A CELL-BASED ARRAY PLATFORM
20190330601 ยท 2019-10-31
Inventors
- Eric Bennett (Lyngby, DK)
- Yoshiki NARIMATSU (Hellerup, DK)
- Catharina STEENTOFT (Copenhagen O, DK)
- Zhang Yang (Gentofte, DK)
- Ulla MANDEL (Copenhagen O, DK)
- Henrik CLAUSEN (Copenhagen O, DK)
Cpc classification
G01N33/6842
PHYSICS
International classification
Abstract
The present invention relates to a method for display of a plurality of mammalian glycans on cells or proteins for probing biological interactions and identifying glycan structures involved. A plurality of mammalian cells is genetically engineered in a combinatorial approach to differentially express the human glycome. Genetic engineering of the cell produces a plurality isogenic cells with different repertoires of glycosyltransferases and display of glycans that is used to interpret biological interactions. The plurality of engineered cells display glycans with and without the context of specific proteins exogeneously expressed, and is useful for detection and optimization of biological interactions for example binding of lectins, antibodies, viruses and bacteria and glycoproteins.
Claims
1. A plurality of isogenic mammalian cells, wherein one or more endogenous glycogenes have been inactivated and/or wherein one or more exogenous glycogene have been introduced independently in individual cells of said plurality of mammalian cells.
2.-14. (canceled)
15. The plurality of isogenic mammalian cells of claim 1, furthermore encoding an exogenous protein of interest or induced to overexpress an endogenous protein of interest.
16.-18. (canceled)
19. The plurality of isogenic mammalian cells of claim 15, in which the protein of interest is a lysosomal enzyme expressed to comprise one or more posttranslational modifications independently selected from: a) with 2,3NeuAc capping, b) without 2,3NeuAc capping, c) with 2,6NeuAc capping, d) without 2,6NeuAc capping, e) without LacDiNac structure, f) high Mannose6phosphate, g) low Mannose6phosphate, h) without bisecting glycoforms; and i) with high mannose.
20. The plurality of isogenic mammalian cells of claim 1, wherein said one or more endogenous glycogene inactivated and/or exogenous glycogene introduced independently in individual cells of said plurality of mammalian cells is selected from the list of GNPTAB, GNPTG, NAGPA, ALG3/6/8/9/10/12s, Mannosidases (MAN1A1, MAN1A2, MAN1B1, MAN1C1, MAN2A1, MAN2A2), MOGS, GANAB plus MGAT1/2 and Sialyl transferases.
21. The plurality of isogenic mammalian cells of claim 1 wherein said one or more endogenous glycogene inactivated is GNPTAB, such as in order to increase sialic acids.
22. The plurality of isogenic mammalian cells of claim 19, wherein said lysosomal enzyme has obtained increased mannose-6-phosphate (M6P) tagging of N-glycans and/or has obtained changed site occupancy of M6P, such as by knocking out a gene selected from ALG3, ALG8, NAGPA.
23. The plurality of isogenic mammalian cells of claim 19, wherein said lysosomal enzyme has obtained increased high mannose structures, such as by knocking out a gene selected from MGAT1 and/or GNPTAB and/or MOGS.
24.-39. (canceled)
40. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells has an inactivation and/or introduction of one or more glycogene selected from the list consisting of glycogenes associated with subset of O-Mannose type glycoproteins (listed in Table 5 under group 1 genes for O-Glycans), such as POMT1 and/or POMT2 and/or TMTC1 and/or TMTC2 and/or TMTC3 and/or TMTC4 (Group 1).
41.-43. (canceled)
44. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells has an inactivation and/or introduction of one or more glycogene selected from the list consisting of MGAT1 (N-Glycans), COSMC (O-GalNac), B4GALT7 (Glycosaminoglycans, GAG), B4GALT5/6 (Glycosphingolipids), POMGNT1 (O-Man) (Group 2).
45. (canceled)
46. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells has an inactivation and/or introduction of one or more glycogene selected from the list consisting of MGAT2/3/4A/4B/4C/4D/5/5B, MAN1A1, MAN1A2, MAN1B1, MAN1C1, MAN2A1, MAN2A2, MOGS, GANAB, B3GALT1/T2/T4/T5, B3GALNT1/T2, B3GNT2/T3/T4/T6/T7/T8/T9, B4GALT1/T2/T3/T4, B4GALNT1/T2/T3/T4, GCNT1/T2/T3/T4/T6/T7, B3GAT1/T2, B4GAT1, LARGE, GYLT1B (LARGE2), ABO, A4GNT, XXYLT1, EXT1/2, EXTL1/3, CHPF/2, CHSY1/3, and CSGALNACT1/T2 (Group 3).
47. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells has an inactivation and/or introduction of one or more glycogene selected from the list consisting of glycogenes associated with genes involved in N and O-glycan and glycolipid capping (sialylation), such as ST3GAL1/2/3/4/5/6 (2,3NeuAc capping/sialylation) and/or ST6GAL1/2 (2,6NeuAc capping/sialylation) and/or ST8SIA1/2/3/4/5/6 (capping by poly-sialylation) and/or ST6GALNAC1/2/3/4/5/6 (2,6NeuAc capping/sialylation) (Group 4).
48. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells has an inactivation and/or introduction of one or more glycogene selected from the list consisting of FUT1/2/3/4/5/6/7/8/9/10/11, ST3GAL1/2/3/4/5/6, ST6GAL1/2, ST6GALNAC1/2/3/4/5/6, and ST8SIA1/2/3/4/5/6 (Group 4).
49. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells has an inactivation and/or introduction of one or more glycogene selected from the list consisting of DSE, DSEL, CHST11/T12/T13/T14/T15, UST, NDST1/T2/T3/T4, GLCE, HS2ST1, HS3ST1/T2/T3A1/T3B1/T4/T5/T6, HS6ST1/T2/T3, SULF1/2, HPSE, CHST1/T2/T3/T4/T5/T6/T7/T8/T9/T10, GAL3ST1/T2/T3/T4, CHST8/T9/T10, CASD1, FAM20B, POMK, GNPTAB (Group 5).
50. The plurality of isogenic mammalian cells of claim 1, wherein one or more of said cells are HEK293 cells that has an introduction of one or more glycogene selected from the list of A3GALT2, A4GNT, ABO, ALG1L2, B3GALNT1, B3GALT2, B3GNT6, B4GALNT2, FUT5, FUT7, FUT9, GALNT15, GALNT5, GALNT9, GALNTL5, GALNTL6, GALNT19/WBSCR17, GCNT3, GCNT4, GCNT7, GLT1D1, GLT6D1, HAS1, MGAT4C, MGAT4D, ST6GAL2, ST6GALNAC1, ST8SIA1, ST8SIA3, ST8SIA4, CHST2, GAL3ST3, HS3ST1, HS3ST4, HS3ST5, NDST3 (Table 6).
51.-52. (canceled)
53. A glycome display library comprising the plurality of isogenic mammalian cells of claim 1.
54. (canceled)
55. Use of the glycome display library of claim 53 for the display of a plurality of different glycans on the surface of or after being released from said mammalian cells.
56. Use of the glycome display library of claim 53 for probing interactions of a glycan-binding entity, such as a glycan-binding-protein (GBP) with glycans presented by said mammalian cells.
57.-64. (canceled)
65. A mammalian cell capable of expressing a gene encoding a polypeptide of interest, wherein the polypeptide of interest is expressed comprising one or more of the posttranslational modification patterns: i) homogenous mono-antennary or biantennary N-glycans, and a) with 2,3NeuAc capping, b) without 2,3NeuAc capping, c) with 2,6NeuAc capping, d) without 2,6NeuAc capping, e) without LacDiNac structure, or f) with M6P.
66. (canceled)
67. A method for identifying glycoprotein glycovariants with improved drug properties comprising: a) producing a plurality of different glycoforms of said glycoprotein by expressing the glycoprotein in a plurality of different isogenic mammalian cells, each of said isogenic mammalian cells comprising different glycosylation capacities due to their having one or more endogenous glycogene that has been inactivated and/or one or more exogenous glycogene that has been introduced; b) determining the activity of the different glyco-forms in comparison with a reference glycoprotein in suitable bioassay; and c) selecting the glycoform with the higher/highest/optimal activity.
68. The method of claim 67, wherein said one or more endogenous glycogene inactivated and/or exogenous glycogene introduced in said isogenic mammalian cells is selected from the list of GNPTAB, GNPTG, NAGPA, ALG3/6/8/9/10/12s, Mannosidases (MAN1A1, MAN1A2, MAN1B1, MAN1C1, MAN2A1, MAN2A2), MOGS, GANAB plus MGAT1/2 and Sialyl transferases.
Description
LEGENDS TO THE FIGURE
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025] AAVS1 ZFN ObLiGaRe mediated donor target integration at the AAVS1 safe harbour site. SH #1; CHO-K1 safe harbour site #1 landing pad and binding site for CHO SH #1 ZFNs. CMV-IE; CMV immediate early promoter. GOI; gene of interest ORF. BgH; bovine growth hormone poly-(A) and 3URT. Ins; insulator sequences.
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
DETAILED DISCLOSURE OF THE INVENTION
[0043] As described above the present invention relates to a plurality of isogenic mammalian cells, wherein one or more glycogenes have been inactivated and/or introduced to alter the glycosylation capacity and display of glycans on the cell surface of said cells.
[0044] In some embodiments of the present invention the plurality of mammalian cells comprises two or more glycosyltransferase genes that have been inactivated.
[0045] Group 2 (Type of Glycoconjugate)
[0046] In some embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the glycogenes listed as group 2 genes suitable for determining the types of glycoconjugates involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of MGAT1 (N-Glycans) and/or COSMC (O-GalNac) and/or B4GALT7 (Glycosaminoglycans, GAG) and/or B4GALT5/6 (Glycosphingolipids) and/or POMGNT1 (O-Man) is used to identify if said interaction occurs through the type of glycoconjugate indicated in parenthesis, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the corresponding type(s) of glycoconjugate(s) is responsible for the interaction as indicated.
[0047] Group 1 (Initiation)
[0048] All Subtypes of O-GalNAc Linked Mucin-Type O-Glycans:
[0049] In some embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the GALNT glycogenes (listed in Table 5 under group 1 genes for N-glycans). Determining changes in interactions with a plurality of mammalian cells with knock out of GALNT1 and/or GALNT2 and/or GALNT3 and/or GALNT4 and/or GALNT6 and/or GALNT7 and/or GALNT10 and/or GALNT11 and/or GALNT12 and/or GALNT13 and/or GALNT14 and/or GALNT16 and/or GALNT18 is used to identify if said interaction occurs through subsets of O-GalNAc glycoproteins controlled by one or more of the 20 GALNTs, respectively, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the O-glycoprotein(s) responsible for the interaction requires glycosylation by the corresponding GALNT(s).
[0050] O-Xylose,
[0051] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the XYLT1 and/or XYLT2 glycogenes for determining if O-xylose type glycoproteins are involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of XylT1/XylT2 is used to identify if said interaction occurs through O-Xylose glycoproteins, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the O-glycoprotein(s) responsible for the interaction requires glycosylation by the XYLT(s).
[0052] All Subtypes O-Fucose,
[0053] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the O-glycan glycogenes (listed in Table 5 under group 1 genes for O-Glycans), suitable for determining subsets of O-Fucosylated type glycoproteins involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of POFUT1 and/or POFUT2 is used to identify if said interaction occurs through fucosylated O-glycan type of glycoconjugate, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the O-glycoprotein(s) responsible for the interaction requires glycosylation involving the corresponding POFUT activity.
[0054] POMT's (O-Mannose)
[0055] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the O-glycan glycogenes (listed in Table 5 under group 1 genes for O-Glycans), suitable for determining subsets of O-Mannose type glycoproteins involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of POMT1 and/or POMT2 and/or TMTC1 and/or TMTC2 and/or TMTC3 and/or TMTC4 is used to identify O-mannose type of glycoconjugate, such that loss or reduction in measured interactions with mammalian cells with knock out of the gene(s) confer that the O-Mannosylated glycoconjugate responsible for the interaction requires glycosylation involving initiation by POMT1 or POMT2 or TMTC1 or TMTC2 or TMTC3 or TMTC4.
[0056] TMTC's (O-Mannose)
[0057] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the O-glycan glycogenes (listed in Table 5 under group 1 genes for O-Glycans), suitable for determining subsets of O-Mannose type glycoproteins involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of TMTC1 and/or TMTC2 and/or TMTC3 and/or TMTC4 is used to identify an O-mannose type of glycoconjugate, such that loss or reduction in measured interactions with mammalian cells with knock out of the gene(s) confer that the O-Mannosylated glycoconjugate responsible for the interaction requires glycosylation involving initiation by one of the TMTC1-4 genes.
[0058] POGLUT1 Only One Gene
[0059] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the O-glycan glycogenes (listed in Table 5 under group 1 genes for O-Glycans), suitable for determining subsets of O-glycan type glycoproteins involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of POGLUT1 is used to identify if said interaction occurs through the O-glucose type of glycoconjugate, such that loss or reduction in measured interactions with mammalian cells with knock out of POGLUT1 confer that the O-glycoprotein(s) responsible for the interaction requires O-Glucose modification.
[0060] All Subtypes of N-Linked Glycoproteins:
[0061] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the STT3A/B (initiation) and ALG3/6/8/9/12 (oligomannose synthesis) glycogenes (listed in Table 5 under the group 1 genes for N-Glycans) suitable for determining subsets of N-linked type glycoproteins involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of STT3A and/or STT3B and/or ALG3 and/or ALG6 and/or ALG8 and/or ALG9 and/or ALG12 is used to identify if said interaction occurs through subsets of N-linked glycoproteins controlled by one of the two STT3 catalytic units or one of the five ALG enzymes, such that loss or reduction in measured interactions with mammalian cells with knock out of the named gene confer that the N-glycoprotein(s) responsible for the interaction requires glycosylation conferred by the corresponding STT3A or STT3B or one of the ALG's, including ALG3, ALG6, ALG8, ALG9, ALG10 and ALG12.
[0062] All Subtypes of C-Mannosylated Glycoproteins:
[0063] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the DPY19L1, DPY19L2, DPY19L3 and DPY19L4 glycogenes (listed in Table 5 under group 1 genes for C-mannosylation) suitable for determining subsets of C-mannosylation type glycoproteins involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of DPY19L1 and/or DPY19L2 and/or DPY19L3 and/or DPY19L4 is used to identify if said interaction occurs through subsets of C-mannosylated glycoproteins controlled by one or more of the four DPY19L genes, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the C-mannosylated protein(s) responsible for the interaction as indicated.
[0064] Group 3
[0065] N-Glycan Branching
[0066] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of MGAT2 or MGAT3 (for mono antennary), MGAT3, MGAT4A, MGAT4B or MGAT5 (for bi antennary), MGAT3, MGAT4A, MGAT4B or MGAT3/5 (for tri-antennary) and knock out of MGAT3 combined with knock-in of MAGAT5 and MGAT4A and/or MGAT4B (for tetra-antennary) glycogenes (listed in Table 5, group 3 genes) suitable for determining N-linked branched glycans involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out and/or knock in of MGAT2 and/or MGAT3 and/or MGAT4A and/or MGAT4B and/or MGAT5 is used to identify if said interaction occurs through N-linked antennae controlled by one or more of these enzymes, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the N-linked antennae(s) is responsible for the interaction as indicated.
[0067] N-Glycan Oligomannose Trimming
[0068] In other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of MAN1A1, MAN1A2, MAN1B1, MAN1C1, MAN2A1, MAN2A2 or MOGS or GANAB (oligomannosidase trimming) glycogenes (listed in Table 5, group 3 genes) suitable for determining N-linked branched glycans involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out and/or knock in of MAN1A1 and/or MAN1A2 and/or MAN1B1 and/or MAN1C1 and/or MAN2A1 and/or MAN2A2 and/or MOGS and/or GANAB is used to identify if said interaction occurs through N-linked antennae controlled by one or more of these enzymes such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the oligomannose trimming is responsible for the interaction as indicated.
[0069] O-Glycan Branching
[0070] In some other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of GCNT1, GCNT2, GCNT3, GCNT4, GCNT6, GCNT7, B3GNT6 or B3GNT2 glycogenes (listed in Table 5, group 3 genes) suitable for determining O-linked branching in Core2 Core3 and Core4 structures, involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of GCNT1 and/or GCNT2 and/or GCNT3 and/or GCNT4 and/or GCNT6 and/or GCNT7 and/or B3GNT6 and/or B3GNT6 is used to identify if said interaction occurs through O-linked branched structures by one or a plurality of the branching enzymes, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the O-linked branched structure is responsible for the interaction as indicated.
[0071] N and O-Elongation (LacNAc 1-3/1-4/LacdiNAc), O-GalNAc Core 1-4, PolyLAc/Branching
[0072] In yet other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of B3GNT2/3/4/6/7/8/9, B4GALT1, B4GALT2, B4GALT3 or B4GALT4 (type2) and/or B4GALT1/2/3/4/5 (type1) and/or B4GALNACT3/4 and/or GCNT2 glycogenes (listed in Table 5, group 3 genes) suitable for determining N, and O-linked elongated LacNac (polylacNAc when repeated), LacdiNAc and branched structures respectively, involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of B3GNT2/3/4/6/7/8/9 and/or B4GALT1/2/3/4 and/or B3GALT1/2/3/4/5 and/or B4GALNACT3/4 and/or GCNT2 is used to identify if said interaction occurs through N or O-linked elongated structures by one or a plurality of the elongation enzymes, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the N or O-linked branched structure is responsible for the interaction as indicated.
[0073] Glycosaminoglycans and Glycolipids Branching/Elongation
[0074] In some embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of the glycogenes listed as group 2 genes suitable for determining the types of glycoconjugates involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of EXTL2/3 (Heparan Sulphate) and/or CSGALNACT1/2 (chondroitin/chondoitin-sulfate) and/or A4GALT (glycolipids globo) and/or B3GNT5 (glycolipids lacto) and/or B4AGLNT1 (glycolipids ganglio) is used to identify if said interaction occurs through the type of glycoconjugate indicated in parenthesis, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the corresponding type(s) of glycoconjugate(s) is responsible for the interaction as indicated.
[0075] Group 4
[0076] NeuAc's/Polysialylation Capping
[0077] In yet other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with individual and combinatorial knock out of genes involved in N and O-glycan and glycolipid capping (sialylation); ST3GAL1/2/3/4/5/6 (2,3NeuAc capping/sialylation) and/or ST6GAL1/2 (2,6NeuAc capping/sialylation) and/or ST8SIA1/2/3/4/5/6 (capping by poly-sialylation) and/or ST6GALNAC1/2/3/4/5/6 (2,6NeuAc capping/sialylation) (glycogenes listed in Table 5, group 4 genes) suitable for determining the capped (sialylated or fucosylated) glycan structure involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of ST3GAL1/2/3/4/5/6 and/or ST6GAL1/2 and/or ST8SIA1/2/3/4/5/6 and/or ST6GALNAC1/2/3/4/5/6 is used to identify if said interaction occurs through the type of capping indicated in parenthesis, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named groups of genes confer that the type of capping is responsible for the interaction as indicated.
[0078] Fucosylation Capping
[0079] In yet other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with knock out of genes involved in O-glycan capping by fucosylation; FUT1/2 (1,2 fucosylation) and/or FUT3/4/5/6/7/9/10/11 (1,3/4 fucosylation) (glycogenes are listed in Table 5, group 4 genes) suitable for determining type of O-fucosylation involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of FUT1/2 and/or FUT3/4/5/6/7/9/10/11 is used to identify if said interaction occurs through the type of fucosylation indicated in parenthesis, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene groups confer that the corresponding type of fucosylation is responsible for the interaction as indicated.
[0080] Group 5
[0081] Sulfation, Acetylation and Other Modifications
[0082] In yet other embodiments of the present invention the plurality of mammalian cells comprises or consists of mammalian cells with one or more knock out of CHST1/2/3/4/5/6/7/8/9/10 (SO.sub.4.sup.2 sulfation) and/or CASD1 (AcO.sup. acetylation) glycogenes (listed in Table 5, group 5 genes) suitable for determining modification of glycan structures, involved in observed interactions. Determining changes in interactions with a plurality of mammalian cells with knock out of CHST1/2/3/4/5/6/7/8/9/10 and/or CASD1 is used to identify if said interaction occurs through type of glyco-modification indicated in parenthesis, such that loss or reduction in measured interactions with mammalian cells with knock out of one or more of the named gene(s) confer that the corresponding type of modification is responsible for the interaction as indicated.
[0083] HEK293 Missing Genes Knock In
[0084] In yet other embodiments of the present invention the plurality of mammalian cells comprises or consists of HEK293 cells with knock in of one or more of the following human glycogenes that are not expressed or expressed at low levels in HEK293 cells (Table 6): A3GALT2, A4GNT, ABO, ALG1L2, B3GALNT1, B3GALT2, B3GNT6, B4GALNT2, FUT5, FUT7, FUT9, GALNT15, GALNT5, GALNT9, GALNTL5, GALNTL6, GALNT19/WBSCR17, GCNT3, GCNT4, GCNT7, GLT1D1, GLT6D1, HAS1, MGAT4C, MGAT4D, ST6GAL2, ST6GALNAC1, ST8SIA1, ST8SIA3, ST8SIA4, CHST2, GAL3ST3, HS3ST1, HS3ST4, HS3ST5, NDST3.
[0085] In some embodiments of the present invention comprises mammalian cells displaying N-glycans with only 2,3NeuAc capping by knock out of ST6GAL1 and/or ST6GAL2
[0086] In some other embodiments of the present invention comprises mammalian cells displaying N-glycans with only 2,6NeuAc capping by knock out of one or more of ST3GAL1, ST3GAL2, ST3GAL3, ST3GAL4, ST3GAL5 and ST3GAL6.
[0087] In some embodiments of the present invention the plurality of mammalian cells comprises mammalian cells displaying N-glycans without NeuAc capping by knock out of ST3GAL3/4/6 and/or ST6GAL1/2.
[0088] Another object of the present invention relates to a plurality of mammalian cells comprising one or more glycosyltransferase genes that have been introduced stably by site-specific gene or non-site-specific knock in and with different glycosylation capacities.
[0089] Another object of the present invention relates to a plurality of mammalian cells comprising one or more glycosyltransferase genes that have been introduced transiently and with different glycosylation capacities.
[0090] In some embodiments of the present invention the plurality of mammalian cells comprises two or more glycosyltransferases that have been introduced stably by site-specific or non-site-specific gene knock in.
[0091] An aspect of the present invention relates to a plurality of mammalian cells comprising one or more glycosyltransferase genes introduced stably by site-specific or non-site-specific gene knock in, and furthermore comprising one or more endogenous glycosyltransferase genes that have been inactivated by knock out, and with different glycosylation capacities.
[0092] In some embodiments of the present invention the cell is a human cell.
[0093] In some embodiments of the present invention the mammalian cell expresses at least 95% of the human glycogenes identified in Table 1 or heterologous homologs hereof, or at least 50%, such as 55%, such as 60%, such as 65%, such as 70%, such as 75%, such as 80%, such as 85%, such as 90% of human glycogenes identified in Table 1 or heterologous homologs hereof.
[0094] In some other embodiments of the present invention the mammalian cell is derived from human kidney.
[0095] In further embodiments of the present invention the mammalian cell is selected from the group consisting of NS0, SP2/0, YB2/0, HEK293, HUVEC, HKB, PER-C6, NS0, or derivatives of any of these cells.
[0096] In some embodiments of the present invention is the mammalian cell a HEK293 cell.
[0097] In some other embodiments of the present invention the plurality of mammalian cells furthermore encodes one or more exogenous proteins of interest, such as a glycoprotein of interest.
[0098] In further embodiments of the present invention are the glycosyltransferases that are inactivated belonging to the CAZy families as listed in Table 1.
[0099] In yet other embodiments of the present invention are the glycosyltransferases that are inactivated belonging to same subfamily of isoenzymes in a CAZy family.
[0100] In yet other embodiments of the present invention is the glycosylation non-galactosylated (for example by knock-out of B4GALT1-6).
[0101] In some embodiments of the present invention the glycosylation comprises biantennary N-glycans (for example by knock-out of ST6GAL1/2).
[0102] In some other embodiments of the present invention does the glycosylation not comprise poly-LacNAc (for example by knock-out of B3GNT2/3/4/7/8/9).
[0103] In some other embodiments of the present invention does the glycosylation not comprise LacDiNAc (for example by knock-out of B4GALNT3/4).
[0104] In yet other embodiments of the present invention comprises mammalian cells displaying N-glycans without fucose by knock-out of FUT8.
[0105] Glycosylation in mammalian cells is a non-template driven process involving more than 200 glycosyltransferases and other enzymes and transporters, and the repertoire of these genes expressed in a given cell is the major determinant of the glycome produced.
[0106] GTf Genes
[0107] Mammalian cells have a large number of glycosyltransferase genes and over 200 distinct genes have been identified and their catalytic properties and functions in glycosylation processes partially determined (Ohtsubo 2006; Lairson 2008; Bennett 2012; Schachter 2014). These genes are classified in homologous gene families with related structural folds in the CAZy database (www.cazy.org). The encoded glycosyltransferases catalyse different steps in the biosynthesis of glycosphingolipids, glycoproteins, GPI-anchors, and proteoglycans (together termed glycoconjugates), as well as oligosaccharides found in mammalian cells. Enormous diversity exists in the structures of glycans on these molecules, and biosynthetic pathways for different types of glycans have been worked out (Kornfeld 1985; Tarp 2008; Bennett 2012; Schachter 2014), although our understanding of which glycosyltransferase enzyme(s) that catalyze a particular linkage in the biosynthesis of the diverse set of glycoconjugates produced in a mammalian cell is not complete. Glycosylation in cells is a non-template driven process that relies on a number of factors many of which are unknown for producing the many different glycoconjugates and glycan structures with a high degree of fidelity and differential expression and regulation in cells. These factors may include: expression of the glycosyltransferase proteins; the subcellular topology and retention in the ER-Golgi secretory pathway, the synthesis, transport into, and availability of sugar nucleotide donors in the secretory pathway; availability of acceptor substrates; competing glycosyltransferases; divergence and/or masking of glycosylation pathways that affect availability of acceptor substrates and/or result in different structures; and the general growth conditions and nutritional state of cells.
[0108] GTf Isoenzymes
[0109] A number of the glycosyltransferase genes have high degree of sequence similarity and these have been classified into subfamilies encoding closely related putative isoenzymes, which have been shown to or predicted to serve related or similar functions in biosynthesis of glycans in cells (Tsuji 1996; Amado 1999; Narimatsu 2006; Bennett 2012). Examples of such subfamilies include the polypeptide GalNAc-transferases (GalNT1 to 20), 2,3sialyltransferases (ST3GAL1-6), 2,6sialyltransferases (ST6GAL1 and 2), 2,6sialyltransferases (ST6GALNAC1 to 6), 2,8sialyltransferases (ST8SIA1 to 6), 4galactosyltransferases (B4GALT1 to 7), 33galactosyltransferases (B3GALT1 to 6), 3GlcNAc-transferases (B3GNT2 to 9), 6GlcNAc-transferases (GCNT1-7 including GCNT2A, 2B and 2C (also known as C2GnT1-7 and IGnT2A to C), 4GalNAc-transferases (B4GALNT1 to 4), 33glucuronyltransferase (B3GAT1 to 3), 3/4-fucosyltransferases (FUT1 to 11), O-fucosyltransferases (POFUT1 and 2), O-glucosyltransferases (POGLUT 1 and 2), 4GlcNAc-transferases (MGAT4A to C), 36GlcNAc-transferases (MGAT5 and 5B), and hyaluronan synthases (HAS1 to 3) (Hansen 2014) (See Table 1 and
[0110] GTf Subfamily Functions
[0111] These subfamilies of isoenzymes are generally poorly characterized and the functions of individual isoenzymes unclear. In most cases the function of isoforms are predicted from in vitro enzyme analysis with artificial substrates and these predictions have often turned out to be wrong or partially incorrect (Marcos 2004). Isoenzymes may have different or partially overlapping functions or may be able to provide partial or complete backup in biosynthesis of glycan structures in cells in the absence of one or more related glycosyltransferases. It is therefore not possible to reliably predict how deficiency of a particular gene in these subfamilies will affect the glycosylation pathways and glycan structures produced on the different glycoconjugates in a cell.
[0112] Engineering GTfs in Cells
[0113] Only little information exists as to the effects of knock out of glycosyltransferase genes in mammalian cell lines. For human cell lines only a few spontaneous mutants of glycosyltransferase genes have been identified. For example the colon cancer cell line LSC derived from LS174T has a mutation in the COSMC chaperone that leads to misfolded and non-functional core1 synthase C1GalT (Ju 2008). The COSMC gene is also mutated in the human lymphoblastoid Jurkat cell line (Ju 2008; Steentoft 2011). A series of CHO cell lines (Lec cell lines) with deficiency in one glycosyltransferase gene was originally generated by random mutagenesis follow by lectin selection, and the isolated lectin-resistant mutant clones were later shown to have defined mutations in the glycosyltransferase genes Mgat1 (Lec1), Mgat5 (Lec4), and B4galt1 (Lec20) (Patnaik 2006).
[0114] Knock Out of Glycosylation Genes in Cell Lines
[0115] The limited information of effects of knock out of glycosyltransferase genes in cell lines is partly due to past difficulties with making knock outs in cell lines before the recent advent of precise gene editing technologies (Steentoft 2014). Thus, until recently essentially only one glycosyltransferase gene, FUT8, had been knocked out in a directed approach using two rounds of homologous recombination including massive clone screening efforts. The conventional gene disruption by homologous recombination is typically a very laborious process as evidenced by this knock out of Fut8 in CHO, as over 100,000 clonal cell lines were screened to identify a few growing Fut8/ clones (Yamane-Ohnuki 2004) (U.S. Pat. No. 7,214,775). With the advent of the Zinc finger nuclease (ZFN) gene targeting strategy it became less laborious to disrupt genes, which was first demonstrated by knock out of the Fut8 gene in a CHO cell line, where additional two other genes unrelated to glycosylation were also effectively targeted (Malphettes 2010). More recently, TALENs and the CRISPR/Cas9 editing strategies have emerged, and the latter editing strategy was used to knock out the Fut8 gene (Ronda 2014).
[0116] It is thus clear that targeted genetic engineering is now a tool the skilled person may use but editing of the glycosylation genes in mammalian cells and animals are prone to substantial uncertainty, and thus identifying the optimal engineering targets for display of a given glycan structure will require extensive experimental efforts. Therefore a random type approach involving testing of a multiplicity of different glycogene and glycoform variations may be beneficial.
[0117] Overexpression of Glycosylation Genes in Cell Lines
[0118] It is noteworthy that transient or stable overexpression of a glycosyltransferase gene in a cell most often result in only partial changes in the glycosylation pathways in which the encoded enzyme is involved. A number of studies have attempted to overexpress e.g. the core2 C2GnT1 enzyme in CHO to produce core2 branched O-glycans, the ST6GAL1 sialyltransferase to produce 2,6linked sialic acid capping on N-glycoproteins (El Mai 2013), and the ST6GALNAC1 sialyltransferase to produce 2,6linked sialic acid on O-glycoproteins forming the cancer-associated glycan STn (Sewell 2006). However, in all these studies heterogeneous and often unstable glycosylation characteristics in transfected cell lines have been obtained. This is presumably partly due to competing endogenous glycosyltransferase activities whether acting with the same substrates or diverging pathway substrates. Other factors may also explain the heterogeneous glycosylation characteristics.
[0119] Display of Protein Glycoforms by Recombinant Expression
[0120] Human cells produce a variety of complex glycan structures not found in other mammalian cells. HEK293 has been the preferred human cell line for expression of recombinant proteins (Walsh 2014), and this cell line produce complex type N and O-glycans with both 2,3 and 2,6 sialic acid capping of N-glycans, extensive fucosylation, and LacDiNAc structures (Bohm 2015).
[0121] Genetic engineering of human cells have recently been introduced to alter the glycosylation of recombinant expressed proteins. Human cell lines including HEK293 with inactivation of the COSMC gene have been produced, and these cell lines produce O-glycans with truncated GalNAc1-O-Thr structure with variable degree of sialic acid capping (Stentoft 2013).
[0122] Sugar chains of glycoproteins are roughly divided into two types, namely a sugar chain which binds to asparagine (N-glycoside-linked sugar chain) and a sugar chain which binds to other amino acid such as serine, threonine (O-glycoside-linked sugar chain), based on the binding form to the protein moiety (
[0123] For the present invention it is to be understood that the sugar chain terminus which links to the protein or lipid moiety is called a reducing end, and the opposite side is called a non-reducing end. It is known that the N-glycoside-linked sugar chain includes a high mannose type in which mannose alone binds to the non-reducing end of the core structure; a complex type in which the non-reducing end side of the core structure has at least one parallel branches of galactose-N-acetylglucosamine (hereinafter referred to as Gal-GlcNAc) and the non-reducing end side of Gal-GlcNAc has a structure of sialic acid, bisecting N-acetylglucosamine or the like; a hybrid type in which the non-reducing end side of the core structure has branches of both of the high mannose type and complex type.
[0124] The glycome of a cell is the sum of all glycan structures produced in that cell. Individual glycan structures may have important biological functions, and example serve as ligands for carbohydrate-binding proteins such as lectins, toxins and adhesins found in bacteria and viruses. The glycome of a mammalian and human cell is vast with 1,000s of different glycan structures on different types of glycolipids, glycoproteins, proteoglycans (glycoconjugates) and also free oligosaccharides. There exist a number of ways to isolate and characterize these glycoconjuagtes, but it is often very difficult to obtain homogeneous structures with respect to the glycan part and to prepare comprehensive isolation of all structures found in the glycome. Advances in organic synthesis and chemoenzymatic strategies of glycans have facilitated access to pure glycan structures, which has led to generation of glycan libraries representing the glycome, although so far not comprehensive. These advances has enabled development of glycan array technologies where individual glycans are attached to microarray slides, and used for display of parts of the glycome for interrogation of biological interactions with glycans (Rillahan 2011, Blixt 2004, Padler-Karavani 2012). However, the current glycan arrays only display limited subsets of the glycome of cells and they display glycans without the context of proteins, proteoglycans and lipids as well as the cell membrane.
[0125] There is a need for development of new methods for the display of mammalian and preferably human glycomes that are comprehensive and with the context of glycoconjugates and the cell membrane.
[0126] Moreover there is a need to develop a plurality of mammalian cells that display the mammalian and preferably the human glycomes in a comprehensive way, and such that individual glycan structures can be probed and assessed by interpretation as contributing to a particular biological interaction measured by use of the cell or shed/secreted proteins or components from the cell.
[0127] This present invention discloses a gene engineering method involving knock out and knock in of over 250 mammalian and human glycosyltransferase and related glycogenes to develop a plurality of mammalian, such as human cells displaying differential parts of the cell glycome, and use of such plurality of engineered mammalian cells to display and probe the glycome in the context of the glycoconjugate structure and/or cell membrane. Moreover the invention provides a method for step-by-step assessing and interpreting the biosynthetic pathway(s) and glycan structure(s) involved in biological interactions probed by use of the plurality of mammalian cells displaying the glycome.
[0128] In one aspect, ZFN targeting designs for inactivation of glycosyltransferase genes are provided.
[0129] In another aspect, TALEN targeting designs for inactivation of glycosyltransferase genes are provided.
[0130] In yet another aspect, CRISPR/Cas9 based targeting for inactivation of glycosyltransferase genes is provided.
[0131] In certain embodiments, the invention provides mammalian cells with inactivation of two or more glycosyltransferase genes encoding isoenzymes with partially overlapping glycosylation functions in the same glycosylation pathway, and for which inactivation of two or more of these genes is required for loss of said glycosylation functions in the cell.
[0132] In certain embodiments, the invention provides mammalian cells with inactivation of two or more glycosyltransferase genes encoding isoenzymes with partially overlapping glycosylation functions in the same glycosylation pathway and biosynthetic step, and for which inactivation of two or more of these genes is required for loss of said glycosylation functions in the cell.
[0133] In certain embodiments, the invention provides mammalian cells with inactivation of two or more glycosyltransferase genes encoding isoenzymes with no overlapping glycosylation functions in the same glycosylation pathway, and for which inactivation of two or more of these genes is required for loss of said glycosylation functions in the cell.
[0134] In some other embodiments, the invention provides mammalian cells with inactivation of two or more glycosyltransferase genes encoding enzymes with unrelated glycosylation functions in the same glycosylation pathway, and for which inactivation of two or more genes is required for abolishing said glycosylation functions in the cell.
[0135] In some other embodiments, the invention provides mammalian cells with inactivation of two or more glycosyltransferase genes encoding enzymes with unrelated glycosylation functions in different glycosylation pathways, and for which inactivation of two or more genes is required for desirable glycosylation functions in the cell.
[0136] In some other embodiments, the present invention provides a defined set of 266 glycosyltransferase and related glycogenes with which to combinatorially construct the plurality of mammalian cells capable of displaying the glycome in a plurality of mammalian cells with capability to address the glycome on said cells and/or products from these in biological assays, and to interpret glycans involved in biological assays with respect to the glycosyltransferase and related genes controlling biosynthesis of such glycan(s) and the structure(s).
[0137] In some other embodiments, the present invention provides a limited set of up to 47 glycosyltransferase and related glycogenes with which to combinatorially construct the plurality of mammalian cells capable of displaying the glycoconjugate type (the initiation step 1,
[0138] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of up to 13 glycosyltransferase and related glycogenes required for displaying the truncated human glycome on all types of plurality of mammalian cells capable of displaying the glycoconjugate type (the truncation step 2,
[0139] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of up to 67 glycosyltransferase and related glycogenes required for display of elongated and branched core structures for the human glycome on all types of glycoconjugates in a plurality of mammalian cells (the elongation, brancing core structures, step 3,
[0140] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of up to 35 glycosyltransferase and related glycogenes required for display of glycan capping of the human glycome on all types of glycoconjugates in a plurality of mammalian cells (the capping, step 4,
[0141] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of up to 44 glycosyltransferase and related glycogenes required for display of non-GTf modifications including sulfonation, acetylation and phosphorylation of the human glycome on all types of glycoconjugates in a plurality of plurality of mammalian cells (the non-GTf modifications, step 5,
[0142] In certain embodiments, the invention provides inactivation and/or introduction of two or more genes required for display of various N-glycans in a plurality of mammalian cells. Genes involved in N-glycosylation include but are not limited to genes listed in
[0143] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of glycosyltransferase genes and related glycogenes required for display of various O-Glc/O-Fut glycans in a plurality of mammalian cells (the O-Glc/O-fut glycan pathways, Step 1-4,
[0144] In certain embodiments, the invention provides inactivation and/or introduction of two or more genes required for display of various O-Gluc/O-Fut glycans in a plurality of mammalian cells. Genes involved in O-Gluc/O-Fut glycosylation include but are not limited to genes listed in
[0145] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of glycosyltransferase genes and related glycogenes required for display of various O-Man glycans in a plurality of mammalian cells (the O-Man glycan pathways, Step 1-5,
[0146] In certain embodiments, the invention provides inactivation and/or introduction of two or more genes required for display of various O-Man glycans in a plurality of mammalian cells. Genes involved in O-Man glycosylation include but are not limited to genes listed in
[0147] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of glycosyltransferase genes and related glycogenes required for display of various O-GalNac glycans in a plurality of mammalian cells (the O-GalNac glycan pathways, Step 1-5,
[0148] In certain embodiments, the invention provides inactivation and/or introduction of two or more genes required for display of various O-GalNac glycans in a plurality of mammalian cells. Genes involved in O-GalNac glycosylation include but are not limited to genes listed in
[0149] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of glycosyltransferase genes and related glycogenes required for display of various Glycolipids in a plurality of mammalian cells (the Glycolipid pathways, Step 1-5,
[0150] In certain embodiments, the invention provides inactivation and/or introduction of two or more genes required for display of various Glycolipids glycans in a plurality of mammalian cells. Genes involved in Glycolipid synthesis include but are not limited to genes listed in
[0151] In yet other embodiments, this invention provides a combinatorial design for inactivation(s) and/or introduction of a limited set of glycosyltransferase genes and related glycogenes required for display of various Glycosaminoglycans in a plurality of mammalian cells (the Glycolipid pathways, Step 1-5,
[0152] In certain embodiments, the invention provides inactivation and/or introduction of two or more genes required for display of various Glycosaminoglycans in a plurality of mammalian cells. Genes involved in Glycosaminoglycan synthesis include but are not limited to genes listed in
[0153] The present inventors have used different nuclease-mediated (ZFN, TALEN, CRISPR/Cas9) knock out and knock in in human HEK293 cells to explore the potential for display of the glycome in an addressable and interpretable way.
[0154] One object of the present invention is to provide a plurality of isogenic mammalian cells that display one or more of the following posttranslational modification patterns on proteins, lipids, and proteoglycans on the cell surface:
[0155] Another related object of the present invention is to provide a plurality of isogenic mammalian cells that display one or more of the following posttranslational modification patterns on proteins, lipids, and/or proteoglycans secreted and/or released from said cells:
[0156] a) eliminated 4-branched tetraantennary N-glycans (for example by knock-out of MGAT4A and MGAT4B),
[0157] b) eliminated 6-branched tetraantennary structures (for example by knock-out of MGAT5),
[0158] c) elimination of L-PHA lectin labeling (for example by knock-out of MGAT5),
[0159] d) homogenous biantennary N-glycans (for example by knock-out of MGAT4A, MGAT4B and MGAT5),
[0160] e) abolished galactosylation on N-glycans (for example by knock-out of B4GALT1 and B4GALT3),
[0161] f) elimination of poly-LacNAc (for example by knock-out of B3GNT2),
[0162] g) heterogeneous tetraantennary N-glycans without trace of sialylation (for example by knock-out of ST3GAL3/4/6, ST6GAL1 and ST6GAL2),
[0163] h) biantennary N-glycans without sialylation (for example by knock-out of MGAT4A/4B/5, ST3GAL3/4/6, ST6GAL1 and ST6GAL2),
[0164] i) lack of sialic acid (for example by knock-out of one or more of ST3GAL3, ST3GAL4, ST3GAL6, ST6GAL1 and ST6GAL2),
[0165] j) uncapped LacNAc termini (for example by knock-out of B4GALT1/2/3/4/5/6),
[0166] k) homogenous biantennary N-glycans capped by 2,6NeuAc (for example by knock-out of MGAT4A/4B/5 and one or more of ST3GAL1, ST3GAL2, ST3GAL3, ST3GAL4, ST3GAL5 and ST3GAL6),
[0167] l) homogenous 2,6NeuAc capping (for example by knock-out of one or more of ST3GAL1, ST3GAL2, ST3GAL3, ST3GAL4, ST3GAL5 and ST3GAL6), or
[0168] m) homogenous biantennary N-glycans capped by 2,3NeuAc (for example by knock-out of ST6GAL1 and ST6GAL2).
[0169] n) Elimination of LacDiNAc (for example by knock-out of B4GALNT3/4).
[0170] One, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, or more of these effects can be combined to generate specific posttranslational modification patterns.
[0171] The genes involved in this highly complex glycosylation machinery have been examined by the present inventors by various combinations of inactivation of C1GALT1, ALG3/9, A4GALT, B3GNT2/4/5/8, B4GALNT3/4, B4GALT1/2/3/4/5/6/7, DPY19L2/3/4, FUT4/8, GALNT1/2/3/6/7/10/11/12/13/14/16/18, GCNT1, GLT1D1, GLT8D1/2, GTDC1, MGAT1/2/3/4A/4B, POMGNT1, POMT1/2, ST3GAL1/2/3/4/5/6, ST6GAL1/2, ST6GALNAC1/2/3/4, ST8SIA2/4/5, STT3A/3B, TMTC1/2/3/4, UGT8, FUT8, B3GNT2, GNPTAB, GNPTG, ST6GALNACT1, COSMC, MGAT5 and introduction of ST6GALNACT1, B4GALT1/T2/T3/T4, B3GNT6, GCNT1, ST3GAL4, ST6GAL1, ST6GALNAC1, TMTC3, FUT8, ST3GAL4/6, ST6GAL1/2, MGAT3/4A/5, B3GNT2, GNPTAB, GNPTG, GALNT1/3, CHST1/3/15/, GAL3ST2/4 and effects have been identified.
[0172] In one aspect of the present invention MGAT4A and MGAT4B is knocked out in the cell to eliminate 4-branched tetraantennary N-glycans.
[0173] In another aspect of the present invention MGAT5 is knocked out in the cell to eliminate 6-branched tetraantennary structures.
[0174] In yet another aspect of the present invention MGAT5 is knocked out in the cell leading to loss of L-PHA lectin labelling.
[0175] In a further aspect of the present invention MGAT4A, MGAT4B and MGAT5 are knocked out in the cell leading to homogenous biantennary N-glycans.
[0176] In another aspect of the present invention B4GALT1 and B4GALT3 is knocked out in the cell leading to abolished galactosylation on N-glycans.
[0177] In a further aspect of the present invention B3GNT2 is knocked out in the cell leading to elimination of poly-LacNAc.
[0178] In a further aspect of the present invention B4GALNT3 and B4GALNT4 is knocked out in the cell leading to elimination of LacDiNAc (GalNAc1-4GlcNAc), as knock out of individual genes did not completely eliminate LacDiNAc detection.
[0179] In another aspect of the present invention ST3GAL4 and ST4GAL6 are knocked out in the cell leading to homogeneous 2,6 sialylation of N-glycans.
[0180] In another aspect of the present invention ST3GAL4, ST4GAL6, and ST6GAL1 are knocked out in the cell leading to homogeneous lack of sialylation of N-glycans.
[0181] In another aspect of the present invention ST6GAL1 is knocked out in the cell leading to homogeneous 2,3 sialylation of N-glycans.
[0182] In another aspect of the present invention GNPTAB is knocked out in the cell leading to elimination of mannose-6-phosphate (M6P) tagging of N-glycans and increase in sialylated N-glycans of lysosomal enzyme proteins.
[0183] In another aspect of the present invention ALG9 is knocked out in the cell leading to reduction in M6P tagging of N-glycans and increase in sialylated N-glycans of lysosomal enzyme proteins.
[0184] In another aspect of the present invention ALG12 is knocked out in the cell leading to truncated high-mannose and hybrid type N-glycans with M6P tagging of N-glycans and increase in sialylated N-glycans of lysosomal enzyme proteins.
[0185] In another aspect of the present invention ALG8 is knocked out in the cell leading to increase in hybrid type N-glycans with M6P tagging and LacNAc with sialic acids of N-glycans of lysosomal enzyme proteins.
[0186] In another aspect of the present invention NAGPA is knocked out in the cell leading to increase in GlcNAc residues on M6P tagged N-glycans of lysosomal enzyme proteins.
[0187] In another aspect of the present invention ALG3 is knocked out in the cell leading to increase in truncated high-mannose and hybrid type N-glycans with M6P tagging of N-glycans of lysosomal enzyme proteins.
[0188] In another aspect of the present invention MGAT1 is knocked out in the cell leading to elimination of complex type N-glycans and increase in truncated high-mannose N-glycans and unchanged M6P tagging of N-glycans of lysosomal enzyme proteins.
[0189] In another aspect of the present invention MOGS is knocked out in the cell leading to high mannose type N-glycans with Glc residues and reduced M6P tagging of N-glycans of lysosomal enzyme proteins.
[0190] In another aspect of the present invention MGAT1 and GNPTAB are knocked out in the cell leading to elimination of complex type N-glycans and increase in truncated high-mannose N-glycans without M6P tagging of N-glycans of lysosomal enzyme proteins.
[0191] In another aspect of the present invention MGAT2 and GNPTAB are knocked out in the cell leading to marked increase in monoantennary N-glycans with sialic acids and without M6P tagging of N-glycans of lysosomal enzyme proteins.
[0192] In another aspect of the present invention GNPTAB and ST6GAL1 are knocked out and ST3GAL4 is knocked in in the cell leading to complex type N-glycans with 2,3-linked sialic acids and without M6P tagging of N-glycans of lysosomal enzyme proteins.
[0193] In another aspect of the present invention GNPTAB, ST3GAL4 and ST3GAL6 are knocked out and ST6GAL1 is knocked in in the cell leading to complex type N-glycans with 2,6-linked sialic acids and without M6P tagging of N-glycans of lysosomal enzyme proteins.
[0194] In another aspect of the present invention B4GALT1 and/or FUT8 is knocked out in the cell leading to more homogeneous GOF type N-glycans on IgG.
[0195] In another aspect of the present invention MGAT3 is knocked out in the cell leading to elimination of bisecting N-glycans on IgG and lysosomal proteins.
[0196] In another aspect of the present invention B4GALT1 is knocked in in the cell leading to homogeneous G2F type N-glycans on IgG.
[0197] In another aspect of the present invention B4GALT1 is knocked in and FUT8 knocked out in the cell leading to homogeneous G2 type N-glycans on IgG.
[0198] In another aspect of the present invention B4GALT1 and ST6GAL1 are knocked in and MGAT3 is knocked out in the cell leading to more homogeneous G2S1F type N-glycans with one sialylation on IgG.
[0199] In another aspect of the present invention B4GALT1 and ST6GAL1 are knocked in and MGAT3 and FUT8 are knocked out in the cell leading to more homogeneous G2S1 type N-glycans with one sialylation on IgG.
[0200] In another aspect of the present invention MGAT2 is knocked out in the cell leading to homogeneous monoantennary N-glycans on IgG.
[0201] In another aspect of the present invention MGAT2, MGAT3, ST6GAL1, ST3GAL4 and ST3GAL6 are knocked out and B4GALT1 is knocked in in the cell leading to homogeneous monoantennary G1F type N-glycans on IgG.
[0202] In another aspect of the present invention MGAT2, MGAT3, ST6GAL1, ST3GAL4, ST3GAL6 and FUT8 are knocked out and B4GALT1 is knocked in in the cell leading to homogeneous monoantennary G1 type N-glycans on IgG.
[0203] In another aspect of the present invention MGAT2, MGAT3 and ST6GAL1 are knocked out and B4GALT1 and ST3GAL4 are knocked in in the cell leading to homogeneous monoantennary type N-glycans with 2,3-linked sialic acids on IgG.
[0204] In another aspect of the present invention MGAT2, MGAT3, ST6GAL1 and FUT8 are knocked out and B4GALT1 and ST3GAL4 are knocked in in the cell leading to homogeneous monoantennary type N-glycans with 2,3-linked sialic acids and without fucose on IgG.
[0205] In another aspect of the present invention MGAT2, MGAT3, ST3GAL4, and ST3GAL6 are knocked out and B4GALT1 and ST6GAL1 are knocked in in the cell leading to homogeneous monoantennary type N-glycans with 2,6-linked sialic acids on IgG.
[0206] In another aspect of the present invention MGAT2, MGAT3, ST3GAL4, ST3GAL6, and FUT8 are knocked out and B4GALT1 and ST6GAL1 are knocked in in the cell leading to homogeneous monoantennary type N-glycans with 2,6-linked sialic acids and without fucose on IgG.
[0207] O-GalNAc Glycosylation:
[0208] In one aspect of the present invention GALNT1 and/or GALNT2 and/or GALNT3 and/or GALNT4 and/or GALNT7 and/or GALNT10 and/or GALNT11 and/or GALNT13 are knocked out in the cell to eliminate part of or all O-glycan attachments to proteins.
[0209] In one aspect of the present invention GALNT1 and/or GALNT2 and/or GALNT3 are knocked out in the cell to eliminate O-glycosylation of erythropoietin.
[0210] In another aspect of the present invention COSMC and/or C1GALT1 are knocked out in the cell leading to homogeneous truncated O-glycans with GalNAc1-O-Ser/Thr structures.
[0211] In another aspect of the present invention COSMC and/or C1GALT1 are knocked out and ST6GALNT1 is knocked in in the cell leading to homogeneous truncated O-glycans with NeuAc2-6GalNAc1-O-Ser/Thr structures.
[0212] O-Man Glycosylation:
[0213] In one aspect of the present invention POMGNT1 is knocked out in the cell leading to homogeneous truncated O-glycans with Man1-O-Ser/Thr structures.
[0214] In another aspect of the present invention POMT1 and/or POMT2 is knocked out in the cell leading to elimination of O-Man glycans on a subset of proteins including -dystroglycan.
[0215] In another aspect of the present invention TMTC1 and/or TMTC2 and/or TMTC3 and/or TMTC4 is knocked out in the cell leading to elimination of O-Man glycans on a subset of proteins including cadherins and protocadherins.
[0216] Glycosphingolipids:
[0217] In one aspect of the present invention B4GALT5 and/or B4GALNT6 are knocked out in the cell leading to homogeneous truncated glycolipids with Glc-Cer structures.
[0218] Gene Editing Strategies:
[0219] In one aspect of the present invention is one or more of the above mentioned genes knocked out using zinc finger nucleases ZFN. ZFNs can be used for inactivation of any genes disclosed herein. ZFNs comprise a zinc finger protein (ZFP) and a nuclease (cleavage) domain.
[0220] In one aspect of the present invention is one or more of the above mentioned genes knocked out using TALENs. TALENs can be used for inactivation of any genes disclosed herein.
[0221] In one aspect of the present invention is one or more of the above mentioned genes knocked out using CRISPR/Cas9. CRISPR/Cas9 can be used for inactivation of any genes disclosed herein.
[0222] In yet other embodiments, this invention provides mammalian cells with different well-defined N-glycosylation capacities that enable recombinant production of glycoprotein therapeutics with N-glycans comprised of either biantennary, triantennary, or tetraantennary N-glycans with or without poly-LacNAc, with or without 2,6NeuAc capping, and with or without 2,3NeuAc capping.
[0223] In yet other embodiments, this invention provides mammalian cells with different well-defined N-glycosylation capacities that enable recombinant production of Lysosomal glycoprotein therapeutics with N-glycans with and without M6P tagging, with and without 2,6NeuAc capping, with or without 2,3NeuAc capping, with and without high mannose, with and without Glc residues, and with and without GlcNAc-1-phosphate residues.
[0224] In yet another aspect also provided is an isolated cell comprising any of the proteins and/or polynucleotides as described herein. In certain embodiments, one or more glycosyltransferase genes are inactivated (partially or fully) in the cell. Any of the cells described herein may include additional genes that have been inactivated, for example, using zinc finger nucleases, TALENs and/or CRISPR/Cas9 designed to bind to a target site in the selected gene. In certain embodiments, provided herein are cells or mammalian cells in which two or more glycosyltransferase genes have been inactivated, and cells or mammalian cells in which one or more glycosyltransferase and related glycogenes have been inactivated and one or more glycosyltransferase genes introduced.
[0225] In some embodiments, this invention provides a cell with inactivation of the second step in the O-GalNAc glycosylation pathway, and that produces truncated O-GalNAc O-glycans without sialic acid capping.
[0226] In some embodiments, this invention provides a cell with inactivation of the second step in the O-Xyl glycosylation pathway, and that produces truncated O-Xyl O-glycans without proteoglycan chains.
[0227] In some embodiments, this invention provides a cell with inactivation of the second step in the O-Man glycosylation pathway, and that produces truncated O-Man O-glycans without sialic acid capping.
[0228] In some embodiments, this invention provides a cell with inactivation of the second step in the O-Man, O-Xyl and O-GalNAc glycosylation pathways, and that produces truncated O-Man, O-Xyl, and O-GalNAc O-glycans.
[0229] In some embodiments, this invention provides a cell with inactivation of the second step in the glycosphingolipid glycosylation pathway, and that produces truncated glycosphingolipid glycans.
[0230] In some embodiments, this invention provides a cell with inactivation ad/or modification of the M6P tagging process of N-glycans, and that produces lysosomal enzyme proteins with no or lower or higher levels of M6P tagged N-glycans.
[0231] Thus, in another aspect, provided herein are methods for inactivating one or more cellular glycosyltransferase and related genes (e.g., MGAT1, MGAT2, MGAT3, MGAT4A, MGAT4B, MGAT4C, MGAT5, MGAT5B, B4GALT1, B4GALT2, B4GALT3, B4GALT4, B3GNT2, B3GNT8, ST3GAL3, ST3GAL4, ST3GAL6, FUT8, GNPTAB, ALG9, ALG12, ALG8, NAGPA, ALG3; MOGS, and ST6GAL1 genes (as listed in Table 1) in a cell, by use of methods comprising genome perturbation, gene-editing and/or gene disruption capability such as nucleic acid vector systems related to Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and components thereof, nucleic acid vector systems encoding fusion proteins comprising zinc finger DNA-binding domains (ZF) and at least one cleavage domain or at least one cleavage half-domain (ZFN) and/or nucleic acid vector systems encoding a first transcription activator-like (TAL) effector endonuclease monomer and a nucleic acid encoding a second cleavage domain or at least one cleavage half-domain (TALEN). Introduction into a cell of either of the above mentioned nucleic acid cleaving agents (CRISPR, TALEN, ZFN) are capable of specifically cleaving a glycosyltransferase gene target site as a result of cellular introduction of: (Rillahan 2011) a nucleic acid encoding pair of either ZF or TAL glycosyltransferase gene target binding proteins each fused to Fok1 endonuclease, wherein at least one of said ZF or TAL polypeptides is capable of specifically binding to a nucleotide sequence located upstream from said target cleavage site, and the other ZF or TAL protein is capable of specifically binding to a nucleotide sequence located downstream from the target cleavage site, whereby each of the zinc finger proteins are independently bound to and surround the nucleic acid target followed by target nucleic acid disruption by double stranded breakage mediated by the fused endonuclease cleaving moieties, (Hansen 2015) a nucleotide sequence encoding a CRISPR-Cas system guide RNA that hybridizes glycosyltransferase gene target sequence, and b) a second nucleotide sequence encoding a Type-II Cas9 protein, wherein components (a) and (b) are located on same or different vectors of the system, wherein the guide RNA is comprised of a chimeric RNA and includes a guide sequence and a trans-activating cr (tracr) sequence, whereby the guide RNA targets the glycosyltransferase gene target sequence and the Cas9 protein cleaves the glycosyltransferase gene target site.
[0232] In yet other embodiments, this invention provides mammalian cells with inactivation of one or more glycosyltransferase genes and with stable introduction of one or more glycosyltransferases to enhance fidelity of desirable glycosylation features and/or introduce improved glycosylation features and/or novel glycosylation features.
[0233] In certain embodiments mammalian cells with inactivation of one or more sialyltransferases, and/or galactosyltransferases, and/or glucosyltransferases, and/or GlcNAc-transferases, and/or GalNAc-transferases, and/or xylosyl-transferase, and/or glucuronosyltransferases, mannosyltransferases, and/or fucosyltransferases, and in which one or more glycosyltransferases have been stably introduced are provided.
[0234] There are a number of methods available for introduction of exogenous genes such as glycosyltransferase genes in mammalian cells and selecting stable clonal mammalian cells that harbor and express the gene of interest. Typically the gene of interest is co-transfected with a selection marker gene that favors mammalian cells expressing the selection marker under certain defined media culture conditions. The media could contain an inhibitor of the selection marker protein or the media composition could stress cell metabolism and thus require increased expression of the selection marker. The selection marker gene may be present on same plasmid as gene of interest or on another plasmid.
[0235] In some embodiments, introduction of one or more exogenous glycosyltransferase(s) is performed by plasmid transfection with a plasmid encoding constitutive promotor driven expression of both the glycosyltransferase gene and a selectable antibiotic marker, where the selectable marker could also represent an essential gene not present in the host cell such as GS system (Sigma/Lonza), and/or separate plasmids encoding the constitutive promotor driven glycosyltransferase gene or the selectable marker. For example, plasmids encoding ST6GalNAc-I and Zeocin have been transfected into cells and stable ST6Gal-I expressing lines have been selected based on zeocin resistance
[0236] In some other embodiments, introduction of one or more exogenous glycosyltransferase(s) is performed by site-directed nuclease-mediated insertion.
[0237] In some embodiments, a method for stably expressing at least one product of an exogenous nucleic acid sequence in a cell by introduction of double stranded breaks at the PPP1R12C or Safe Harbor #1 genomic locus using ZFN nucleic acid cleaving agents and an exogenous nucleic acid sequence that by a homology dependent manner or via compatible flanking ZFN cutting overhangs is inserted into the cleavage site and expressed. Safe Harbor sites are sites in the genome that upon manipulation do not lead to any obvious cellular or phenotypic consequences. In addition to the aforementioned sites, several other sites have been identified such as Safe Harbor #2, CCR5 and Rosa26. Besides ZFN technology, TALEN and CRISPR tools can also provide for integrating exogenous sequences into mammalian cells or genomes in a precise manner. In doing so it should be evaluated; i) to what extend epigenetic silencing and ii) what the desired expression level of the gene of interest should be. In the examples enclosed herein, site-specific integration of human glycosyltransferases e.g. ST6GALNT1 using the ObLiGaRe insertion strategy is based on a CMV expression driven insulator flanked vector design (Example 4,
[0238] In yet another aspect, the disclosure provides a method of producing a recombinant protein of interest in a host cell, the method comprising the steps of: (a) providing a host cell comprising two or more endogenous glycosyltransferase genes; (b) inactivating the endogenous glycosyltransferase genes of the host cell by any of the methods described herein; and (c) introducing an expression vector comprising a transgene, the transgene comprising a sequence encoding a protein of interest, into the host cell, thereby producing the recombinant protein for display with a plurality of glycoforms. In certain embodiments, the protein of interest comprises e.g. MUC1 or an antibody, e.g., a monoclonal antibody.
[0239] In yet another aspect, the disclosure provides a method of producing a recombinant protein of interest in a cell, the method comprising the steps of: (a) providing a cell comprising one or more endogenous glycosyltransferase gene; (b) inactivating the endogenous glycosyltransferase gene(s) of the host cell; (c) introducing one or more glycosyltransferase gene(s) in the cell by any of the methods described herein; and (d) introducing an expression vector comprising a transgene, the transgene comprising a sequence encoding a protein of interest, into the cell, thereby producing the recombinant protein protein for display with a plurality of glycoforms. In certain embodiments, the protein of interest comprises e.g.
[0240] erythropoietin or an antibody, e.g., a monoclonal antibody.
[0241] Another aspect of the disclosure encompasses a method for producing a recombinant protein with a plurality of more homogeneous and/or novel and/or functionally beneficial glycosylation. The method comprises expressing the protein in a mammalian cell line deficient in two or more glycosyltransferase genes and/or deficient in one or more glycosyltransferase genes combined with one or more gained glycosyltransferase genes. In one specific embodiment, the cell line is a Human embryonic kidney (HEK293) cell line. In some embodiments, the cell line comprises inactivated chromosomal sequences encoding any endogenous glycosyltransferases. In some embodiments, the inactivated chromosomal sequences encoding any endogenous glycosyltransferases is monoallelic and the cell line produces a reduced amount of said glycosyltransferases. In some other embodiments, the inactivated chromosomal sequences encoding encoding any endogenous glycosyltransferases are biallelic, and the cell line produces no measurable said glycosyltransferases. In some other embodiments, the recombinant protein has more homogeneous and/or novel and/or functionally beneficial glycosylation. In some embodiments, the plurality of recombinant proteins with different glycoforms has at least one property that is improved relative to a similar recombinant protein produced by a comparable cell line not deficient in said endogenous glycosyltransferases, for example, biological binding, immunogenicity, increased bioavailability, increased efficacy, increased stability, increased solubility, improved half-life, improved clearance, improved pharmacokinetics, and combinations thereof. The recombinant protein can be any protein, including a therapeutic protein. Exemplary proteins include those selected from but not limited to a mucin, cell membrane protein, an antibody, an antibody fragment, a growth factor, a cytokine, a hormone, a lysosomal enzyme, a clotting factor, and functional fragment or variants thereof.
[0242] The disclosure may also be used to identify target genes for modification and use this knowledge to glycoengineer an existing mammalian cell line previously transfected with DNA coding for the protein of interest.
[0243] In any of the cells and methods described herein, the cell or cell line can be a HEK293 (e.g., HEK293-F, HEK293-H, HEK293-T, HEK293-6E), COS, VERO, MDCK, WI38, V79, B14AF28-G3, BHK, HaK, NS0, SP2/0-Ag14, HeLa, and PERC6.
[0244] Mammalian cells as described herein can also be used to display and glycooptimize N-glycoproteins including without intend for limitation for example 1-antitrypsin, gonadotropins, lysosomal targeted enzyme proteins (e.g. Glycocerebrosidase, alpha-Galactosidase, alpha-glucosidase, sulfatases, glucuronidase, iduronidase). Known human glycosyltransferase genes are assembled in homologous gene families in the CAZy database and these families are further assigned to different glycosylation pathways in Hansen et al. (Hansen, Lind-Thomsen et al. 2014). Table 1 lists all human glycosyltransferase genes in CAZy GT families with NCBI Gene IDs and assignment of confirmed or putative functions in biosynthesis of different mammalian glycoconjugates (N-glycans, O-GalNAc, O-GlcNAc, O-Glc, O-Gal, O-Fuc, O-Xyl, O-Man, C-Man, Glycosphingolipids, Hyaluronan, and GPI anchors).
TABLE-US-00001 TABLE 1 Human GTf (in total 214) CAZy Gene Gene family.sup.(1) ID.sup.(2) Symbol.sup.(3) Description.sup.(4) GTnc 127550 A3GALT2* alpha 1,3-galactosyltransferase 2 (inactive) GT32 53947 A4GALT 1,4-galactosyltransferase GT32 51146 A4GNT 1,4-N-acetylglucosaminyltransferase GT6 28 ABO ABO blood group GT33 56052 ALG1* chitobiosyldiphosphodolichol -mannosyltransferase GT59 84920 ALG10* 1,2-glucosyltransferase GT59 144245 ALG10B* 1,2-glucosyltransferase GT4 440138 ALG11* 1,2-mannosyltransferase GT22 79087 ALG12* 1,6-mannosyltransferase GT1 79868 ALG13* UDP-N-acetylglucosaminyltransferase subunit GT1 199857 ALG14* UDP-N-acetylglucosaminyltransferase subunit GT33 200810 ALG1L* chitobiosyldiphosphodolichol -mannosyltransferase- like GT33 644974 ALG1L2* chitobiosyldiphosphodolichol -mannosyltransferase- like 2 GT4 85365 ALG2* 1,3/1,6-mannosyltransferase GT58 10195 ALG3* 1,3- mannosyltransferase GT2 29880 ALG5* dolichyl-phosphate b-glucosyltransferase GT57 29929 ALG6* 1,3-glucosyltransferase GT57 79053 ALG8* 1,3-glucosyltransferase GT22 79796 ALG9* 1,2-mannosyltransferase GT31 8706 B3GALNT1 b1,3-N-acetylgalactosaminyltransferase 1 GT31 148789 B3GALNT2 b1,3-N-acetylgalactosaminyltransferase 2 GT31 8708 B3GALT1 UDP-Gal:bGlcNAc 1,3-galactosyltransferase, polypeptide 1 GT31 8707 B3GALT2 UDP-Gal:bGlcNAc b1,3-galactosyltransferase, polypeptide 2 GT31 8705 B3GALT4 UDP-Gal:bGlcNAc-b1,3-galactosyltransferase, polypeptide 4 GT31 10317 B3GALT5 UDP-Gal:bGlcNAc-b1,3-galactosyltransferase, polypeptide 5 GT31 126792 B3GALT6 UDP-Gal:bGal-b1,3-galactosyltransferase polypeptide 6 GT43 27087 B3GAT1 b1,3-glucuronyltransferase 1 GT43 135152 B3GAT2 b1,3-glucuronyltransferase 2 GT43 26229 B3GAT3 b1,3-glucuronyltransferase 3 GT31 145173 B3GLCT Beta-1,3-glucosyltransferase GT31 10678 B3GNT2 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 2 GT31 10331 B3GNT3 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 3 GT31 79369 B3GNT4 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 4 GT31 84002 B3GNT5 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 5 GT31 192134 B3GNT6 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 6 GT31 93010 B3GNT7 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 7 GT31 374907 B3GNT8 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 8 GT31 84752 B3GNT9 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase 9 GT2 146712 B3GNTL1 UDP-GlcNAc:bGal b1,3-N- acetylglucosaminyltransferase-like 1 GT12 2583 B4GALNT1 b1,4-N-acetyl-galactosaminyl transferase 1 GT12 124872 B4GALNT2 b1,4-N-acetyl-galactosaminyl transferase 2 GT7 283358 B4GALNT3 b1,4-N-acetyl-galactosaminyl transferase 3 GT7 338707 B4GALNT4 b1,4-N-acetyl-galactosaminyl transferase 4 GT7 2683 B4GALT1 UDP-Gal:bGlcNAc b1,4- galactosyltransferase, polypeptide 1 GT7 8704 B4GALT2 UDP-Gal:bGlcNAc b1,4- galactosyltransferase, polypeptide 2 GT7 8703 B4GALT3 UDP-Gal:bGlcNAc b1,4- galactosyltransferase, polypeptide 3 GT7 8702 B4GALT4 UDP-Gal:bGlcNAc b1,4- galactosyltransferase, polypeptide 4 GT7 9334 B4GALT5 UDP-Gal:bGlcNAc b1,4- galactosyltransferase, polypeptide 5 GT7 9331 B4GALT6 UDP-Gal:bGlcNAc b1,4- galactosyltransferase, polypeptide 6 GT7 11285 B4GALT7 xylosylprotein b1,4-galactosyltransferase, polypeptide 7 GT49 11041 B4GAT1 UDP-GlcNAc:bGal bl,3-N- acetylglucosaminyltransferase 1 GT31 56913 C1GALT1 core 1 synthase, galactosyltransferase 1 GT31 29071 C1GALT1C1 C1GALT1-specific chaperone 1 GT25 51148 CERCAM cerebral endothelial cell adhesion molecule (inactive) GT7/31 79586 CHPF chondroitin polymerizing factor GT7/31 54480 CHPF2 chondroitin polymerizing factor 2 GT7/31 22856 CHSY1 chondroitin sulfate synthase 1 GT7/31 337876 CHSY3 chondroitin sulfate synthase 3 GT25 79709 COLGALT1 collagen b(1-O)galactosyltransferase 1 GT25 23127 COLGALT2 collagen b(1-O)galactosyltransferase 2 GT7 55790 CSGALNACT1 chondroitin sulfate N- acetylgalactosaminyltransferase 1 GT7 55454 CSGALNACT2 chondroitin sulfate N- acetylgalactosaminyltransferase 2 GT2 8813 DPM1* dolichyl-phosphate mannosyltransferase polypeptide 1 GTnc 23333 DPY19L1 dpy-19-like 1 (C. elegans) GTnc 283417 DPY19L2 dpy-19-like 2 (C. elegans) GTnc 147991 DPY19L3 dpy-19-like 3 (C. elegans) GTnc 286148 DPY19L4 dpy-19-like 4 (C. elegans) GT61 285203 EOGT EGF domain-specific O-linked N-acetylglucosamine transferase GT47/64 2131 EXT1 exostosin glycosyltransferase 1 GT47/64 2132 EXT2 exostosin glycosyltransferase 2 GT47/64 2134 EXTL1 exostosin-like glycosyltransferase 1 GT64 2135 EXTL2 exostosin-like glycosyltransferase 2 GT47/64 2137 EXTL3 exostosin-like glycosyltransferase 3 GTnc 79147 FKRP* fukutin related protein GTnc 2218 FKTN* fukutin GT11 2523 FUT1 fucosyltransferase 1, H blood group GT10 84750 FUT10 fucosyltransferase 10, 1,3 fucosyltransferase GT10 170384 FUT11 fucosyltransferase 11, 1,3 fucosyltransferase GT11 2524 FUT2 fucosyltransferase 2 secretor status include GT10 2525 FUT3 fucosyltransferase 3, Lewis blood group GT10 2526 FUT4 fucosyltransferase 4, 1,3 fucosyltransferase, myeloid-specific GT10 2527 FUT5 fucosyltransferase 5, 1,3 fucosyltransferase GT10 2528 FUT6 fucosyltransferase 6, 1,3 fucosyltransferase GT10 2529 FUT7 fucosyltransferase 7, 1,3 fucosyltransferase GT23 2530 FUT8 fucosyltransferase 8, 1,6 fucosyltransferase GT10 10690 FUT9 fucosyltransferase 9, 1,3 fucosyltransferase GT27 2589 GALNT1 polypeptide N-acetylgalactosaminyltransferase 1 GT27 55568 GALNT10 polypeptide N-acetylgalactosaminyltransferase 10 GT27 63917 GALNT11 polypeptide N-acetylgalactosaminyltransferase 11 GT27 79695 GALNT12 polypeptide N-acetylgalactosaminyltransferase 12 GT27 114805 GALNT13 polypeptide N-acetylgalactosaminyltransferase 13 GT27 79623 GALNT14 polypeptide N-acetylgalactosaminyltransferase 14 GT27 117248 GALNT15 polypeptide N-acetylgalactosaminyltransferase 15 GT27 57452 GALNT16 polypeptide N-acetylgalactosaminyltransferase 16 GT27 374378 GALNT18 polypeptide N-acetylgalactosaminyltransferase 18 GT27 2590 GALNT2 polypeptide N-acetylgalactosaminyltransferase 2 GT27 2591 GALNT3 polypeptide N-acetylgalactosaminyltransferase 3 GT27 8693 GALNT4 polypeptide N-acetylgalactosaminyltransferase 4 GT27 11227 GALNT5 polypeptide N-acetylgalactosaminyltransferase 5 GT27 11226 GALNT6 polypeptide N-acetylgalactosaminyltransferase 6 GT27 51809 GALNT7 polypeptide N-acetylgalactosaminyltransferase 7 GT27 26290 GALNT8 polypeptide N-acetylgalactosaminyltransferase 8 GT27 50614 GALNT9 polypeptide N-acetylgalactosaminyltransferase 9 GT27 168391 GALNTL5 polypeptide N-acetylgalactosaminyltransferase-like 5 GT27 442117 GALNTL6 polypeptide N-acetylgalactosaminyltransferase-like 6 GT27 64409 WBSCR17 Williams-Beuren syndrome chromosome region 17 GT6 26301 GBGT1* globoside 1,3-N-acetylgalactosaminyltransferase 1 (Forssman) GT14 2650 GCNT1 glucosaminyl (N-acetyl) transferase 1, core 2 GT14 2651 GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme GT14 9245 GCNT3 glucosaminyl (N-acetyl) transferase 3, mucin type GT14 51301 GCNT4 glucosaminyl (N-acetyl) transferase 4, core 2 GT14 644378 GCNT6 glucosaminyl (N-acetyl) transferase 6 GT14 140687 GCNT7 glucosaminyl (N-acetyl) transferase family member 7 GT4 144423 GLT1D1* glycosyltransferase 1 domain containing 1 GT6 360203 GLT6D1* glycosyltransferase 6 domain containing 1 GT8 55830 GLT8D1* glycosyltransferase 8 domain containing 1 GT8 83468 GLT8D2* glycosyltransferase 8 domain containing 2 GT4 79712 GTDC1* glycosyltransferase-like domain containing 1 GT8 283464 GXYLT1 glucoside xylosyltransferase 1 GT8 727936 GXYLT2 glucoside xylosyltransferase 2 GT8 2992 GYG1* glycogenin 1 GT8 8908 GYG2* glycogenin 2 GT8/49 120071 GYLTL1B glycosyltransferase-like 1B, LARGE2 GT3 2997 GYS1* glycogen synthase 1 (muscle) GT3 2998 GYS2* glycogen synthase 2 (liver) GT2 3036 HAS1* hyaluronan synthase 1 GT2 3037 HAS2* hyaluronan synthase 2 GT2 3038 HAS3* hyaluronan synthase 3 GT90 79070 KDELC1* KDEL motif-containing protein 1 GTnc 143888 KDELC2* KDEL motif-containing protein 2 GT8/49 9215 LARGE 1,3-xylosyltransferase GT31 3955 LFNG O-fucosylpeptide 3-N- acetylglucosaminyltransferase GT31 4242 MFNG O-fucosylpeptide 3-N- acetylglucosaminyltransferase GT13 4245 MGAT1 mannosyl 1,3glycoprotein 1,2N- acetylglucosaminyltransferase GT16 4247 MGAT2 mannosyl 1,6glycoprotein 2N- acetylglucosaminyltransferase GT17 4248 MGAT3 mannosyl 1,4glycoprotein 1,4N- acetylglucosaminyltransferase GT54 11320 MGAT4A mannosyl 1,3glycoprotein 1,4N- acetylglucosaminyltransferase GT54 11282 MGAT4B mannosyl 1,3glycoprotein 1,4N- acetylglucosaminyltransferase GT54 25834 MGAT4C mannosyl 1,3glycoprotein 1,4N- acetylglucosaminyltransferase GTnc 152586 MGAT4D mannosyl 1,3glycoprotein 1,4N- acetylglucosaminyltransferase-like GT18 4249 MGAT5 mannosyl 1,6glycoprotein 1,6N- acetylglucosaminyltransferase GT18 146664 MGAT5B mannosyl 1,6glycoprotein -1,6-N-acetyl- glucosaminyltransferase, isozyme B GT41 8473 OGT O-linked N-acetylglucosamine (GlcNAc) transferase GT4 5277 PIGA phosphatidylinositol glycan anchor biosynthesis, class A GT22 9488 PIGB phosphatidylinositol glycan anchor biosynthesis, class B GT50 93183 PIGM phosphatidylinositol glycan anchor biosynthesis, class M GT76 55650 PIGV phosphatidylinositol glycan anchor biosynthesis, class V GT22 80235 PIGZ phosphatidylinositol glycan anchor biosynthesis, class Z GTnc 8985 PLOD3 procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 GT65 23509 POFUT1 O-fucosyltransferase 1 GT68 23275 POFUT2 O-fucosyltransferase 2 GT90 56983 POGLUT1 O-glucosyltransferase 1 GT13 55624 POMGNT1 O-linked mannose N-acetylglucosaminyltransferase 1, 1, 2 GT61 84892 POMGNT2 O-linked mannose N-acetylglucosaminyltransferase 2, 1, 4 GT39 10585 POMT1 O-mannosyltransferase 1 GT39 29954 POMT2 O-mannosyltransferase 2 GT35 5834 PYGB* phosphorylase, glycogen; brain GT35 5836 PYGL* phosphorylase, glycogen, liver GT35 5837 PYGM* phosphorylase, glycogen, muscle GT31 5986 RFNG O-fucosylpeptide 3N-acetylglucosaminyltransferase GT29 6482 ST3GAL1 -galactoside -2,3-sialyltransferase 1 GT29 6483 ST3GAL2 -galactoside -2,3-sialyltransferase 2 GT29 6487 ST3GAL3 -galactoside -2,3-sialyltransferase 3 GT29 6484 ST3GAL4 -galactoside -2,3-sialyltransferase 4 GT29 8869 ST3GAL5 -galactoside -2,3-sialyltransferase 5 GT29 10402 ST3GAL6 -galactoside -2,3-sialyltransferase 6 GT29 6480 ST6GAL1 -galactosamide -2,6-sialyltranferase 1 GT29 84620 ST6GAL2 -galactosamide -2,6-sialyltranferase 2 GT29 55808 ST6GALNAC1 -N-acetyl-neuraminyl-2,3--galactosyl-1,3-N- acetylgalactosaminide -2,6-sialyltransferase 1 GT29 10610 ST6GALNAC2 -N-acetyl-neuraminyl-2,3--galactosyl-1,3)-N- acetylgalactosaminide -2,6-sialyltransferase 2 GT29 256435 ST6GALNAC3 -N-acetyl-neuraminyl-2,3--galactosyl-1,3)-N- acetylgalactosaminide -2,6-sialyltransferase 3 GT29 27090 ST6GALNAC4 -N-acetyl-neuraminyl-2,3--galactosyl-1,3-N- acetylgalactosaminide -2,6-sialyltransferase 4 GT29 81849 ST6GALNAC5 -N-acetyl-neuraminyl-2,3--galactosyl-1,3-N- acetylgalactosaminide -2,6-sialyltransferase 5 GT29 30815 ST6GALNAC6 -N-acetyl-neuraminyl-2,3--galactosyl-1,3-N- acetylgalactosaminide -2,6-sialyltransferase 6 GT29 6489 ST8SIA1 -N-acetyl-neuraminide -2,8-sialyltransferase 1 GT29 8128 ST8SIA2 -N-acetyl-neuraminide -2,8-sialyltransferase 2 GT29 51046 ST8SIA3 -N-acetyl-neuraminide -2,8-sialyltransferase 3 GT29 7903 ST8SIA4 -N-acetyl-neuraminide -2,8-sialyltransferase 4 GT29 29906 ST8SIA5 -N-acetyl-neuraminide -2,8-sialyltransferase 5 GT29 338596 ST8SIA6 -N-acetyl-neuraminide -2,8-sialyltransferase 6 GT66 3703 STT3A subunit of the oligosaccharyltransferase complex (catalytic) GT66 201595 STT3B subunit of the oligosaccharyltransferase complex (catalytic) GTnc 10329 TMEM5* transmembrane protein 5 GTnc 83857 TMTC1 transmembrane and tetratricopeptide repeat containing 1 GTnc 160335 TMTC2 transmembrane and tetratricopeptide repeat containing 2 GTnc 160418 TMTC3 transmembrane and tetratricopeptide repeat containing 3 GTnc 84899 TMTC4 transmembrane and tetratricopeptide repeat containing 4 GT21 7357 UGCG UDP-glucose ceramide glucosyltransferase GT24 56886 UGGT1* UDP-glucose glycoprotein glucosyltransferase 1 GT24 55757 UGGT2* UDP-glucose glycoprotein glucosyltransferase 2 GT1 54658 UGT1A1* UDP glucuronosyltransferase 1 family, polypeptide Al GT1 54575 UGT1A10* UDP glucuronosyltransferase 1 family, polypeptide A10 GT1 54659 UGT1A3* UDP glucuronosyltransferase 1 family, polypeptide A3 GT1 54657 UGT1A4* UDP glucuronosyltransferase 1 family, polypeptide A4 GT1 54579 UGT1A5* UDP glucuronosyltransferase 1 family, polypeptide A5 GT1 54578 UGT1A6* UDP glucuronosyltransferase 1 family, polypeptide A6 GT1 54577 UGT1A7* UDP glucuronosyltransferase 1 family, polypeptide A7 GT1 54576 UGT1A8* UDP glucuronosyltransferase 1 family, polypeptide A8 GT1 54600 UGT1A9* UDP glucuronosyltransferase 1 family, polypeptide A9 GT1 10941 UGT2A1* UDP glucuronosyltransferase 2 family, polypeptide A1 GT1 79799 UGT2A3* UDP glucuronosyltransferase 2 family, polypeptide A3 GT1 7365 UGT2B10* UDP glucuronosyltransferase 2 family, polypeptide B10 GT1 10720 UGT2B11* UDP glucuronosyltransferase 2 family, polypeptide B11 GT1 7366 UGT2B15* UDP glucuronosyltransferase 2 family, polypeptide B15 GT1 7367 UGT2B17* UDP glucuronosyltransferase 2 family, polypeptide B17 GT1 54490 UGT2B28* UDP glucuronosyltransferase 2 family, polypeptide B28 GT1 7363 UGT2B4* UDP glucuronosyltransferase 2 family, polypeptide B4 GT1 7364 UGT2B7* UDP glucuronosyltransferase 2 family, polypeptide B7 GT1 133688 UGT3A1* UDP glycosyltransferase 3 family, polypeptide A1 GT1 167127 UGT3A2* UDP glycosyltransferase 3 family, polypeptide A2 GT1 7368 UGT8 UDP glycosyltransferase 8 GT8 152002 XXYLT1 xyloside xylosyltransferase 1 GT14 64131 XYLT1 xylosyltransferase I GT14 64132 XYLT2 xylosyltransferase II .sup.(1)GT classification system (Lombard et al. (2013). Nucl Acid Res 42: D1P: D490-D495 .sup.(2)Gene ID, GenBank .sup.(3)Approved HGNC gene symbol .sup.(4)Official full name, UniProt *GTfs not included in the deconstruction scheme in FIG. 1 and Table 5
[0245] TABLE 2 lists are known human non-glycosyltransferase genes that modify glycans including sulfotransferases with NCBI Gene IDs and assignment of confirmed or putative functions in biosynthesis of different mammalian glycoconjugates.
TABLE-US-00002 TABLE 2 Human Non-GTfs (in total 62) PTM Gene Gene Family.sup.(1) ID.sup.(2) Symbol.sup.(3) Description.sup.(4) Acetylation 64921 CASD1 CAS1 domain-containing protein 1 Sulfo-T 8534 CHST1 Carbohydrate sulfotransferase 1 Sulfo-T 9486 CHST10 Carbohydrate sulfotransferase 10 Sulfo-T 50515 CHST11 Carbohydrate sulfotransferase 11 Sulfo-T 55501 CHST12 Carbohydrate sulfotransferase 12 Sulfo-T 166012 CHST13 Carbohydrate sulfotransferase 13 Sulfo-T 113189 CHST14 Carbohydrate sulfotransferase 14 Sulfo-T 51363 CHST15 Carbohydrate sulfotransferase 15 Sulfo-T 9435 CHST2 Carbohydrate sulfotransferase 2 Sulfo-T 9469 CHST3 Carbohydrate sulfotransferase 3 Sulfo-T 10164 CHST4 Carbohydrate sulfotransferase 4 Sulfo-T 23563 CHST5 Carbohydrate sulfotransferase 5 Sulfo-T 4166 CHST6 Carbohydrate sulfotransferase 6 Sulfo-T 56548 CHST7 Carbohydrate sulfotransferase 7 Sulfo-T 64377 CHST8 Carbohydrate sulfotransferase 8 Sulfo-T 83539 CHST9 Carbohydrate sulfotransferase 9 OST 1603 DAD1 Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 OST 1650 DDOST dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit (non-catalytic) Donor 22845 DOLK* dolichol kinase Donor 1798 DPAGT1* dolichyl-phosphate (UDP-N-acetylglucosamine) N- acetylglucosaminephosphotransferase 1 Donor 8818 DPM2* Dolichol phosphate-mannose biosynthesis regulatory protein Donor 54344 DPM3* dolichyl-phosphate mannosyltransferase polypeptide 3 Epimerase 29940 DSE Dermatan-sulfate epimerase Epimerase 92126 DSEL dermatan-sulfate epimerase-like protein precursor Kinase 9917 FAM20B Glycosaminoglycan xylosylkinase Sulfo-T 9514 GAL3ST1 galactose-3-O-sulfotransferase 1 Sulfo-T 64090 GAL3ST2 galactose-3-O-sulfotransferase 2 Sulfo-T 89792 GAL3ST3 galactose-3-O-sulfotransferase 3 Sulfo-T 79690 GAL3ST4 Galactose-3-O-sulfotransferase 4 Epimerase 26035 GLCE D-glucuronyl C5-epimerase Man-6-P 79158 GNPTAB N-acetylglucosamine-1-phosphate transferase, alpha and beta subunits Man-6-P 84572 GNPTG N-acetylglucosamine-1-phosphate transferase, gamma subunit Degradation 10855 HPSE heparanase Sulfo-T 9653 HS2ST1 heparan sulfate 2-O-sulfotransferase 1 Sulfo-T 9957 HS3ST1 heparan sulfate D-glucosaminyl3-O-Sulfo T2 Sulfo-T 9956 HS3ST2 heparan sulfate D-glucosaminyl3-O-Sulfo T2 Sulfo-T 9955 HS3ST3A1 heparan sulfate D-glucosaminyl3-O-Sulfo T3A1 Sulfo-T 9953 HS3ST3B1 heparan sulfate D-glucosaminyl3-O-Sulfo T3B1 Sulfo-T 9951 HS3ST4 heparan sulfate D-glucosaminyl3-O-Sulfo T4 Sulfo-T 222537 HS3ST5 heparan sulfate D-glucosaminyl3-O-Sulfo T5 Sulfo-T 64711 HS3ST6 heparan sulfate D-glucosaminyl3-O-Sulfo T6 Sulfo-T 9394 HS6ST1 heparan sulfate 6-O-sulfotransferase 1 Sulfo-T 90161 HS6ST2 heparan sulfate 6-O-sulfotransferase 2 Sulfo-T 266722 HS6ST3 heparan sulfate 6-O-sulfotransferase 3 Sulfo-T 3340 NDST1 heparan N-deacetylase/N-sulfotransferase-1 Sulfo-T 8509 NDST2 heparan N-deacetylase/N-sulfotransferase-2 Sulfo-T 9348 NDST3 heparan N-deacetylase/N-sulfotransferase-3 Sulfo-T 64579 NDST4 heparan N-deacetylase/N-sulfotransferase-4 Man-6-P 51172 NAGPA N-acetylglucosamine-1-phosphodiester alpha-N- acetylglucosaminidase OST 100128731 OST4 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 GPI- 5279 PIGC* phosphatidylinositol glycan anchor biosynthesis, class C anchor GPI- 5283 PIGH* phosphatidylinositol glycan anchor biosynthesis, class H anchor GPI- 51227 PIGP* phosphatidylinositol glycan anchor biosynthesis, class P anchor GPI- 9091 PIGQ* phosphatidylinositol glycan anchor biosynthesis, class Q anchor Kinase 84197 POMK protein-O-mannose kinase OST 91869 RFT1 RFT1 homolog OST 6184 RPN1 ribophorin I OST 6185 RPN2 ribophorin II Degradation 23213 SULF1 sulfatase 1 Degradation 55959 SULF2 sulfatase 2 OST 7991 TUSC3 Tumor suppressor candidate 3 Sulfo-T 10090 UST uronyl 2-Sulfo Transferase .sup.(1)Genes are grouped after PTM (post translational modification) function (OST, oligosaccharyltransferase; GPI, Glycosylphosphatidylinositol anchor; Sulfo-T, sulfotransferase) .sup.(2)Gene ID, GenBank .sup.(3)Approved HGNC gene symbol .sup.(4)Official full name. UniProt *Non-GTfs not included in the deconstruction scheme in FIG. 1 and Table 5
[0246] The present inventors previously explored the glycosylation capacity of CHO cells using a genetic knock out screen focused on the N-glycosylation pathway, and demonstrated that the N-glycome of cells can be modified by a combinatorial knock out approach. The present inventors also demonstrated that site-directed knock in of one glycosyltransferase resulted in efficient glycosylation, but it is still difficult to design and built more complex glycosylation traits in homogeneous form by knock in of glycosyltransferase genes primarily because the relative expression levels of these enzymes participate in determining the glycosylation capacities and stable knock in of multiple genes is still a challenge.
[0247] By listing reported RNA sequencing data of a CHO-K1 line (Xu 2011) with RNA sequencing data from the human kidney HEK293 cells (Human Protein Atlas) it is obvious that CHO cells express a limited number of the annotated glycosyltransferases and other glycogenes (Table 3). Accordingly HEK293 and other human cells in general have a substantially broader glycosyltransferase gene repertoire compared to CHO. HEK293 cells express a large number of glycogenes not expressed in CHO cells, which provides HEK293 with considerable more complex glycosylation capacities compared to CHO. Such capacities of significance for the present invention include for example extensive fucosylation (FUTs), capping by 2,6sialic acids (ST6GAL1) and LacdiNAc (B4GALNT3/4), N-glycan branching (MGAT4s), O-GalNAc glycan density and branching (GALNTs and GCNTs), O-Man glycosylation and branching (POMTs and MGAT5B), glycolipids with globo, ganglio and lactoseries structures (A4GALT, B4GALNT1, B3GNT5), and more extensive sulfation of proteoglycans and glycoproteins.
TABLE-US-00003 TABLE 3 GTf genes, available RNA_seq data for HEK293 and CHO-K1 CHO-K1 CAZy Gene HEK293 (RNA mapping family.sup.(1) symbol.sup.(2) (fpkm).sup.(3) Depth).sup.(4) GTnc A3GALT2 0.0 nd GT32 A4GALT 3.5 0.0 GT32 A4GNT 0.0 0.0 GT6 ABO 0.0 nd GT33 ALG1 22.9 41.2 GT59 ALG10 7.9 0.0 GT59 ALG10B 6.4 0.0 GT4 ALG11 8.8 20.2 GT22 ALG12 16.1 68.7 GT1 ALG13 35.9 na GT1 ALG14 5.7 54.6 GT33 ALG1L 2.4 nd GT33 ALG1L2 0.0 nd GT4 ALG2 16.2 51.7 GT58 ALG3 59.4 37.6 GT2 ALG5 58.1 70.8 GT57 ALG6 12.8 22.2 GT57 ALG8 44.6 22.2 GT22 ALG9 13.6 98.0 GT31 B3GALNT1 0.0 37.0 GT31 B3GALNT2 19.9 0.0 GT31 B3GALT1 0.2 0.0 GT31 B3GALT2 0.0 0.0 GT31 B3GALT4 0.6 16.1 GT31 B3GALT5 0.1 0.0 GT31 B3GALT6 19.9 42.2 GT43 B3GAT1 0.5 0.0 GT43 B3GAT2 0.8 0.0 GT43 B3GAT3 30.0 30.6 GT31 B3GLCT 8.8 nd GT31 B3GNT2 8.2 188.6 GT31 B3GNT3 0.1 0.0 GT31 B3GNT4 1.4 0.0 GT31 B3GNT5 12.1 0.0 GT31 B3GNT6 0.0 nd GT31 B3GNT7 0.1 0.0 GT31 B3GNT8 0.2 0.0 GT31 B3GNT9 2.1 0.0 GT2 B3GNTL1 5.5 nd GT12 B4GALNT1 2.1 0.0 GT12 B4GALNT2 0.0 0.0 GT7 B4GALNT3 12.7 0.0 GT7 B4GALNT4 18.9 0.0 GT7 B4GALT1 10.4 36.0 GT7 B4GALT2 59.9 40.7 GT7 B4GALT3 38.7 74.0 GT7 B4GALT4 6.3 28.4 GT7 B4GALT5 9.4 71.3 GT7 B4GALT6 5.6 71.3 GT7 B4GALT7 17.5 169.3 GT49 B4GAT1 39.7 0.0 GT31 C1GALT1 6.6 25.5 GT31 C1GALT1C1 31.3 120.2 GT25 CERCAM 16.5 nd GT7/31 CHPF 14.1 332.3 GT7/31 CHPF2 12.8 129.7 GT7/31 CHSY1 14.6 0.0 GT7/31 CHSY3 1.2 0.0 GT25 COLGALT1 70.6 nd GT25 COLGALT2 2.5 nd GT7 CSGALNACT1 0.4 0.0 GT7 CSGALNACT2 7.3 0.0 GT2 DPM1 41.6 77.6 GTnc DPY19L1 15.3 nd GTnc DPY19L2 1.6 nd GTnc DPY19L3 8.9 nd GTnc DPY19L4 15.1 nd GT61 EOGT 5.4 nd GT47/64 EXT1 35.3 83.2 GT47/64 EXT2 40.6 136.1 GT47/64 EXTL1 0.1 2.1 GT64 EXTL2 9.3 179.4 GT47/64 EXTL3 17.9 78.7 GTnc FKRP 15.9 nd GTnc FKTN 7.0 nd GT11 FUT1 0.5 0.0 GT10 FUT10 7.4 0.0 GT10 FUT11 13.8 0.0 GT11 FUT2 0.2 0.0 GT10 FUT3 0.2 0.0 GT10 FUT4 2.0 0.0 GT10 FUT5 0.0 0.0 GT10 FUT6 0.5 0.0 GT10 FUT7 0.0 0.0 GT23 FUT8 10.7 165.8 GT10 FUT9 0.0 0.0 GT27 GALNT1 19.0 0.0 GT27 GALNT10 7.5 nd GT27 GALNT11 18.3 63.0 GT27 GALNT12 2.3 0.0 GT27 GALNT13 3.6 0.0 GT27 GALNT14 2.6 0.0 GT27 GALNT15 0.0 0.0 GT27 GALNT16 6.2 0.0 GT27 GALNT18 11.5 0.0 GT27 GALNT2 40.0 324.3 GT27 GALNT3 11.5 0.0 GT27 GALNT4 2.1 nd GT27 GALNT5 0.0 0.0 GT27 GALNT6 3.7 0.0 GT27 GALNT7 22.3 43.9 GT27 GALNT8 1.0 0.0 GT27 GALNT9 0.0 0.0 GT27 GALNTL5 0.0 0.0 GT27 GALNTL6 0.0 nd GT27 GALNT19/WBSCR17 0.0 63.0 GT6 GBGT1 0.5 11.4 GT14 GCNT1 4.0 0.0 GT14 GCNT2 6.0 0.0 GT14 GCNT3 0.0 0.0 GT14 GCNT4 0.0 0.0 GT14 GCNT6 0.1 nd GT14 GCNT7 0.0 nd GT4 GLT1D1 0.0 nd GT6 GLT6D1 0.0 nd GT8 GLT8D1 35.9 nd GT8 GLT8D2 8.6 nd GT4 GTDC1 7.7 nd GT8 GXYLT1 17.2 nd GT8 GXYLT2 1.0 nd GT8 GYG1 25.9 nd GT8 GYG2 5.9 nd GT8/49 GYLTL1B 7.7 0.0 GT3 GYS1 36.8 nd GT3 GYS2 0.1 nd GT2 HAS1 0.0 0.0 GT2 HAS2 0.5 0.0 GT2 HAS3 1.2 2.1 GT90 KDELC1 15.7 nd GTnc KDELC2 24.6 nd GT8/49 LARGE 11.6 22.0 GT31 LFNG 0.3 24.0 GT31 MFNG 1.7 0.0 GT13 MGAT1 47.9 60.6 GT16 MGAT2 18.6 138.2 GT17 MGAT3 0.3 0.0 GT54 MGAT4A 7.8 0.0 GT54 MGAT4B 52.4 0.0 GT54 MGAT4C 0.0 nd GTnc MGAT4D 0.0 nd GT18 MGAT5 13.3 19.8 GT18 MGAT5B 0.8 0.0 GT41 OGT 60.4 39.3 GT4 PIGA 7.8 8.6 GT22 PIGB 7.1 75.6 GT50 PIGM 7.5 54.0 GT76 PIGV 4.6 nd GT22 PIGZ 0.5 nd GTnc PLOD3 19.7 nd GT65 POFUT1 18.2 126.2 GT68 POFUT2 12.7 15.3 GT90 POGLUT1 11.4 nd GT13 POMGNT1 33.8 101.5 GT61 POMGNT2 28.0 nd GT39 POMT1 26.8 0.0 GT39 POMT2 16.9 0.0 GT35 PYGB 19.4 nd GT35 PYGL 42.6 nd GT35 PYGM 0.9 nd GT31 RFNG 33.2 157.7 GT29 ST3GAL1 3.6 195.5 GT29 ST3GAL2 8.2 28.3 GT29 ST3GAL3 3.4 75.0 GT29 ST3GAL4 10.0 33.1 GT29 ST3GAL5 7.1 43.7 GT29 ST3GAL6 4.2 29.1 GT29 ST6GAL1 6.5 0.0 GT29 ST6GAL2 0.0 0.0 GT29 ST6GALNAC1 0.0 0.0 GT29 ST6GALNAC2 0.8 0.0 GT29 ST6GALNAC3 2.5 0.0 GT29 ST6GALNAC4 5.9 66.7 GT29 ST6GALNAC5 1.1 0.0 GT29 ST6GALNAC6 10.9 24.7 GT29 ST8SIA1 0.0 0.0 GT29 ST8SIA2 0.4 0.0 GT29 ST8SIA3 0.0 0.0 GT29 ST8SIA4 0.0 0.0 GT29 ST8SIA5 0.3 0.0 GT29 ST8SIA6 0.1 0.0 GT66 STT3A 93.7 nd GT66 STT3B 58.7 nd GTnc TMEM5 17.6 nd GTnc TMTC1 4.4 na GTnc TMTC2 5.0 na GTnc TMTC3 9.3 na GTnc TMTC4 8.4 na GT21 UGCG 8.6 0.0 GT24 UGGT1 15.4 nd GT24 UGGT2 6.3 95.0 GT1 UGT1A1 0.0 95.7 GT1 UGT1A10 0.0 nd GT1 UGT1A3 0.0 nd GT1 UGT1A4 0.0 nd GT1 UGT1A5 0.0 nd GT1 UGT1A6 0.0 nd GT1 UGT1A7 0.0 nd GT1 UGT1A8 0.0 nd GT1 UGT1A9 0.0 nd GT1 UGT2A1 0.0 0.0 GT1 UGT2A3 0.0 nd GT1 UGT2B10 0.0 0.0 GT1 UGT2B11 0.0 nd GT1 UGT2B15 0.0 nd GT1 UGT2B17 0.0 0.0 GT1 UGT2B28 0.0 0.0 GT1 UGT2B4 0.0 0.0 GT1 UGT2B7 0.0 nd GT1 UGT3A1 0.0 nd GT1 UGT3A2 2.5 nd GT1 UGT8 7.9 0.0 GT8 XXYLT1 23.6 nd GT14 XYLT1 0.8 0.0 GT14 XYLT2 13.2 5.9 .sup.(1)GT classification system (Lombard et al. 2013, Nucl Acid Res 42: D1P: D490-D495), .sup.(2)Approved HGNC gene symbol .sup.(3)Gene expression levels in HEK293 is expressed as fpkm (fragments Per Kilobase of transcript per Million) adapted from Human Protein Atlas (http://www.proteinatlas.org/) .sup.(4)Gene expression in the CHO-K1 cell line is based on WGS sequencing depth adapted from Xu et al. 2011, Nature Biotech 29:735-742, nd means not detectable and na means not analysed.
TABLE-US-00004 TABLE 4 Non-GTfs, available RNA_seq data HEK293 and CHO-K1 (in total 62) CHO K1 CAZy Common HEK293 (RNA Seq classification gene name (FPKM) Mapping Depth) Acetylation CASD1 7.6 nd Sulfo-T CHST1 17.9 0.0 Sulfo-T CHST10 16.5 0.0 Sulfo-T CHST11 4.9 23.4 Sulfo-T CHST12 12.8 246.5 Sulfo-T CHST13 0.5 na Sulfo-T CHST14 11.1 96.6 Sulfo-T CHST15 4.9 0.0 Sulfo-T CHST2 0.0 36.2 Sulfo-T CHST3 4.0 0.0 Sulfo-T CHST4 0.4 0.0 Sulfo-T CHST5 0.1 0.0 Sulfo-T CHST6 0.2 0.0 Sulfo-T CHST7 5.0 na Sulfo-T CHST8 1.2 0.0 Sulfo-T CHST9 2.1 0.0 OST DAD1 173.8 1678.8 OST DDOST 187.8 288.3 Donor DOLK 13.5 nd Donor DPAGT1 30.3 59.0 Donor DPM2 42.9 nd Donor DPM3 150.5 115.6 Epimerase DSE 13.7 nd Epimerase DSEL 0.1 0.0 Kinase FAM20B 14.7 nd Sulfo-T GAL3ST1 0.8 0.0 Sulfo-T GAL3ST2 0.2 0.0 Sulfo-T GAL3ST3 0.0 0.0 Sulfo-T GAL3ST4 0.8 0.0 Epimerase GLCE 18.2 90.8 Man-6-P GNPTAB 12.8 nd Man-6-P GNPTG 20.9 nd Degradation HPSE 2.2 36.7 Sulfo-T HS2ST1 19.3 29.0 Sulfo-T HS3ST1 0.0 0.0 Sulfo-T HS3ST2 0.1 0.0 Sulfo-T HS3ST3A1 11.9 0.0 Sulfo-T HS3ST3B1 4.8 0.0 Sulfo-T HS3ST4 0.0 0.0 Sulfo-T HS3ST5 0.0 0.0 Sulfo-T HS3ST6 0.1 0.0 Sulfo-T HS6ST1 14.0 96.8 Sulfo-T HS6ST2 36.7 0.0 Sulfo-T HS6ST3 0.5 0.0 Sulfo-T NDST1 21.8 0.0 Sulfo-T NDST2 15.8 65.8 Sulfo-T NDST3 0.0 65.8 Sulfo-T NDST4 0.3 65.8 Man-6-P NAGPA 10.8 nd Donor OST4 185.9 nd GPI PIGC 26.2 38.3 GPI PIGH 23.1 6.7 GPI PIGP 26.4 225.9 GPI PIGQ 21.7 25.9 Kinase POMK 1.2 nd Donor RFT1 17.4 nd OST RPN1 113.8 584.4 OST RPN2 129.2 1174.7 Degradation SULF1 2.5 0.0 Degradation SULF2 14.5 106.8 Donor TUSC3 69.7 nd Sulfo-T UST 13.6 74.4 .sup.(1)Genes are grouped after PTM (post translational modification) function (OST, oligosaccharyltransferase; GPI, Glycosylphosphatidylinositol anchor; Sulfo-T, sulfotransferase) .sup.(2)Approved HGNC gene symbol .sup.(3)Gene expression levels in HEK203 is expressed as fpkm (fragments Per Kilobase of transcript per Million) adapted from Human Protein Atlas (http://www.proteinatlas.org/) .sup.(4)Gene expression in the CHO-K1 cell line is based on WGS sequencing depth adapted from Xu et al. 2011, Nature Biotech 29:735-742, nd means not detectable and na means not analysed.
[0248] To explore the feasibility of engineering the glycosylation capacity in a human cell and display different glycomes, the present invention employed a nuclease-mediated (ZFNs, TALENs, CRISPR/Cas9) KO screen in a human embryonic kidney HEK293 cell line. The present invention designed a KO screen of genes encoding glycosyltransferases with potential to control early steps in glycosylation of lipids, proteins, and proteoglycans expressed in HEK293 (
[0249] The present invention probed the effects of the knock out screen and display of a cancer-associated glycoform by immunostaining of engineered HEK293 cells with a panel of monoclonal antibodies to different truncated O-glycoforms including Tn, STn, and T.
[0250] The present invention probed the effects of the knock out screen and display of a cancer-associated glycoform by immunostaining of engineered HEK293 cells expressing a cell-membrane chimeric reporter construct containing a human protein sequence derived from human MUC1.
[0251] The present invention relates to reporter constructs useful for displaying specific human protein sequences with different glycoforms. The present invention used a protein sequence derived from the tandem repeat of human MUC1 mucin for display of cancer-associated glycoforms of MUC1. The reporter construct was designed to generate a chimeric type 1 transmembrane protein based on sinal peptide sequences derived from platelet GB1b (amino acid 1-41) or MUC1 (amino acid 1-51) fused to enhanced cyan fluorescent protein (ECFP) linked to a interchangeable polypeptide region fused to the membrane anchoring domain of CD34 (amino acids 129-279) or MUC1 (ENST00000611571.4 amino acid 1039-1196).
[0252] The present invention probed the effect of displaying different glycoforms of MUC1 in the reporter construct on HEK293 cells with the monoclonal antibody 5E5 detecting a cancer-associated Tn glycoforms on MUC1 (Tarp 2007).
[0253] The present invention used ZFNs, TALENs and CRISPR/Cas9 to target and knock out glycosyltransferase genes in a combinatorial approach involved in lipid, protein and proteoglycans (
[0254] Steps 2-4 are different depending on type of glycoconjugate. Type of glycoconjugate is identified by displaying glycans using a multiplicity of mammalian cells with mutations in the genes included in Step 1, see
[0255] For each glycoconjugate and for each of steps 2, 3, 4 and 5 targeted glycan arrays may be displayed on a multiplicity of mammalian cells with mutations in glycogenes shown in
[0256] Introduction of New Glycosylation Capacity in HEK293 Cells.
[0257] The present invention further provides strategies to display glycoforms not normally found in HEK293 cells. The invention provides a strategy to develop mammalian cells with defined and/or more homogenous glycosylation capacities that serves as template for de novo engineering of desirable glycosylation capacities by introduction of one or more glycosyltransferases using site-directed gene integration and/or classical random integration after transfection of cDNA and/or genomic constructs. The strategy involves inactivating glycosyltransferase genes to obtain a homogenous glycosylation capacity in a particular desirable type of glycosylation, for example using the design matrix developed herein for all types of glycosylation of glycoconjugates, and for example but not limited to inactivation of the C1GALT1 and/or COSMC genes to truncate O-glycans in a HEK293 cell and obtaining a cell without sialic acid capping of O-GalNAc glycans. In such a cell the de novo introduction of one or more new glycosylation capacities that utilize the more homogenous truncated glycan product obtained by one or more glycosyltransferase gene inactivation events, will provide for non-competitive glycosylation and more homogeneous glycosylation by the de novo introduced glycosyltransferases. For example but not limited to introduction of a 2,6 sialyltransferase such as ST6GALNAC1 into a mammalian cell with inactivated C1GALT1 and/or COSMC genes (
[0258] Knock Out Targeting Strategy.
[0259] It is clear to the person skilled in the art that inactivation of a glycosyltransferase gene can have a multitude of outcomes and effects on the transcript and/or protein product translated from this. Targeted inactivation experiments performed herein involved PCR and sequencing of the introduced alterations in the genes as well as RNAseq analysis of clones to determine whether a transcript was formed and if potential novel splice variations have possibly introduced new protein structures. Moreover, methods for determining presence of protein from such transcripts are available and include mass spectrometry and SDS-PAGE Western blot analysis with relevant antibodies detecting the most N-terminal region of the protein products.
[0260] The targeting constructs were generally designed to target the first 1/3 of the open reading frame (ORF) of the coding regions but other regions were also targeted. For most clones, out of frame mutations (Indels) that introduced premature stop, non-sense codons or incorrect splicing were selected. This would be expected to produce truncated proteins if any protein at all and without the catalytic domain and hence enzymatic activity. The majority of KO clones exhibited out of frame insertions and/or deletions (indels), and most targeted genes were present with two alleles, while some were present with 1 or 3 alleles, respectively. In a few cases larger deletions were found and these disrupted one or more exons and exon/intron boundaries also resulting in truncated proteins.
[0261] Most ER-Golgi glycosyltransferases share the common type 2 transmembrane structure with a short cytosolic tail that may direct retrograde trafficking and residence time, a non-cleaved signal peptide containing a hydrophobic transmembrane -helix domain for retention in the ER-Golgi membrane, a variable length stem or stalk region believed to displace the catalytic domain into the lumen of the ER-Golgi, and a C-terminal catalytic domain required for enzymatic function (Colley 1997). Only polypeptide GalNAc-transferases has an additional C-terminal lectin domain (Bennett 2012). The genomic organization of glycosyltransferase genes varies substantially with some genes having a single coding exon and others more than 10-15 coding exons, although few glycosyltransferase genes produce different splice variants encoding different protein products.
[0262] Inactivation of glycosyltransferase genes in some of the first coding regions may thus have a multitude of effects on transcript and protein products if these are made: i) one or more transcripts may be unstable and rapidly degraded resulting in little or no transcript and/or protein; ii) one or more transcripts may be stable but not or only poorly translated resulting in little or no protein synthesis; iii) one or more transcripts may be stable and translated resulting in protein synthesis; iv) one or more transcripts may result in protein synthesis but protein products are degraded due to e.g. truncations and/or misfolding; v) one or more transcripts may result in protein synthesis and stable protein products that are truncated and enzymatically inactive; and vi) one or more transcripts may result in protein synthesis and stable protein products that are truncated but have enzymatic activity.
[0263] It is evident for the skilled in the art that gene inactivation that lead to protein products with enzymatic activity is undesirable, and these event are easily screened for by the methods used in the present invention, e.g. but not limited to lectin/antibody labeling and glycoprofiling of proteins expressed in mutant cells.
[0264] However, it is desirable to eliminate potential truncated protein products that may be expressed from mutated transcripts as these may have undesirable effects on glycosylation capacity. Thus, truncated protein products from type 2 glycosyltransferase genes containing part of or entire part of the cytosolic, and/or the transmembrane retention signal, and/or the stem region, and/or part of the catalytic domain may exert a number of effects on glycosylation in cells. For example, the cytosolic tail may compete for COP-I retrograde trafficking of Golgi resident proteins (Eckert, Reckmann et al. 2014), the transmembrane domain may compete for localization in ER-Golgi and potential normal associations and/or aggregations of proteins, and the stem region as well as part of an inactive catalytic domain may have similar roles or part of roles in normal associations and/or aggregations of proteins in ER-Golgi. Such functions and other unknown ones may affect specific glycosylation pathways that the enzymes are involved in, specific functions of isoenzymes, or more generally glycosylation capacities of a cell. While these functions and effects are unknown and unpredictable today, it is an inherent part of the present invention that selection of mammalian cell clones with inactivated glycosyltransferase genes includes selection of editing events that do not produce truncated protein products.
[0265] An object of the present invention relates to a cell comprising one or more glycosyltransferase genes that have been inactivated, and that displays new and/or more homogeneous glycans.
[0266] In some embodiments of the present invention the cell comprises two or more glycosyltransferase genes that have been inactivated.
[0267] Another object of the present invention relates to a cell comprising one or more glycosyltransferase genes that have been introduced stably by site-specific gene or non-site-specific knock in and that display new and/or more homogeneous glycans.
[0268] In some embodiments of the present invention the cell comprises two or more glycosyltransferase that have been introduced stably by site-specific or non-site-specific gene knock in.
[0269] An aspect of the present invention relates to a cell comprising one or more glycosyltransferase genes introduced stably by site-specific or non-site-specific gene knock in, and furthermore comprising one or more endogenous glycosyltransferase genes that have been inactivated by knock out, and that displays new and/or more homogeneous glycans.
[0270] A further aspect of the present invention relates to a cell comprising two or more glycosyltransferase genes encoding isoenzymes with partial overlapping glycosylation functions in the same biosynthetic pathway and/or same biosynthetic step inactivated, and for which inactivation of two or more of these genes is required for display of new and/or more homogeneous glycans.
[0271] In some embodiments of the present invention the cell comprises one or more glycosyltransferase genes inactivated to block and truncate one or more glycosylation pathways.
[0272] A further aspect of the present invention relates to a cell comprising two or more glycosyltransferase genes inactivated to block and truncate one or more glycosylation pathways.
[0273] In some embodiments of the present invention the cell comprises targeted inactivation of one or more glycosyltransferase genes for which no transcripts are detectable.
[0274] A further aspect of the present invention relates to a cell comprising targeted inactivation of one or more glycosyltransferase genes for which no protein products are detectable.
[0275] Another aspect of the present invention relates to a cell comprising targeted inactivation of one or more glycosyltransferase genes for which no protein products with intact cytosolic and/or transmembrane region is detectable.
[0276] In some other embodiments of the present invention is the glycosyltransferase any one or more of the genes listed in Tables 1 and 2.
[0277] In some embodiments of the present invention are the glycosyltransferases that are inactivated working in the same glycosylation pathway.
[0278] In some other embodiments of the present invention are the glycosyltransferases that are inactivated working in the same glycosylation step.
[0279] In yet other embodiments of the present invention are the glycosyltransferases that are inactivated working in consecutive biosynthetic steps.
[0280] In some embodiments of the present invention are the glycosyltransferases that are inactivated retained in the same subcellular topology.
[0281] In some other embodiments of the present invention are the glycosyltransferases that are inactivated having similar amino acid sequence.
[0282] In further embodiments of the present invention are the glycosyltransferases that are inactivated belonging to the CAZy family.
[0283] In yet other embodiments of the present invention are the glycosyltransferases that are inactivated belonging to same subfamily of isoenzymes in a CAZy family.
[0284] In some embodiments of the present invention are the glycosyltransferases that are inactivated having similar structural retention signals (transmembrane sequence and length).
[0285] In some other embodiments of the present invention are the glycosyltransferase genes functioning in the same glycosylation pathway inactivated, and wherein they are not involved in the same glycosylation step.
[0286] In further embodiments of the present invention are the glycosyltransferase genes functioning in the same glycosylation pathway inactivated, and wherein they are involved in the same glycosylation step.
[0287] In some embodiments of the present invention the cell or cell line is a mammalian cell or cell line, or an insect cell or cell line.
[0288] In some other embodiments of the present invention the cell is derived from human kidney.
[0289] In further embodiments of the present invention the cell is selected from the group consisting of HEK293, NS0, SP2/0, YB2/0, HUVEC, HKB, PER-C6, NS0, or derivatives of any of these cells.
[0290] In some embodiments of the present invention is the cell a HEK293 cell.
[0291] In some other embodiments of the present invention the cell furthermore encodes an exogenous protein of interest.
[0292] In some embodiments of the exogenous protein of interest is an antibody, an antibody fragment, or a polypeptide, such as an IgG antibody.
[0293] In some embodiments of the invention the exogenous protein of interest is a lysosomal enzyme.
[0294] In some embodiments of the invention the exogenous protein of interest is a lysosomal enzyme, which lysosomal enzyme is expressed to comprise one or more posttranslational modifications independently selected from:
[0295] a) with 2,3NeuAc capping,
[0296] b) without 2,3NeuAc capping,
[0297] c) with 2,6NeuAc capping,
[0298] d) without 2,6NeuAc capping,
[0299] e) without LacDiNac structure,
[0300] f) high Mannose6phosphate,
[0301] g) low Mannose6phosphate, and
[0302] h) without bisecting glycoforms.
[0303] In some embodiments of the invention the exogenous protein of interest is a lysosomal enzyme, and the one or more endogenous glycogene inactivated and/or exogenous glycogene introduced independently in individual cells of said plurality of mammalian cells is selected from the list of GNPTAB, GNPTG, NAGPA, ALG3/6/8/9/10/12s, Mannosidases (MAN1A1, MAN1A2, MAN1B1, MAN1C1, MAN2A1, MAN2A2), MOGS, GANAB plus MGAT1/2 and Sialyl transferases.
[0304] In some embodiments of the invention the exogenous protein of interest is a lysosomal enzyme, and the one or more endogenous glycogene inactivated is GNPTAB, such as in order to increase sialic acids.
[0305] In some embodiments of the invention the exogenous protein of interest is a lysosomal enzyme, wherein said lysosomal enzyme has obtained increased mannose-6-phosphate (M6P) tagging of N-glycans and/or has obtained changed site occupancy of M6P, such as by knocking out a gene selected from ALG3, ALG8, NAGPA.
[0306] In some embodiments of the invention the exogenous protein of interest is a lysosomal enzyme, wherein said lysosomal enzyme has obtained increased high mannose structures, such as by knocking out a gene selected from MGAT1 and/or GNPTAB and/or MOGS.
[0307] In yet other embodiments of the present invention is the protein of interest a human protein.
[0308] In further embodiments of the present invention is the human protein a mucin or a fragment of a human mucin.
[0309] In some embodiments of the present invention is the glycosylation made more homogenous.
[0310] In some other embodiments of the present invention is the glycosylation non-sialylated.
[0311] In some other embodiments of the present invention is the glycosylation 2,3sialylated.
[0312] In some other embodiments of the present invention is the glycosylation 2,6sialylated.
[0313] In yet other embodiments of the present invention is the glycosylation non-galactosylated.
[0314] In some embodiments of the present invention comprises the glycosylation high mannose N-glycans.
[0315] In some other embodiments of the present invention does the glycosylation not comprise poly-LacNAc.
[0316] In yet other embodiments of the present invention is the glycosylation any combination without fucose.
[0317] One aspect of the present invention relates to a glycoprotein according to the present invention, which is a homogeneous glycoconjugate produced from a glycoprotein having a simplified glycan profile.
[0318] An object of the present invention is to provide a cell capable of expressing a gene encoding a polypeptide of interest, wherein the polypeptide of interest is expressed comprising one or more posttranslational modification patterns.
[0319] In some embodiments of the present invention is the posttranslational modification pattern a glycosylation.
[0320] The optimal glycoform displayed on cells may be identified by the following process:
[0321] (i) producing a plurality of isogenic cells with different glycosylation capacities by inactivating and/or introducing one or more glycosyltransferase genes in said mammalian cells and having at least one novel glycosylation capacity, and (ii) determination of the interaction of said cells displaying different glycans with a biomolecule for example a protein such as a lectin or antibody or carbohydrate-binding protein and/or a microorganism for example a virus or bacteria or fungi or parasite or components thereof in a binding assay in comparison with a reference in same binding assay; and (iii) determination of the cell(s) displaying glycan structure(s) (glycoforms) with the higher/highest binding activity and determination of the cell(s) glycogene genotype fingerprint which is correlated with the higher/highest binding activity level of said cell(s).
[0322] The above described process allows the identification of the optimal glycan structure for display of binding interaction. Those skilled in the art by using the genotype fingerprint identified in (iii) may generate an efficient engineered cell line with the optimal genotype for display of the glycan and glycoconjugate on said cell.
[0323] The above described process allows the identification of the optimal glycan structure for binding interaction. For those skilled in the art by using the genotype fingerprint identified in (iii) may generate an efficient engineered cell line with the optimal genotype for production of the glycoconjugate with said glycan.
[0324] One aspect of the present invention relates to a method for displaying on cell surface and/or secreting a glycoprotein having modified glycan profile wherein the cell producing the glycoprotein has more than one modification of one or more glycosyltransferase genes.
[0325] In some embodiments of the present invention has the cells been modified by glycosyltransferase gene knock-out and/or knock-in of an exogeneous DNA sequence coding for a glycosyltransferase.
[0326] In some embodiments of the present invention one or more endogenous gene selected from the group consisting of GALNT1/T2/T3/T4/T5/T6/T7/T8/T9/T10/T11/T12/T13/T14/T15/T16/T17/T18/T19/T20, POMT1/T2, TMTC1/TMTC2/TMTC3/TMTC4, XYLT1/2, POGLUT1, POFUT1/2, EOGT, UGT8, DPY19L1/2/3/4, SST3A, SST3B, ALG3/6/8/9/10/12 have been knocked out in a plurality of mammalian cells (
[0327] In some embodiments of the present invention all endogenous gene selected from the group consisting of GALNT1/T2/T3/T4/T5/T6/T7/T8/T9/T10/T11/T12/T13/T14/T15/T16/T17/T18/T19/T20, POMT1/T2, TMTC1/TMTC2/TMTC3/TMTC4, XYLT1/2, POGLUT1, POFUT1/2, EOGT, UGT8, DPY19L1/2/3/4, SST3A, SST3B, ALG3/6/8/9/10/12 have been knocked out in a plurality of mammalian cells except for one specific gene selected from the same list (
[0328] In some embodiments of the present invention one or more exogenous gene selected from the group consisting of GALNT1/T2/T3/T4/T5/T6/T7/T8/T9/T10/T11/T12/T13/T14/T15/T16/T17/T18/T19/T20, POMT1/T2, TMTC1/TMTC2/TMTC3/TMTC4, XYLT1/2, POGLUT1, POFUT1/2, EOGT, UGT8, DPY19L1/2/3/4, have been knocked in in a plurality of mammalian cells (
[0329] In some embodiments of the present invention one or more endogenous gene selected from the group consisting of C1GALT1/COSMC, POMGNT1, POMGNT2, B4GALT7, MGAT1, GXYLT1/2, LFNG/MFNG/RFNG, B4GALT5/6, CSGALNACT1/T2, and EXTL2/L3 have been knocked out in a plurality of mammalian cells (
[0330] In some embodiments of the present invention one or more exogenous gene selected from the group consisting of C1GALT1/COSMC, POMGNT1, POMGNT2, B4GALT7, MGAT1, GXYLT1/2, LFNG/MFNG/RFNG, B4GALT5/6, CSGALNACT1/T2, and EXTL2/L3 have been knocked in in a plurality of mammalian cells (
[0331] In some embodiments of the present invention one or more endogenous gene selected from the group consisting of B4GALT1/T2/T3/T4/T5/T6/T7, B3GNT2/T3/T4/T5/T7/T8/T9, GCNT1/T2/T3/T4, MGAT2/3/4A/4B/5/5B, MAN1A1/2, MAN1B1, MAN1C1, MAN2A1/2, MOGS, GANAB, POMK/LARGE, A4GALT/B3GALNT1/B3GNT5/GBGT1, CS/HS/KS polymerase genes and CHPF/CHF2/CHSY1/CHSY3/EXT1/T2 have been knocked out in a plurality of mammalian cells (
[0332] In some embodiments of the present invention one or more exogenous gene selected from the group consisting of B4GALT1/T2/T3/T4/T5/T6/T7, B3GNT2/T3/T4/T5/T7/T8/T9, GCNT1/T2/T3/T4, MGAT2/3/4A/4B/5/5B, POMK/LARGE, A4GALT/B3GALNT1/B3GNT5/GBGT1, CS/HS/KS polymerase genes and CHPF/CHF2/CHSY1/CHSY3/EXT1/T2 have been knocked in in a plurality of mammalian cells (
[0333] In some embodiments of the present invention one or more endogenous gene selected from the group consisting of ST3GAL1/2/3/4/5/6, ST6GAL1/2, ST6GALNAC1/2/3/4/5/6, ST8SIA1/2/3/4/5/6, FUT1/2/3/4/5/6/7/8/9/10/11, and A4GNT/ABO have been knocked out in a plurality of mammalian cells (
[0334] In some embodiments of the present invention one or more exogenous gene selected from the group consisting of ST3GAL1/2/3/4/5/6, ST6GAL1/2, ST6GALNAC1/2/3/4/5/6, ST8SIA1/2/3/4/5/6, FUT1/2/3/4/5/6/7/8/9/10/11, and A4GNT/ABO have been knocked in in a plurality of mammalian cells (
[0335] In some embodiments of the present invention one or more endogenous gene selected from the group consisting of DSEL, CHST1/T2/T3/T4/T5/T6/T7T/8/T9/T10/T11/T12/T13/T15/T15, UST, GLCE, HS2ST1, HS3T1/T2/T3A1/T3B1/T4/T5/T6 and/or HS6ST1/T2/T3, NDST1/T2/T3/T4, and GAL3ST1/T2/T3/T4 and GNPTAB, GNPTG, NAGPA have been knocked out in a plurality of mammalian cells (
[0336] In some embodiment of the present invention the plurality of mammalian cells comprises one or more cells with knock out of all genes in a group (or any one of the listings mentioned herein) except one gene in the same group or listing. It is to be understood that this may be used to isolate and investigate a single glycosylation capacity.
[0337] In some embodiment of the present invention the plurality of mammalian cells comprises one or more cells with knock out of just one gene in a group (or any one of the listings mentioned herein). It is to be understood that this may be used to isolate and investigate the relevance of this particular gene for the glycosylation capacity.
[0338] In some embodiments of the present invention one or more exogenous gene selected from the group consisting of DSEL, CHST1/T2/T3/T4/T5/T6/T7T/8/T9/T10/T11/T12/T13/T15/T15, UST, GLCE, HS2ST1, HS3T1/T2/T3A1/T3B1/T4/T5/T6 and/or HS6ST1/T2/T3, NDST1/T2/T3/T4, and GAL3ST1/T2/T3/T4 and GNPTAB, GNPTG, NAGPA have been knocked in in a plurality of mammalian cells (
[0339] One aspect of the present invention relates to a method for producing a glycoprotein having a plurality of glycan profiles, the method comprising expressing such protein in a plurality of mammalian cells with inactivation of one or more glycosyltransferases, and/or knock in of one or more glycosyltransferases, or a combination hereof in a cell, and isolating said proteins from a plurality of mammalian cells.
[0340] In another embodiment the present invention relates to a method for producing a glycoprotein having a plurality of glycan profiles, and from this plurality of glycovariant protein identify those with improved (drug) properties. The selection may comprise analyzing the glycovariant proteins for activity in comparison with a reference glycoprotein in (a) suitable bioassay(s); and selection of the glycoform with the higher/highest/optimal activity.
[0341] In another aspect of the present invention is one or more of the above mentioned genes knocked out using transcription activator-like effector nucleases (TALENs).
[0342] TALENs are artificial restriction enzymes generated by fusing a TAL effector DNA binding domain to a DNA cleavage domain.
[0343] In yet another aspect of the present invention is one or more of the above mentioned genes knocked out using CRISPRs (clustered regularly interspaced short palindromic repeats).
[0344] CRISPRs are DNA loci containing short repetitions of base sequences. Each repetition is followed by short segments of spacer DNA from previous exposures to a virus.
[0345] CRISPRs are often associated with cas genes that code for proteins related to CRISPRs. The CRISPR/Cas system is a prokaryotic immune system that confers resistance to foreign genetic elements such as plasmids and phages and provides a form of acquired immunity.
[0346] CRISPR spacers recognize and cut these exogenous genetic elements in a manner analogous to RNAi in eukaryotic organisms.
[0347] The CRISPR/Cas system is used for gene editing (adding, disrupting or changing the sequence of specific genes) and gene regulation in species throughout the tree of life. By delivering the Cas9 protein and appropriate guide RNAs into a cell, the organism's genome can be cut at any desired location.
[0348] The cell of the present invention may by a cell that does not comprise the gene of interest to be expressed or the cell may comprise the gene of interest to be expressed. The cell that does not comprise the gene of interest to be expressed is usually called a naked cell.
[0349] The host cell of the present invention may be any host, so long as it can display different glycans in a plurality of isogenic subclones. Examples include a yeast cell, an animal cell, a mammalian cell, an insect cell, a plant cell and the like.
[0350] In some embodiments of the present invention is the cell selected from the group consisting of HEK293, NS0, SP2/0, YB2/0, YB2/3HL.P2.G11.16Ag.20, NS0, SP2/0-Ag14, BHK cell derived from a human kidney, a syrian hamster kidney tissue, antibody-producing hybridoma cell, human leukemia cell line (Namalwa cell), an embryonic stem cell, and fertilized egg cell.
[0351] In a preferred embodiment of the present invention is the cell a HEK293 cell.
[0352] The cell can be an isolated cell or in cell culture or a cell line.
[0353] In one aspect of the present invention is the cell or components of the cell an antigen or vaccine component.
[0354] In another aspect of the present invention is the cell or components of the cell displaying glycans associated with diseases and useful for stimulating antibodies with selective or exclusive reactivity with glycans and/or glycoforms of proteins associated with diseases.
[0355] The cells of the present invention may there for be used to treat immune diseases, cancer, viral or bacterial infections or other diseases or disorders mentioned above.
[0356] The protein of interest can be various types of proteins, and in particular proteins that are glycosylated when expressed recombinant in the cell.
[0357] In a preferred embodiment the protein is an integral membrane bound protein when expressed recombinant in the cell.
[0358] In another preferred embodiment the protein is a secreted protein when expressed recombinant in a cell.
[0359] In one aspect of the present invention is the protein an antigen or vaccine component.
[0360] The glycoproteins of the present invention may there for be use to treat immune diseases, cancer, viral or bacterial infections or other diseases or disorders mentioned above.
[0361] It should be noted that embodiments and features described in the context of one of the aspects of the present invention also apply to the other aspects of the invention.
[0362] Definitions
[0363] Isogenic refers to cells having the same or essentially the same genotype (same genes) except for specific genes specified to be inactivated and/or introduced in some individual cell. Accordingly a population of HEK cells may be isogenic, but may also have some variations in terms of individual genes being knocked in or knocked out in some cells of the isogenic cell population.
[0364] a plurality in relation to a plurality of cells refers to more than one cell, wherein a cell of said plurality is different from the other cells of said plurality. There may also be two or more such as a population of identical cells within this plurality of cells.
[0365] A plurality of isogenic mammalian cells may be used interchangeably with a plurality of mammalian cells. Unless otherwise specified this means the same.
[0366] Cell array refers to a plurality of unique cells, for example a plurality of mammalian cells having the exact same genotype. Accordingly, it is to be understood that a cell array will contain a population of one type of unique individual cells, a second population of a second type of unique individual cells, a third population of a third type of unique individual cells and so forth up to a limit in size of the cell array.
[0367] The term glycome display library as used herein refers to a cell array designed to display different glycomes of the cells used in a library, wherein each different unique cell within the library is trackable back so that the specific genetic manipulation with glycogenes within a particular cell within the library is known at any time. It is to be understood that the cells used in the display library is kept and maintained in a suitable cell bank, and with a unique identification so that any inactivated glycogenes and/or introduced glycogenes within a particular cell is known at any time this particular cell is used and so that this particular unique cell may be used for other purposes.
[0368] General Glycobiology
[0369] Basic glycobiology principles and definitions are described in Varki et al. Essentials of Glycobiology, 2nd edition, 2009.
[0370] CAZy refers to Carbohydrate-Active enZYmes Database which describes the families of structurally-related catalytic and carbohydrate-binding modules (or functional domains) of enzymes that degrade, modify, or create glycosidic bonds. CAZy reference: Lombard V, Golaconda Ramulu H, Drula E, Coutinho P M, Henrissat B (2014) The Carbohydrate-active enzymes database (CAZy) in 2013. Nucleic Acids Res 42:D490-D495.
[0371] CAZy Families are subdivision of enzymes that catalyze breakdown, biosynthesis and/or modification of glycoconjugates.
[0372] CAZy Subfamilies are subgroups found within a family that share a more recent ancestor and, that are usually more uniform in molecular function.
[0373] N-glycosylation refers to the attachment of the sugar molecule oligosaccharide known as glycan to a nitrogen atom residue of a protein
[0374] O-glycosylation refers to the attachment of a sugar molecule to an oxygen atom in an amino acid residue in a protein.
[0375] Galactosylation means enzymatic addition of a galactose residue to lipids, carbohydrates or proteins.
[0376] Sialylation is the enzymatic addition of a neuraminic acid residue.
[0377] Neuraminic acid (or NeuAc) is a 9-carbon monosaccharide, a derivative of a ketononose.
[0378] Monoantennary N-linked glycan is a engineered N-glycan consist of the N-glycan core (Man1-6(Man1-3)Man1-4GlcNAc1-4GlcNAc1-Asn-X-Ser/Thr) that elongated with a single GlcNAc residue linked to C-2 and of the mannose 1-3. The single GlcNAc residue can be further elongated for example with with Gal or Gal and NeuAc residues.
[0379] Biantennary N-linked glycan is the simplest of the complex N-linked glycans consist of the N-glycan core (Man1-6(Man1-3)Man1-4GlcNAc1-4GlcNAc1-Asn-X-Ser/Thr) elongated with two GlcNAc residues linked to C-2 and of the mannose 1-3 and the mannose 1-6. This core structure can then be elongated or modified by various glycan structures.
[0380] Triantennary N-linked glycans are formed when an additional GlcNAc residue is added to either the C-4 of the core mannose 1-3 or the C-6 of the core mannose 1-6 of the bi-antennary core structure. This structure can then be elongated or modified by various glycan structures.
[0381] Tetratantennary N-linked glycans are formed when two additional GlcNAc residues are added to either the C-4 of the core mannose 1-3 or the C-6 of the core mannose 1-6 of the bi-antennary core structure. This core structure can then be elongated or modified by various glycan structures.
[0382] Poly-LacNAc poly-N-acetyllactosamine ([Gal1-4GlcNAc]n; n2.)
[0383] Glycoprofiling means characterization of glycan structures resident on a biological molecule or cell.
[0384] Glycosylation pathway refers to assembly of monosaccharides into a group of related complex carbohydrate structures by the stepwise action of enzymes, known as glycosyltransferases. Glycosylation pathways in mammalian cells are classified as N-linked protein glycosylation, different O-linked protein glycosylation (O-GalNAc, O-GlcNAc, O-Fuc, O-Glc, O-Xyl, O-Gal), different series of glycosphingolipids, and GPI-anchors.
[0385] Biosynthetic Step means the addition of a monosaccharide to a glycan structure.
[0386] Glycosyltransferases are enzymes that catalyze the formation of the glycosidic linkage to form a glycoside. These enzymes utilize activated sugar phosphates as glycosyl donors, and catalyze glycosyl group transfer to a nucleophilic group, usually an alcohol. The product of glycosyl transfer may be an O-, N-, S-, or C-glycoside; the glycoside may be part of a monosaccharide, oligosaccharide, or polysaccharide.
[0387] Glycogenes includes glycosyltransferases and related glycogenes, wherein related glycogenes comprise any other enzyme acting on glycans to modify their structure. This included but is not limited to sulfotransferases, epimerases and deacetylases. In some embodiments the related glycogene is selected from sulfotransferases, epimerases and deacetylases.
[0388] Glycosylation capacity means the ability to produce an amount of a specific glycan structure by a given cell or a given glycosylation process.
[0389] Glycoconjugate is a macromolecule that contains monosaccharides covalently linked to proteins or lipids
[0390] Simple(r) glycan structure is a glycan structure containing fewer mono-saccharides and/or having lower mass and/or having fewer antennae.
[0391] Human like glycosylation means having glycan structures resembling those of human cells. Examples including more sialic acids with 2,6 linkage (more 2,6 sialyltransferase enzyme) and/or less sialic acids with 2,3 linkage and/or more N-acetylneuraminic acid (Neu5Ac) and/or less N-glycolylneuraminic acid (Neu5Gc).
[0392] Display refers to presentation of a plurality of glycan structures on a cell or on one or more glycoconjugates for analysis of binding interactions or other assays probing biological functions.
[0393] Cleavage refers to the breakage of the covalent backbone of a DNA molecule. Cleavage can be initiated by a variety of methods including, but not limited to, enzymatic or chemical hydrolysis of a phosphodiester bond. Both single-stranded cleavage and double-stranded cleavage are possible, and double-stranded cleavage can occur as a result of two distinct single-stranded cleavage events. DNA cleavage can result in the production of either blunt ends or staggered ends. In certain embodiments, fusion polypeptides are used for targeted double-stranded DNA cleavage.
[0394] Deconstruction means obtaining cells producing a simpler glycan structures by single or stacked knock out of glycosyltransferases. Deconstruction of a glycosylation pathway means knock out of glycosyltransferases involved in each step in biosynthesis and identification of glycosyltransferases controlling each biosynthetic step.
[0395] Modified glycan profile refers to change in number, type or position of oligosaccharides in glycans on a given glycoprotein.
[0396] More homogeneous glycosylation means that the proportion of identical glycan structures observed by glycoprofiling a given protein expressed in one cell is larger than the proportion of identical glycan structures observed by glycoprofiling the same protein expressed in another cell.
[0397] General DNA and Molecular Biology Tools.
[0398] Any of various techniques used for separating and recombining segments of DNA or genes, commonly by use of a restriction enzyme to cut a DNA fragment from donor DNA and inserting it into a plasmid or viral DNA. Using these techniques, DNA coding for a protein of interest is recombined/cloned (using PCR and/or restriction enzymes and DNA ligases or ligation independent methods such as USER cloning) into a plasmid (known as an expression vector), which can subsequently be introduced into a cell by transfection using a variety of transfection methods such as calcium phosphate transfection, electroporation, microinjection and liposome transfection. Overview and supplementary information and methods for constructing synthetic DNA sequences, insertion into plasmid vectors and subsequent transfection into cells can be found in Ausubel et al, 2003 and/or Sambrook & Russell, 2001.
[0399] Gene refers to a DNA region (including exons and introns) encoding a gene product, as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences or situated far away from the gene which function they regulate. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites, and locus control regions.
[0400] Targeted Gene Modifications, Gene Editing or Genome Editing
[0401] Gene editing or genome editing refer to a process by which a specific chromosomal sequence is changed. The edited chromosomal sequence may comprise an insertion of at least one nucleotide, a deletion of at least one nucleotide, and/or a substitution of at least one nucleotide. Generally, genome editing inserts, replaces or removes nucleic acids from a genome using artificially engineered nucleases such as Zinc finger nucleases (ZFNs), Transcription Activator-Like Effector Nucleases (TALENs), the CRISPR/Cas system, and engineered meganuclease re-engineered homing endonucleases. Genome editing principles are described in Steentoft 2014 and gene editing methods are described in references therein and also broadly used and thus known to person skilled in the art.
[0402] Endogenous sequence/gene/protein refers to a chromosomal sequence or gene or protein that is native to the cell or originating from within the cell or organism analyzed
[0403] Exogenous sequence or gene refers to a chromosomal sequence that is not native to the cell, or a chromosomal sequence whose native chromosomal location is in a different location in a chromosome or originating from outside the cell or organism analyzed
[0404] Inactivated chromosomal sequence refer to genome sequence that has been edited resulting in loss of function of a given gene product. The gene is said to be knocked out.
[0405] Heterologous refers to an entity that is not native to the cell or species of interest.
[0406] Multiple knock-outs. GALNT1/GALNT2/GALNT3 or in general gene names separated by/(slash) may refer to multiple knock-out meaning all genes are knocked out in same cell. Listing of more genes names may be abbreviated using numbers, for example GALNT1/2/3 means GALNT1/GALNT2/GALNT3. Alternatively, and accordingly in different embodiments of the present invention general gene names in a list separated by / (slash) may refer to one or more, such as two or more, three or more, four or more, etc, or all gene knock-outs from this list.
[0407] The terms nucleic acid and polynucleotide refer to a deoxyribonucleotide or ribonucleotide polymer, in linear or circular conformation, and in either single- or double-stranded form. For the purposes of the present disclosure, these terms are not to be construed as limiting with respect to the length of a polymer. The terms can encompass known analogs of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones). In general, an analog of a particular nucleotide has the same base-pairing specificity; i.e., an analog of A will base-pair with T.
[0408] The term nucleotide refers to deoxyribonucleotides or ribonucleotides. The nucleotides may be standard nucleotides (i.e., adenosine, guanosine, cytidine, thymidine, and uridine) or nucleotide analogs. A nucleotide analog refers to a nucleotide having a modified purine or pyrimidine base or a modified ribose moiety. A nucleotide analog may be a naturally occurring nucleotide (e.g., inosine) or a non-naturally occurring nucleotide.
[0409] The terms polypeptide and protein are used interchangeably to refer to a polymer of amino acid residues. These terms may also refer to glycosylated variants of the polypeptide or protein, also termed glycoprotein. polypeptide, protein and glycoprotein is used interchangeably throughout this disclosure.
[0410] The term recombination refers to a process of exchange of genetic information between two polynucleotides. For the purposes of this disclosure, homologous recombination refers to the specialized form of such exchange that takes place, for example, during repair of double-strand breaks in cells. This process requires sequence similarity between the two polynucleotides, uses a donor or exchange molecule to template repair of a target molecule (i.e., the one that experienced the double-strand break), and is variously known as non-crossover gene conversion or short tract gene conversion, because it leads to the transfer of genetic information from the donor to the target. Without being bound by any particular theory, such transfer can involve mismatch correction of heteroduplex DNA that forms between the broken target and the donor, and/or synthesis-dependent strand annealing, in which the donor is used to resynthesize genetic information that will become part of the target, and/or related processes. Such specialized homologous recombination often results in an alteration of the sequence of the target molecule such that part or all of the sequence of the donor polynucleotide is incorporated into the target polynucleotide.
[0411] As used herein, the terms target site or target sequence refer to a nucleic acid sequence that defines a portion of a chromosomal sequence to be edited and to which a targeting endonuclease is engineered to recognize, bind, and cleave.
[0412] Targeted integration is the method by which exogenous nucleic acid elements are specifically integrated into defined loci of the cellular genome. Target specific double stranded breaks are introduced in the genome by genome editing nucleases that allow for integration of exogenously delivered donor nucleic acid element into the double stranded break site. Thereby the exogenously delivered donor nuclei acid element is stably integrated into the defined locus of the cellular genome.
[0413] Sequence identity Techniques for determining nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity. The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation, Washington, D.C., USA, and normalized by Gribskov, Nucl. Acids Res. 14(6):6745-6763 (1986). An exemplary implementation of this algorithm to determine percent identity of a sequence is provided by the Genetics Computer Group (Madison, Wis.) in the BestFit utility application. Other suitable programs for calculating the percent identity or similarity between sequences are generally known in the art, for example, another alignment program is BLAST, used with default parameters. For example, BLASTN and BLASTP can be used using the following default parameters: genetic code=standard; filter=none; strand=both; cutoff=60; expect=10; Matrix=BLOSUM62; Descriptions=50 sequences; sort by=HIGH SCORE; Databases=non-redundant, GenBank+EMBL+DDBJ+PDB+GenBank CDS translations+Swiss protein+Spupdate+PIR. Details of these programs can be found on the GenBank website. With respect to sequences described herein, the range of desired degrees of sequence identity is approximately 80% to 100% and any integer value therebetween. Typically the percent identities between sequences are at least 70-75%, preferably 80-82%, more preferably 85-90%, even more preferably 92%, still more preferably 95%, and most preferably 98% sequence identity.
[0414] All patent and non-patent references cited in the present application, are hereby incorporated by reference in their entirety.
[0415] The invention will now be described in further details in the following non-limiting examples.
EXAMPLES
Example 1
[0416] The purpose of the following examples are given as an illustration of various embodiments of the invention and are thus not meant to limit the present invention in any way. Along with the present examples the methods described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
Example 1
Glycoengineering of Mammalian HEK293 Cells
[0417] The human HEK293 cell is the preferred cell line for transient expression of human proteins with high transfection efficiencies and at high protein production levels. Moreover, the natural glycosylation capacity of HEK293 cells is complex and includes all major types of glycoconjugates and types of protein and lipid glycosylation. Moreover, elaborations of each type of glycosylation are more diverse than many other cell types and include for example for O-GalNAc glycosylation core 2 structures and for N-linked glycosylation LacDiNAc capping structures. The present inventors used combinatorial precise gene edited knock out and knock in of human glycogenes to develop a plurality of HEK293 isogenic mammalian cells to serve as a library of cells with different capacities for glycosylation of lipids, glycoproteins and proteoglycans to provide a display platform of the human glycome in the context of endogenous HEK293 glycoconjugates. The present inventors also expressed full coding regions of human genes or a reporter construct containing parts of human genes in these cell panels to display individual human proteins or fragments thereof in a wide range of glycoforms directed by the glycosylation capacity of individuals HEK293 cells. The plurality of HEK293 cells with different glycosylation capacities with and without exogenous expressed reporter proteins was shown to enable detection of selective binding to a specific glycoform of a protein and further enable structural deconvolution of the glycan/glycopeptide epitope involved in the binding event.
[0418] Glycan arrays have represented state-of-the-art for probing GBP interactions with the glycome for the past decades. Glycan arrays, however, depend on a match between the types of glycan structures it displays and the specificity of the GBP being analyzed. The ideal array would contain the entire glycome of an organism on a single chip, so that any GBP could be assessed. In practice, however, current arrays are limited to displaying libraries of natural and synthetic glycans that can be practically assembled. Also synthesis of branched complex-type glycans of glycoproteins and glycolipids to cover the diversity of the mammalian glycome is not yet practical. Moreover, the current glycan arrays fail to present glycans in the context of glycoconjugates as well as the cell membrane. Preparation of O-GalNAc glycopeptide libraries have demonstrated the importance of presenting at least short O-glycans in the context of peptides for recognition on arrays by some antibodies with cancer-associated antibodies (Tarp 2007, Blixt 2010). Printed glycan arrays have dramatically advanced studies of biological interactions involving glycans, but there are inherent limitations in synthesis and availability of glycans and their presentation on printed arrays without the context of the full glycoconjugate structure and the surface of a cell. While a large number of lectins, antibodies and carbohydrate-binding proteins from diverse sources including animal, viral, and microbial sources have been characterized to bind specific glycan structures by probing glycan arrays, it is clear in some (many) cases that the minimum glycan epitope defined does not reflect the adhesion properties found from other studies. This suggests that the natural physiologic binding for these involve additional features of the binding epitope that could e.g. be more elaborated glycan structures as well as protein(s) and even cell surface context.
[0419] The inventors of the present invention have recently demonstrated that it is possible to stably engineer the N-glycosylation capacity of a cell line by knock out and knock in of distinct glycosyltransferase genes (Yang 2015), and that such engineered cells may be used to produce recombinant glycoprotein therapeutics with more homogeneous and/or improved glycosylation and biological properties. In the present invention, the present inventors employed a nuclease-mediated knock out screen in human HEK293 cells to explore the wider potential for engineering the glycosylation capacity in a human cells, and further to explore how this affected display of glycans on the cell and on shed glycoproteins.
[0420] The present inventors designed a step-by-step knock out strategy with sequential loss and/or gain of glycosylation capacities to display different glycomes. The step-wise strategy involves combinatorial targeting of the glycosyltransferase genes controlling: i) the initiation and glycoconjugate determination step (
TABLE-US-00005 TABLE 5 Group 1-5 genes and designated functions (in total 206*) Group 1. Initiation (47 genes) N-Gly (Asn) ALG3/6/8/9/10/12, STT3A, STT3B O-Gly (Ser/Thr) POGLUT1 (O-Glc) POFUT1/T2 (O-Fuc) POMT1/T2, TMTC1/2/3/4 (O-Man) GALNT1-T20 (O-GalNAc) OGT, EOGT (O-GlcNAc) Glycolipids (Ceramide) UGCG (Ganglio-, Lacto-, Globo-) UGT8 (Galactocerebrosides) GAG (Ser) XYLT1/T2 (O-Xyl) C-mannosyl (Trp) DPY19L1/2/3/4 (C-Man) Group 2. Truncation (13 genes) N-Gly MGAT1 O-Gly POMGNT1/T2 (O-Man) MFNG, LFNG, RFNG (O-Fuc) B3GLCT (O-Fuc) GXYLT1/T2 (O-Glc) C1GALT1C1 (O-GalNAc) Glycolipids B4GALT5/T6 (Glycosphingolipids) GAG B4GALT7 Group 3. Elongation, branching, core structures (67 genes) N-Gly MGAT2/3/4A/4B/4C/4D/5/5B, MAN1A1/1A2/1B1/1C1, MAN2A1/A2/, MOGS, GANAB N-Gly, O-Gly C1GALT1, B3GNT6 (O-GalNAc) Glycolipids GCNT1/T2/T3/T4/T6/T7 (O-GalNAc) B3GALT1/T2/T4/T5 (O-Gly, N-Gly) B3GALNT1/T2 (O-Gly) B3GNT2/T3/T4/T7/T8/T9 (O-Gly) B4GALT1/T2/T3/T4 (O-Gly, N-Gly) B4GALNT3/T4 (O-Gly, N-Gly) B3GNTL1 B4GAT1 LARGE, LARGE2, FKRP, FKTN (O-Man) A4GALT (Globo) B4GALNT1 (Ganglio) B3GNT5 (Lacto, Galacto) XXYLT1 (O-Glc) A3GALT2 GAG B3GALT6, B3GAT3 EXT1/T2 (Heparan Sulphate) EXTL1/L2/L3 (Heparan Sulphate) CHPF/2, CHSY1/3 (Heparan Sulphate) CSGALNACT1/T2 (Chondroitin/Dermatan sulfate) Group 4. Capping (35 genes) N-Gly, O-Gly FUT1/2/3/4/5/6/7/8/9/10/11 Glycolipids ST3GAL1/2/3/4/5/6 ST6GAL1/2 ST6GALNAC1/2/3/4/5/6 ST8SIA1/2/3/4/5/6 B3GAT1/T2 ABO A4GNT Group 5. Modifications (44 genes) N-Gly, O-glycan, CHST2/T4/T5/T8/T9/T10 Glycolipid (sulfatases) GAL3ST1/T2/T3/T4 GAG- CHST3/T7/T11/T12/T13/T14/T15 Chrondrotin/Dermatan/ UST Heparan sulfate NDST1/T2/T3/T4 (sulfatases) HS2ST1, HS3ST1/T2/T3A1/T3B1/T4/T5/T6, HS6ST1/T2/T3 GLCE, DSE, DSEL Keratan sulfate CHST1/T6 Acetylases CASD1 Glyco-kinases FAM20B, POMK Man-6-P GNPTAB, GNPTG, NAGPA
[0421] The present inventors utilized methods for enriching KO clones by FACS and high throughput screening by an amplicon labelling strategy (IDAA) (Duda 2014, Yang 2015). The majority of KO clones exhibited insertions and/or deletions (indels) in the range of +20 bps, and most targeted genes were present with two alleles, while some were present with 1 or 3-4 alleles. The present inventors targeted the identified human glycosyltransferase and related glycogenes (Table 1) in five different steps as outlined in
[0422] 1. Targeting the initiation and glycoconjugate determination (step 1, group 1 genes). The present inventors identified a group of glycosyltransferase genes (group 1,
[0423] 2. Targeting the second step in biosynthesis (step 2). The present inventors identified a group of glycosyltransferase genes (group 2,
[0424] 3. Targeting the elongation and branching steps (step 3). The present inventors identified a group of glycosyltransferase genes (group 3,
[0425] 4. Targeting the capping step (step 4). The present inventors identified a group of glycosyltransferase genes (group 4,
[0426] 5. Targeting the glycan modifying step (step 5). The present inventors identified a group of genes encoding enzymes modifying glycans (group 5,
[0427] Applying above stepwise glycogene knock-out approach allows probing of glycan interaction using plurality of mammalian cells displaying defined arrays of glycans, which is useful and efficient way for probing the glycosylation capacities naturally present in the HEK293 host cell.
[0428] Targeted Insertion of New Glycosylation Capacities.
[0429] The present inventors also introduced new glycosylation capacities in HEK293 to enable display of more glycan structures. The present inventors used site-directed insertion to stably integrate and express one or more human glycosyltransferase genes. The present inventors identified a group of glycosyltransferase genes not expressed in HEK293 (group 6, Table 6) that when introduced into HEK293 individually or in combination enhance the glycosylation and glycan modifying capability of HEK293 cells, and result in display of new glycan structures or modifications of glycans in different types of glycosylation pathways and on different types of glycoconjugates. A plurality of mammalian cells with one or more genes from group 6 stably introduced and with or without one or more knock outs of any of the glycosyltransferase defined in groups 1-5 genes are useful for display and screening of which type(s) of glycosylation and modifications of glycan structures on glycoconjugate(s) that are important for a given biological interaction with glycans. Group 5 genes are assigned to different types of glycosylation pathways and glycoconjugates (
[0430] A combinatorial list of all individual and stacked glycosyltransferase gene inactivation events required for display of different possible parts of the HEK293 human glycome may be generated from
TABLE-US-00006 TABLE 6 GTf and non-GTf genes where transcripts not are detected in HEK293 (55 genes in total) CAZy Gene HEK293 family.sup.(1) symbol.sup.(2) (fpkm).sup.(3) GTnc A3GALT2 0 GT32 A4GNT 0 GT6 ABO 0 GT33 ALG1L2 0 GT31 B3GALNT1 0 GT31 B3GALT2 0 GT31 B3GNT6 0 GT12 B4GALNT2 0 GT10 FUT5 0 GT10 FUT7 0 GT10 FUT9 0 GT27 GALNT15 0 GT27 GALNT5 0 GT27 GALNT9 0 GT27 GALNTL5 0 GT27 GALNTL6 0 GT27 GALNT19/WBSCR17 0 GT14 GCNT3 0 GT14 GCNT4 0 GT14 GCNT7 0 GT4 GLT1D1 0 GT6 GLT6D1 0 GT2 HAS1 0 GT54 MGAT4C 0 GTnc MGAT4D 0 GT29 ST6GAL2 0 GT29 ST6GALNAC1 0 GT29 ST8SIA1 0 GT29 ST8SIA3 0 GT29 ST8SIA4 0 GT1 UGT1A1 0 GT1 UGT1A10 0 GT1 UGT1A3 0 GT1 UGT1A4 0 GT1 UGT1A5 0 GT1 UGT1A6 0 GT1 UGT1A7 0 GT1 UGT1A8 0 GT1 UGT1A9 0 GT1 UGT2A1 0 GT1 UGT2A3 0 GT1 UGT2B10 0 GT1 UGT2B11 0 GT1 UGT2B15 0 GT1 UGT2B17 0 GT1 UGT2B28 0 GT1 UGT2B4 0 GT1 UGT2B7 0 GT1 UGT3A1 0 Sulfo-T CHST2 0 Sulfo-T GAL3ST3 0 Sulfo-T HS3ST1 0 Sulfo-T HS3ST4 0 Sulfo-T HS3ST5 0 Sulfo-T NDST3 0 .sup.(1)GT classification system (Lombard et al. 2013, Nucl Acid Res 42: D1P: D490-D495), .sup.(2)Approved HGNC gene symbol .sup.(3)Gene expression levels in HEK293 is expressed as fpkm (fragments Per Kilobase of transcript per Million) adapted from Human Protein Atlas (http://www.proteinatlas.org/)
[0431] In summary, the gene editing strategy identifies the key glycogenes controlling decisive biosynthetic steps in glycosylation of glycolipid, glycoprotein and proteoglycans in HEK293 (
[0432] The design matrix based on 214 human glycosyltransferase genes and 62 glycan modifying enzymes was used to design combinations of knock out and knock in in human cells to generate a combinatorial library of isogenic cells displaying different glycans and glycan modifications, and with capacity for secretion and shedding of recombinant glycoproteins with different glycans.
[0433] The following methods were applied for nuclease-based targeting of glycogenes in HEK293 cells. All gene targeting was performed in HEK293 cells. All media, supplements and other reagents used were obtained from Sigma-Aldrich unless otherwise specified. HEK293 cells were cultured in DMEM supplemented with 4 mM L-glutamine and 10% FBS.
[0434] For ZFN and TALEN experiments cells were seeded at 0.510.sup.6 cells/mL in T25 flask (NUNC, Denmark) one day prior to transfection. 210.sup.6 cells and 2 g endotoxin free plasmid DNA of each ZFN (Sigma, USA) or TALEN (ThermoScientifics/GeneArt, USA) were used for transfection. ZFNs were tagged with GFP and Crimson by a 2A linker as previously described (Duda 2014). Transfections were conducted by electroporation using Amaxa kit V and program U24 with Amaxa Nucleofector 2B (Lonza, Switzerland). Electroporated cells were subsequently placed in 3 mL growth media in a 6-well plate. For ZFN and TALEN experiments the intermediate/medium GFP/Crimson positive cell pool were enriched by FACS 72 h post nucleofection. Cells were single cell sorted again one week later to obtain single clones in round bottom 96 well plates. KO clones were identified by insertion deletion analysis (IDAA) as recently described (Yang 2015B), as well as when possible by immunocytology with appropriate lectins and monoclonal antibodies. Selected clones were further verified by TOPO cloning and Sanger sequencing for in detail characterization of mutations introduced. The strategy enabled fast screening and selection of KO clones with frameshift mutations, and on average the present inventors selected 2-5 clones from each targeting event. For CRISPR/Cas9 targeting 0.110.sup.6 cells were seeded in 24-wells the day prior to transfection, followed by PEI transfection (0.01% Polyethylenimin in 150 mM NaCl, pH=7) using 50 ul PEI, 25 ul 150 mM NaCl including 1 ug-Cas9 (Plasmid map in
Example 2
[0435] Determining the Glycosyltransferase Repertoire Expressed in a Mammalian HEK293 Cell Line.
[0436] For transcriptome analysis HEK293 cells were seeded at 0.2510.sup.6cells/ml in 6 well plate and harvested at exponential phase 48 h post inoculation for total RNA extraction with RNeasy mini kit (Qiagen). RNA integrity and quality were checked by 2100-Bioanalyser (Agilent Technologies). Library construction and next generation sequencing was performed using Illumina HiSeq 2000 System (Illumina, USA) under standard conditions as recommended by the RNASeq service provider. The aligned data was used to calculate the distribution of reads on human reference genes and coverage analysis was performed.
[0437] The reported RNAseq analysis of the mammalian CHO-K1 (Xu 2011) was included for comparison since the cells are widely used for biopharm production of glycoproteins and accordingly the glycosylation capacity of CHO is well characterized (Yang 2015B, Xu 2011). Most orthologous human and CHO glycogenes could be assigned, but some genes were not identifiable and annotated in the CHO genome. Importantly, a large subset of glycogenes were found to be expressed in HEK293 and not in CHO (genes with RNA Mapping Depth of 0.0 for CHO in Table 3), while only a few genes were expressed in CHO and not in HEK293.
[0438] The transcriptome analyses of HEK293 compared with reported CHO data (Xu 2011) confirms that HEK293 displays a more complex and more human glycome with examples of the following notable features not found in CHO: Extensive fucosylation (FUTs), 2,6 sialic acid capping (ST6GAL1), LacDiNAc core (B4GALNT3/T4), core2 0-glycans (GCNT1), N-glycan branching (MGAT4s), O-GalNAc glycan density (GALNTs), O-Man glycosylation and branching (POMTs and MGAT5B), glycolipids with globo, ganglio and lactoseries structures (A4GALT, B4GALNT1, B3GNT5), and more extensive sulfation of proteoglycans and glycoproteins.
[0439] The transcriptome analyses of HEK293 cells also identifies a number of human glycosyltransferase and other glycogenes not expressed including for example several GALNTs and GCNTs (Table 6)
Example 3
[0440] Gene Inactivation of Glycosyltransferase and Glycan Modifying Enzyme Genes in a Mammalian HEK293 Cell.
[0441] All the glycosyltransferase gene targeted inactivations were performed in HEK293 and cells were grown as described in Example 1. For ZFN and TALEN targeting cells were seeded at 0.510.sup.6 cells/mL in T25 flask (NUNC, Denmark) one day prior to transfection. 210.sup.6 cells and 2 pg endotoxin free plasmid DNA of each ZFN (Sigma, USA) were used for transfection. ZFN's were tagged with GFP and Crimson by a 2A linker (Duda 2015). Transfections were conducted by electroporation using Amaxa kit V and program U24 with Amaxa Nucleofector 2B (Lonza, Switzerland). Electroporated cells were subsequently plated in 3 mL growth media in a 6-well plate. Cells were moved to 30 C. for a 24 h cold shock. 72 h post nucleofection the intermediate positive cell pool for both GFP and Crimson were enriched by FACS. The present inventors utilized recent developed methods for enriching KO clones by FACS (GFP/Crimson tagged ZFNs) (Duda 2015). Cells were single cell sorted again one week later to obtain single clones in round bottom 96 well plates. CRISPR/Cas9 PEI targeting was performed by PEI transfection of 0.110.sup.6 preceded cells in 24wells, using 50 ng QCgRNA amplicon (
[0442] QCgRNA amplicon were made with a tri-primer PCR set up, using QCGFOR, QCGRNA-Primer, QCGREV primers (See
[0443] QCgF/gX/QCgR primers used for validating are the following:
TABLE-US-00007 QCGfor: 5-ctcgatatcgaattcGAGGGCCTATTTCCCATGATTCC-3 QCGrev: 5-cgaattaacggtaccAAAAAAAGCACCGACTCGGTGCCACTTTTTCA AGTTGATAACGGACTAGCCTTATTTTAACTTGCTATTTCTAGCTC-3 gX: 5-TTTAACTTGCTATTTCTAGCTCTAAAACnnnnnnnnnnnnnnnnnnn nGGTGTTTCGTCCTTTCCACAAGAT-3
[0444] Two days post transfection the intermediate GFP positive cell pool was enriched by FACS. Cells were single cell sorted again one week later to obtain single clones in round bottom 96 well plates For TALENs the post transfected cell pool was single cell sorted without FACS. KO clones were identified by high throughput amplicon labeling strategy screening (IDAA), and when possible also by immunocytology with appropriate lectins and monoclonal antibodies. Selected clones were further verified by TOPO cloning of PCR products (Invitrogen, US) and in detail Sanger sequencing. The strategy enabled fast screening and selection of KO clones with appropriate inactivation mutations as outlined herein, and on average the present inventors selected 2-5 clones from each targeting event.
[0445] The majority of KO clones exhibited out of frame insertions and/or deletions (indels), and most targeted genes were present with two alleles, while some were present with 1 or 3 or 4 alleles.
[0446] The optimized DNA fragments used for genetic engineering of the human cells are included in Table 7 and 8. Table 7 provides a list of validated gRNAs for 279 human glycosyltransferase and glycan modifying enzymes listed in Tables 1 and 2, plus additional 14 glycan relevant genes. Table 8 provides a list of validated ZFN and Talen target sequences against selected human glycosyltransferases and glycan modifying enzymes listed in Tables 1 and 2.
TABLE-US-00008 TABLE7 HEK293Glyco-genegRNAlistforCRISPR/Cas9 engineering Foreachgene3or4gRNAsequencesweredesigned. AfterevaluationbyQuickChangebasedgRNA ampliconvalidationproceduretheoptimalgRNA wasselectedandsuchvalidatedconstructsare shownassinglegRNAsequenceforthatparticular gene.Whenvalidationhasnotbeencompletedthe 3-4gRNAsequencecandidatesareincluded. Genename (HGNC) gRNAsequence 1 GALNT1 TCCCACTGTACACTCACAAT 2 GALNT2 GTGAAACGTGATCACCACGC 3 GALNT3 TATGGAAGTAACCATAACCG 4 GALNT4 AACAGTGGCCTATATCTTCG 5 GALNT5 GATGACTTCGATTACTGGAC 6 GALNT6 GAAGAGCAAGTGGACCCCCC 7 GALNT7 ATGCCCAACCGAGGCGGCAA 8 GALNT8 GTAGTCTCGCGTGTCGGGGA 9 GALNT9 CGCACTGTCGCGGATCCGAG 10 GALNT10 CTCTCTCAGCATCGGTCATG 11 GALNT11 TATGCTTATCAGTGACCGCT 12 GALNT12 TTCTTCTAGCAGGATATCCG 13 GALNT13 TTAATACGTGCCCGTCTTCG 14 GALNT14 CTTACAGGACTACACGCGGG 15 GALNT15 GCTGGCTGAGGTCGTCCACG 16 GALNT16 GTAATGGCGGGTGTCCCGGA 17 GALNT17 AGTTCACATTGACCTCGCAG 18 GALNT18 TGAGATAGAAGAGTACCCGC 19 GALNT19 AGGTTGGCCACCTCGGCGCG 20 GALNT20 ATACTCTGTTCACCTCACAG 21 C1GALT1 ACAACACTTTGTTACAACGC CCAAGTAGCTTTGACGTGTT CAACACTTTGTTACAACGCT 22 COSMC GTAGGTGATGATGCTCATGG 23 POMT1 GAGCTCCAACACTATCTGGT 24 POMT2 CTTCGAGGCGGTCGGCTGGT 25 POMGNT1 GAGGGACACATGGGCCTTCG 26 GOLPH3 GCAACGCCGCCGACAAGGAG AGGGCGACTCCAAGGAAACG GAGCAGGACGACGACGACAA GCTGGGCCTCAAGGACCGCG 27 GOLPH3L TTATTTCAGTGCGACGGGCC TCTTGCTTATTTCAGTGCGA CTTCTTCCATAAGAGTAAGG GGATATCCGCCTTACTCTTA 28 LGALS1 GGTGGCCTGTGGCAATCGGC CGATGGTGTTGGCGTCGCCG GGAGAGTGCCTTCGAGTGCG 29 ATG7 CTTGAAAGACTCGAGTGTGT TAGCTGGGCAGCAACGGGCT CTTCCAAGGTCAAAGGACGA 30 VAMP7 CTCTTGAACCGTAAGTAGTC ACTTGAGAACTCGCTATTCA CACACCAAGCATGTTTGGCA 31 LGALS7 CTCATCATCGCGTCAGACGA GGTGCTGAGAATTCGCGGCT CTGCCCGAGGGCATCCGCCC 32 FAM20C GTGTTCCTACTACTGCTCCA 33 B4GALNT3 CATAGATTCGCACAACCCTG 34 B4GALNT4 CAGTGAGACCGACGGCCGGG 35 LDLR GTCTGTCACCTGCAAATCCG 36 PCSK9 AGTGACCACCGGGAAATCGA 37 38 STT3A ATGTTGTTCTTAGCATAAGA 39 STT3B TTGGGTGTATCACTAGCTGC 40 ST6GAL1 TGTATCCTCAAGCAGCACCC 41 ST6GAL2 AGCTGGGTACAGGCTCAGCG 42 ST6GALNAC1 ACGGTGTCAGAGAAGCACCA 43 ST6GALNAC2 GAGCCCCCGCCAGCCATACG 44 ST6GALNAC3 GTATCCATAGTGAGTTCGAA 45 ST6GALNAC4 TGTGTGTGAGACGACACGCA 46 ST6GALNAC5 CTAGTGTACAGCAGCCTCGG 47 ST6GALNAC6 TCTTCCATTACGGCTCCCTG 48 MUC1 GCATTCTTCTCAGTAGAGCT 49 ST3GAL1 TCCAAGTCGATGGTCTTGAA 50 ST3GAL2 GTGGCTGTCAAACCAGTCGG 51 ST3GAL3 GATTCTAGCCCACTTGCGAA 52 ST3GAL4 TTACCCGCTTCTTATCACTC 53 ST3GAL5 ATTTGAGCACAGGTATAGCG 54 ST3GAL6 TGAGAATCACTGTCGTATTA 55 B4GALT7 TGACCTGCTCCCTCTCAACG 56 CHST11 GATAAAGGATCCCAAGCAAG 57 CHST12 CGTGTGCAAGTAGAAGTGCG 58 B3GAT1 GCTAGGATGTCCCGTCTCTT 59 B3GAT2 AAAGAAGCGGGTGAAAAGCG 60 B3GAT3 TCGGAGTTCCGCTTGCAGCT 61 B4GALT1 GGAGTCTCCACACCGCTGCA 62 B4GALT2 AGTAGAGGATGACGGCCACG 63 B4GALT3 TCCCTGATCTCGGCCAAATA 64 B4GALT4 ACCCACGAAGTAGTTACTGG 65 B4GALT5 TTCGGAGTGCTTATGCCAAG 66 B4GALT6 CTCTTTATGGTACAAGCTCG 67 B3GNT1 CATCGCCACCAGCATGAGCG 68 B3GNT2 GTTCCAGTATGCCTCGGGAG 69 B3GNT3 GCAGCCACCGGCGATCCCCG 70 B3GNT4 GTATCCTTGGAACAGCCTGA 71 B3GNT5 CTCACAATGTGATTATCGAT CTCTTAAGCACACCTCAGCG CCAATACTTGATTAACCACA 72 B3GNT6 GCGGGGACCTTGGCGCCTGG 73 B3GNT7 GCTCCTGCAGAAACTGACCA 74 B3GNT8 GGAGTGTGAGCAGTGCTGAC 75 B3GNT9 GCTTATTGCTGTCAAGTCGG 76 MGAT1 CCCTCAGTCAGCGCTCTCGA 77 MGAT2 GTTCGGCGTCCAGCAACGGT 78 MGAT3 TCCTCGGCCGCCTTGCTGGG 79 MGAT4A CTTTGTCTTGGTATACTACA 80 MGAT4B GGAGAGCCTCAAGCGCTCCA 81 MGAT4C TGTGGCAGCTAGGTAGCGAT 82 MGAT4D GGTATTTCCACTGTTAACAG 83 MGAT5 GCTGTCATGACTCCAGCGTA 84 MGAT5B CCACCAAGGTACCTTCTGTG 85 FUT1 CAGGGTGATGCGGAATACCG 86 FUT2 AGTGCTAGCCTCAACATCAA 87 FUT3 TGTCCGTAGCAGGATCAGGA 88 FUT4 CCTCCACGCCTGCGGACGCG 89 FUT5 GGCAGTGGAACCTGTCACCG 90 FUT6 GGACCCATTAGGGTACACAG 91 FUT7 TAGCGGGTGCAGGTGTCGCT 92 FUT8 ACCTTGCTGTTTTATATAGG 93 FUT9 GTGAACGGTCCGTTGTGAGA 94 FUT10 GGGACCACCAGAGCATAATG 95 FUT11 CGCGCAGCTCTGGGACGCCG 96 POFUT1 AAAGCTGCTAAACCGTACCT 97 POFUT2 GGAAGGCTTCAACCTGCGCA 98 LFNG GATGAAGCGGTCATACTCCA 99 MFNG GCGCAAGCGGTGGAAAGCCC 100 RFNG GCCACCCTGGACCCTCTCGG 101 POGLUT1 GAGGATCTAACTCCTTTCCG 102 GXYLT1 AATTGTTTTAGCTTGACAAC AACAATCTCTGCGAAGCACA TTCGCAGAGATTGTTCTTGC 103 GXYLT2 ACCCGAGCTCTGGATCCACC 104 XXYLT1 GCAGTGAGCGCAGCGCGACG 105 B3GALT1 TCAGCCACCTAACAGTTGCC 106 B3GALT2 CCTGTGACATACACTTTCCG 107 B3GALT4 GGAAGCTTGCAGTGGTCCCG 108 B3GALT5 TTTCCCCCACGTCTGCCGGA 109 B3GALT6 CTTCGAGTTCGTGCTCAAGG CGGACGACGACTCCTTCGCG AGAAGCCCCAGTAGAGGCGG 110 B3GALTL GTTTAGCCAGCTGATGAAGG CATCAGCTGGCTAAACAAGA CAAACGTACTGCGGTAACAA 111 B3GALNT1 CGTTCTATCACATTGTAGTG 112 B3GALNT2 GAAACGTGATAAGAAGCACC 113 B4GALNT1 ACCGGGATGTGTGCGTAGCG 114 B4GALNT2 CCGTGGACTGGGTACCCAAA 115 GCNT1 TAGTCGTCAGGTGTCCACCG 116 GCNT2 ATAGCAGGTAGCTTCATCAA 117 GCNT3 ACTGTTCAGGGGTCACCCGA 118 GCNT4 GCAGCCATAGGGTTAAAAAC 119 GCNT6 GGTCAAATAGATGACGTAGG 120 GCNT7 ACTGCTCCAGGATTTCTCGG 121 ST8SIA1 CGTTGGGCAGCCGGTAGACG 122 ST8SIA2 TGCCATCGTGGGCAACTCGG 123 ST8SIA3 GATGAGCGATAAAATCAGCA 124 ST8SIA4 AGATGCGCTCCATTAGGAAG 125 ST8SIA5 ATACAGGATCTGTTGCAGCA 126 ST8SIA6 GGAGCGTCCTCAGCGCTGCG 127 XYLT1 ACAACAGCAACTTCGCACCC 128 XYLT2 GACAGTTCAGCAGGGCGACG 129 CSGALNACT1 GGTACCCCTCCTTCCCCGTG 130 CSGALNACT2 GTATTATCAAGCCCTCCTAC 131 CHPF GGAACACCACACGCTCCAGC 132 CHPF2 CAGTGAAGTAGAGTAACCGA 133 CHSY1 GTACATCAAAGGAGACCGTC 134 CHSY3 TCTCGGCTAAAGATCATGCC 135 EXT1 GTAGAACCTGGAGCCCTCGA 136 EXT2 TCGGCTGGCAGCCTAACAAC 137 EXTL1 GTAGAAGCGAGAGCCCTCAA 138 EXTL2 CAGCTACCAGTAATAATACG 139 EXTL3 GGTGGGGAACGAGCTGTGCG 140 GBGT1 GTTGGCGCCCATCGTCTCCG 141 OGT GCAACCTATTCTTCTCTAAC 142 EOGT GTTTGCAGCTATGTCGACAT 143 POMGNT2 ACTGAGGATCGACTACCCGA 144 LARGE CCTGGAGGTGCGCATGCGCG 145 FKRP GCACCAGGACGGTGACACGG 146 FKTN GAGTCTATCCCGTCTAGCCG 147 KDELC1 CTGAATATAGAAATAGCGGG 148 KDELC2 GATTTGACTACGACTTTGAA 149 GLT1D1 GCTCTTCATCTCTATAGGGG 150 GTDC1 TCAGAGTGTGATACACACTG 151 GLT8D1 GCTCTCCGACATGCAGTAGA 152 GLT8D2 GCTATTGATGGCAGCCATAG 153 DAG1 ACATTTCAGTGAGCGCTACA 154 CDH1 ATAGGCTGTCCTTTGTCGAC 155 CDH2 TTACACTGTACCGCAGTGAA CCGACAGCTGACCCGAGATG GCTATCTGCTCGCGATCCAG 156 LARGE2 CTTCATTAGCCCATAGAGGC CCGTGTCCAGGACAATGACG CCAGAGCTCCGAGATGTCAG 157 MMP23E5 GGCCTGATGCACTCACAACA 158 MMP23E7 AGGAACGTGACCTTCCGCTG 159 TMTC1 GACCTGCCAGTCATAGCACA 160 TMTC2 GCCTGAACCATGCCATTGGA 161 TMTC3 ACTGCTGGACAGTTTCTCCG 162 TMTC4 GCTGCGTGCAAAACACACAA 163 SDF2 AGCCGCAAGTAACGACACCC 164 SDF2L GCAATCGGTGACCGGCGTAG 165 A3GALT2 CTAAGAGGCCAAGTGTAAGT CGGCAGATCCTACTTACACT GCTTTTACCTGAATTTAGGG 166 A4GALT TCCGGGGCGCCCCAAGGCAG GTCTGCACCCTGTTCATCAT GCACGTTGTGGGAGAGCCCA 167 A4GNT ACTTCAGGGTGAACTGGTAG CTACGGAACAGGAGACCAAA AATCTTGGCAGCAGACTCTA 168 ABO AATGTGCCCTCCCAGACAAT 169 NGLY1 ACTAGACTCTTGCCTGTCAG 170 UGCG TTAGGATCTACCCCTTTCAG 171 UGGT1 CTACTATCATGCAATATTGG 172 UGGT2 TTCGCAGCTCGGCTCCGGGA GGCAGTCACCGACTTGGACG CGGGGTCTCGGGCCACTTCG 173 UGT8 TGGTACTGTTAAAGATCCCT GGGCATGGTTGCCAACCATC TGTGATAGCTCATCTTTTAG 174 HAS1 CATGGTCGACATGTTCCGCG 175 HAS2 TGAAAAGGCTAACCTACCCT 176 HAS3 GGTGGTGGATGGCAACCGCC 177 GYS1 GACGAAGGCGAAGGTGACAG 178 GYS2 ACTGTAAGAAGAATGCTTCG AGTTCTTCGACTTCCCACTG GGAGCAGTACAAACCTTTAT 179 GYG1 GACCAGGGCACCTTTGGCGT 180 GYG2 GAGAGTCCAACAGTGAAGCT 181 GLT6D1 GGGAAGGGACTTTCGACAGG 182 CERCAM GTCTGCCCCTTCAGCCCGCA 183 COLGALT1 GGTGGCTACGGACCACAACA ATAACACGTCAACTGTGCTG GAAGAGTTTGTACCATTCCG 184 COLGALT2 ACTACGTTCAGATTCGAGAA CCACCTTCCTAATTGACCTC GTAGAAAGTCAGCTTGTCCG 185 B3GNTL1 CAGTCCACAACGCTGAACCG 186 ENPP1 GCAGTTTCCAAGCTCAACAC 187 GBE1 GGCTGTGTACCACATCTAAG 188 PIGA ACACTCTCTCGGGTTAGCCC CCGTACCCATAATATATGCA TTTTCGATTTCCATAAGCAT 189 PIGB AAGTGCGGAATGGAGCCGGG TTCGCAGCTTTATCTTGCCG TACCTTGTACTTCAACACCC 190 PIGC TCAACCTGTGACTAACACCA GGAGCTCTTCCAGGAATCGC AGTCCCTAAAAGCCAATGGG 191 PIGH GGCAGGACGGGGAGTAGTAG GCAGAATTCCCGGCAGGACG ACTTGCCATTACCTCGCAGA 192 PIGM GAAGACGCCATAGAAAACCA CCCCTCCGTGACGAAGCGCG ACTTTCCAAAGAGCTCGCTG 193 PIGP TACAGTACTTTACCTCGTGT CAGGAATAAAGGCCCACACG AACTTACTTTTGAGGCCAAT 194 PIGQ CACCTGGTGCCACTGCCGGC CGGCACGTTCTGGAGCTGCG CATCTTCTATGACCAGCGCC 195 PIGV AGTTGGTCCACAAAGCCTGA AGGCTTTGTGGACCAACTCG AACTGTTGAGACCCTTACGG 196 PIGZ GCGTAGCATCTGTAGCAGCT GCAACAACTGGATCTGAAGA GCACATAGCCCGTCTGCGGA 197 PYGB GTTGAAGCTCTTCCGCACCT AGGTGCGGAAGAGCTTCAAC AGCGCGAAGAAGTAGTCGCG 198 PYGL TGACGGACCAGGAGAAGCGG TCTCCACGCCCACGATGCCG CGCGAAGTAGTAGTCGCGGG 199 PYGM CGAGTGTGAAATGCAGGTGC AGCAAAGTAGTAGTCTCGTG ACGAGACTACTACTTTGCTC 200 TMEM5 CATTGAGCAGTCACATCGCT CCAGCGATGTGACTGCTCAA AGAGAAGGAAAGTCAATCGT 201 DPY19L1 AATGACGGTCATTTTCAAAG TCTCCCTTTCCAATGTTGAG CTCACCTCTCAACATTGGAA 202 DPY19L2 AGCCAGTCTAAGGGGCGGCG CAGACTTTGGATCCTCCCCG GCAGCTCCGGGAAAAGGTGC 203 DPY19L3 GAGCTGTGACATAGATCGCC TGTACCACTGAGTAGCCAGC GCTGGCTACTCAGTGGTACA 204 DPY19L4 TGTCTTGCAGCGGTTACTAG ACTTATCAGCATACCATGAA CATACCATGAACGGAAATTC 205 SCFD1 CCATTTAAACAGGGTTAATT GGAGTGGAAAACTCTCCAGC GAAGTCTTATGATTTAACTC 206 SCFD2 GATGTCCCGTAGGATCTCCA AGCTAATCATGTCCCAGCGG CAACATGAACTACACGGCCG 207 ALG1 GCAATGCTAGGCAGACCTGG TGACGAGCTTGCTTCCACAA GCAGAACGAGGGGATGGTTG 208 ALG2 TGTTCAGGCTGGCTAGACGG TTTTCTTAAACGACTATACA GGCCCCAATTGACTGGATAG 209 ALG3 TTGTACTATGCCACCAGCCG CCGAGGCACTGACATCCGCA GATCTATCACCAGACCTGCA 210 ALG5 AGCAGTTGTAAATGCAACGA TCTTCATGTCGATGGAGTGC GTAGGTGAGTCCCATATGCT 211 ALG6 GGCTGCCATTCTTTACAGAA AGAGTCTTCTTAGAACCTGC AGACTCTTCCCGGTTGATCG 212 ALG8 GTGCGGTGCCGCAGCAATGG GCGGCGCTCACAATTGCCAC TGCGAGTCCCTTACTATGTG 213 ALG9 GTGTACATACAGAAGCTACT CGTTGATAGCCATGACTGGA GGCCATTCAGTGCAGCTCTT 214 ALG10 TGATCACTCCAATTGACACC GGCTTGTACCTGGTGTCAAT CTGCCATTTGGATCTTTGGA 215 ALG10B GCAGGAATGGCGCAGCTAGA GCTAGAGGGTTACTGTTTCT TGTAGGGCTCTCGCAGCGCC 216 ALG11 GTTCCACATACAATGAGCCC GCAGCAGTCTGATTCCCCAA CCATACTGCAATGCTGGTGG 217 ALG12 AGTTCCCCGGAGTCGTCCCC CTGCGATCACCACTGGCCCG GCGAAAGCACGTAAACCGCG 218 ALG13 ACCCTGTACAAAATGCATAA AATGGCCCGAAAGAGGCAAG GCTCCGAAATGGCCCGAAAG 219 ALG14 GTGCGTTCTCGTTCTAGCTG GAAGCACTACCCATATTCGC AAGATACTGAGAGACTCCCG 220 DPM1 GTAGTCCTCGCAGGTCTCGG TTCTCGCGCTCGTTGTAGGT ACCAGCAGCCACACGATGAG 221 DPM2 CGAGGCCGAGTCCCACCACC TGATCAGGCTAACGGCGACG CTTCACCTACTACACCGCCT 222 DPM3 GCCCTGACCACGGGAGCCTT GCGGACACCAGCAAGTAGGC GCCTACTTGCTGGTGTCCGC 223 DPAGT1 AGTTGGTGAAATAGACCATG GAAGGGCTTGGGCACCACAA GATGCAGGCCAAGTATCGGG 224 RFT1 CCCCACTGAGACATGCTCTG GGTCTGGCTCCAGTCTCGCT CGTTAGCCACAGCAGGTTGA 225 RPN1 AGAGGCAAGCTTCACACGCA GTAGCTCTCCACATTTCGAG AGTAGGTCCTCAGAGCGCGT 226 RPN2 CTATGATTGTCAGGGCCAAC GACAATCATAGCCAGCACCT CTACCTCACCAAGCATGACG 227 DDOST GCGCAAACCGCGCCAAGCAA TCCAGCAGCACTAAGGTGCG AATGAGTCTCCCGCACGTTG 228 DAD1 CGGTAGTGTCTGTCATTTCG GTAACCGAACTGCAGCGCCC GTTCGGTTACTGTCTCCTCG 229 TUSC3 CACGCCGTAGGCAAGCGGGG AGGAAGGGAAAGCTCCCGGT CTGCTCTGCATCCAGCTCGG 230 OST4 TCTTCTCCGCAGGATGATCA GCCCAGCATGTTGGCGAAGA GCCATCTTCGCCAACATGCT 231 DOLK GCCAGCACCGATCCACTCAG CCACGAGTATCGGTCCCATA CCGATACTCGTGGTGCGCCG 232 CHST1 CGTGGTAGAGGGGCTCAAAC TCTTGCCCTGGGTGAAGCGG GCCTAGCATGACCCGCCGGT 233 CHST2 AAGGAGTGCGGAGGTCCAAA TGGTGTACGTGTTCACCACG GCTATTCAACCAGAATCCCG 234 CHST3 GTTGGCATCTGCTAGAGCTT GGAGCCGCCCAGACCGGCCG ATGAGCAGCACGTGGCGCCG 235 CHST4 CCTTCAAGCAGAGCACCGCC GCTCATGTCGCACAAGAAGA AAGAGGCTGGACTGTCTCCG 236 CHST5 ACTGTCTTGCTGGAGAACCG TCTTCATCATCTCCCGGCCA CATGCCACGCGGGCTCCATC 237 CHST6 CGTGCCACGCGGGCTCCATT CACAGCCATGTGCAGCGTTG CCTGTCCGACCTCTTCCAGT 238 CHST7 GTCCCCTCCGTATTGGACGG CGGTTCCCAAGCAACCTCAG GCTGGTTAAAGAGTTCGCCC 239 CHST8 CCCTGCGACCTGGAACAATG TGCAGCTCCGAACAGCAGGA GCTGGGGGGCGAGCTCCGTA 240 CHST9 TCAATTCTGAGAGATCTACT GACCAGTCATTCACAAGGAG AAGCTTTAAGTAAGTCCACA 241 CHST10 AGGCGCTCCATGTAGACCAG ACTCATCAGAAACGTCTGCA TATTCGGTCCAGGACAAACT 242 CHST13 CTGCCGGTGCACCTTCGCCA CCTGTAGCCGCCACTCACGC TCTTGCGCGGAGATGGCGCG 243 CHST14 CTGCTGCTCATGATCGAGCG GCTGTGCCCTCGCGGCCGGG CTGTCCGCACACCGCCCGCA 244 CHST15 TGCATACAGCTGTTACCCGA TTATTATCAGTCCAAAAACG GGTTTTTGCGCTTCAAAAAG 245 GAL3ST1 GATCCGGGCCAACGGCTCGG AAGAACACGATGTTGCGCCG GCGGAACAGGATGTTGAGCA 246 GAL3ST2 AACATGATGTTGGTGACCGG CGAGACCCACAACCTGTCCG TAGCGCGCCAGGAAGAGCCA 247 GAL3ST3 GTCATGTGCTTGGGGCGCGG TGCCGAGCGCCACAACCTGA ACTTCGTGCACCCGGCCACG 248 GAL3ST4 TTGGGTAGCCAAACTGGTAG GTAAAAGGCTACCGCCCACA TGAACCTCATGTGGTGACAG 249 HS2ST1 AATTGAGCAGCGACATACAA TCTAAAGTGGCATCTTGCCG GCAAGATGCCACTTTAGATG 250 HS3ST1 AGGAGCTTCTGCGGAAAGCG ATCATCATCGGCGTGCGCAA GAAGTGGACCTCGTTCTCCG 251 HS3ST2 CAGCGTGATCTGGCTCTCGA GACATGTTGAAGATGCGTCG CGTGTAATCAGAGATGGCAC 252 HS3ST3A1 CGTCCTGGCCGGAGGCCCGA GCTGGCGGTGTGGCCGGCGG GCCTCCTCGCCGTCGTCGCG 253 HS3ST3B1 GCGAGCTTCCTCCTCACCGG ATAGAGCCAGACGCAGAGCA ATGTTCCTGTACTCGTGCGC 254 HS3ST4 CTTCTTCTCCCCATAGTCGG GGATCGCCTCCAGCAGCGCG CGTGCACCCGGACGTGCGGG 255 HS3ST5 CACCCAGTCGACCTTCAATG CGCGCCCTGCAGTTTAAGCG CCTGCTGCACGAGTTCCGGA 256 HS3ST6 TCGCGTCACGAAGTAGCTGG GACATGGCGTGGATGCGGCG GGACACGAAGCTGATCGTGG 257 HS6ST1 CGCTCAGGTAGCGGGACACG ATGCAACGACGTCTTCCACG GGAGCTGCCGCCCTGCTACG 258 HS6ST2 GGAGGACGATCACGGCAAAT GGTGCCGGACCCGTACCGCT CCGCGGGTGAAATTGTAGCG 259 HS6ST3 CCTCCACATCCAGAAGACGG CCTGGTGAAGAACATCCGGC TCTCCTTCTTGCCAGGCCGG 260 NDST1 ACGCTCACTGACAAGGGCCG CGTCCAGGTTGACATACTTG GTACTGTGTGGCCTACGGCG 261 NDST2 ACATTGACTGATAATACCCA ACTGCTAGACCGGTACTGCG CTACTGAGCGCCCAGCTCAA 262 NDST3 TCTGCTTACTACCTGTACAG GTTGATATGGTAGGTGTTGG CTACAAATACTAGGACTGTG 263 NDST4 GTAGACCCCTGAGTGATGTG ACATCACTCAGGGGTCTACC ACATTCAGCTGTATGCAGCT 264 UST TGTTGTACACCACCTGGCTT CTACCCTGTTGTACACCACC AGAATCTTGTCGGAGAAGCA 265 DSEL TGGCTAGTAGAGAATGCACC GGAAATGTACGAGTATTCCA GTATTCCAAGGTCCGCTCAT 266 GLCE AAGCCACTACTCGAACGCCG TAACAACTATATGAACCACG TTGAAGCCCCCAACAACAGG 267 FAM20B TACATCAGCTGCCAACCGGG AATGATGACTGGCTTGCGGG CACTGGGCTGCAATCTCCCA 268 MOGS CCTGAGCTTAGGAGTCCCCG 269 GANAB TGGCTGATCCACCAATAGCC 270 MAN1A1 GAACTTCTCCGTCAGGCGGA TGGGGGCACGAAGTCCACCG TGCCCTTTTCTCGCGGATGG 271 MAN1A2 GTCAACATTCGATTTATTGG 272 MAN1B1 GCGGTGATCGAGCCTGAGCA 273 MAN1C1 GCTATAAGCGTTATGCAATG 274 MAN2A1 GGTCAGCTTGAAATTGTGAC 275 MAN2A2 GGAGCTGCCGTTTGACAACG 276 MANEA ATGTCATCATGGCAAAGTTT 277 GNPTAB TAAACAACGTCAATCGGCAT 278 GNPTG GCTGCTCACCCAAACGCGTT 279 NAGA TAGCAAGTCGTCGTCGCGGG
Example 4
[0447] Gene Insertion of Glycosyltransferase and Glycan Modifying Enzyme Genes in a Mammalian HEK293 Cell.
[0448] Target specific integration (knock in/KI) was directed towards PP1R12C known as the AAVS1 Safe Harbor locus (CompoZ Targeted Integration KitAAVS1, SigmaAldrich) (See Table 8). A modified ObLiGaRe strategy (Maresca 2013) was used where two inverted ZFN binding sites flank the donor plasmid gene of interest to be knocked in (
[0449] As an example, a full length ST6GAL1 open reading frame was inserted directionally into EPB71-AAVS1-2X-Ins generating EPB71-AAVS1-2X-Ins -ST6GAL1. Transfection and sorting of HEK293 cell clones was performed as described previously (Duda 2015). Clones were initially screened by positive SNA lectin staining and selected clones further analyzed by 5 and 3 junction PCR to confirm correct targeted integration event into AAVS1 site in HEK293. The allelic copy number of integration was determined by WT allelic PCR. Subsequently, full length human MGAT4A open reading frame was inserted directionally into 2nd AAVS1 allele of the HEK293 ST6GAL1 KI clone, followed by inserting full human MGAT5 to SH landing pad using same strategy as described above for ST6GAL1. The landing pad encodes the Safe Harbor #1 (SH1) sequence derived from the CHO genome, that has successfully been utilized by us (Duda 2015) and others for ZFN mediated target integration in CHO cells and thus represents a unique site when integrated in human cells devoid of this sequence. This allows for subsequent donor target integration into the SH1 site using CompoZ Targeted Integration KitCHO-SH #1, SigmaAldrich and a donor vector designated EPB69 (Plasmid map see
TABLE-US-00009 TABLE8 HEK293Glyco-geneZFN/Talenlist ZFNandTalentargetgenesequences.ForallthesegenesZFN/Talen constructsweregeneratedandtestedefficientforknock-out. Genename (HGNC) Targetsequence HEK293ZFN AAVS1 ACCCCACAGTGGggccacTAGGGACAGGAT B3GNT2 TCCCGAGGCATACTGGAAccgagaGCAAGAGAAGCTGAA B4GALT5 TGGAAGCCTTCTGATTGCatgccTCGGTGGAAGGTAGGGTG B4GALT6 CTGTCTGTACTTCATCTATgtggcCCCAGGCATCGGTAAGCA B4GALT7 GTCGGCGGCATCCTGCTGctctcCAAGCAGCACTACCGG C1GALT1 TACCTGTTTCCACTACttttttAGGGTCCTGGTTGCT CDX2 AACTTCGTCAGCCCCccgcagTACCCGGACTACGGCGGTT COSMC CCCCAACCAGGTAGTAgaaggctGTTGTTCAGATATGGCTGTT GALNT1 CTGGATGCCCATTGTgagtgtACAGTGGGATGGCTG GALNT10 GACCTTACCCCATGAccgatGCTGAGAGAGTGGATCAG GALNT11 GACCGCTTGGGCTACcacagaGATGTGCCAGACACAAGG GALNT12 CTTGAGACATCCCCGGATAtcctgCTAGAAGAAGTGATC GALNT13 AGCCTTTGCTGGCAAgaataAAGGAAGACAGGTAAGAA GALNT14 ACCTTCACCTACATCGAGtctgccTCGGAGCTCAGAGGGGGTG GALNT2 GTCGGCCCTACTCAGGACcgtggtCAGGTGAGGCCAGGAGAT GALNT3 TTCAACAAACCTTCTccttatGGAAGTAACCATAAC GALNT4 TTCATGCCTCCGCAGGAGccggccGTGCCAGGGAGCTGGGGTC GALNT5 CCAGTAATCGAAGTCATCaatgaTAAGGATATGAGGTA GALNT6 GGCCACCACAGGACCccaatgCCCCTGGGGCAGATGGAA GALNT7 CCTGTGGTACCATGGCctcatGTTGAAGGAGTAGAAGTG GALNT8 CATCCCCGACACGCGAGACtacaggTGGGATGAAcCAGGCT GALNT9 AGCCCGCACTGTCgcggaTCCGAGAGGACCGGCGTC GALNTL1 CCGAGTGGCTGCCGCCCATgctgcaGCGGGTGAAGGAGGTGAG GALNTL2 AGCGTCATCCTCTGTttccatGATGAGGCCTGGTCC GALNTL5 CTGGTGTTCCTGGACagccacTGTGAGGTGAACAGAG GALNTL6 TCCGGACCCGTCTCCTGGgggcaTCTATGGCCAGAGGAGAAG KL CCCTCTTCCCTTTGCAGCcatcaaGCTGGATGGGGTGGATGTC MAPK15 TACCGCAGCCGCGTCTATcaggtGCTCCGGCTCTCGAC MBTPS1 AACATCGCCCGCTTTtcttcAAGGGGAATGACTACCTG MGAT3 GTCTTCCTGGACCACTTCccgcccGGCGGCCGGCAGGACGGC MGAT4A CTTTGTCTTGGTATACTACatggcaAAATGGGAAAGGTAAGGA MGAT5 ATCCTGGACCTCAGCAAAaggtacATCAAGGCACTGGCAGAA MSLN CTCGAGGACCCTGGCtggagaGACAGGGCAGGTAAGGTC MUC1 CTGCTCCTCACAGTGCTTAcaggtGAGGGGCACGAGGTGGGG MUC16 AACATCCTCTTTGATTCCtggattAAGGGACACCAGGACGTC NEU4 GGCTTCCCAGCCCCCgccccCAACAGGCCACGGGATGAC PCSK5 TACCACTTCTACCATAGCaggacGATTAAAAGGTCAGTT PCSK9 CTACTCCCCAGCCTCAGCtcccgAGGTAGGTGCTGGGG POMGNT1 AGCCAAGGCTCTgctgaGGAGCCTGGGCAGCCAGG ST3GAL1 ATGATCCTGGTGCCCTTCaagaccATCGACTTGGAGTGGGTG ST6GALNACI CACAAAGACGACCCAAGGaaatggGGGCCAGACCAGGAA ST6GALNACII AGCCAACACAAAGCCccgtaTGGCTGGCGGGGGC STT3A GACCTGCAGCTCCTCGTCttcatGTTTCCAGGTATGTG STT3B TGCTGCAAGCTTATGCtttcttGCAGTATCTGAGAGACCG TUSC3 TTCTCCTGCTGCTGCTGCtctgcATCCAGCTCGGGGGAGGA WBSCR17 GGACGCCGGAGACCCTTCtctcccCATCAGGTCTGTGGCT ST6GAL1 ATGATCCTGGTGCCCTTCaagaccATCGACTTGGAGTGGGTG ST3GAL2 CCCTACCTGGACTCAGGGGccctggATGGGACGCACCGGGTGAA B4GALT1 CCTGGCTGGCCGCGACCTGagccgcCTGCCCCAACTGGTCGGA ST3GAL3 CAGGTTCTCCAAGCCagcaccCATGTTCCTGGATGAC B4GALT3 GACCCCCGGGGACCCCGCcatgttGCCGTTGCTATGAACAAG B4GALT4 GGCATCTACGTCATCcaccaGGTGAGCGTGGGGGCAGAC ST3GAL4 TCTGCCCACTTCGACcccaaaGTAGAAAACAACCCAGAC ST6GAL2 ACCTGCCATGAAACCACACttgaaGCAATGGAGACAACG B3GNTL1 CCGGAGGACCTGCTGTTCttctaCGAGCACCTCAGGAAGGG B3GNT5 CTCAGCGGGGCCTCGCtaccaaTACTTGATTAACCACAAG HEK293Talen COSMC TGACTTATCACCCCAACCAGGTAgtagaaggctgttGTTCAGATATGGCTGTTACTTTTA
Example 5
[0450] Display of the Human Glycome on Human HEK293 Cells.
[0451] A plurality of HEK293 cells engineered as described in above examples express subsets of the human glycome on glycoconjugates found on the cell surface and/or shed/secreted into the culture medium. Probing biological interactions with the displayed glycome on cells may be carried out by a multitude of established experimental methods including but not limited to different types of immunocytology and fluorescence-activated cell sorting (FACS), adsorption, enzyme-linked immunosorbent assays (ELISA), radioimmunoassays, and any other assay capable of determining an interaction of a biological molecule, antibody, lectin, adhesin and/or pathogen to a cell. The preferred method is amenable for high-throughput (HTP) analysis of a large array of isogenic cells and with ability to quantitate the degree of biological interaction with cells.
[0452] Here, the present inventors initially used immunocytology to demonstrate the feasibility to probe display of common glycan structures with glycan-binding antibodies, and to interpret defining structural and glycoconjugate features of the binding glycan from the differential binding patterns (
[0453] 1. Targeting the initiation and glycoconjugate determination (step 1, group 1 genes). To demonstrate capability to use a cell-based HEK293 glycan display to decipher contribution of glycoconjugates to a biological interaction, a plurality of HEK293 cells with knock out of group 1 genes were used to display and probe with monoclonal antibody.
[0454] 2. Targeting the second step in biosynthesis (step 2, group 2 genes). To demonstrate capability to use a cell-based HEK293 glycan display to decipher contribution of glycoconjugates and glycan structures to a biological interaction, a plurality of HEK293 cells with knock out of group 2 genes were probed with monoclonal antibodies (MAbs) 3C9 (anti-T) and 5F4 (anti-Tn) directed to O-GalNAc glycans found only on O-glycoproteins. As shown in
[0455] 3. Targeting the elongation and branching steps (step 3, group 3 genes). To demonstrate capability to use a cell-based HEK293 glycan display to decipher contribution of elongation and/or branching of glycans on one or more types of glycoconjugates, a plurality of HEK293 cells with knock out of group 3 genes, including MGAT5, B4GALT1/2/3/4 and/or B4GALNT1/2. When probing MGAT5 ko cells with animal lectins PHA-L, which is preferentially reactive with tetraantennary N-glycans found on N-glycoproteins. As shown in
[0456] Using GLA enzyme as a secreted reporter protein we analysed LacDiNac by MSMS analysis. GLA enzyme was expressed in wt and engineered HEK cell lines and GLA glycopeptides were purified by ion exchange chromatography before digesting with chymotrypsin and analysis of glycopeptides by MSMS (procedures are described in more detail in Example 6A). The analysis showed that LacDiNac structures were completely eliminated when GLA was expressed in cells with double knock out of B4GALNT3/4 (
[0457] 4. Targeting the capping step (step 4). To demonstrate capability to use a cell-based HEK293 glycan display to decipher contribution of capping of glycans on one or more types of glycoconjugates, a plurality of HEK293 cells with knock out of group 4 genes can be probed with animal lectins (MAL II and SNA) with preferential reactivity with 2,3 and 2,6 sialic acid capping, respectively, and MAbs (1B2) with preferential reactivity with unsubstituted poly-LacNAc chains found on N-glycoproteins and O-glycoproteins. Another example is knock-in of ST6GALNACT1 into HEK293 cells with COSMC knock out. The immunohistochemistry data shown in
[0458] By applying more extensive engineering designs glycans with exact tailored SA may be displayed. A multiplicity of HEK293 cells with single or multiple knock out of genes comprising ST3GAL1/2/3/4/5/6 and/or ST6GAL1/2 was investigated. By stacked knock out of ST3GAL1/2/3/4/5/6 and ST6GAL1/2 we could remove both and sialylations on N-glycans as well as on 0 glycans. This was demonstrated by lectin staining using MAL1, MAL2 and SNA lectins, which all lost binding to the engineered cells as shown in
[0459] The result demonstrate that the cells had different sialylation capacities allowing cell surface display of a range of different sialylation glycoforms useful for probing protein-glycan interactions. The exact need for cell engineering to obtain specific capping events may be evaluated using more detailed engineering and display experiments, including knock out of subsets of indicated stacked ko designs and possibly ki of glycosyltransferases for optimal capping density and specificity. Such systematic display analysis may give glycovariants with improved drug features as described in Example 6.
[0460] The following Lectins were used (binding specificities indicated) to evaluate and illustrate effects of glycoengineering:
[0461] WFA (Wisteria floribunda) lectin recognize glycostructure terminating in GalNAc;
[0462] RCA (Ricinus communis Agglutinin) recognize glycostructures terminating in Galactose;
[0463] MAL1 (Maackia amurensis leukoagglutinin 1) recognize N-glycan structures terminating with 2,3 Sialic Acid;
[0464] MAL2 (Maackia amurensis leukoagglutinin 2) recognize O-glycan structures terminating with 2,3 Sialic Acid;
[0465] SNA (Sambucus nigra) lectin recognize glycan structures terminating with 2,6 Sialic Acid;
[0466] GSL2 (Griffonia simplicifolia) lectin recognize N-glycans terminating in GlcNAc
[0467] 5. Targeting the glycan modifying step (step 5). To demonstrate capability to use a cell-based HEK293 glycan display to decipher contribution of modification of glycans on one or more types of glycoconjugates, a plurality of HEK293 cells with knock out of group 5 genes can be probed with suitable antibody or other assay.
[0468] 6. To expand the glycan display of HEK293 cells to include glycosylation features not normally found in wildtype HEK293 cells and display the entire human glycome, the present inventors identified the group of glycosyltransferase genes not expressed in HEK293 (Table 6) that when introduced into HEK293 individually or in combination enhance the glycosylation and glycan modifying capability of HEK293 cells. To demonstrate that new glycosylation features are introduced, the present inventors used targeted insertion of a human sialyltransferase, ST6GALNACT1, and demonstrate that introduction of this induce display of the cancer-associated O-glycan STn only when combined with gene engineering to truncate O-glycans by knock out of C1GALT1 or COSMC (
[0469] HEK293 cells were fixed in ice-cold acetone for 5-8 min. Monoclonal antibodies were incubated overnight at 4 C. followed by incubation with FITC conjugated Rabbit anti-mouse Ig (F 0261, Dako, Denmark) for 40 min at RT. Slides were mounted with Vectashield (Vector labs, CA, USA) and examined in a Zeiss fluorescence microscope.
Example 5b
[0470] A systematic approach for determining which glycomodification that influence a given activity, for example binding to a given virus, may comprise the following: [0471] 1. Determination of type of glycosylation is accomplished by generating a multiplicity of mammalian cells engineered in the 19 glycogenes involved in the truncation step, which is step 2 in
Example 6
[0476] Display of Different Glycoforms of Recombinant Expressed Human Proteins in HEK293 Cells.
[0477] A plurality of HEK293 cells engineered as described in above examples have different glycosylation capacities, and are suitable for recombinant expression of human and other species proteins with different glycoforms to display such proteins on the cell surface and/or shed into the culture medium. An appropriate signal peptide is used to direct trafficking into ER and Golgi for glycosylation, and provided the gene encoding the protein of interest does not already have an efficient signal peptide. To demonstrate use of the cell-based for display of different glycoforms of a human protein not expressed in HEK293 cells, the present inventors used an expression construct encoding for the cell membrane bound mucin, MUC1. As shown in
[0478] To demonstrate that the cell-based array also can be used to develop protein arrays with proteins carrying glycans replicating the different glycosylation capacities of the plurality HEK293 cells, the present inventors analysed shed MUC1 found in the culture medium from the plurality of HEK293 cells expressing human MUC1. We used an ELISA capture assay with the MAb HMFG2 or 5E10 for capture and biotinylated MAb 5E5 for detection (Wandall 2010). The capture ELISA assay was performed using Nunc-Immuno MaxiSorp F96 plates (Nunc) coated with 1 ug/mL HMFG2 (MUC1) in carbonate-bicarbonate buffer (pH 9.6) overnight at 4 C. Plates were blocked with BSA/Triton X-100 buffer (1% BSA, 1% Triton X-100, 3 mM KCl, 0.5 M NaCl, and 8 mM phosphate buffer (pH 7.4)) for 1 h at RT and incubated with serially diluted spend culture medium and/or cell lysates from cell lines for 2 hrs at RT followed by washing. When neuraminidase treatment (0.1 U/mL Chlostridium Perfringes VI (Sigma) was performed for 1 hr at 37 C. a second blocking step was included for 15 min followed by washing. Culture supernatants of mouse MAbs IgG 5E5 and as controls for glycoforms IgM 3C9 (T), 5F4 (Tn) and 1B2 (poly-LacNAc) were applied for 1 hr followed by rabbit anti-mouse IgM HRP-conjugated antibody (Southern Biotech). Plates were developed with TMB+ one-step substrate system (Dako), reactions stopped with 0.5 M H2SO4, and read at 450 nm. As illustrated in
[0479] To further demonstrate that the cell-based array also can be used to analyse proteins carrying glycans replicating the different glycosylation capacities of the plurality of HEK293 cells, the present inventors analysed Erythropoietin (EPO) produced in HEK293 cell lines with knock out of GALNT1/2/3. As shown in
[0480] Using cell based display glycans may be displayed on the following types of proteins; Lysosomal enzymes including human iduronate 2-sulfatase (IDS), human arylsulfatase B (N-acetylgalactosamine-4-sulfatase) (ARSB), human lysosomal -glucosidase (GAA), human alpha-galactosidase (GLA), human beta-glucuronidase (GUSB), human alpha-L-iduronidase (IDUA), human iduronate 2-sulfatase (IDS), human beta-hexosaminidase alpha (HEXA), human beta-hexosaminidase beta (HEXB), human lysosomal -mannosidase (mannosidase alpha class 2B member 1) (MAN2B1), human glucosylceramidase (GBA), human lysosomal acid lipase/cholesteryl ester hydrolase (lipase A, lysosomal acid type) (LIPA), human aspartylglucosaminidase (N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase) (AGA), and human galactosylceramidase (GALC).
[0481] Antibodies, IgG, IgG fragments, Ig fusion proteins, receptor-Fc fusion proteins, Bispecific IgG formats, Interleukin recepter fusion proteins
[0482] Anticoagulants/Coagulation Factors including coagulation factor II (2), coagulation factor V (F5), coagulation factor VII (F7), coagulation factor VIII (F8), coagulation factor IX (F9), coagulation factor X (F10), or coagulation factor XIII (F13), plasminogen activator tPA (PLAT), tPA fragments, erythropoietin (EPO)
[0483] Cytokines including Interferons alpha/beta/gamma (IFNA2, IFNA14, IFNB1, IFNG), Interleukin 2/11 (IL2, IL11), colony stimulating factor 2 (alias: granulocyte macrophage colony-stimulating factor) (CFS2), colony stimulating factor 3 (alias: granulocyte colony-stimulating factor) (CSF3) ( ), alpha-lantitrypsin (SERPINA1), plasma protease C1 inhibitor (alias: complement C1 esterase inhibitor) (SERPING1), anti-Thrombin (alias: Antithrombin-III) (SERPINC1), protein C (alias: autoprothrombin IIA) (PROC),human chorionic gonadotropin, alpha peptide (CGA), /Luteinizing hormone LH (LHB), Follicle-stimulating hormone FSH (FSHB), Thyroid-stimulating hormone TSH (TSHB), Glycodelin, progestagen-associated endometrial protein (PAEB), PDGF, Platelet-derived growth factor subunit A and B (PGDFA, PDGFB), TNFalpha, tumor necrosis factor (TNF), cytotoxic T-lymphocyte associated protein 4 (CTLA4) and fusion protein(s), VEGFR, vascular endothelial growth factor receptors 1/2 fusion protein, Bone morphogenetic protein 2, BMP-2 (BMP2), Dornase alpha or Pulmozyme (Human human deoxyribonuclease I, DNASE1)
Example 6A
[0484] Lysosomal replacement enzymes represent an increasing group of therapeutic biologics essential for serious and rare congenital deficiencies. Many of these enzymes are effective in alleviating deleterious effects of these diseases in some organs but not in others including bone, heart, kidney and brain, and all enzymes are used in very high doses presenting a huge economic burden on society. Replacement enzymes are delivered intravenously and taken up by cells through different receptors that transport them to the lysosome, and N-glycan structures attached to these enzymes can hugely influence their organ targeting, speed of uptake and circulation. Accordingly there is a need for better glycan-display procedures for optimizing lysosomal replacement enzymes. Such procedure should display the enzymes with N-glycan structures which differ in parameters like degrees of sialic acid capping, type(s) of sialic acids (2,3 vs 2,6 linkage), amount of M6P tagging, and exposed mannose. Ideally the display should also address different distribution of these features between the different glycosylation sites of the enzyme. Given the complexity of the glycoprocessing involved in synthesis, addition and site specificity of M6P on lysosomal enzymes a random approach like the cell based glycan array is optimal for investigating and optimizing the glycans on this class of enzymes.
[0485] To demonstrate that the cell-based array could be used to display lysosomal enzymes with different glycans in an interpretable fashion a display experiment using a model lysosomal enzyme was performed. Display of glycans on enzymes of pharmaceutical interest would facilitate development of glycovariant enzyme isoforms with improved drug features.
[0486] For optimizing glycans on lysosomal enzymes, a series of glycoengineered HEK293 cells were generated using CRISPR/Cas9 mediated gene modification to display glycans with most relevance for replacement lysosomal enzymes. The genes addressed were glycosyltransferases important for regulating N-glycan branching (MGAT1/2/4B/5, group 3 in Table 5), galactosylation (B4GALT1/3, group 3 in Table 5), terminal capping by sialylation (ST3GAL4/6/ST6GAL1, group 4 in Table 5) and core a6-fucosylation (FUT8, group 4 in Table 5). Furthermore we engineered the enzymes involved in N-glycan precursor trimming, including glucosidases (MOGS/GANAB) and mannosidases (MANEA/MAN1A1/1A2/1B1/1C1/2A1/2A2) (added) as well as enzymes involved in modifying the M6P tag (GNPTAB/GNPTG/NAGPA, group 5 in Table 5) and finally we addressed the N-glycan precursor synthesis pathway (ALG1/2/3/5/6/8/9/11/12/13/14, group 1 in Table 5). For knock-out and knock-in of genes the gRNAs shown in Table 7 were used for procedures described in Examples 3 and 4 respectively. The model enzyme chosen for the glycan display was alpha-galactosidase (GLA) which is the active pharmaceutical ingredient of two marketed replacement products for treating Fabry disease. The two products are Fabrazyme from Genzyme/Sanofi and Replagal from Shire. The GLA protein is a homodimer with 3 N-glycan sites on each subunit at Asn139, Asn192, and Asn215 (Lee 2003). For display of different glycans on the GLA enzyme it was expressed transiently in the glyco-engineered cell lines described above.
[0487] Expression constructs containing the entire coding sequence of human GLA was cloned into BamH1 site of the pTT5 expression vector (Durocher 2002). Engineered HEK293-6E cells were cultured in DMEM/high glucose medium supplemented with 10% FBS and 1% Glutamax. 60% confluent cells were seeded in T75 flasks the day prior to transfection. Plasmid was transfected into cells using PEI, by mixing 30 ul PEI (0.1% linear 25 k Polyethylenimin in 150 mM NaCl, pH 7.0) with 10 ug-GLA.pTT5 expression plasmid in 2 ml Opti-MEM Medium. One day after transfection, culture medium was changed to F17 Medium supplemented with 2% Glutamax and 1% TN1 (Tryptone N1). Culture supernatant was collected after incubating the cells at 37 C for another 2 to 3 days in F17 medium. Secreted GLA was purified from culture supernatant by ion exchange on a DEAE column. The culture supernatant was centrifuged at 3,000 g for 20 min and then further filtered for clarification through a 0.45 m filter. After dilution with 3 volumes of 25 mM MES (pH 6.0) the resulting solution was loaded onto a DEAE sepharose fast-flow column pre-equilibrated with the same buffer. Elution was carried out by applying 0.2 M sodium chloride in 25 mM MES (pH 6.0) and the fractions containing the recombinant GLA were determined by enzyme activity assay and collected. Purity and rough titer of GLA was evaluated by Coomassie staining of SDS-PAGE gels.
[0488] For N-glycan profiling of purified GLA approximately 10 g purified enzyme was reduced and alkylated followed by chymotrypsin digestion at a 1:25 chymotrypsin:protein ratio. Digests were loaded onto a stage tip containing 3 layers of C18 membrane. Glycopeptides were eluted with 50% MEOH in 0.1% formic acid, and then dried and re-solubilized in 0.1% formic acid. Samples were analyzed on an OrbiTrap Fusion MS (Thermo Fisher Scientific). Data processing was carried out using Proteome Discoverer 1.4 software (Thermo Fisher Scientific) with similar preprocessing and processing procedures. The exact masses of glycopeptide were subtracted from the corresponding precursor ion mass. Fragmentation spectra of candidate-matched glycopeptides associated with each protein were inspected to verify accuracy of sequence and site assignments.
[0489] Sialic acid density and type of sialic acids, 2,3-linked or 2,6 linked, both influence circulating half-life of glycoproteins and for display of GLA enzyme with higher or changed sialic-acids we investigated cells with glycodesigns comprising various combinations of knockout or knockin of GNPTAB, ST3GAL4, ST3GAL6, ST6GAL1, MGAT1 and MGAT2. As shown in
[0490] Simpler branching of N-glycans was obtained by double knock out of GNPTAB and MGAT2 that resulted in cells producing homogenous monoantennary structures with sialic acids and without M6P (
[0491] M6P is critical for uptake of lysosomal enzyme drugs into target cells via M6P receptors. For displaying glycans with higher M6P content we generated cells with knock out of the ALG genes involved in synthesis of the N-glycan oligomannose structure. Using cell lines with single knockout of ALG3, ALG8 or ALG12 for displaying glycans on the GLA enzyme we achieved modification of both the overall M6P content and the site specific content as well as the general glycostructure. For example knockout of ALG3 resulted in increase in truncated high-mannose and hybrid structures with M6P tagging as shown in
[0492] Glycoproteins with exposed mannose residues will bind to Mannose receptors, which are predominantly found on macrophages and liver cells, resulting in specific targeting to these organs whereas circulation time in serum will be shortened. For modifying mannose structures we engineered cells by various knockout combinations involving the MGAT1, MOGS and GNPTAB genes. When expressing the GLA enzyme in MGAT1 knockout cells we obtained mannose and M6P structures only (
[0493] Expression of the GLA enzyme in cells with knockout of the uncovering enzyme NAGPA resulted in increase of GlcNAc residues on the M6P tagged N-glycans (
[0494] For the engineered cell lines the yield of GLA protein was similar to wt cells and galactosidase enzyme activity was not lost in any of the GLA preparations. In addition to the major trends shown for the glycoforms we observed minor glycan species with LacDiNAc or bisecting structures which may be avoided by additional combinatorial knock out of B4GALT3/4 (avoid LacDiNac) and/or knock out of MGAT3 (avoid Bisecting). Furthermore minor peaks of uncovered GlcNac structures on M6P were occasionally observed, probably due to somewhat low expression of NAGPA in our HEK293 cells. This may be optimized by knock in or overexpression of the NAGPA gene.
[0495] This example shows that the cell based display technology was readily applied to a secreted lysosomal enzyme. Site specific glycoanalysis of displayed GLA enzyme variants showed that using cell based display current investigators could induce dramatic changes of all glycan parameters critical for lysosomal delivery and circulation time. More specifically sialylation, M6P content, M6P distribution between sites, exposed Mannoses and branching of the glycostructures could be modified.
Example 6b
[0496] Antibodies constitute the largest class of therapeutic biologics. Human IgG1s contain one conserved N-glycosylation site at N297. N-glycans on IgG1 are critical for their biological functions and glycoengineering has been applied to optimize ADCC functions. Thus, removal or lowering of the core fucose on the IgG glycans has proven effective for boosting ADCC effect (Yamane-Uhnuki 2004, Umana 1999). Lowering of fucose levels by way of gene engineering was originally obtained through a tour-de-force using two rounds of homologous recombination to eliminate both alleles of the fut8 gene in CHO (Yamane-Uhnuki 2004). The therapeutic IgG mogamulizumab currently in clinical use is produced in CHO cells with knock out of fut8. Reduction in the level of fucose on IgG has also been obtained by overexpression of MGAT3 (GnTIII) enzyme in CHO cells, which interferes with fut8 mediated fucosylation of N-glycans and results in production of IgG1 with minimal fucose glycoproteins with bisecting N-acetylglucosamine (GlcNAc) (Umana 1999), also for this strategy one antibody product, obinutuzumab (Gazyva), has now been marketed. More antibodies with low fucose content derived by these strategies or other approaches are currently in clinical trials for treating different cancers. However, there is a need for testing the role of distinct features of the N-glycans on IgG including branching status, exposed GlcNAc and galactose residues as well as sialic acid capping and the type of sialic acid linkage to evaluate biological effects.
[0497] To display different glycan structures on antibodies we expressed the human IgG1 antibody Trastuzumab (Herceptin) in glycoengineered cells by transient or stable expression as described in preceding Examples. Expression constructs containing the entire coding sequences of human IgG1, heavy and light chains were cloned into EcoR1/BamH1 site of the pTT5 transient expression vector (Durocher 2002). Capillary Electrophoresis laser-induced fluorescent detection (CE-LIF) was used for glycoprofiling. IgG was purified by protein G sepharose. HiTrap Protein G HP (GE Healthcare, US) was pre-equilibrated and washed in PBS and IgG was eluted with 0.1 M Glycine (pH 2.7). N-glycans from purified IgG were released by PNGase F (New England BioLabs), captured on MagnaBind Carboxyl Derivatized Beads (Thermo-Fischer) and labeled with 8-Aminopyrene-1,3,6-trisulfonate (APTS) (Sigma-Aldrich) before elution in water and run with formamide on a 3500XL Genetic Analyzer from Hitachi Applied Biosystems (Thermo Fischer).
[0498] More homogeneous N-glycans with simpler glycoforms consisting of the pentasaccharide (Gn2Man3) with and without fucose (GOF/GO) were obtained with stable knock out of B4GALT1 and/or FUT8 genes, respectively (
[0499] Targeted KI of human B4GALT1 produced a highly homogeneous G2F glycoforms (
[0500] Knock out of MGAT2 as predicted resulted in heterogeneous monoantennary N-glycans on IgG1 (
[0501] The genetic engineering of cells resulted in the display of highly diverse and in most cases highly homogeneous N-glycans on recombinant IgG1 suitable for testing and design of improved glycoforms of therapeutic antibodies.
Example 6C
[0502] A systematic approach for determining which glycomodification that influence and improve activity of an lysosomal enzyme, may comprise the following:
[0503] Generating a multiplicity of mammalian cells with modification of genes resulting in glycoforms with modified (extreme) N-glycans (high/low) with respect to the following parameters: M6P content, Sialic Acid content, Ratio between 2,3/2,6 Sialic acids, and exposed Mannose content.
[0504] Express the enzyme in the glycoengineered cell lines and produce a multiplicity of glycovariants of the enzyme.
[0505] Screen the multiplicity of enzyme glycovariants for optimized drug effect in relevant in-vitro assay and/or animal model.
[0506] Identify which glycovariants (and glycodesigns) that have improved drug function.
[0507] Additional round(s) of glycoengineering and screening (steps 1-4) may be applied to secure optimal glycovariant candidate.
[0508] The optimization aims at identifying a glycovariant of the enzyme which ultimately give improved clinical performance with respect to one or more parameters including efficacy, dosing, potency, purity, less side-effects and better safety. The assays used for screening will monitor biomarkers/reporters for one or more of these parameters.
[0509] For an enzyme glycovariant with improved drug function a production cell line may be developed by transferring the glycodesign to any mammalian cell based production platform.
Example 6D
[0510] A systematic approach for determining which glycomodification that influence and improve activity of a therapeutic IgG antibody, may comprise the following:
[0511] Generating a multiplicity of mammalian cells with modification of genes resulting in glycoforms with modified N-glycans with respect to branching, bisecting GlcNAc incorporation, galactosylation, capping by sialic acid and linkage, and fucosylation.
[0512] Express the IgG in the glycoengineered cell lines and produce a multiplicity of glycovariants of the antibody.
[0513] Screen the multiplicity of IgG glycovariants for optimized drug effect in relevant in-vitro assay and/or animal model.
[0514] Identify which glycovariants (and glycodesigns) that have improved drug function.
[0515] Additional round(s) of glycoengineering and screening (steps 1-4) may be applied to improve homogeneity and secure optimal glycovariant candidate.
[0516] The optimization aims at identifying a glycovariant of the IgG which ultimately give improved clinical performance with respect to one or more parameters including efficacy, dosing, potency, purity, less side-effects and better safety. The assays used for screening will monitor biomarkers/reporters for one or more of these parameters.
[0517] For an IgG glycovariant with improved drug function a production cell line may be developed by transferring the glycodesign to any mammalian cell based production platform.
Example 7
[0518] Display of Different Glycoforms of Specific Domains of Human Proteins Using a Reporter Design in HEK293 Cells.
[0519] In this Example the present inventors sought to test if the cell-based array could be used to display specific domains of human proteins in a common reporter construct that targets the domain to the cell surface and displays this with different glycans in an interpretable fashion. Such a strategy would enable display of glycans on isolated domains of biological interest such as for example small domains of the large mucins with clustered O-glycans that are difficult to express as whole proteins due to their large size, folded domains in proteins like Notch with diverse types O-glycans, folded domains of large membrane proteins with N-glycans, and more. A list of human mucin tandem repeat domains is presented in Table 9.
[0520] The present inventors designed and a reporter construct in the pcDNA3-neo (Invitrogen) vector synthesized by Genewiz, USA, encoding a chimeric type 1 transmembrane protein based on a signal peptide sequences derived from platelet GB1b (amino acid 1-41) or MUC1 (amino acid 1-51) fused to enhanced cyan fluorescent protein (ECFP) linked to a interchangeable polypeptide region fused to the membrane anchoring domain of CD34 (amino acids 129-279) or MUC1 (ENST00000611571.4 amino acid 1039-1196), generating two designs of cell surface reporters (MUC1-CSR or CD34-CSR,
[0521] The following MAbs were used to detect display of MUC1 tandem repeats (5E10), the Tn-glycoform of MUC1 (5E5), the Tn glycan on any protein (5F4), and anti-FLAG MAb for detection and quantification of reporter expression. All HEK293 cell clones were reactive with anti-FLAG and the general MUC1 Mab (5E10), whereas only the HEK293 clones with COSMC knock out expressing Tn glycoforms were reactive with the Tn-MUC1 Mab (5E5) (
Example 7b
[0522] In this example the present inventors demonstrate the feasibility of the cell-based array for display of specific glycoforms of defined molecules expressed on the cell surface of glycoengineered cells. Such a strategy would enable display of defined glycans on defined domains of large molecules such as mucins with clustered O-glycans that are normally difficult to express molecules on the HEK293 cell surface. A full length MUC1 pcDNA3.1neo construct C-terminally fused to EYFP (Singh 2008) was transfected into HEK293wt or HEK293SC. 3 days post transfection, cells were trypsinized and dried on teflon coated slides followed by IHC (Mandel 1999) using 5E5 and 5E10 as primary antibodies as described above, followed by incubation with Alexa546 coupled rabbit anti-mouse secondary anti-bodies, as previously described. As shown in
TABLE-US-00010 TABLE9 DisplayoftheHumanMucinome Sequencesofhumanmucinsandmucindomainsofglycoproteinsusedfordesignof reporterconstructstodisplaythecharacteristictandemrepeatregionsofmucins carryinghighdensityofO-glycans.Thesesequenceswereintroducedinthe reporterconstructdescribedinFIG.7,andreporterconstructsexpressedina multiplicityofglycoengineeredHEK293celllines. ORF Construct EncodedAAsequence GP1BA EPB105 PTLGDEGDTDLYDYYPEEDTEGDKVRATRTVVKFPTKAHTTPWGLFYSW STASLDSQMPSSLHPTQESTKEQTTFPPRWTPNFTLHMESITFSKTPKST TEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPSPTTPEPTSEPA PSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLTTTKPV SLLESTKKTIPELD MUC1 EPB109a APDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRSAPG STAPAAHGVTSAPDTRSVPGSTAPQAHGVTSAPDTRPAPGSTAPPAHGV TSAPDTRPVPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPA PGSTAPQAHGVTS MUC7 EPB109b PPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPTPSA TTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPP SSPAPQETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQ PTSAP MUC2 EPB110 SPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPPPTTTPSPPIST (TR1) TTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPAST TTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTT MUC2 EPB111 TQTPTTTPITTTTTVTPTPTPTGTQTPTPTPITTTTTVTPTPTPTGTQTPTST (TR2) PITTTTTVTPTPTPTGTQTPTMTPITTTTTVTPTPTPTGTQTPTTTPISTTTT VTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITT MUC3A EPB112 EISSHSTPSFSSSTIYSTVSTSTTAISSLPPTSGTMVTSTTMTPSSLSTDIP (TR1) FTTPTTITHHSVGSTGFLTTATDLTSTFTVSSSSAMSTSVIPSSPSIQNTE TSSLVSMTSATTPNVRPTFVSTLSTPTSSLLTTFPATYSFSSS MUC3A EPB113 MTSATTPNVRPTFVSTLSTPTSSLLTTFPATYSFSSSMSASSAGTTHTESI (TR2) SSPPASTSTLHTTAESTLAPTTTTSFTTSTTMEPPSTTAATTGTGQTTFTS STATFPETTTPTPTTDMSTESLTTAMTSPPITSSVTSTNTVT MUC3A EPB114 TTPTPTTDMSTESLTTAMTSPPITSSVTSTNTVTSMTTTTSPPTTTNSFTS (TR3) LTSMPLSSTPVPSTEVVTSGTINTIPPSILVTTLPTPNASSMTTSETTYPNS PTGPGTNSTTEITYPTTMTETSSTATSLPPTSPLVSTAKTAKTPTTNL MUC3A EPB115 TTTETTSHSTPGFTSSITTTETTSHSTPSFTSSITTTETTSHDTPSFTSSIT (TR4) TSETPSHSTPSSTSLITTTKTTSHSTPSFTSSITTTETTSHSAHSFTSSITT TETTSHNTRSFTSSITTTETNSHSTTSFTSS MUC4 EPB116 LPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATSLP (TR) VTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVT STSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTM MUC5AC EPB117 TTSAPTTSTTSAPTTSTISAPTTSTTSATTTSTTSAPTPRRTSAPTTSTISA STTSTTSATTTSTTSATTTSTISAPTTSTTLSPTTSTTSTTITSTTSAPISST TSTPQTSTTSAPTTSTTSGPGTTSSPVPTTSTTSAPTT MUC6 EPB118 TSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTTLP (TR1) THVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKATGS THTAPPMTPTTSGTSQSPS MUC6 EPB119 SIHSMPTGTIPPPTTIKATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSL (TR3) PYHTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAH MUC9 EPB120 AMTMTSVGHQSMTPGEKALTPVGHQSVTTGQKTLTSVGYQSVTPGEKT LTPVGHQSVTPVSHQSVSPGGTTMTPVHFQTETLRQNTVAP MUC13 EPB121 TTETATSGPTVAAADTTETNFPETASTTANTPSFPTATSPAPPIISTHSSS TIPTPAPPIISTHSSSTIPIPTAADSESTTNVNSLATSDIITASSPNDGLIT MVPSETQSNNEMSPTTEDNQSSGPPTGTALLETSTLNST MUC17 EPB122 LSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPSEGSTPFTSMPVSTM PVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGTTPL TSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMP MUC19 EPB123 VTRTTRSSAGLTGKTGLSAGVTGKTGLSAEVTGTTRLSAGVTGTTGPSP GVTGTTGTPAGVTGTTELSAGVTGKTGLSSEVTETTGLSYGVKRTIGLSA GSTGTSGQSAGVAGTTTLSAEVTGTTRPSAGVTGTTGLSAEVTEITGISA MUC20 EPB124 ESSASSDSPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHP VITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPSRASESSA SSDGPHPVITPSRASESSASSDGPHPVITPSRASESSASSDGPHPVITPS RA MUC21 EPB125 SGASTATNSDSSTTSSGASTATNSDSSTTSSEASTATNSESSTTSSGAS TATNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATN SESSTTSSGASTATNSESSTPSSGAGTATNSESSTTSSGAGTATNSESS TV MUC22 EPB126 GTTTASMAGSETTVSTAGSETTTVSITGTETTMVSAMGSETTTNSTTSS ETTVTSTAGSETTTVSTVGSETTTAYTADSETTAASTTGSEMTTVFTAGS ETITPSTAGSETTTVSTAGSETTTVSTTGSETTTASTAHSETTAASTMG mGp1ba EPB127 TSSGDTDYDDYDDIPDVPATRTEVKFSTNTKVHTTHWSLLAAAPSTSQD SQMISLPPTHKPTKKQSTFIHTQSPGFTTLPETMESNPTFYSLKLNTVLIP SPTTLEPTSTQATPEPNIQPMLTTSTLTTPEHSTTPVPTTTILTTPEHSTIPV PTTAILTTPKPSTIPVPTTATLTTLEPSTTPVPTTATLTTPEPSTTLVPTTATL TTPEHSTTPVPTTATLTTPEHSTTPVPTTATLTTPEPSTTLTNLVSTISPVLT TTLTTPESTPIETILEQFFTTELTLLPTLESTTTIIPEQN
Example 8
[0523] Display of Homogeneous Cancer-Associated Glycomes and Use of Cells Displaying these for Generation and Discovery of Antibodies with Cancer-Associated or Cancer-Specific Reactivity.
[0524] Aberrant glycosylation is a hallmark of cancer and most types of human glycosylation known are affected in various ways. A large number of antibodies with reactivity to aberrant glycans expressed mainly or exclusively in cancer have been produced and characterized in the last 3-4 decades, and the vast majority of these react with immature and truncated glycans that are normal biosynthetic intermediates in the normal biosynthetic pathways of glycans. However, more recently it has emerged that antibodies may react with certain truncated glycans in the context of a specific protein or protein sequence and such MAbs have surprisingly high affinities and specific reactivity with cancer (Tarp 2008). The clearest example of this class of antibodies is the 5E5 MAb with specificity for Tn-MUC1 as demonstrated in the previous examples (Tarp 2007). This and similar antibodies to human Tn-glycoproteins have all been generated using rather homogeneous glycopeptide immunogens (Tarp 2008), and selection of such antibodies using whole cells or cell extracts have in general failed. The present inventors reasoned that the major obstacle for selection of such antibodies rested in two factors: i) the general heterogeneity found in glycosylation in cancer cells, where individual proteins are displayed literarily with hundreds of different glycans limits the possibility for stimulation of specific antibodies to such aberrant glycoprotein epitopes; and ii) the difficulty in screening and selection of antibodies reactive with aberrant glycoprotein epitopes without availability of homogeneous antigens for screening. The present inventors therefore developed and tested if the cell-based glycan display technology could be used to induce and select specific antibodies to aberrant glycoprotein epitopes. A general scheme for the comprehensive strategy is depicted in
[0525] The present inventors first tested if they could generate a MAb with 5E5 characteristics by immunizing mice with a human cell displaying a homogenous O-GalNAc glycoproteome with Tn glycans as well as the MUC1 membrane protein. The present inventors used HEK293 cells engineered to only display Tn O-glycans, and transfected these with the full coding MUC1 pCDNA3 construct described in above Examples, as well as a human breast cancer cell line MDA-MB-231 engineered to only display Tn O-glycans that endogenously express MUC1.
[0526] The present inventors next tested immunization with Tn-glycoproteins extracted from cell lysates or culture medium of the engineered MDA-MB-231 by VVA lectin chromatography. As illustrated in
[0527] The present inventors next tested immunization with exosomal fractions and membrane factions collected by ultracentrifugation from the pancreatic cell line T3M4 engineered to only display STn/Tn O-glycans. Both exosome and membrane fraction generated strong polyclonal responses.
[0528] The present inventors next tested immunization with extracts from other cell lines engineered to only display STn/Tn O-glycans including the gastric cancer cell line AGS and the ovarian carcinoma cell line OVCAR-3.
[0529] Two major classes of immunogens can be generated from the engineered SC; i) different cell extracts including affinity purified glycoproteins, membrane extracts, microvesicles, secretomes and whole cells or ii) or recombinant expressed and purified glycoproteins (FIG. 16). In the current study we used affinity enriched cell lysates from breast (MDA-MB-231) and ovarian (OVCAR-3) cancer SimpleCell lines as well as microvesicles purified by sequential centrifugation steps of conditioned medium from a pancreatic cancer (T3M4) SimpleCell. The affinity enriched lysates were isolated by Triton-X100 extraction followed by lectin chromatography using the Tn-binding lectin Vicia Villosa (VVA) and elution with GalNAc. While MDA-MB-231 SC only express the Tn-glycoform, OVCAR-3 SC express a mixture of STn and Tn and was therefore neuraminidase treated prior to lectin binding. After mouse immunization and hybridoma fusion the obtained antibodies were screened by immunocytochemistry on trypsinated acetone fixed SC and the isogenic WT and antibodies with preferred SC reactivity was selected. Using microvesicles as an immunogen we obtained a significant number of hybridoma wells producing Abs with strong binding to the T3M4 SC (146 out of 480 wells) however only clone, 5D10, did not also react with T3M4 WT cells. When using lectin enriched lysates as the immunogen source we obtained less Ab producing hybridomas however multiple clones with preferred SC reactivity were isolated (8 out of 41 and 5 out of 15 SC positive wells for MDA-MB-231 SC and OVCAR-3 SC respectively). We selected one hybridoma well from each fusion for subcloning and thus generated mAb 6C5 (MDA-MB-231), 1D5 (OVCAR-3) and 5D10 (T3M4). All three mAbs were IgG1 and exhibited strong binding to the respective SC and no binding to the corresponding WT. We selected mAb 6C5 for further characterization including Western blotting, immunocytochemistry (ICC) on a panel of cancer SimpleCells, immunohistochemistry (IHC) on cancer and normal tissue followed by antigen identification as described below.
[0530] Characterization of mAb 6C5
[0531] As an initial characterization we used mAb 6C5 to stain our panel of SCs from various tissue origin including HEK293, T3M4, HeLa, Colo-205, IMR-32, MCF7 and HepG2 with and without neuraminidase treatment to remove sialic acid. While most SC lines were stained strongly by mAb 6C5, MCF7 SC only displayed very faint staining and HepG2 SC were completely negative. This experiment confirmed that mAb 6C5 is not a Tn-hapten antibody, but on the contrary recognizes a Tn-glycoprotein antigen either differentially expressed or dependent of differentially expressed GALN-Ts. Neuraminidase seemed to enhance the staining of 6C5 indicating that the preferred glycoform is Tn which is consistent with the fact that MDA-MB-231 SC used for immunization does not express the STn glycoform48. Western blot of MDA-MB-231 SC cell lysates as well 6C5-immunopreciptated (IP) lysate showed that 6C5 recognizes a 50 kDa protein that is Tn-glycosylated as validated by VVA staining (
[0532] An immunohistological study using mAb 6C5 was performed on three tissue microarrays (TMAs) representing paraffin-embedded cores from four different types of breast cancer, three different types of ovarian cancer and adenocarcinomas of stomach as well as normal appearing tissue adjacent to cancer. The result is summarized in Table 10 and representative images displayed in
[0533] Staining revealed that all three cancers were positive with mAb 6C5. Breast cancer had the highest number of positive cores (carcinoma simplex: 14/25, atypical medullary carcinoma: 6/13, infiltrating duct carcinoma: 6/13 and scirrhous carcinoma: 7/12). Ovarian cancer had less positive cores (serous papillary cyst adenomas: 10/47, mucinous carcinomas: 3/6, and endometrioid adenocarcinomas: 4/7). In stomach 7/22 adenocarcinomas were stained. The percentage of positive cells in all the tested tumors varied from less than 30% to more than 60% (Table 1).
TABLE-US-00011 TABLE 10 Summary of immunohistology with mAb 6C5. Negative <30% 30-60% >60% Tissues Cases #(%) #(%) #(%) #(%) Breast Cancer 68 30(44%).sup.1 21(31%) 10(15%) 7(10%) Normal 8 8(100%).sup.2 0(0%) 0(0%) 0(0%) Ovary Cancer 59 39(66%).sup.3 18(31%) 1(2%) 1(2%) Normal 10 10(100%) 0(0%) 0(0%) 0(0%) Stomach Cancer 22 15(68%).sup.4 3(14%) 2(9%) 2(9%) Normal 45 45(100%).sup.5 0(0%) 0(0%) 0(0%) [0534] The tissue microarray cores were classified according to cell surface membrane staining. .sup.11 core had granular intracellular staining. .sup.22 cores had granular intracellular staining. .sup.311 cores had granular intracellular staining. .sup.44 cores had granular intracellular staining. .sup.515 cores had strong Golgi-like staining of mucous producing cells. Four of those also had homogeneous staining throughout the cytoplasm.
[0535] The staining pattern observed with mAb 6C5 was mainly membraneous and cytoplasmic, although a subset of the three cancers only showed a weak punctuate granular intracellular staining (Table 10). In a few cancer cores mAb 6C5 labelled vascular endothelium and single dispersed cells possibly representing immune cells or detached cancer cells.
[0536] The tested TMAs also contained cores representing normal appearing tissues adjacent to cancer. Eight normal breast cores were examined, six of them were completely negative (
[0537] The mab 6C5 antigen epitope is dependent on GALNT7 expressionSince 6C5 was strongly positive on HEK293 SC cells we screened a panel of HEK293 cells in which GALN-Ts known to be expressed were knocked out individually or in combination (
[0538] Mab 6C5 reacts with a Tn-glycopeptide epitope on FXYD5 dependent on GALNT7To further identify the O-glycoprotein and epitope recognized by mAb 6C5 we screened a panel of engineered isogenic HEK293-SC with different repertoire of GALNTs, and surprisingly found that reactivity was not dependent on the most abundant and broadly active GALNTs (GALNT1/T2/T3), while reactivity was almost abolished in HEK293-SC without GALNT7. This finding was confirmed by Western blot analysis where the 50 kDa band was detected in lysates from all HEK293-SCs except in cells without GALNT7 as well as in HEK293WT cells with elongated O-glycans (
[0539] To narrow down the epitope of mAb 6C5 a 30 mer peptide covering amino acid 81-110 of FXYD5 (TDGPLVTDPETHKSTKAAHPTDDTTTLSER) was obtained and in vitro glycosylated with GalNacT1, T2 and T3 alone or in combination with GalNacT7. The glycopeptides were analysed by MALDI-TOF. GalNacT7 has been proposed to require neighboring GalNac residues in order to function and we observed no glycosylation of the peptide with GalNac-T7 alone. GalNacT2 only glycosylated one site, independent of GalNacT7, and GalNacT3 was unreactive (not shown). Glycosylation with GalNacT1 (FXYD5.sub.81-110GalNacT1) or GalNacT1and GalNacT7 (FXYD5.sub.81-110GalNac-T1+T7) resulted in a heterogeneous mixture with 0-8 O-GalNAc sites making it difficult to perceive a possible GalNacT7 specific site in the obtained MS spectrum. We therefore tested 6C5 reactivity on the peptide, the two glycopeptides as well as two Tn-glycopeptide controls in ELISA (
[0540] The presented versatile strategy for discovery and generation of mAbs targeting cancer-specific truncated O-glycopeptide epitopes employs glycoengineered cancer cell lines displaying homogenous truncated O-glycans and relevant repertoires of GALN-Ts. The wide discovery potential of the strategy was illustrated by using as examples engineered breast, ovarian and pancreatic cancer cell lines for the generation of three novel mAbs. The mAb 6C5 was characterized in detail and shown to exhibit a high degree of cancer specific reactivity and be directed to a Tn-glycopeptide epitope in dysadherin (FXYD5), a known cancer-associated cell membrane glycoprotein. Moreover, we show that the epitope for 6C5 requires expression of the GALNT7 isoform and a distinct O-glycosylation pattern.
[0541] Methods
[0542] Cell line engineeringHuman cancer cell lines were engineered as described in above Examples by ZFNs, TALENs, or CRISPR/Cas9 with KO of COSMC (SC) and/or KI of ST6GALNACT1 to express homogenous Tn and/or STn. KO of GALNTs and FXYD5 in HEK293 cells were made using CRISPR/Cas9. For FXYD5 KO a gRNA targeting 5-TCGTTGGCCTGATTCTCCCC-3 was selected and KO clones were identified using fragment analysis and KO confirmed by DNA sequencing using the following primers, 5-GCCAGAGGTTTTTGCTCAGG-3 and 5-CAGGACAACGTTCACACGG-3.
[0543] Immunogen preparationImmunogens were prepared as follows; Whole cells (10 mio cells) were harvested by trypsin, washed in PBS, fixed in ice-cold 1% glutaraldehyde for 10 min, washed in PBS and used for immunization. VVA enrichment was performed passing either culture media or Triton x-100 cell extracts (pellets from 4 T175 lysed in 1% Triton-x-100 in lectin buffer (20 mM Tris-HCl pH 7.4, 150 mM NaCl, 1 M Urea, 1 mM CaCl.sub.2, MgCl.sub.2, MnCl.sub.2 and ZnCl.sub.2.) and protease inhibitor) over 500 l VVA coupled agarose beads pre-equilibrated with lectin buffer containing 0.1% Triton x-100. The beads were subsequently washed and eluted with 0.4 M GalNAc as previously described (Schjoldager PNAS 2012) and eluted glycoproteins used for immunization. Membrane fractions were isolated by a one-step ultracentrifugation (100000g 1 h) of total cell lysates (20 mM Tris-HCl pH 7.4, 250 mM Sucrose and protease inhibitor). The pellet was re-dissolved in PBS and used for immunization. Exosomes were purified by a two-step centrifugation protocol (11600 RPM and 38600 RPM) of serum free (48 h) cell culture medium. The obtained pellet was re-dissolved in PBS and used for immunization.
[0544] Lysis of cell pellets (8 T175 flask MDA-MB-231 SC or 2 T175 flasks OVCAR-3 SC confluent cells) were made in 1% Triton X-100 in lectin buffer (20 mM Tris-HCl pH 7.4, 150 mM NaCl, 1 M Urea, 1 mM CaCl.sub.2, MgCl.sub.2, MnCl.sub.2 and ZnCl.sub.2) and protease inhibitor (Complete, EDTA-free (Roche)). The lysates were diluted with lectin buffer to a final concentration of 0.1% Triton X-100 and the OVCAR-3 SC lysate neuraminidase treated 1.5 h, 37 C. with 0.01 U/mL neuraminidase (C. perfringens, type VI (Sigma)). Samples were passed over 500 l VVA coupled agarose beads (Vector Laboratories) pre-equilibrated with lectin buffer containing 0.1% Triton X-100. The beads were subsequently washed and eluted with 21 ml 0.4 M GalNAc in 20 mM Tris-HCl pH 7.4, 150 mM NaCl and 0.1% triton x-100. Glycoprotein enrichment was confirmed by western blot by VVA detection and eluted glycoproteins were used for immunization.
[0545] Microvesicles were purified from 500 ml of serum free (48 h) cell culture medium from T3M4 SC by five centrifugation steps (10 150g, 30 300g, 30 850g, 30 10,000g, 1 h 100,000g all at 4 C.). The obtained pellet was re-dissolved in PBS and used for immunization.
[0546] Immunogen preparationImmunogens were prepared as follows; Whole cells (10 mio cells) were harvested by trypsin, washed in PBS, fixed in ice-cold 1% glutaraldehyde for 10 min, washed in PBS and used for immunization. VVA enrichment was performed passing either culture media or Triton x-100 cell extracts (pellets from 4 T175 lysed in 1% Triton-x-100 in lectin buffer (20 mM Tris-HCl pH 7.4, 150 mM NaCl, 1 M Urea, 1 mM CaCl.sub.2, MgCl.sub.2, MnCl.sub.2 and ZnCl.sub.2.) and protease inhibitor) over 500 l VVA coupled agarose beads pre-equilibrated with lectin buffer containing 0.1% Triton x-100. The beads were subsequently washed and eluted with 0.4 M GalNAc as previously described (Schjoldager 2012) and eluted glycoproteins used for immunization. Membrane fractions were isolated by a one-step ultracentrifugation (100000g 1 h) of total cell lysates (20 mM Tris-HCl pH 7.4, 250 mM Sucrose and protease inhibitor). The pellet was re-dissolved in PBS and used for immunization. Exosomes were purified by a two-step centrifugation protocol (11600 RPM and 38600 RPM) of serum free (48 h) cell culture medium. The obtained pellet was re-dissolved in PBS and used for immunization.
[0547] Lysis of cell pellets (8 T175 flask MDA-MB-231 SC or 2 T175 flasks OVCAR-3 SC confluent cells) were made in 1% Triton X-100 in lectin buffer (20 mM Tris-HCl pH 7.4, 150 mM NaCl, 1 M Urea, 1 mM CaCl.sub.2, MgCl.sub.2, MnCl.sub.2 and ZnCl.sub.2) and protease inhibitor (Complete, EDTA-free (Roche)). The lysates were diluted with lectin buffer to a final concentration of 0.1% Triton X-100 and the OVCAR-3 SC lysate neuraminidase treated 1.5 h, 37 C. with 0.01 U/mL neuraminidase (C. perfringens, type VI (Sigma)). Samples were passed over 500 l VVA coupled agarose beads (Vector Laboratories) pre-equilibrated with lectin buffer containing 0.1% Triton X-100. The beads were subsequently washed and eluted with 21 ml 0.4 M GalNAc in 20 mM Tris-HCl pH 7.4, 150 mM NaCl and 0.1% triton x-100. Glycoprotein enrichment was confirmed by western blot by VVA detection and eluted glycoproteins were used for immunization.
[0548] Microvesicles were purified from 500 ml of serum free (48 h) cell culture medium from T3M4 SC by five centrifugation steps (10 150g, 30 300g, 30 850g, 30 10,000g, 1 h 100,000g all at 4 C.). The obtained pellet was re-dissolved in PBS and used for immunization.
[0549] Immunization Protocol
[0550] Female Balb/c mice were injected subcutaneously or intraperitoneally with 100 l immunogen in a total volume of 200 l (1:1 mix with Freunds adjuvant, Sigma). Mice received three immunizations 2-3 weeks apart and finally a boost intraperitoneally 3 days before fusion. Blood samples were obtained by eye or tail bleeding one week after third immunization
[0551] Balb/c mice were immunized with a single intraperitoneal injection of 20-40 g protein of VVA-enriched glycoproteins (MDA-MB-231 SC and OVCAR-3 SC) or with a single subcutaneous injection of microvesicle fraction (T3M4) in a total volume of 200 l (1:1 mix with Freunds adjuvant) three times, three weeks apart and finally an intraperitoneal boost without adjuvant. Three days after the 4th immunization splenocytes from one mouse were fused with NS1 myeloma cells. Hybridoma supernatants were screened by immunocytochemistry on trypsinated and acetone fixed cells46 after 10-12 days of culture. Hybridomas producing Abs with significant reactivity to SC and not to WT cells were subjected to at least two limiting dilutions. Three mAb producing clones were finally selected for further characterization, 6C5 (MDA-MB-231 SC), 1D5 (OVCAR-3 SC) and 5D10 (T3M4 SC) and all determined to secrete IgG1.
[0552] Monoclonal antibodies were generated as previously described (Vester-Christensen 2013) from Balb/c mice immunized with human cancer cells engineered to only display Tn O-glycans or cell membrane extracts hereof. Screening was based on immunocytochemistry on acetone fixed slides with engineered cells and corresponding wt cells and immunohistology with human cancer tissues as well as ELISA assays and Western Blot. Selection was based on reactivity pattern similar to total sera of the same mice
[0553] For immunohistochemistry formalin fixed paraffin embedded TMAs (Biomax) were dewaxed, rehydrated and subjected to antigen retrieval by microwave treatment (5 min at 600 w and 15 min at 300 w) at pH 6 (citrate buffer). Sections subjected to sialidase treatment were pretreated with 0.1 U/ml neuraminidase in 0.1M sodium acetate buffer (pH 5.5) for 2 hrs at 37 C. Sections were blocked with 10% calf serum, incubated overnight at 4 C. with primary antibodies, rinsed and incubated with FITC-conjugated rabbit anti-mouse immunoglobulins (DAKO) for 45 min. Slides were mounted in Vectashield (Vector Laboratories, Inc).
[0554] For immunocytochemistry cells were seeded on sterile coverslips coated with type I collagen (0.4 mg/ml) and cultivated for 2-3 days. The cells were then washed in cold PBS and fixed in cold 4% PFA for 10 min. After washing in cold PBS, the primary antibody (1 g/ml (NCC-M53), 0.5 g/ml VVA-biotin, 10 or 100 diluted hybridoma supernatant (6C5), undiluted hybridoma supernatant (5F4, 1E3, 4C4, 8B8)) was added ON 4 C. After washing the secondary antibody was added (anti-Mouse Ig-FITC, 1:400 dilution in 2.5% BSA PBS or 1:2000 strepdavidin-Alexa488 (Life technologies)) and incubated for 45 min, washed and mounted with ProLong Gold Antifade Mountant with DAPI (Life Technologies).
[0555] For immunohistochemistry formalin fixed paraffin embedded TMAs (Biomax) were heated at 60 C. 30 min, dewaxed, rehydrated and subjected to antigen retrieval by microwave treatment at pH 6 (citrate buffer). Sections were blocked with 10% calf serum, incubated overnight at 4 C. with primary antibody (undiluted supernatant), rinsed and incubated with anti-Mouse Ig-FITC, 1:200 dilution in 2.5% BSA/PBS and incubated for 45 min. Slides were washed and mounted in Vectashield (Vector Laboratories, Inc). All images were acquired using Zeiss Axioscope 2 plus with an AxioCam MRc (40).
[0556] For FACS analysis cells were harvested by trypsin, washed in PBS, blocked in FACS buffer (2% Fetal bovine serum in PBS) and antibody added 45 min on ice (1 g/ml (MC53), 1:100 diluted hybridoma supernatant (6C5)). Cells were washed in FACS solution, incubated 35 min on ice with anti-Mouse Ig-FITC, washed and analyzed on instrument.
[0557] Cell lysis and subsequent immunoprecipitation (IP) was performed following a modified protocol61. Cells were lysed in 1 High salt lysis buffer (10 mM, Tris-HCL, 420 mM NaCl, 0.1% NP-40), and protease inhibitor cocktail (cOmplete, EDTA free (Roche)), subjected to 3 freeze-thaw cycles and sonication. The lysate was centrifuged,13000 rpm 10 min, and the protein concentration was measured by 280 nm absorption on nanodrop. For IP 800 g of lysate was incubated with 1 g of antibody (or 50 l hybridoma supernatant) and incubated for 4 h 4 C. 15 l of Dynabeads Protein G (Invitrogen) were washed 3 in low salt lysis buffer (10 mM Tris-HCL, 100 mM NaCl, 0.1% NP-40), added to the lysate-Ab mix and incubated ON 4 C. Beads were washed with 4 low salt lysis buffer and eluted in 60 l 0.5 M ammonium hydroxide or Novex NuPAGE LDS Sample Buffer with 20 mM DTT.
[0558] For Western blot, samples were mixed to a final concentration of 1 Novex NuPAGE LDS Sample Buffer and 20 mM DTT. After denaturation at 96 C. for 10 min the samples were loaded into a NuPAGE Bis-Tris 4-12% gel (Invitrogen) and electrophoresis was carried out at 200 V for 35 min. The proteins were transferred onto a nitrocellulose membrane at 30 V for 90 min and the membrane blocked in 5% skimmed milk or 1% polyvinylpyrrolidone (for VVA detection) in TBS-T. The membrane was incubated with primary antibody (1 g/ml (MC53, VVA-biotin), 0.1 g/ml (anti-GAPDH, FL-335 Santa cruise biotechnology), 10 diluted hybridoma supernatant (6C5)) in blocking buffer at 4 C. overnight, washed and incubated with the secondary layer at room temperature for 1 hour (Rabbit Anti-Mouse Ig-HRP, Goat Anti-Rabbit Ig-HRP or Streptavidin-HRP (Dako, 1:4000 dilution) and developed using the Thermo Scientific Pierce ECL Western Blotting Substrate kit.
[0559] FXYD5 recombinant protein and glycopeptidesFull length FXYD5 with a C-terminal Myc-tag was cloned into the PTT5 vector. HEK293 SC FXYD5 KO cells were transfected with 1 g of DNA using lipofectamin 3000 and cells were harvested after 48 h. Cell lysis, IP and western blot were performed as described above. A 30-mer peptide (TDGPLVTDPETHKSTKAAHPTDDTTTLSER) was purchased (SynPeptide) covering the investigated glycosylation site on FXYD5 and subjected to in vitro glycosylation using recombinant glycosyltransferases expressed as soluble secreted truncated proteins in insect cells and purified. Glycosylation of the peptide was performed in a reaction mixture (0.4 mg peptide/mL) containing 25 mM cacodylate buffer (pH 7.4), 10 mM MnCl2, 0.25% Triton X-100, 12 g/mL GalNAc-T and 2 mM UDP-GalNAc. The reactions were incubated at 37 C., and glycopeptide development was monitored by MALDI-TOF MS (Bruker, Autoflex).
[0560] For ELISA assays, 100 g of peptide was glycosylated with either GalNacT1 alone or in combination with GalNacT7, acidified and purified by UHPLC (Thermo, Ultimate 3000) on a C18 column (Phenomenex, Jupiter, 5 m, 300 , 250 mm). 96-well plates (MaxiSorp, Nunc) were coated overnight with peptide or glycopeptides diluted to 50 l/well in coating buffer (Na2CO3-buffer pH 9.6) at 4 C. ON. Plates were blocked with 150 l/well PLI-P-buffer (PO4-buffer pH 7.4, Na/K, 1% Triton-X, 1% BSA) for 1 hour at room temperature and incubated 1 h with the primary layer (0.5 g/ml, VVA-biotin or 6C5). After 1 hour of incubation with secondary layer (1:4000 Streptavidin-HRP or anti-IgG-HRP) the plates where developed with TMB+ chromogen (Dako) and stopped with 0.5 M H2SO4 and read at 450 nm. All washing steps were performed with PBS-T (PBS-buffer pH 7.4, 0.05% Tween-20).
LIST OF REFERENCES
[0561] Amado M, Almeida R, Schwientek T, Clausen H (1999) Identification and characterization of large galactosyltranserase gene families: galactosyltransferases for all functions. Biochim. Biophys. Acta, 1473:35-53
[0562] Arthur, C. M., Cummings, R. D., and Stowell, S. R. (2014) Using glycan microarrays to understand immunity. Current opinion in chemical biology 18, 55-61
[0563] Bennett E P, Mandel U, Clausen H, Gerken T A, Fritz T A, Tabak L A. (2012) Control of Mucin-Type O-GlycosylationA Classification of the Polypeptide GalNAc-transferase Gene Family. Glycobiology. 22(6):736-56
[0564] Blixt, O., Head, S., Mondala, T., Scanlan, C., Huflejt, M. E., Alvarez, R., Bryan, M. C., Fazio, F., Calarese, D., Stevens, J., Razi, N., Stevens, D. J., Skehel, J. J., van Die, I., Burton, D. R., Wilson, I. A., Cummings, R., Bovin, N., Wong, C. H., and Paulson, J. C. (2004) Printed covalent glycan array for ligand profiling of diverse glycan binding proteins. Proceedings of the National Academy of Sciences of the United States of America 101, 17033-17038
[0565] Bohm, E., Seyfried, B. K., Dockal, M., Graninger, M., Hasslacher, M., Neurath, M., Konetschny, C., Matthiessen, P., Mitterer, A., and Scheiflinger, F. (2015) Differences in N-glycosylation of recombinant human coagulation factor VII derived from BHK, CHO, and HEK293 cells. BMC biotechnology 15, 87
[0566] Colley K. J. (1997) Golgi localization of glycosyltransferases: more questions than answers. Glycobiology 7, 1-13
[0567] Duda K, Lonowski L A, Kofoed-Nielsen M, Ibarra A, Delay C M, Kang Q, Yang Z, Pruett-Miller S M, Bennett E P, Wandall H H, Davis G D, Hansen S H, Frodin M. Nucleic Acids Res. 2014 June
[0568] Durocher Y, Perret S, Kamen A (2002) High-level and high-throughput recombinant protein production by transient transfection of suspension-growing human 293-ebnal cells. Nucleic acids res. 30(2):e9
[0569] El Mai N, Donadio-Andrei S, Iss C, Calabro V, Ronin C (2013) Engineering a human-like glycosylation to produce therapeutic glycoproteins based on 6-linked sialylation in CHO cells. Methods Mol Biol 988:19-29
[0570] Geissner, A., Anish, C., and Seeberger, P. H. (2014) Glycan arrays as tools for infectious disease research. Current opinion in chemical biology 18, 38-45
[0571] Hansen, L., Lind-Thomsen, A., Joshi, H. J., Pedersen, N. B., Have, C. T., Kong, Y., Wang, S., Sparso, T., Grarup, N., Vester-Christensen, M. B., Schjoldager, K., Freeze, H. H., Hansen, T., Pedersen, O., Henrissat, B., Mandel, U., Clausen, H., Wandall, H. H., and Bennett, E. P. (2015) A glycogene mutation map for discovery of diseases of glycosylation. Glycobiology 25, 211-224
[0572] Ilver, D., Johansson, P., Miller-Podraza, H., Nyholm, P. G., Teneberg, S., and Karlsson, K. A. (2003) Bacterium-host protein-carbohydrate interactions. Methods in enzymology 363, 134-157
[0573] Jacewicz, M., Clausen, H., Nudelman, E., Donohue-Rolfe, A., and Keusch, G. T. (1986) Pathogenesis of shigella diarrhea. XI. Isolation of a shigella toxin-binding glycolipid from rabbit jejunum and HeLa cells and its identification as globotriaosylceramide. The Journal of experimental medicine 163, 1391-1404
[0574] Ju T, Lanneau G S, Gautam T, Wang Y, Xia B, Stowell S R, et al. (2008) Human tumor antigens Tn and sialyl Tn arise from mutations in Cosmc. Cancer Res 15 donadi (68):1636-1646
[0575] Kornfeld S., Kornfeld R. (1985) Assembly of asparagine-linked oligosaccharides. Annu. Rev. Biochem., 54: 631-644
[0576] Lairson L L, Henrissat B, Davies G J, Withers S G. (2008) Glycosyltransferases: Structures, functions, and mechanisms, Annu Rev Biochem 77: 521-555
[0577] Lee K, Jin X, Zhang K, Copertino L, Andrews L, Baker-Malcolm J, Geagan L, Oiu H, Seiger K, Barngrover D, McPherson J M, Edmunds T. (2003) A biochemical and pharmacological comparison of enzyme replacement therapies for the glycolipid storage disorder Fabry disease. Glycobiology 13(4): 305-313
[0578] Magnani, J. L., Nilsson, B., Brockhaus, M., Zopf, D., Steplewski, Z., Koprowski, H., and Ginsburg, V. (1982) A monoclonal antibody-defined antigen associated with gastrointestinal cancer is a ganglioside containing sialylated lacto-N-fucopentaose II. The Journal of biological chemistry 257, 14365-14369
[0579] Malphettes L, Freyvert Y, Chang J, Liu P-Q, Chan E, Miller J C, Zhou Z, Nguyen T, Tsai C, Snowden A W, et al. (2010) Highly efficient deletion of FUT8 in CHO cell lines using zinc-finger nucleases yields cells that produce completely nonfucosylated antibodies, Biotechnol Bioeng 106: 774-783
[0580] Mandel U, Hassan H, Therkildsen M H, Rygaard J, Jakobsen M H, Juhl B R, Dabelsteen E, Clausen H. (1999) Expression of polypeptide GalNAc-transferases in stratified epithelia and squamous cell carcinomas: Immunohistological evaluation using monoclonal antibodies to three members of the GalNAc-transferase family, Glycobiology 9: 43-52
[0581] Marcos, N. T., Pinho, S., Grandela, C., Cruz, A., Samyn-Petit, B., Harduin-Lepers, A., Almeida, R., Silva, F., Morais, V., Costa, J., Kihlberg, J., Clausen, H., and Reis, C. A. (2004) Cancer Res. 64, 7050-7057
[0582] Marcos N T, Bennett E P, Gomes J, Magalhaes A, Gomes C, David L, Dar I, Jeanneau C, DeFrees S, Krustrup D, Vogel L K, Kure E H, Burchell J, Taylor-Papadimitriou J, Clausen H, Mandel U, Reis C A (2011) ST6GalNAc-I controls expression of sialyl-Tn antigen in gastrointestinal tissues. Front Biosci 3:1443-55
[0583] Maresca M, Lin V G, Guo N, Yang Y. (2013) Obligate ligation-gated recombination (ObLiGaRe): custom-designed nuclease-mediated targeted integration through nonhomologous end joining. Genome Res, 23: 539-546
[0584] Narimatsu H. (2006) Human glycogene cloning: Focus on beta 3-glycosyltransferase and beta 4-glycosyltransferase families, Curr Opin Struct Biol 16: 567-575
[0585] Ohtsubo, K. and Marth, J. D. (2006) Glycosylation in cellular mechanisms of health and disease Cell 126, 855-867
[0586] Padler-Karavani, V., Song, X., Yu, H., Hurtado-Ziola, N., Huang, S., Muthana, S., Chokhawala, H. A., Cheng, J., Verhagen, A., Langereis, M. A., Kleene, R., Schachner, M., de Groot, R. J., Lasanajak, Y., Matsuda, H., Schwab, R., Chen, X., Smith, D. F., Cummings, R. D., and Varki, A. (2012) Cross-comparison of protein recognition of sialic acid diversity on two novel sialoglycan microarrays. The Journal of biological chemistry 287, 22593-22608
[0587] Palma, A. S., Feizi, T., Childs, R. A., Chai, W., and Liu, Y. (2014) The neoglycolipid (NGL)-based oligosaccharide microarray system poised to decipher the meta-glycome. Current opinion in chemical biology 18, 87-94
[0588] Patnaik, S. K. & Stanley, P. (2006) Lectin-resistant CHO glycosylation mutants. Methods Enzymol. 416, 159-182
[0589] Paulson, J. C., Blixt, O., and Collins, B. E. (2006) Sweet spots in functional glycomics. Nature chemical biology 2, 238-248
[0590] Rillahan, C. D., and Paulson, J. C. (2011) Glycan microarrays for decoding the glycome. Annual review of biochemistry 80, 797-823
[0591] Ronda, C., Pedersen, L. E., Hansen, H. G., Kallehauge, T. B., Betenbaugh, M. J., Nielsen, A. T., and Kildegaard, H. F. (2014) Accelerating genome editing in CHO cells using CRISPR Cas9 and CRISPy, a web-based target finding tool Biotechnol. Bioeng. 111, 1604-1616
[0592] Schachter H. (2014) Complex N-glycans: the story of the yellow brick road. Glycoconjugate journal 31(1): 1-5
[0593] Schietinger, A., Philip, M., Yoshida, B. A., Azadi, P., Liu, H., Meredith, S. C., and Schreiber, H. (2006) A mutant chaperone converts a wild-type protein into a tumor-specific antigen. Science 314, 304-308
[0594] Sewell R, Bckstrm M, Dalziel M, Gschmeissner S, Karlsson H, Noll T, et al. (2006) The ST6GalNAc-I sialyltransferase localizes throughout the Golgi and is responsible for the synthesis of the tumor-associated sialyl-Tn O-glycan in human breast cancer. J Biol Chem 281:3586-3594
[0595] Sharon, N., and Lis, H. (2004) History of lectins: from hemagglutinins to biological recognition molecules. Glycobiology 14, 53R-62R
[0596] Singh P K, Behrens M E, Eggers J P, Cerny R L, Bailey J M, Shanmugam K, Gendler S J, Bennett E P, Hollingsworth M A. (2008) Phosphorylation of MUC1 by Met modulates interaction with p53 and MMP1 expression. J Biol Chem. 283:26985-26995
[0597] Steentoft C, Bennett E P, Schjoldager K T, Vakhrushev S Y, Wandall H H, Clausen H. (2014) Precision genome editinga small revolution for glycobiology. Glycobiology 24:663-80
[0598] Steentoft, C., Vakhrushev, S. Y., Joshi, H. J., Kong, Y., Vester-Christensen, M. B., Schjoldager, K. T., Lavrsen, K., Dabelsteen, S., Pedersen, N. B., Marcos-Silva, L., Gupta, R., Paul Bennett, E., Mandel, U., Brunak, S., Wandall, H. H., Levery, S. B., and Clausen, H. (2013) Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology. The EMBO journal 32, 1478-1488
[0599] Steentoft C, Vakhrushev S Y, Vester-Christensen M B, Schjoldager K T, Kong Y, Bennett E P, Mandel U, Wandall H, Levery S B, Clausen H. (2011) Mining the O-glycoproteome using zinc-finger nuclease-glycoengineered SimpleCell lines. Nat Methods. 8(11):977-82
[0600] Stevens, J., Blixt, O., Tumpey, T. M., Taubenberger, J. K., Paulson, J. C., and Wilson, I. A. (2006) Structure and receptor specificity of the hemagglutinin from an H5N1 influenza virus. Science 312, 404-410
[0601] Tang, P. W., and Feizi, T. (1987) Neoglycolipid micro-immunoassays applied to the oligosaccharides of human milk galactosyltransferase detect blood-group related antigens on both O- and N-linked chains. Carbohydrate research 161, 133-143
[0602] Tarp M A, Clausen H. (2008) Mucin-type O-glycosylation and its potential use in drug and vaccine development. Biochim Biophys Acta 1780(3): 546-63
[0603] Tarp, M. A., Sorensen, A. L., Mandel, U., Paulsen, H., Burchell, J., Taylor-Papadimitriou, J., and Clausen, H. (2007) Identification of a novel cancer-specific immunodominant glycopeptide epitope in the MUC1 tandem repeat. Glycobiology 17, 197-209
[0604] Taylor, M. E., and Drickamer, K. (2014) Convergent and divergent mechanisms of sugar recognition across kingdoms. Current opinion in structural biology 28, 14-22
[0605] Tsuji S, Datta A K, Paulson J C. (1996) Systematic nomenclature for sialyltransferases. Glycobiology 6(7):v-vii.
[0606] Umana P, Jean-Mairet J, Moudry R, Amstutz H, Bailey J E. (1999) Engineered glycoforms of an antineuroblastoma IgG1 with optimized antibody-dependent cellular cytotoxic activity. Nat Biotechno1.17:176-180
[0607] Vester-Christensen M B, Bennett E P, Clausen H, Mandel U. (2013). Generation of monoclonal antibodies to native active human glycosyltransferases. Methods Mol Biol 1022:403-420
[0608] Walsh, G. (2014) Biopharmaceutical benchmark 2014, Nat. Biotechnol. 32, 992-1000.
[0609] Wandall H H, Blixt O, Tarp M A, Pedersen J W, Bennett E P, Mandel U, et al. (2010) Cancer biomarkers defined by autoantibody signatures to aberrant O-glycopeptide epitopes. Cancer research 70(4):1306-13
[0610] Wands, A. M., Fujita, A., McCombs, J. E., Cervin, J., Dedic, B., Rodriguez, A. C., Nischan, N., Bond, M. R., Mettlen, M., Trudgian, D. C., Lemoff, A., Quiding-Jarbrink, M., Gustaysson, B., Steentoft, C., Clausen, H., Mirzaei, H., Teneberg, S., Yrlid, U., and Kohler, J. J. (2015) Fucosylation and protein glycosylation create functional receptors for cholera toxin. eLife 4
[0611] Xu, X., Nagarajan, H., Lewis, N. E., Pan, S., Cai, Z., Liu, X., Chen, W., Xie, M., Wang, W., Hammond, S., Andersen, M. R., Neff, N., Passarelli, B., Koh, W., Fan, H. C., Wang, J., Gui, Y., Lee, K. H., Betenbaugh, M. J., Quake, S. R., Famili, I., Palsson, B. O., and Wang, J. (2011) The genomic sequence of the Chinese hamster ovary (CHO)-K1 cell line. Nature biotechnology 29, 735-741
[0612] Yamane-Ohnuki N, Kinoshita S, Inoue-Urakubo M, Kusunoki M, Iida S, Nakano R, Wakitani M, Niwa R, Sakurada M, Uchida K, Shitara K, Satoh M (2004) Establishment of FUT8 knockout Chinese hamster ovary cells: an ideal host cell line for producing completely defucosylated antibodies with enhanced antibody-dependent cellular cytotoxicity. Biotechnol Bioeng 87:614-622
[0613] Yang, Z., Wang, S., Halim, A., Schulz, M. A., Frodin, M., Rahman, S. H., Vester-Christensen, M. B., Behrens, C., Kristensen, C., Vakhrushev, S. Y., Bennett, E. P., Wandall, H. H., and Clausen, H. (2015) Engineered CHO cells for production of diverse, homogeneous glycoproteins. Nature biotechnology 33, 842-844
[0614] Yu, X., and Blanchard, H. (2014) Carbohydrate recognition by rotaviruses. Journal of structural and functional genomics 15, 101-106