal stromal tumors. The antigen-binding antibody fragments, for example, were shown to bind to B7-H6 with an affinity that is greater than that of previously available anti-B7-H6 antibodies and were shown to bind to an epitope that is different from that bound by previously available anti-B7-H6 antibodies. The antigen-binding antibody fragments, as provided herein, in some embodiments, are used to produce chimeric antigen receptors and bi specific T cell engagers (BiTEs) for use, for example, in the treatment of cancer and autoimmune disorders.
(10) Examples of scFv antibody fragments that bind specifically to B7-H6 are provided in
(11) An antibody or an antigen-binding domain (e.g., an scFV) that binds specifically to B7-H6 or other target or epitope is a term understood in the art, and methods to determine such specific binding are also known in the art. A molecule is said to exhibit specific binding if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen than it does with alternative targets. An antigen binding domain (e.g., an scFV) that binds specifically to a first target antigen may or may not bind specifically to a second target antigen. As such, specific binding does not necessarily require (although it can include) exclusive binding.
(12) In some embodiments, antibodies and antigen-binding antibody fragments that bind specifically to B7-H6 have a heavy chain amino acid sequence of SEQ ID NO: 2, 11, 20 or 29. In some embodiments, antibodies and antigen-binding antibody fragments that bind specifically to B7-H6 have a heavy chain amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 2, 11, 20 or 29. In some embodiments, antibodies and antigen-binding antibody fragments that bind specifically to B7-H6 have a light chain amino acid sequence of SEQ ID NO: 3, 12, 21 or 30. In some embodiments, antibodies and antigen-binding antibody fragments that bind specifically to B7-H6 have a light chain amino acid sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 3, 12, 21 or 30.
(13) In some embodiments, the heavy chain variable (V.sub.H) region of the antibody or antibody fragment has a CDR1 sequence of SEQ ID NO: 4, 13, 22 or 31. In some embodiments, the heavy chain variable (V.sub.H) region of the antibody or antibody fragment has a CDR1 sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 4, 13, 22 or 31. In some embodiments, the heavy chain variable region of the antibody or antibody fragment has a CDR2 sequence of SEQ ID NO: 5, 14, 23 or 32. In some embodiments, the heavy chain variable region of the antibody or antibody fragment has a CDR2 sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 5, 14, 23 or 32. In some embodiments, the heavy chain variable region of the antibody or antibody fragment has a CDR3 sequence of SEQ ID NO: 6, 15, 24 or 33. In some embodiments, the heavy chain variable region of the antibody or antibody fragment has a CDR3 sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 6, 15, 24 or 33.
(14) In some embodiments, the light chain variable (V.sub.L) region of the antibody or antibody fragment has a CDR1 sequence of SEQ ID NO: 7, 16, 25 or 34. In some embodiments, the light chain variable (V.sub.L) region of the antibody or antibody fragment has a CDR1 sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 7, 16, 25 or 34. In some embodiments, the light chain variable (V.sub.L) region of the antibody or antibody fragment has a CDR2 sequence of SEQ ID NO: 8, 17, 26 or 35. In some embodiments, the light chain variable (V.sub.L) region of the antibody or antibody fragment has a CDR2 sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 8, 17, 26 or 35. In some embodiments, the light chain variable (V.sub.L) region of the antibody or antibody fragment has a CDR3 sequence of SEQ ID NO: 9, 18, 27 or 36. In some embodiments, the light chain variable (V.sub.L) region of the antibody or antibody fragment has a CDR3 sequence that is at least 80% (e.g., at least 85%, 90%, 95%, 96%, 97%, 98%, 99%) identical to SEQ ID NO: 9, 18, 27 or 36.
(15) Also provided herein are functional variants of the scFv antibody fragments provided in
(16) In some embodiments, a light chain variable region of an antibody or antibody fragment is at least 80% (e.g., 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO: 33, 12, 21 or 30. In some embodiments, a light chain variable region of an antibody or antibody fragment is at least 80% (e.g., 85%, 90%, 95%, 96%, 97%, 98%, or 99%) identical to SEQ ID NO: 33, 12, 21 or 30 and consists of at least one mutation in at least one framework region in SEQ ID NO: 3, 12, 21 or 30, respectively.
(17) Functional variants are capable of binding to a B7-H6 molecule, particularly a human B7-H6 molecule. In some embodiments, the variants possess similar antigen-binding affinity relative to the B7-H6 scFvs provided in
(18) In some embodiments, the functional variants described above contains one or more mutations (e.g., conservative substitutions) in the framework region (FR) of the V.sub.H relative to SEQ ID NO: 2, 11, 20 or 29. In some embodiments, the functional variants described above contains one or more mutations (e.g., conservative substitutions) in the FR V.sub.L relative to SEQ ID NO: 33, 12, 21 or 30. These mutations, in some embodiments, do not occur at residues which are predicted to interact with one or more of the CDRs. Mutations within the FR are unlikely to affect the antigen-binding activity of an antibody or antigen-binding antibody fragment. In some embodiments, the functional variants described herein contain at least one (e.g., 1, 2 or 3) mutations within at least one of the CDR regions. These functional variants, in some embodiments, retain the same regions/residues responsible for antigen-binding as the parent, such as the same specificity-determining residues inside the CDRs.
(19) The percent identity of two amino acid sequences can be determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Sci. USA 87:2264-68, 1990, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA 90:5873-77, 1993. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. J. Mol. Biol. 215:403-10, 1990. BLAST protein searches can be performed, for example, with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of interest. Where gaps exist between two sequences, Gapped BLAST can be utilized, for example, as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used, in some embodiments.
(20) Provided herein are full length antibodies and antigen-binding antibody fragments (including single-chain antibodies). In some embodiments, an antibody fragment that specifically binds to B7-H6 is an scFV antibody fragment. Other examples of antibody fragments include, but are not limited to, F(ab)2, Fv, scFv, F(ab).sub.2, F(ab), VL, VH, dsFv, Fv, scFv-Fc, (scFv).sub.2, diabodies and bivalent antibodies.
(21) An antibody (or an antigen-binding antibody fragment) may be, for example, polyclonal, monoclonal, recombinant, chimeric or humanized. In some embodiments, an antibody is an IgA, IgD, IgE, IgG, or IgM isotype. Other isotypes are encompassed by the present disclosure. In some embodiments, an antibody that binds specifically to B7-H6 is an IgA, such as IgA1 or IgA2, or is am IgG, such as IgG1, IgG2, IgG3, IgG4, or synthetic IgG. In some embodiments, an antibody (or an antigen-binding fragment of the antibody) is a synthetic antibody, such as a non-depleting IgG antibody, T-body, or other Fe or Fab variant of antibody.
(22) In some embodiments, an antibody is an isolated antibody.
(23) Antibodies, and antigen-binding antibody fragments, in some embodiments, have an affinity for B7-H6 of 100 pM to 1 ?M. In some embodiments, antibodies have an affinity for B7-H6 of 100 pM to 1 ?M. For example, antibodies may have an affinity for B7-H6 of 100-200 pM, 100-300 pM, 100-400 pM, 100-500 pM, 100-600 pM, 100-700 pM, 100-800 pM or 100-900 pM. In some embodiments, antibodies have an affinity for B7-H6 of 1-10 nM, 1-100 nM, or 1-1000 nM (1 ?M). For example, antibodies may have an affinity for B7-H6 of 1-5 nM, 1-25 nM, 1-50 nM, 1-75 nM, 1-150 nM, 1-200 nM, 1-300 nM, 1-400 nM, 1-500 nM, 1-600 nM, 1-700 nM, 1-800 nM or 1-900 nM.
(24) In some embodiments, antibodies have an affinity for B7-H6 of 10 nM to 50 nM (e.g., 10 nM, 15 nM, 20 nM, 25 nM, 30 nM, 35 nM, 40 nM, 45 nM, or 50 nM). In some embodiments, antibodies have an affinity for B7-H6 of at least 10 nM. For example, antibodies may have an affinity for B7-H6 of at least 15 nM, at least 20 nM, at least 30 nM, at least 40 nM, at least 45 nM, or at least 50 nM. In some embodiments, antibodies have an affinity for B7-H6 of 15 nM to 50 nM, 20 nM to 50 nM, or 30 nM to 50 nM. In some embodiments, antibodies have an affinity for B7-H6 of less than 10 nM.
(25) Affinity can be measured using known techniques. The affinity of an antibody can be determined by measuring the K.sub.D of the antibody. The K.sub.D is the equilibrium dissociation constant (a ratio of k.sub.off/k.sub.on) between an antibody and its antigen, where K.sub.off is the antibody dissociation rate (the rate at which an antibody dissociates from its antigen), and K.sub.on is the antibody association rate (the rate at which an antibody binds to its antigen). K.sub.D and affinity are inversely related. The K.sub.D value relates to the concentration of antibodythe lower the K.sub.D value (lower concentration), the higher the affinity of the antibody.
(26) Antibodies, and antigen-binding antibody fragments, in some embodiments, have an avidity for B7-H6 of 1 ?M to 10 nM. In some embodiments, antibodies have an avidity for B7-H6 of 10 ?M or less. For example, antibodies may have an avidity for B7-H6 of 5 ?M or less, 2 ?M or less, 1 ?M or less, 500 nM or less, 400 nM or less, 300 nM or less, or 200 nM or less. n some embodiments, antibodies have an avidity for B7-H6 of 100 nM or less, 75 nM or less, 50 nM or less, 25 nM or less, 10 nM or less, or 5 nM or less. Avidity refers to the accumulated strength of multiple affinities of individual antibody-antigen binding interactions (compare to affinity, which describes the strength of a single interaction). Avidity can be measured using techniques, such as an enzyme-linked immunosorbent assay (ELISA) or a BIACORE? detection system.
(27) Antibodies, and antigen-binding antibody fragments, may be produced used a eukaryotic expression system or a non-eukaryotic expression system. In some embodiments, an antibody is produced using a mammalian expression system. In some embodiments, the antibody (or antibody fragment) is encoded by a DNA sequence selected from any one of SEQ ID NO: 38-41. In some embodiments, an antibody is produced using a bacterial expression system. For example, a bacterial expression system may be used to produce antibody fragments, such as F(ab).sub.2, Fv, scFv, F(ab).sub.2, F(ab), VL, VH, dsFv, Fv, scFv-Fc, (scFv).sub.2 and diabodies. Techniques for altering DNA coding sequences to produce such fragments are known.
(28) An antibody, or antigen-binding antibody fragment, in some embodiments, is conjugated to a synthetic molecule. In some embodiments, a synthetic molecule is a molecule that targets (recognizes and binds to) a particular cell or cell type, such as a tumor cell (e.g., a cancerous tumor cell) or a metastatic cell.
(29) In some embodiments, a synthetic molecule is a therapeutic molecule, such as a cytotoxic molecule (e.g., a protein toxin obtained from a plant, fungus or bacterium), a cytostatic molecule, an anti-angiogenic molecule or a radioisotope.
(30) Examples, of therapeutic molecules include, but are not limited to, maytansinoids (e.g., maytansinol or DM1 maytansinoid), taxanes, calicheamicin, vincristine and prednisone. A therapeutic molecule, in some embodiments, is: an antimetabolite (e.g., an antifolate such as methotrexate, a fluoropyrimidine such as 5-fluorouracil, cytosine arabinoside, or an analogue of purine or adenosine); an intercalating agent (e.g., an anthracycline such as doxorubicin, daunomycin, epirubicin, idarubicin, mitomycin-C, dactinomycin, or mithramycin); a platinum derivative (e.g., cisplatin or carboplatin); an alkylating agent (e.g., nitrogen mustard, melphalan, chlorambucil, busulphan, cyclophosphamide, ifosfamide nitrosoureas or thiotepa); an antimitotic agent (e.g., a vinca alkaloid, such as vincristine, or taxoid, such as paclitaxel or docetaxel); a topoisomerase inhibitor (e.g., etoposide and teniposide, amsacrine, topotecan); a cell cycle inhibitor (e.g., a flavopyridol); or a microbtubule agent (e.g., an epothilone, discodermolide analog or eleutherobin analog). In some embodiments, a therapeutic molecule is a proteosome inhibitor or a topoisomerase inhibitor, such as bortezomib, amsacrine, etoposide, etoposide phosphate, teniposide or doxorubicin.
(31) Examples of cytotoxic molecules include, but are not limited to, auristatins, maytansines, calicheamicins, duocarymycins, PBD dimers and alpha-amanitin. Examples of cytotoxic/immunosuppressive molecules include, but are not limited to, cyclophosphamide (e.g., Cytoxan), azathioprine (e.g., Imuran) and methotrexate.
(32) Examples of anti-angiogenic agents include, but are not limited to, linomide, bevacuzimab, angiostatin and razoxane. The synthetic molecule can be another antibody such as rituximab or bevacuzimab.
(33) Examples of therapeutic radioisotopes include, but are not limited to, yttrium (90Y), lutetium (177Lu), actinium (225Ac)) bismuth (212Bi praseodymium, astatine (211At) rhenium (186Re), bismuth (212Bi or 213Bi) and rhodium (188Rh).
(34) In some embodiments, a synthetic molecule is a fusion protein produced, for example, by conventional recombinant protein expression systems and methods.
(35) In some embodiments, a synthetic molecule is a label. Labels can be useful in diagnostic applications and can include, for example, contrast agents. Examples of contrast agents include, but are not limited to, radioisotope labels such as iodine (131I or 125I), indium In), technetium (99Tc), phosphorus (32P), carbon (14C), tritium (3H) and other radioisotopes (e.g., a radioactive ion) listed above; radiopaque molecule, magnetic resonance imaging (MRI) molecule, ultrasound imaging molecule, and any other contrast molecule suitable for detection by a device that images an animal body. In some embodiments, a synthetic molecule is a fluorescent label, a biologically active enzyme label, a luminescent label, or a chromophore label.
(36) In some embodiments, a synthetic molecule is a magnetic nanoparticle, a controlled release polymer nanoparticle or a lipid composition. Examples of magnetic nanoparticles include, but are not limited to, iron (e.g., Fe.sub.3O.sub.4 or Fe.sub.2O.sub.4), cobalt, zinc, cadmium, nickel, gadolinium, chromium, copper, manganese, terbium, europium, gold, silver, platinum, and alloys thereof. Controlled release polymer nanoparticles can be produced using conventional methods, for example, from biodegradable or nonbiodegradable polymers, e.g., poly(lactic acid), derivatives of poly(lactic acid), PEGylated poly(lactic acid), poly(lactic-co-glycolic acid), derivatives of poly(lactic-co-glycolic acid), PEGylated poly(lactic-co-glycolic acid), a polyanhydride, poly(ortho esters), derivatives of poly(ortho esters), PEGylated poly(ortho esters), poly(caprolactone), derivatives of poly(caprolactone), PEGylated poly(caprolactone), poly(acrylic acid), derivatives of poly(acrylic acid), poly(urethane), derivatives of poly(urethane), or combinations thereof). Similarly, lipid compositions (e.g., liposomes, solid lipid nanoparticles and the like) can be produced using conventional methods.
(37) An anti-B7-H6 antibody, or antigen-binding antibody fragment, can be conjugated to a synthetic molecule using any type of suitable conjugation method. Recombinant engineering and incorporated selenocysteine (e.g., as described in WO 2008/122039) can be used to conjugate a synthetic molecule, for example. Other methods of conjugation include, but are not limited to covalent coupling to native or engineered lysine side-chain amines or cysteine side-chain thiols. See, e.g., Wu, et al. (2005) Nat. Biotechnol. 23:1137-1146.
(38) Also provided herein are chimeric antigen receptors (CARs). A T cell that expressed a CAR is referred to as a CAR T cell. A CAR T cell receptor, in some embodiments, comprises a signaling domain of the T-cell receptor (TcR) complex and a B7-H6-recognizing domain (e.g., a single chain fragment (scFv) of
(39) There are four generations of CARs, each of which contains different components. First generation CARs join an antibody-derived scFv to the CD3zeta or z) intracellular signaling domain of the T-cell receptor through hinge and transmembrane domains. Second generation CARs incorporate an additional domain, e.g., CD28, 4-1BB (41BB), or ICOS, to supply a costimulatory signal. Third-generation CARs contain two costimulatory domains fused with the TeR CD3-? chain. Third-generation costimulatory domains may include, e.g., a combination of CD3z, CD27, CD28, 4-1BB, ICOS, DAP-10 or OX40. CARs, in some embodiments, contain an ectodomain (e.g., CD3?), commonly derived from a single chain variable fragment (scFv), a hinge, a transmembrane domain, and an endodomain with one (first generation), two (second generation), or three (third generation) signaling domains derived from CD3Z and/or co-stimulatory molecules (Maude et al., Blood. 2015; 125(26):4017-4023; Kakarla and Gottschalk, Cancer J. 2014; 20(2):151-155).
(40) In some embodiments, the chimeric antigen receptor (CAR) is a T-cell redirected for cytokine activity (e.g., TRUCK), also known as a fourth generation CAR. TRUCKs are CAR-redirected T-cells used as vehicles to trigger effector activity of the CAR T cells and in addition produce and release a transgenic cytokine (e.g., IL-12) that accumulates in the targeted tissue, e.g., a tumor tissue that expresses B7-H6. The transgenic cytokine is made constitutively or released upon CAR engagement of the target. TRUCK cells may deposit a variety of therapeutic cytokines at the target site. This may result in therapeutic concentrations at the targeted site and avoid systemic toxicity of these same cytokines.
(41) CARs typically differ in their functional properties. The CD3? signaling domain of the T-cell receptor, when engaged, will activate and induce proliferation of T-cells but can lead to anergy (a lack of reaction by the body's defense mechanisms, resulting in direct induction of peripheral lymphocyte tolerance). Lymphocytes are considered anergic when they fail to respond to their specific antigen. The addition of a costimulatory domain in second-generation CARs improved replicative capacity and persistence of modified T-cells. Similar antitumor effects are observed in vitro with CD28 or 4-1 BB CARs, but preclinical in vivo studies suggest that 4-1BB CARs may produce superior proliferation and/or persistence. Clinical trials suggest that both of these second-generation CARs are capable of inducing substantial T-cell proliferation in vivo, but CARs containing the 4-1BB costimulatory domain appear to persist longer. Third generation CARs combine multiple signaling domains (costimulatory) to augment potency. Fourth generation CARs are additionally modified with a constitutive or inducible expression cassette for a transgenic cytokine, which is released by the CAR T-cell to modulate the immune response. See, for example, Enblad et al., Human Gene Therapy. 2015; 26(8):498-505; Chmielewski and Hinrich, Expert Opinion on Biological Therapy. 2015; 15(8): 1145-1154.
(42) In some embodiments, a chimeric antigen receptor is a first generation CAR. In some embodiments, a chimeric antigen receptor is a second generation CAR. In some embodiments, a chimeric antigen receptor is a third generation CAR. In some embodiments, the chimeric antigen receptor is a fourth generation CAR or a T cell redirected to produce additional cytokines (TRUCK).
(43) A chimeric antigen receptor (CAR) may comprise an extracellular domain comprising a B7-H6 binding domain, a transmembrane domain, and a cytoplasmic domain. In some embodiments, a CAR is fully human. A spacer domain or hinge domain may be located between an extracellular domain (comprising the antigen binding domain) and a transmembrane domain of a CAR, or between a cytoplasmic domain and a transmembrane domain of the CAR. A spacer domain refers to any oligopeptide or polypeptide that functions to link the transmembrane domain to the extracellular domain and/or the cytoplasmic domain in the polypeptide chain. A hinge domain refers to any oligopeptide or polypeptide that functions to provide flexibility to the CAR, or domains thereof, or to prevent steric hindrance of the CAR, or domains thereof. In some embodiments, a spacer domain or hinge domain may comprise up to 300 amino acids (e.g., 10 to 100 amino acids, or 5 to 20 amino acids). In some embodiments, one or more spacer domain(s) may be included in other regions of a CAR.
(44) In some embodiments, a CAR comprises an antigen binding domain, such as a single chain Fv (scFv) specific for B7-H6.
(45) In some embodiments, T cells expressing a CAR are genetically modified to recognize multiple targets or antigens, which permits the recognition of unique target or antigen expression patterns on tumor cells. Examples of CARs that can bind multiple targets include: split signal CARs, which limit complete T cell activation to tumors expressing multiple antigens; tandem CARs (TanCARs), which contain ectodomains having two scFvs; and universal ectodomain CARs, which incorporate avidin or a fluorescein isothiocyanate (FITC)-specific scFv to recognize tumor cells that have been incubated with tagged monoclonal antibodies (blabs).
(46) A CAR is considered bispecific if it recognizes two distinct antigens (has two distinct antigen recognition domains). In some embodiments, a bispecific CAR is comprised of two distinct antigen recognition domains present in tandem on a single transgenic receptor (referred to as a TanCAR; see, e.g., Grada Z et al. Molecular Therapy Nucleic Acids 2013; 2:e105, incorporated herein by reference).
(47) In some embodiments, a CAR is an antigen-specific inhibitory CAR (iCAR), which may be used, for example, to avoid off-tumor toxicity (Fedorov, V D et al. Sci. Transl. Med. published online Dec. 11, 2013, incorporated herein by reference). iCARs contain an antigen-specific inhibitory receptor, for example, to block nonspecific immunosuppression, which may result from extra-tumor target expression. iCARs may be based, for example, on inhibitory molecules CTLA-4 or PD-1. In some embodiments, these iCARS block T cell responses from T cells activated by either their endogenous T cell receptor or an activating CAR. In some embodiments, this inhibiting effect is temporary.
(48) In some embodiments, CARs may be used in adoptive cell transfer, wherein immune cells are removed from a subject and modified so that they express receptors specific to B7-H6. The modified immune cells, which may then recognize and kill the cancer cells, are reintroduced into the subject (Pule, et al., Cytotherapy. 2003; 5(3): 211-226; Maude et al., Blood. 2015; 125(26): 4017-4023, each of which is incorporated herein by reference).
(49) CARs may be prepared using standard recombinant protein techniques using sequences of CD3-zeta and other costimulatory molecules known in the art. For example, the human CD3-zeta sequence is available under GENBANK accession number NP 932170 (e.g., entry as of Mar. 18, 2016), the human CD28 sequence is available under GENBANK accession number NP 006130 (e.g., entry as of Mar. 18, 2016), the human OX40 sequence is available under GENBANK accession number NP_003318 (e.g., entry as of Mar. 18, 2016), and the human CD19 sequence is available under GENBANK accession number AAA69966 (e.g., entry as of Mar. 18, 2016).
(50) In some embodiments, an antibody, or an antigen-binding antibody fragment, also has specificity for one or more antigens in addition to B7-H6. For example, the antibody may be engineered (e.g., as a bivalent diabody or a conjugated Fab dimer or trimer) to have specificity for B7-H6 and another tumor antigen, for example, an antigen associated with lymphoma, leukemia, melanoma, or sarcoma. In some embodiments, an antibody is engineered to have specificity for B7-H6 and an antigen that promotes activation or targeting of other cells, such as cytotoxic effector cells or T cells. Accordingly, the present disclosure also provides BiTES (bi-specific T-cell engagers) and DARTS (dual affinity retargeting reagents).
(51) A BiTE refers to a single polypeptide chain molecule having two antigen binding domains, one of which binds to a T-cell antigen (e.g., CD3) and the other of which binds to an antigen present on the surface of a target cell (WO 05/061547; Baeuerle, et al. (2008) Drugs of the Future 33:137-147; Bargou, et al. (2008) Science 321:974-977). BiTE antibodies have been constructed to target various antigens including CD19, EpCAM, Her2/neu, EGFR, CD66e (or CEA, CEACAM5), CD33, EphA2 and MCSP (or HMW-MAA) (Baeuerle, et al. (2009) Curr. Opin. Mol. Ther. 11:22-30). Key features of BiTE antibodies that, in their combination, distinguish them from other bispecific antibody constructs include a high potency of redirected lysis with EC.sub.50 values ranging from 0.1 to 50 pmol/L (2-1,000 pg/mL) (Baeuerle, et al. (2009) supra); strict target cell-dependent activation of T cells (Brischwein, et al. (2007) J. Immunother. 30:798-807); and support of serial lysis by activated T cells (activity at low E:T ratios). BiTE antibodies are typically produced as recombinant, glycosylated proteins secreted by higher eukaryotic cell lines. Accordingly, in some embodiments of the present disclosure, an anti-B7-H6 antibody fragment (e.g., a scFv) is a component of a BiTE. In particular embodiments, a BiTE is composed of an anti-B7-H6 antibody fragment and an anti-CD3 antibody fragment fused together by a linker, for example, a (G4S)3 linker.
(52) A DART refers to an immunoglobulin molecule that includes at least two polypeptide chains that associate (especially through a covalent interaction) to form at least two epitope binding sites, which may recognize the same epitope or different epitopes. Each of the polypeptide chains of a DART include an immunoglobulin light chain variable region and an immunoglobulin heavy chain variable region, but these regions do not interact to form an epitope binding site. Rather, the immunoglobulin heavy chain variable region of one (e.g., the first) of the DART polypeptide chains interacts with the immunoglobulin light chain variable region of a different (e.g., the second) DART polypeptide chain to form an epitope binding site. Similarly, the immunoglobulin light chain variable region of one (e.g., the first) of the DART polypeptide chains interacts with the immunoglobulin heavy chain variable region of a different (e.g., the second) DART polypeptide chain to form an epitope binding site. DARTs may be monospecific, bispecific or trispecific, for example, thus they are capable of simultaneously binding one, two or three (or more) different epitopes (which may be of the same or of different antigens). DARTs may additionally be monovalent, bivalent, trivalent, tetravalent, pentavalent or hexavalent, for example, thus are capable of simultaneously bind one, two, three, four, five, six or more molecules. These two features of DARTs (degree of specificity and valency) may be combined, for example to produce bispecific antibodies (capable of binding two epitopes) that are tetravalent (capable of binding four sets of epitopes, for example. Examples of methods of constructing DART molecules is disclosed in WO 2006/113665, WO 2008/157379 and WO 2010/080538. Accordingly, in some embodiments, an anti-B7-H6 antibody fragment is a component of a DART.
(53) The present disclosure further provides eukaryotic or non-eukaryotic cells that are recombinantly engineered to produce an antibody or an antigen-binding antibody fragment that binds specifically to B7-H6. The eukaryotic or non-eukaryotic cells can be used, for example, as an expression system to produce the antibody. In some embodiments, the present disclosure provides B7-H6 targeted immune cells (e.g., T cells or B cells) that are engineered to recombinantly express a B7-H6 specific antibody. For example, a T-cell may be engineered to express an antibody or an antigen-binding antibody fragment (e.g., an scFv, scFv-Fc, (scFv).sub.2) that binds specifically to B7-H6. In some embodiments, the antibody, or an antigen-binding antibody fragment, is linked to a synthetic molecule with the following domains: a spacer domain or hinge domain (e.g., a CD28 or IgG hinge domain), a transmembrane domain (e.g., a transmembrane canonical domain), and an intracellular signaling domain (e.g., a T-cell receptor (TCR) signaling domain or a FcR-gamma intracellular signaling domain), thereby forming a CAR. Examples of intracellular signaling domains that can be included in a CAR include, but are not limited to, CD3zeta, FcR-gamma and Syk-PTK signaling domains as well as the CD28, 4-1BB and CD134 co-signaling domains. Methods for producing T-cells (and other immune cells) expressing a CAR are known. See, e.g., Marcu-Malina, et al. (2009) Exp. Opin. Biol. Ther. 9:579-91.
(54) The present disclosure also provides methods of killing, inhibiting the growth of (e.g., proliferation), or inhibiting the activity of cells that express B7-H6 (B7-H6 cells) by contacting the cells with (administering to the cells or to a subject having the cells) an antibody, antigen-binding antibody fragment or fusion protein (e.g., BiTE) that binds specifically to B7-H6. Inhibiting B7-H6-positive cell growth or activity can include blocking or reducing growth or activity (e.g., secretion of certain molecules). In some embodiments, the antibody is conjugated (linked to) to a synthetic molecule. In some embodiments, and antibody is conjugated to a cytotoxic molecule (e.g., Pseudomonas exotoxin A (PE38)), cytostatic molecule, anti-angiogenic molecule or a radioisotope. Methods can be used to kill or inhibit growth of B7-H6 cells in vitro or in vivo (in a subject, such as a human subject). Thus, also provided herein, in some embodiments, are methods of treating a subject that has, is suspected to have, or is at risk for a condition characterized by increased levels of cellular B7-H6 expression. Treating can include curing or reducing the symptoms associated with the particular condition. Thus, treating does not necessarily imply 100% or complete treatment. Rather, there are varying degrees of treatment of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. Treatment provided by the present disclosure can include the treatment of one or more conditions or symptoms of the disease being treated.
(55) Increased amounts of cellular B7-H6 expression is typically relative to a normal (healthy) cell that expresses little or no B7-H6. For example, where a normal (healthy) cell does not express detectable levels of B7-H6 and a diseased cell does express detectable levels of B7-H6, expression of B7-H6 by the diseased cell is characterized as increased. Generally, a method of treatment includes administering a therapeutically effective amount of an antibody, antibody fragment or fusion protein to a subject. A therapeutically effective amount can be determined by a medical professional by known methods. For example, an antibody may be delivered to a subject at a dosage of 10 ?g/kg to 1 mg/kg. Bispecific molecules may be delivered to a subject at a dosage of, for example, 100 ng/kg to 100 mg/kg. Cell comprising antibodies or antibody fragments may be delivered to subject at in an amount of, for example, 5?10.sup.7-5?10.sup.9 (e.g., 5?10.sup.8) cells. In some embodiments, an effective amount is an amount effective to reduce the growth of B7-H6-expressing (e.g., cancerous) cells by at least 20% relative to untreated control cells. For example, an effective amount may be an amount effective to reduce the growth of B7-H6-expressing cells by at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% or 100%. In some embodiments, an effective amount is an amount effective to reduce the growth of B7-H6-expressing cells by 10-100%, 20-100%, 30-100%, 40-100%, 50-100%, 60-100%, 70-1005, 80-100% or 90-100%.
(56) In some embodiments, the contacted B7-H6 cells can be in, for example, a cell culture or animal model of a disorder associated with aberrant expression or amounts of B7-H6. These methods are useful, for example, for measuring and/or ranking (relative to another antibody) the antibody's inhibitory activity for a specific B7-H6 cell type. Cytotoxicity of an antibody, antibody fragment or fusion protein (e.g., BiTE) can be assessed using any conventional assay including, e.g., a lactate dehydrogenase cytotoxicity assay such as the CYTOTOX 96? non-radioactive cytotoxicity assay commercially available from PROMEGA?.
(57) An antibody, or antigen-binding antibody fragment, used as provided herein can be any anti-B7-H6 antibody, or antigen-binding antibody fragment, of the present disclosure. Thus, the antibody can be chimeric, humanized, synthetic, F(ab).sub.2, Fv, scFv, F(ab).sub.2, F(ab), VL, VII, dsFv, Fv, or (scFv).sub.2, for example. In some embodiments, the methods include administering an IgG, an scFv, a dsFv, a F(ab).sub.2, a diabody, a bivalent antibody, a CAR, a BiTE or a DART that targets cells expressing B7-H6.
(58) In some embodiments, a subject who is administered an anti-B7-H6 antibody, or antigen-binding antibody fragment, is a subject having a cancer, an autoimmune disorder or an immunodeficiency disorder (e.g., Sjogren's syndrome, see, e.g., Rusakiewicz et al. Science Translational Medicine, 5(195): 195, 2013). For example, as subject may have lymphoma (e.g., T-cell lymphoma or B-cell lymphoma), leukemia (e.g., myeloid leukemia, acute nonlymphocytic leukemia. T-cell acute lymphoblastic leukemia), melanoma or sarcoma (e.g., gastric sarcoma). In some embodiments, a subject who is administered an anti-B7-H6 antibody, or antigen-binding antibody fragment, is a subject having myeloid leukemia, acute nonlymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, breast cancer, cervical cancer, clear cell renal cell carcinoma, dermatofibrosarcoma protuberans, gastric sarcoma, gastrointestinal stromal tumor, glioblastoma, leiomyosarcoma, invasive ductal breast carcinoma, malignant fibrous histiocytoma, melanoma, ovarian serous surface papillary carcinoma, pancreatic cancer, prostate cancer, T-cell acute lymphoblastic leukemia or T-cell lymphoma.
(59) In some embodiments, a subject is administered an engineered (e.g., recombinant) immune cell (e.g., T cell) that expresses an antibody or antigen-binding antibody fragment that binds specifically to B7-H6 (e.g., adoptive transfer). In some embodiments, the immune cell (e.g., T cell) comprises a CAR or BiTE that selectively binds B7-H6 (e.g., an epitope of B7-H6 bound by an scFV of
(60) In some embodiments, methods further include co-administering a second therapeutic agent for a disorder associated with elevated B7-H6. For example, methods may further include co-administering a cytotoxic, cytostatic, or anti-angiogenic agent suitable for treating a cancer. If the cancer is a B-cell lymphoma, the method can further include, for example, co-administration of rituximab, alemtuzumab or a CHOP (cyclophosphamide, hydroxydaunorubicin, oncovin and prednisone (or prednisolone) chemotherapeutic regimen.
(61) For use in treatment, the present disclosure also provides compositions (e.g., pharmaceutical compositions) comprising an antibody or antigen-binding antibody fragment that binds specifically to B7-H6 (e.g., an scFv of
(62) In some embodiments, a composition (e.g., a pharmaceutical composition) includes a carrier for the antibody, such as a pharmaceutically acceptable carrier. A pharmaceutically acceptable carrier can be any suitable pharmaceutically acceptable carrier. The term pharmaceutically acceptable carrier, refers to one or more compatible solid or liquid fillers, diluents, other excipients, or encapsulating substances, which are suitable for administration into a human or veterinary subject (e.g., a physiologically acceptable carrier or a pharmacologically acceptable carrier). The term carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application. The pharmaceutically acceptable carrier can be co-mingled with one or more of the active components, e.g., a hybrid molecule, and with each other, when more than one pharmaceutically acceptable carrier is present in the composition in a manner so as not to substantially impair the desired pharmaceutical efficacy. Pharmaceutically acceptable materials typically are capable of administration to a patient without the production of significant undesirable physiological effects such as nausea, dizziness, rash, or gastric upset. It is, for example, desirable for a composition comprising a pharmaceutically acceptable carrier not to be immunogenic when administered to a human patient for therapeutic purposes.
(63) A pharmaceutical composition can contain, in some embodiments, suitable buffering agents, including, for example, acetic acid in a salt, citric acid in a salt, boric acid in a salt, and phosphoric acid in a salt. Pharmaceutical compositions also may contain suitable preservatives, such as benzalkonium chloride, chlorobutanol, parabens, thimerosal, or a combination thereof.
(64) A pharmaceutical composition can be presented in unit dosage form and can be prepared by any suitable method, many of which are well-known. Such methods include the step of bringing an anti-B7-H6 antibody into association with a carrier that constitutes one or more accessory ingredients. In general, a composition is prepared by bringing the active agent into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the composition.
(65) A composition suitable for parenteral administration includes, for example, a sterile aqueous preparation of the composition, which preferably is isotonic with the blood of the recipient. This aqueous preparation can be formulated according to known methods using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation also can be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, and isotonic sodium chloride solution. In some embodiments, an anti-B7-H6 antibody composition is formulated and pre-packaged for subcutaneous injection in the form of a pen (e.g., single-use pen) or syringe (e.g., single-use syringe). Other forms of preparation and delivery systems are encompassed by the present disclosure.
(66) A subject may be an animal subject, such as a human subject. Animal subjects include, but are not limited to, animal models, such as, mammalian models of conditions or disorders associated with elevated B7-H6 expression such as those described above.
(67) Also provided herein are uses of anti-B7-H6 antibodies to detect in a test sample an altered amount of B7-H6 (e.g., cell surface B7-H6), for example, relative to a control. A test sample can be from a cell culture or from a test subject, e.g., a plasma or a tissue sample from a subject that has, is suspected to have, or is at risk for a disease or condition characterized by aberrant expression of B7-H6 in a subject. A control amount may correspond to the B7-H6 amount detected using the same antibody in a corresponding sample(s) from one or more control cultures or subjects. Methods of using anti-B7-H6 antibodies to determine B7-H6 amounts can include any immunoassay such as immuno-(western) blot, enzyme-linked immunosorbent assay (ELISA), and flow cytometry, e.g., fluorescence-activated cell sorting (FACS) analysis.
(68) Additionally, B7-H6 detection can be used to monitor the progress of a disorder associated with B7-H6 expression. Amounts of B7-H6 that are significantly elevated or decreased relative to control indicate that the subject's disorder is deteriorating or improving, respectively.
(69) The foregoing screens can be used to identify the presence or to monitor the progress of disorders, including those described above.
(70) The invention also provides kits suitable for carrying out the methods of the invention. Typically, a kit includes two or more components required for performing a therapeutic or detection method of the invention. Kit components include, but are not limited to, one or more antibody of the invention, appropriate reagents, and/or equipment.
(71) Also provided herein are kits that can include an anti-B7-H6 antibody and an immunoassay buffer suitable for detecting B7-H6 (e.g., by ELISA or FACS). The kit may also at least one microliter plate, standard, assay diluent, wash buffer, adhesive plate cover, and/or instructions for carrying out a method using the kit. The kit can include an antibody bound to a substrate (e.g., a multi-well plate or a chip), which is suitably packaged and useful for detecting B7-H6. In some embodiments, a kit includes an anti-B7-H6 antibody that is conjugated to a label, such as, a fluorescent label, a biologically active enzyme label, a luminescent label, or a chromophore label. A kit can further include reagents for visualizing the conjugated antibody, e.g., a substrate for the enzyme. In some embodiments, a kit includes an anti-B7-H6 antibody that is conjugated to a contrast agent and, optionally, one or more reagents or pieces of equipment useful for imaging the antibody in a subject. Generally the antibody of the invention in a kit is suitably packaged, e.g., in a vial, pouch, ampoule, and/or any container appropriate for a therapeutic or detection method. Kit components can be provided as concentrates (including lyophilized compositions), which may be further diluted prior to use or they can be provided at the concentration of use. When an anti-B7-H6 antibody is for use in vivo, single dosages may be provided in sterilized containers having the desired amount and concentration of agents.
(72) Embodiments of the present disclosure are described in more detail by the following non-limiting examples.
EXAMPLES
Example 1: Human scFvs Targeting Tumor Antigen B7H6
(73) Fully human scFvs against tumor antigen B7H6 were produced from a nonimmune library of 10.sup.9 human antibody scFv fragments cloned and expressed on the surface of yeast. Magnetic bead and single-cell sorting methods with positive selections for binding to B7H6-Ig, a fusion protein containing the extracellular portion of B7H6 and the Fc portion of a Mouse IgG2a, and negative selections for binding to a polyclonal mixture of Normal Mouse IgG were used. One round of random mutagenesis to isolate the clones described below was also performed.
(74) The scFvs, denoted generation 2.5 (Lib g2.5), showed 10-50 nM affinity as demonstrated in
(75) TABLE-US-00001 TABLE 1 Protein Sequence Distance Matrix: number of amino acid differences between each pair of variant. g2.5-9 g2.5-6 g2.5-3 g2.5-2 g2.5-9 3 1 3 g2.5-6 3 2 4 g2.5-3 1 2 2 g2.5-1 3 4 2
Experimental Validation of scFvs as Soluble scFv-Fc Proteins.
(76) Isolated scFvs were grafted onto VRC01 IgG1 antibody heavy chain constant regions (CH1-CH3) to obtain soluble scFv-Fc for testing. One representative clone, g2.5-11 (equivalent to Fg2.5-3 at the amino acid level), was expressed recombinantly in Human Embryonic Kidney (HEK) cells for soluble secretion. Purified scFv-Fe proteins were then screened for binding to both B7H6-expressing cell lines and soluble B7H6 antigen.
(77) Production/Purification of Fv-Fc.
(78) The representative g2.5-11 scFv-Fc was expressed recombinantly and purified. Briefly, HEK-293F cells at a density of 10.sup.6 cells/mL were transfected with pCMVR-g2.5-11-Fe plasmids at a concentration of 1.0 mg/L and cultured for 5 days before Protein A purification of cell culture supernatants. Cultures were centrifuged at 3,000?g for 15 minutes and supernatants were passed over 1.0 mL Protein A resin columns. Columns were then washed with 10 mL phosphate-buffered saline (PBS) before elution with 100 mM glycine, pH 3. Eluants were then buffer-exchanged back into PBS using Amicon-30K ultracentrifugation tubes.
(79) g2.5-11 scFv-Fc Binds B7H6-Expressing Cell Line RMA-B7H6 with KD?30 nM Affinity and does not Bind Negative Control RMA Cell Line.
(80) A Miltenyi Biotech MACSQuant? Flow Cytometer was used for cell-binding assays. To obtain an experimental K.sub.D, 2.5E5 RMA-B7H6 (B7H6-expressing) or RMA (negative control) cells/well were washed 3 times with PBS+0.1% BSA(PBS-F) before pre-incubation with 0-500 nM g2.5-11. Cells were then washed 3 times with PBS-F before secondary detection reagents were added. After a final wash with PBS-F, cells were resuspended in 200 mL PBS-Elwell before reading on a Miltenyi MACSQuant? flow cytometer. Results, shown in
(81) g2.5-11 scFv-Fc Binds an Epitope on B7H6 that is Distinct from Murine Antibody TZ47.
(82) For the competition assay, 2.5E5 RMA-B7H6 cells/well were washed 3? with PBS+0.1% BSA (PBS-F) before incubation with 500 nM of either g2.5-11 scFv-Fc, murine TZ47, or both for 1 hour. Cells were then washed 3 times with PBS-F before secondary detection reagents were added to measure the gain or loss of signal for g2.5-11 scFv-Fc (APC), and the competing murine TZ47 (FITC). After a final wash with PBS-F, cells were resuspended in 200 mL PBS-F/well before reading on a Miltenyi MACSQuant? flow cytometer.
(83) g2.5-11 scFv-Fc Binds Soluble B7H61 g Antigen.
(84) Anti-Human CH1 tips were activated with 0.05 mg/mL g2.5-11 scFv-Fc protein for 600 seconds to ensure saturation of tips with antigen. Tips were then transferred to PBS+0.1% Tween (PBS-T)-containing wells for baseline measurements of scFv-Fc-loaded tips before transferring to antigen-containing wells ranging from 0-500 nM B7H6-Ig. Samples were double-referenced using non-activated tips and PBS-T only containing wells. The Octet Analysis software was used for global kinetic fits which determine a single KD measurement for each antigen using association and dissociation curves for all concentrations tested. The quality of fits were determined by R.sup.2 correlation coefficients and are reported in
(85) Testing of g2.5-6 as a Fv Binding Region for a Chimeric Antigen Receptor (CAR).
(86) The Fv region from clone g2.5-6 was cloned into a CAR backbone containing the hinge, transmembrane and cytoplasmic region from human CD28 connected to the cytoplasmic region of CD3z. This new CAR contains the binding of g2.5-6 for B7H6, a costimulation signal from CD28 and a primary signal for T cells via CD3zeta. This CAR was expressed in T cells using a retroviral vector that also contains a truncated mouse CD19 gene for cell tracking. As shown in
(87) Specific Lysis of B7H6+ Tumor Cells by Fg2.5 CAR T Cells.
(88) Specific Lysis of B7H6+ Tumor Cells by Fg2.5 CAR T Cells.
(89) Effector T cells were cultured with RMA (
(90) TABLE-US-00002 TABLE2 AntibodyscFvAminoAcidSequences SEQ Name Sequence IDNO: g2.5-9 QVQLVQSGAEVKKPGASVKISCKASGYTLGTYTLHWMRQAPG 1 (G4S)3 QRIEWMGWINPGNGYTKYSQRLQGRVTINRDTSATTTYMELSS Linkerin LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSSGILGSGG bold GGSGGGGSGGGGSQSVLTQPASVSGSPGQSVTISCTGTSSDIGS YKFVSWYQHHPGKAPKLMIYDVTQRPSGVPYRFSGSKSGNTAS LTISGLQAEDEADYYCCSYAGDYTYALFGGGTQLTVLS g2.5-9 QVQLVQSGAEVKKPGASVKISCKASGYTLGTYTLHWMRQAPG 2 Heavy QRIEWMGWINPGNGYTKYSQRLQGRVTINRDTSATTTYMELSS Chain LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSS g2.5-9 QSVLTQPASVSGSPGQSVTISCTGTSSDIGSYKFVSWYQHHPGK 3 Light APKLMIYDVTQRPSGVPYRFSGSKSGNTASLTISGLQAEDEADY Chain YCCSYAGDYTYALFGGGTQLTVLS g2.5-9 GYTLGTYT 4 CDR-H1 g2.5-9 INPGNGYT 5 CDR-H2 g2.5-9 ATDRA 6 CDR-H3 g2.5-9 SSDIGSYKF 7 CDR-L1 g2.5-9 DVT 8 CDR-L2 g2.5-9 CSYAGDYTYAL 9 CDR-L3 g2.5-6 QVQLVQSGAEVKKPGASVKIPCKASGYTLGTYTLHWMRQAPG 10 QRIEWMGWINPGNGYTKYSQRFQGRVTINRDTSATTTYMELSS LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSSGILGSGG GGSGGGGSGGGGSQSVLTQPASVSGSPGQSVTISCTGTSSDIGS YKFVSWYQHHPGKAPKLMIYDVTQRPSGVPYRFSGSKSGNTAS LTISGLQAEDEADYYCCLYAGDYTYALFGGGTQLTVLS g2.5-6 QVQLVQSGAEVKKPGASVKIPCKASGYTLGTYTLHWMRQAPG 11 Heavy QRIEWMGWINPGNGYTKYSQRFQGRVTINRDTSATTTYMELSS Chain LRSEDTAVYFCATDRAVRRAFDIWGQGTMVTVSS g2.5-6 QSVLTQPASVSGSPGQSVTISCTGTSSDIGSYKFVSWYQHHPGK 12 Light APKLMIYDVTQRPSGVPYRFSGSKSGNTASLTISGLQAEDEADY Chain YCCLYAGDYTYALFGGGTQLTVLS g2.5-6 GYTLGTYT 13 CDR-H1 g2.5-6 INPGNGYT 14 CDR-H2 g2.5-6 ATDRA 15 CDR-H3 g2.5-6 SSDIGSYKF 16 CDR-L1 g2.5-6 DVT 17 CDR-L2 g2.5-6 CLYAGDYTYAL 18 CDR-L3 g2.5-3* QVQLVQSGAEVKKPGASVKISCKASGYTLGTYTLHWMRQAPG 19 QRIEWMGWINPGNGYTKYSQRFQGRVTINRDTSATTTYMELSS LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSSGILGSGG GGSGGGGSGGGGSQSVLTQPASVSGSPGQSVTISCTGTSSDIGS YKFVSWYQHHPGKAPKLMIYDVTQRPSGVPYRFSGSKSGNTAS LTISGLQAEDEADYYCCSYAGDYTYALFGGGTQLTVLS *theaminoacidsequenceforg2.5-3andg2.5-11are identical g2.5-3 QVQLVQSGAEVKKPGASVKISCKASGYTLGTYTLHWMRQAPG 20 Heavy QRIEWMGWINPGNGYTKYSQRFQGRVTINRDTSATTTYMELSS Chain LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSS g2.5-3 QSVLTQPASVSGSPGQSVTISCTGTSSDIGSYKFVSWYQHHPGK 21 Light APKLMIYDVTQRPSGVPYRFSGSKSGNTASLTISGLQAEDEADY Chain YCCSYAGDYTYALFGGGTQLTVLS g2.5-3 GYTLGTYT 22 CDR-H1 g2.5-3 INPGNGYT 23 CDR-H2 g2.5-3 ATDRA 24 CDR-H3 g2.5-3 SSDIGSYKF 25 CDR-L1 g2.5-3 DVT 26 CDR-L2 g2.5-3 CSYAGDYTYAL 27 CDR-L3 g2.5-1 QVQLVQSGAEVKKPGASVKISCKASGYTPGTYTLHWMRQAPG 28 QRIEWMGWINPGNGYTKYSQRFQARVTINRDTSATTTYMELSS LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSSGILGSGG GGSGGGGSGGGGSQSVLTQPASVSGSPGQSVTISCTGTSSDIGS YKFVSWYQHHPGKAPKLMIYDVTQRPSGVPYRFSGSKSGNTAS LTISGLQAEDEADYYCCSYAGDYTYALFGGGTQLTVLS g2.5-1 VQLVQSGAEVKKPGASVKISCKASGYTPGTYTLHWMRQAPGQ 29 Heavy RIEWMGWINPGNGYTKYSQRFQARVTINRDTSATTTYMELSSL Chain RSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSS g2.5-1 QSVLTQPASVSGSPGQSVTISCTGTSSDIGSYKFVSWYQHHPGK 30 Light APKLMIYDVTQRPSGVPYRFSGSKSGNTASLTISGLQAEDEADY Chain YCCSYAGDYTYALFGGGTQLTVLS g2.5-1 GYTLGTYT 31 CDR-H1 g2.5-1 INPGNGYT 32 CDR-H2 g2.5-1 ATDRA 33 CDR-H3 g2.5-1 SSDIGSYKF 34 CDR-L1 g2.5-1 DVT 35 CDR-L2 g2.5-1 CSYAGDYTYAL 36 CDR-L3 Consensus QVQLVQSGAEVKKPGASVKISCKASGYTLGTYTLHWMRQAPG 37 Sequence QRIEWMGWINPGNGYTKYSQRFQGRVTINRDTSATTTYMELSS LRSEDTAVYFCATDRAPVRRAFDIWGQGTMVTVSSGILGSGG GGSGGGGSGGGGSQSVLTQPASVSGSPGQSVTISCTGTSSDIGS YKFVSWYQHHPGKAPKLMIYDVTQRPSGVPYRFSGSKSGNTAS LTISGLQAEDEADYYCCSYAGDYTYALFGGGTQLTVLS
(91) TABLE-US-00003 TABLE3 AntibodyscFvNucleicAcidSequences SEQ Name Sequence IDNO: g2.5-9 CAGGTCCAGCTTGTACAGTCTGGGGCTGAGGTGAAGAAGCC 38 (G4S)3 TGGGGCCTCAGTGAAGATTTCCTGCAAGGCTTCTGGATACAC Linkerin CCTCGGTACCTACACTCTGCACTGGATGCGCCAGGCCCCCGG bold ACAAAGGATTGAGTGGATGGGATGGATCAACCCTGGCAATG GTTACACAAAATATTCACAGAGGCTCCAGGGCAGAGTCACC ATTAATAGGGACACATCCGCGACCACAACGTACATGGAGCT GAGCAGCCTGAGATCTGAAGACACGGCTGTATATTTCTGTGC GACAGATAGGGCTCCAGTTCGTCGTGCTTTTGATATCTGGGG CCAAGGGACAATGGTCACCGTCTCTTCAGGAATTCTAGGAT CCGGTGGCGGTGGCAGCGGCGGTGGTGGTTCCGGAGGC GGCGGTTCTCAGTCTGTTCTGACTCAGCCTGCCTCCGTGTCT GGGTCTCCTGGACAGTCGGTCACCATCTCCTGCACTGGCACC AGCAGTGACATTGGTTCTTATAAATTTGTCTCCTGGTACCAA CATCACCCCGGCAAAGCCCCCAAACTCATGATTTATGACGTC ACTCAGCGGCCCTCAGGGGTCCCTTATCGCTTCTCTGGCTCC AAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAG GCTGAAGATGAGGCTGATTATTACTGCTGCTCATATGCAGGC GACTACACTTATGCTCTATTCGGAGGAGGCACCCAGCTGACC GTCCTCTCC g2.5-6 CAGGTCCAGCTTGTACAGTCTGGGGCTGAGGTGAAGAAGCC 39 TGGGGCCTCAGTGAAGATTCCCTGCAAGGCTTCTGGATACAC CCTCGGTACCTACACTCTGCACTGGATGCGCCAGGCCCCCGG ACAAAGGATTGAGTGGATGGGATGGATCAACCCTGGCAATG GTTACACAAAATATTCACAGAGGTTCCAGGGCAGAGTCACC ATTAATAGGGACACATCCGCGACCACAACGTACATGGAGCT GAGCAGCCTGAGATCTGAAGACACGGCTGTATATTTCTGTGC GACAGATAGGGCTCCAGTTCGTCGTGCTTTTGATATCTGGGG CCAAGGGACAATGGTCACCGTCTCTTCAGGAATTCTAGGAT CCGGTGGCGGTGGCAGCGGCGGTGGTGGTTCCGGAGGC GGCGGTTCTCAGTCTGTTCTGACTCAGCCTGCCTCCGTGTCT GGGTCTCCTGGACAGTCGGTCACCATCTCCTGCACTGGCACC AGCAGTGACATTGGTTCTTATAAATTTGTCTCCTGGTACCAA CATCACCCCGGCAAAGCCCCCAAACTCATGATTTATGATGTC ACTCAGCGGCCCTCAGGGGTCCCTTATCGCTTCTCTGGCTCC AAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAG GCTGAAGATGAGGCTGATTATTACTGCTGCTTATATGCAGGC GACTACACTTATGCTCTATTCGGAGGAGGCACCCAGCTGACC GTCCTCTCC g2.5-3 CAGGTCCAGCTTGTACAGTCTGGGGCTGAGGTGAAGAAGCC 40 TGGGGCCTCAGTGAAGATTTCCTGCAAGGCTTCTGGATACAC CCTCGGTACCTACACTCTGCACTGGATGCGCCAGGCCCCCGG ACAAAGGATTGAGTGGATGGGATGGATCAACCCTGGCAATG GTTACACAAAATATTCACAGAGGTTCCAGGGCAGAGTCACC ATTAATAGGGACACATCCGCGACCACAACGTACATGGAGCT GAGCAGCCTGAGATCTGAAGACACGGCTGTATATTTCTGTGC GACAGATAGGGCTCCAGTTCGTCGTGCTTTTGATATCTGGGG CCAAGGGACAATGGTCACCGTCTCTTCAGGAATTCTAGGAT CCGGTGGCGGTGGCAGCGGCGGTGGTGGTTCCGGAGGC GGCGGTTCCCAGTCTGTTCTGACTCAGCCTGCCTCCGTGTCT GGGTCTCCTGGGCAGTCGGTCACCATCTCCTGCACTGGCACC AGCAGTGACATTGGTTCTTATAAATTTGTCTCCTGGTACCAA CATCACCCCGGCAAAGCCCCCAAACTCATGATTTATGATGTC ACTCAGCGGCCCTCAGGGGTCCCTTATCGCTTCTCTGGCTCC AAGTCTGGCAACACGGCTTCCCTGACCATCTCTGGGCTCCAG GCTGAAGATGAGGCTGATTATTACTGCTGCTCATATGCAGGC GACTACACTTATGCTCTATTCGGAGGAGGCACCCAGCTGACC GTCCTCTCC g2.5-1 AGGTCCAGCTTGTACAGTCTGGGGCTGAGGTGAAGAAGCCT 41 GGGGCCTCAGTGAAGATTTCCTGCAAGGCTTCTGGATACACC CCCGGTACCTACACTCTGCACTGGATGCGCCAGGCCCCCGGA CAAAGGATTGAGTGGATGGGATGGATCAACCCTGGCAATGG TTACACAAAATATTCACAGAGGTTCCAGGCCAGAGTCACCAT TAATAGGGACACATCCGCGACCACAACGTACATGGAGCTGA GCAGCCTGAGATCTGAAGACACGGCTGTATATTTCTGTGCGA CAGATAGGGCTCCAGTTCGTCGTGCTTTTGATATCTGGGGCC AAGGGACAATGGTCACCGTCTCTTCAGGAATTCTACGATCC GGTGGCGGTGGCAGCGGCGGTGGTGGTTCCGGAGGCGG CGGTTCTCAGTCTGTTCTGACTCAGCCTGCCTCCGTGTCTGG GTCTCCTGGACAGTCGGTCACCATCTCCTGCACTGGCACCAG CAGTGACATTGGTTCTTATAAATTTGTCTCCTGGTACCAACA TCACCCCGGCAAAGCCCCCAAACTCATGATTTATGATGTCAC TCAGCGGCCCTCAGGGGTCCCTTATCGCTTCTCTGGCTCCAA GTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAGGC TGAAGATGAGGCTGATTATTATTGCTGCTCATATGCAGGCGA CTACACTTATGCTCTATTCGGAGGAGGCACCCAGCTGACCGT CCTCTCC g2.5-11 CAGGTCCAGCTTGTACAGTCTGGGGCTGAGGTGAAGAAGCC 42 TGGGGCCTCAGTGAAGATTTCCTGCAAGGCTTCTGGATACAC CCTCGGTACCTACACTCTGCACTGGATGCGCCAGGCCCCCGG ACAAAGGATTGAGTGGATGGGATGGATCAACCCTGGCAATG GTTACACAAAATATTCACAGAGGTTCCAGGGCAGAGTCACC ATTAATAGGGACACATCCGCGACCACAACGTACATGGAGCT GAGCAGCCTGAGATCTGAAGACACGGCTGTATATTTCTGTGC GACAGATAGGGCTCCAGTTCGTCGTGCTTTTGATATCTGGGG CCAAGGGACAATGGTCACCGTCTCTTCAGGAATTCTAGGAT CCGGTGGCGGTGGCAGCGGCGGTGGTGGTTCCGGAGGC GGCGGTTCTCAGTCTGTTCTGACTCAGCCTGCCTCCGTGTCT GGGTCTCCTGGACAGTCGGTCACCATCTCCTGCACTGGCACC AGCAGTGACATTGGTTCTTATAAATTTGTCTCCTGGTACCAA CATCACCCCGGCAAAGCCCCCAAACTCATGATTTATGATGTC ACTCAGCGGCCCTCAGGGGTCCCTTATCGCTTCTCTGGCTCC AAGTCTGGCAACACGGCCTCCCTGACCATCTCTGGGCTCCAG GCTGAAGATGAGGCTGATTATTACTGCTGCTCATATGCAGGC GACTACACTTATGCTCTATTCGGAGGAGGCACCCAGCTGACC GTCCTCTCC