CHIMERIC ANTIGEN RECEPTORS BASED ON ALTERNATIVE SIGNAL I DOMAINS
20190330302 ยท 2019-10-31
Inventors
- Marcela V. Maus (Lexington, MA, US)
- Mark Cobbold (Winchester, MA, US)
- Irene Scarfo (Cambridge, MA, US)
Cpc classification
A61K39/395
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C07K2319/30
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
A61K39/464429
HUMAN NECESSITIES
C07K14/70596
CHEMISTRY; METALLURGY
C07K14/70578
CHEMISTRY; METALLURGY
C07K2317/92
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K39/464417
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
C07K16/2896
CHEMISTRY; METALLURGY
International classification
C07K14/705
CHEMISTRY; METALLURGY
A61K35/17
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
Abstract
Described herein are methods for producing and utilizing an alternative signal 1 domain to construct an optimally signaling CAR. Alternative signal 1 domains of the present technology are based on alternatives to CD3, including mutated ITAMs from CD3 (which contains 3 IT AM motifs), truncations of CD3, and alternative splice variants known as CD3s, CD3 theta, and artificial constructs engineered to express fusions between CD3s or CD30 and CD3. CAR polypeptides comprising alternative signal 1 domains are utilized to engineer CAR T cells. Further, this technology related to methods of treating cancer by administering to a subject in need thereof CAR T cells comprising alternative signal 1 domains.
Claims
1. A chimeric antigen receptor (CAR) polypeptide comprising: a) an extracellular domain comprising a target-binding sequence; b) a transmembrane domain; c) a co-stimulatory domain; and d) a T cell intracellular signaling domain that lacks a functional ITAM3 sequence.
2. The CAR polypeptide of claim 1, wherein the transmembrane domain is the transmembrane domain from is CD8 or 4-1BB.
3. The CAR polypeptide of claim 1, wherein the co-stimulatory domain is the co-stimulatory domain of 4-1BB.
4. The CAR polypeptide of claim 1, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34.
5. The CAR polypeptide of claim 1, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13.
6. The CAR polypeptide of claim 1, wherein the T-cell intracellular signaling domain is the intracellular signaling domain of CD3 or CD3.
7. The CAR polypeptide of claim 1, wherein the target-binding sequence comprises a ligand of the target or an antibody reagent that specifically binds the target.
8. The CAR polypeptide of claim 1, wherein the target is B cell maturation antigen (BCMA).
9. The CAR polypeptide of claim 1, wherein the target is CD37.
10. The CAR polypeptide of claim 1, wherein the antibody reagent comprises an scFv.
11. The CAR polypeptide of claim 1, wherein the antibody reagent has the sequence selected from SEQ ID NO: 1, 5, or 9.
12. A chimeric antigen receptor (CAR) polypeptide comprising: a) an extracellular domain comprising a BCMA-binding sequence; b) a transmembrane domain of CD8; c) a co-stimulatory domain of a 4-1BB; and d) a T cell intracellular signaling domain that lacks a functional ITAM3 sequence.
13. The CAR polypeptide of claim 12, wherein the BCMA-binding sequence comprises a ligand of BCMA or an antibody reagent that specifically binds BCMA.
14. The CAR polypeptide of claim 12, wherein the antibody reagent comprises a scFv.
15. The CAR polypeptide of claim 12, wherein the antibody reagent the sequence of SEQ ID NO: 1
16. The CAR polypeptide of claim 12, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34.
17. The CAR polypeptide of claim 12, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13.
18. A chimeric antigen receptor (CAR) polypeptide comprising: a) an extracellular domain comprising a CD37-binding sequence; b) a transmembrane domain of CD8; c) a co-stimulatory domain of a 4-1BB; and d) a T cell intracellular signaling domain that lacks a functional ITAM3 sequence.
19. The CAR polypeptide of claim 18, wherein the CD37-binding sequence comprises a ligand of CD37 or an antibody reagent that specifically binds BCMA.
20. The CAR polypeptide of claim 18, wherein the antibody reagent comprises a scFv.
21. The CAR polypeptide of claim 18, wherein the scFv has a sequence selected from SEQ ID NO: 5 or 9.
22. The CAR polypeptide of claim 18, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34.
23. The CAR polypeptide of claim 18, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13.
24. A mammalian cell comprising: a) the CAR polypeptide of claim 1; or b) a nucleic acid encoding any of the CAR polypeptides of claim 1.
25. The cell of claim 24, wherein the cell is a T cell.
26. The cell of claim 24, wherein the cell is a human cell.
27. The cell of claim 24, wherein the cell is obtained from an individual having or diagnosed as having cancer, a plasma cell disorder, or autoimmune disease.
28. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: a) engineering a T cell to comprise a CAR polypeptide of claim 1 on the T cell surface; b) administering the engineered T cell to the subject.
29. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: a) administering the cell of claim 24 to the subject.
30. The method of claim 29, wherein the cancer is a CD37+ or BCMA+ cancer.
31. The method of claim 29, wherein the CD37+ cancer is lymphoma or leukemia.
32. The method of claim 31, wherein the lymphoma is B-cell Non-Hodgkin Lymphoma (NHL), mantle cell lymphoma, Burkitt's lymphoma, B cell lymphoblastic lymphoma or T cell lymphoma.
33. The method of claim 32, wherein the T cell lymphoma is peripheral T cell lymphoma (PTCL).
34. The method of claim 33, wherein the PTCL is cutaneous T-cell lymphoma (CTCL) or anaplastic large cell lymphoma (ALCL).
35. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: a) engineering a T cell to comprise a CAR polypeptide of claim 18 on the T cell surface; b) administering the engineered T cell to the subject; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
36. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising administering a cell of any of claim 24 to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
37. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: a) selecting a subject who is non-responsive to anti-CD19 and/or anti-CD20 therapy; b) engineering a T cell to comprise a CAR polypeptide of claim 18 on the T cell surface; c) administering the engineered T cell to the subject; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
38. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: a) selecting a subject who is non-responsive to anti-CD19 and/or anti-CD20 therapy; b) administering a cell of claim 24 to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
39. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: a) engineering a T cell to comprise a CAR polypeptide of claim 18 on the T cell surface; b) administering the engineered T cell to the subject; wherein the subject is concurrently administered an anti-CD19 and/or anti-CD20 therapy.
40. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising administering a cell of claim 24 to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; wherein the subject is concurrently administered an anti-CD19 and/or anti-CD20 therapy.
41. A composition comprising the CAR polypeptide of claim 1 formulated for the treatment of cancer.
42. The composition of claim 41, further comprising a pharmaceutically acceptable carrier.
43. The method of claim 31, wherein the leukemia is acute myeloid leukemia (AML).
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0071]
[0072]
[0073]
[0074]
[0075]
[0076]
[0077]
[0078]
[0079]
[0080]
[0081]
[0082]
[0083]
[0084]
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096]
[0097]
[0098]
[0099]
[0100]
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
[0121]
[0122]
[0123]
[0124]
[0125]
[0126]
[0127]
[0128]
[0129]
[0130]
[0131]
[0132]
[0133]
DETAILED DESCRIPTION
[0134] To date, CARs have generally included a full length CD3 signaling domain. CD3 is thought to mediate signal 1 in T cell activation. However, these signaling domains are phosphorylated upon T cell activation and have been associated with proliferation, cytokine secretion, cytotoxicity, and activation-induced cell death. As described herein, the present technology utilizes alternative signaling domains that decouple the cytotoxic signal from the activation-induced cell death signal mediated by engagement of the CAR and activation of CD3 zeta. This change, and others described herein, provide more potent CAR-alternative T cells compared to CAR-original T cells.
[0135] Embodiments of the technology described herein relate to the discovery that including an alternative signal 1 domain in a CAR construct results in a more efficient CAR T cell. CAR T cells with alternative signal 1 domains exhibit a higher capacity for treating disease, for example, cancer, compared to CAR T cells that utilize the original signal 1 domain.
[0136] Accordingly, one aspect of the technology described herein relates to a CAR polypeptide comprising: an extracellular domain comprising a target-binding sequence; a transmembrane domain (including, for example, a transmembrane domain of a co-stimulatory ligand); and a T cell intracellular signaling domain that lacks a functional ITAM3 sequence.
[0137] Another aspect of the technology described herein relates to a CAR polypeptide comprising: an extracellular domain comprising a BCMA-binding sequence; a transmembrane domain comprising the transmembrane domain of CD8 or 4-1BB; and an intracellular domain comprising a T-cell signaling domain.
[0138] Another aspect of the technology described herein relates to a CAR polypeptide comprising: an extracellular domain comprising a CD37-binding sequence; a transmembrane domain comprising the transmembrane domain of CD8 or 4-1BB; and an intracellular domain comprising a T-cell signaling domain.
[0139] Considerations necessary to make and use these and other aspects of the technology are described in the following.
[0140] Chimeric Antigen Receptors
[0141] The technology described herein provides improved CARs for use in immunotherapy. The following discusses CARs and the various improvements.
[0142] It should be understood that while BCMA and CD37 are discussed herein as examples of CAR targets, they are just that: examples. The principles described herein with respect to improvements in CAR and therefore CAR T design can be applied to CARs that target any target or antigen, including any cell-surface target or antigen.
[0143] The terms chimeric antigen receptor or CAR or CARs as used herein refer to engineered T cell receptors, which graft a ligand or antigen specificity onto T cells (for example nave T cells, central memory T cells, effector memory T cells or combinations thereof). CARs are also known as artificial T-cell receptors, chimeric T-cell receptors or chimeric immunoreceptors.
[0144] A CAR places a chimeric extracellular target-binding domain that specifically binds a target, e.g., a polypeptide, expressed on the surface of a cell to be targeted for a T cell response onto a construct including a transmembrane domain and intracellular domain(s) of a T cell receptor molecule. In one embodiment, the chimeric extracellular target-binding domain comprises the antigen-binding domain(s) of an antibody that specifically binds an antigen expressed on a cell to be targeted for a T cell response. The properties of the intracellular signaling domain(s) of the CAR can vary as known in the art and as disclosed herein, but the chimeric target/antigen-binding domains(s) render the receptor sensitive to signaling activation when the chimeric target/antigen binding domain binds the target/antigen on the surface of a targeted cell.
[0145] With respect to intracellular signaling domains, so-called first-generation CARs include those that solely provide CD3zeta (CD3) signals upon antigen binding. So-called second-generation CARs include those that provide both co-stimulation (e.g., CD28 or CD 137) and activation (CD3) domains, and so-called third-generation CARs include those that provide multiple costimulatory (e.g., CD28 and CD 137) domains and activation domains (e.g., CD3). In various embodiments, the CAR is selected to have high affinity or avidity for the target/antigenfor example, antibody-derived target or antigen binding domains will generally have higher affinity and/or avidity for the target antigen than would a naturally-occurring T cell receptor. This property, combined with the high specificity one can select for an antibody provides highly specific T cell targeting by CAR T cells.
[0146] As used herein, a CAR T cell or CAR-T refers to a T cell which expresses a CAR. When expressed in a T cell, CARs have the ability to redirect T-cell specificity and reactivity toward a selected target in a non-MHC-restricted manner, exploiting the antigen-binding properties of monoclonal antibodies. The non-MHC-restricted antigen recognition gives T-cells expressing CARs the ability to recognize an antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
[0147] As used herein, the term extracellular target binding domain refers to a polypeptide found on the outside of the cell which is sufficient to facilitate binding to a target. The extracellular target binding domain will specifically bind to its binding partner, i.e. the target. As non-limiting examples, the extracellular target-binding domain can include an antigen-binding domain of an antibody, or a ligand, which recognizes and binds with a cognate binding partner (for example, BCMA or CD37) protein. In this context, a ligand is a molecule which binds specifically to a portion of a protein and/or receptor. The cognate binding partner of a ligand useful in the methods and compositions described herein can generally be found on the surface of a cell. Ligand:cognate partner binding can result in the alteration of the ligand-bearing receptor, or activate a physiological response, for example, the activation of a signaling pathway. In one embodiment, the ligand can be non-native to the genome. Optionally, the ligand has a conserved function across at least two species. In one embodiment, the extracellular target binding domain comprises a non-antibody ligand (e.g., A PRoliferation-Inducing Ligand (APRIL)).
[0148] Antibody Reagents
[0149] In various embodiments, the CARs described herein comprise an antibody reagent or an antigen-binding domain thereof as an extracellular target-binding domain.
[0150] As used herein, the term antibody reagent refers to a polypeptide that includes at least one immunoglobulin variable domain or immunoglobulin variable domain sequence and which specifically binds a given antigen. An antibody reagent can comprise an antibody or a polypeptide comprising an antigen-binding domain of an antibody. In some embodiments of any of the aspects, an antibody reagent can comprise a monoclonal antibody or a polypeptide comprising an antigen-binding domain of a monoclonal antibody. For example, an antibody can include a heavy (H) chain variable region (abbreviated herein as V.sub.H), and a light (L) chain variable region (abbreviated herein as V.sub.L). In another example, an antibody includes two heavy (H) chain variable regions and two light (L) chain variable regions. The term antibody reagent encompasses antigen-binding fragments of antibodies (e.g., single chain antibodies, Fab and sFab fragments, F(ab)2, Fd fragments, Fv fragments, scFv, CDRs, and domain antibody (dAb) fragments (see, e.g. de Wildt et al., Eur J. Immunol. 1996; 26(3):629-39; which is incorporated by reference herein in its entirety)) as well as complete antibodies. An antibody can have the structural features of IgA, IgG, IgE, IgD, or IgM (as well as subtypes and combinations thereof). Antibodies can be from any source, including mouse, rabbit, pig, rat, and primate (human and non-human primate) and primatized antibodies. Antibodies also include midibodies, humanized antibodies, chimeric antibodies, and the like. Fully human antibody binding domains can be selected, for example, from phage display libraries using methods known to those of ordinary skill in the art.
[0151] The V.sub.H and V.sub.L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR). The extent of the framework region and CDRs has been precisely defined (see, Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242, and Chothia, C. et al. (1987) J. Mol. Biol. 196:901-917; which are incorporated by reference herein in their entireties). Each V.sub.H and V.sub.L is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
[0152] In one embodiment, the antibody or antibody reagent is not a human antibody or antibody reagent, (i.e., the antibody or antibody reagent is mouse), but has been humanized. A humanized antibody or antibody reagent refers to a non-human antibody or antibody reagent that has been modified at the protein sequence level to increase its similarity to antibody or antibody reagent variants produced naturally in humans. One approach to humanizing antibodies employs the grafting of murine or other non-human CDRs onto human antibody frameworks.
[0153] In one embodiment, a CAR's extracellular target binding domain comprises or consists essentially of a single-chain Fv (scFv) fragment created by fusing the V.sub.H and V.sub.L domains of an antibody, generally a monoclonal antibody, via a flexible linker peptide. In various embodiments, the scFv is fused to a transmembrane domain and to a T cell receptor intracellular signaling domain, e.g., an engineered intracellular signaling domain as described herein.
[0154] Antibody binding domains and ways to select and clone them are well known to those of ordinary skill in the art. In another embodiment, the antibody reagent is an anti-CD37 antibody reagent and has the sequence selected from SEQ ID NO: 5 or 9. In one embodiment, the anti-OTK3 antibody reagent corresponds to the sequence of SEQ ID NO: 5 or 9; or comprises the sequence of SEQ ID NO: 5 or 9; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NO: 5 or 9.
[0155] In another embodiment, the antibody reagent is an anti-BCMA antibody reagent and has the sequence of SEQ ID NO: 1. In one embodiment, the anti-CD28 antibody corresponds to the sequence of SEQ ID NO: 1; or comprises the sequence of SEQ ID NO: 1; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NO: 1.
[0156] In one embodiment, the CARs useful in the technology described herein comprise at least two antigen-specific targeting regions, an extracellular domain, a transmembrane domain, and an intracellular signaling domain. In such embodiments, the two or more antigen-specific targeting regions target at least two different antigens and may be arranged in tandem and separated by linker sequences. In another embodiment, the CAR is a bispecific CAR. A bispecific CAR is specific to two different antigens.
[0157] Target/Antigen
[0158] Any cell-surface moiety can be targeted by a CAR. Most often, the target will be a cell-surface polypeptide differentially or preferentially expressed on a cell one wishes to target for a T cell response. In this regard, tumor antigens or tumor-associated antigens provide attractive targets, providing a means to target tumor cells while avoiding or at least limiting collateral damage to non-tumor cells or tissues. Non-limiting examples of tumor antigens or tumor-associated antigens include CEA, Immature laminin receptor, TAG-72, HPV E6 and E7, BING-4, Calcium-activated chloride channel 2, Cyclin B 1, 9D7, Ep-CAM, EphA3, Her2/neu, Telomerase, Mesotheliun, SAP-1, Survivin, BAGE family, CAGE family, GAGE family, MAGE family, SAGE family, XAGE family, NY-ESO-1/LAGE-1, PRAME, SSX-2, Melan-A/MART-1, Gp100/pme117, Tyrosinase, TRP-1/-2, MC1R, BRCA1/2, CDK4, MART-2, p53, Ras, MUC1, and TGF-RII.
[0159] In one embodiment, the target is B cell maturation antigen (BCMA), also known as tumor necrosis factor receptor superfamily member 17 (TNFRSF17). BCMA is a cell surface receptor expressed preferentially on mature B lymphocytes that specifically recognizes B cell activating factor (BAFF). BCMA sequences are known for a number of species, e.g., human BCMA (NCBI Gene ID: 608) polypeptide (e.g., NCBI Ref Seq NP_001183.2) and mRNA (e.g., NCBI Ref Seq NM_001192.2). BCMA can refer to human BCMA, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, BCMA can refer to the BCMA of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human BCMA are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference BCMA sequence.
[0160] In one embodiment, the BCMA-binding sequence comprises a ligand of BCMA or an antibody reagent that specifically binds BCMA. In one embodiment, the antibody reagent that specifically binds BCMA is a scFv from a humanized anti-BCMA m murine antibody. The orientation of a humanized murine antibody-derived single-chain variable fragment can be V.sub.L-V.sub.H or V.sub.H-V.sub.L.
[0161] In one embodiment, the target is CD37. CD37 is cell surface protein that contains four hydrophobic transmembrane domains. CD37 is expressed exclusively on immune cells; CD37 is highly expressed on mature B cells, and moderately expressed on T cells and myeloid cells. CD37 sequences are known for a number of species, e.g., human CD37 (NCBI Gene ID: 951) polypeptide (e.g., NCBI Ref Seq NP_001035120.1) and mRNA (e.g., NCBI Ref Seq NM_001040031.1). CD37 can refer to human CD37, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, CD37 can refer to the CD37 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CD37 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD37 sequence.
[0162] In one embodiment, the CD37-binding sequence comprises a ligand of CD37 or an antibody reagent that specifically binds CD37.
[0163] Transmembrane Domain
[0164] Each CAR as described herein necessarily includes a transmembrane domain that joins the extracellular target-binding domain to the intracellular signaling domain.
[0165] As used herein, transmembrane domain (TM domain) refers to the generally hydrophobic region of the CAR which crosses the plasma membrane of a cell. The TM domain can be the transmembrane region or fragment thereof of a transmembrane protein (for example a Type I transmembrane protein or other transmembrane protein), an artificial hydrophobic sequence, or a combination thereof. While specific examples are provided herein and used in the Examples, other transmembrane domains will be apparent to those of skill in the art and can be used in connection with alternate embodiments of the technology. A selected transmembrane region or fragment thereof would preferably not interfere with the intended function of the CAR. As used in relation to a transmembrane domain of a protein or polypeptide, fragment thereof refers to a portion of a transmembrane domain that is sufficient to anchor or attach a protein to a cell surface.
[0166] In one embodiment, a CAR's transmembrane domain or fragment thereof is derived from or comprises the transmembrane domain of CD8. In an alternate embodiment, the transmembrane domain or fragment thereof of the CAR described herein comprises a transmembrane domain selected from the transmembrane domain of an alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, KIRDS2, OX40, CD2, CD27, LFA-1 (CD1 la, CD18), ICOS (CD278), 4-1BB (CD137), GITR, CD40, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, IL2R beta, IL2R gamma, IL7R a, ITGA1, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD1 ld, ITGAE, CD103, ITGAL, CD1 la, LFA-1, ITGAM, CD1 lb, ITGAX, CD1 lc, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, DNAM1(CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRT AM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, and/or NKG2C. CD8 is an antigen preferentially found on the cell surface of cytotoxic T lymphocytes. CD8 mediates cell-cell interactions within the immune system, and acts as a T cell coreceptor. CD8 consists of an alpha (CD8a) and beta (CD8(3) chain. CD8a sequences are known for a number of species, e.g., human CD8a, (NCBI Gene ID: 925) polypeptide (e.g., NCBI Ref Seq NP_001139345.1) and mRNA (e.g., NCBI Ref Seq NM_000002.12). CD8 can refer to human CD8, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, CD8 can refer to the CD8 of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human CD8 are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference CD8 sequence.
[0167] Co-Stimulatory Domain
[0168] Each CAR described herein comprises an intracellular domain of a co-stimulatory molecule, or co-stimulatory domain. As used herein, the term co-stimulatory domain refers to an intracellular signaling domain of a co-stimulatory molecule. Co-stimulatory molecules are cell surface molecules other than antigen receptors or Fc receptors that provide a second signal required for efficient activation and function of T lymphocytes upon binding to antigen. Illustrative examples of such co-stimulatory molecules include CARD11, CD2, CD7, CD27, CD28, CD30, CD40, CD54 (ICAM), CD83, CD134 (OX40), CD137 (4-1BB), CD150 (SLAMF1), CD152 (CTLA4), CD223 (LAG3), CD270 (HVEM), CD273 (PD-L2), CD274 (PD-L1), CD278 (ICOS), DAP10, LAT, NKD2C SLP76, TRIM, and ZAP70. In one embodiment, the intracellular domain is the intracellular domain of 4-1BB.
[0169] 4-1BBL is a type 2 transmembrane glycoprotein belonging to the TNF superfamily. 4-1BBL is expressed on activated T lymphocytes. 4-1BBL sequences are known for a number of species, e.g., human 4-1BBL, also known as TNFSF9 (NCBI Gene ID: 8744) polypeptide (e.g., NCBI Ref Seq NP_003802.1) and mRNA (e.g., NCBI Ref Seq NM_003811.3). 4-1BBL can refer to human 4-1BBL, including naturally occurring variants, molecules, and alleles thereof. In some embodiments of any of the aspects, e.g., in veterinary applications, 4-1BBL can refer to the 4-1BBL of, e.g., dog, cat, cow, horse, pig, and the like. Homologs and/or orthologs of human 4-1BBL are readily identified for such species by one of skill in the art, e.g., using the NCBI ortholog search function or searching available sequence data for a given species for sequence similar to a reference 4-1BBL sequence.
[0170] Intracellular Signaling Domain
[0171] CARs as described herein comprise an intracellular signaling domain. An intracellular signaling domain, refers to the part of a CAR polypeptide that participates in transducing the message of effective CAR binding to a target antigen into the interior of the immune effector cell to elicit effector cell function, e.g., activation, cytokine production, proliferation and cytotoxic activity, including the release of cytotoxic factors to the CAR-bound target cell, or other cellular responses elicited following antigen binding to the extracellular CAR domain.
[0172] CD3 is a T cell co-receptor that facilitates T lymphocytes activation when simultaneously engaged with the appropriate co-stimulation (e.g., binding of a co-stimulatory molecule). A CD3 complex consists of 4 distinct chains; mammal CD3 consists of a CD3 chain, a CD3 chain, and two CD3 chains. These chains associate with a molecule known as the T cell receptor (TCR) and the CD3 to generate an activation signal in T lymphocytes. A complete TCR complex comprises a TCR, CD3, and the complete CD3 complex.
[0173] In some embodiments of any aspect, a CAR polypeptide described herein comprises an intracellular signaling domain that comprises an Immunoreceptor Tyrosine-based Activation Motif or ITAM from CD3 zeta (CD3). In some embodiments of any aspect, the ITAM comprises three motifs of ITAM of CD3 (ITAM3). In some embodiments of any aspect, the three motifs of ITAM of CD3 are mutated.
[0174] ITAMs are known as a primary signaling domains which regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary signaling domains that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Non-limiting examples of ITAM-containing intracellular signaling domains that are of particular use in the technology include those derived from TCR, FcR, FcR, CD3, CD3, CD3, CD3, CD3, CD22, CD79a, CD79b, and CD66d.
[0175] One skilled in the art will be capable of introducing mutations into the nucleic acid sequence of a gene or gene product, for example an ITAM, using standard techniques. For example, point mutations can be introduced via site-directed point mutagenesis, a PCR technique. Site-directed mutagenesis kits are commercially available, for instance, through New England Biolabs; Ipswich, Mass. Non-limiting examples of alternative methods to introduce point mutations to the nucleic acid sequence of a gene or gene product include cassette mutagenesis or whole plasmid mutagenesis.
[0176] In one embodiment, the ITAM utilized in the CAR is based on alternatives to CD3, including mutated ITAMs from CD3 (which contains 3 ITAM motifs), truncations of CD3, and alternative splice variants known as CD3, CD3, and artificial constructs engineered to express fusions between CD3 or CD3 and CD3.
[0177] In one embodiment, the CD3 ITAM3 sequence corresponds to the sequence of SEQ ID NO: 13; or comprises the sequence of SEQ ID NO: 13; or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity to the sequence of SEQ ID NO: 13.
[0178] In one embodiment, the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34. In one embodiment, the tyrosine residues are mutated to phenylalanine residues, thereby inhibiting the phosphorylation of the native tyrosine residues. Exemplary tyrosine residues that can be mutated include any tyrosine residue described in Examples 9 or 10. It is contemplated that the tyrosine residues can be mutated to any residue that results in the inhibition of tyrosine phosphorylation. In another embodiment of any aspect, tyrosines are mutated in at least one, at least two, or all three ITAMs (e.g., ITAM I, II, and III).
[0179] In one embodiment, the T-cell intracellular signaling domain comprises the ITAMs of CD3 eta (CD3), CD3 theta (CD3) or CD3. In one embodiment, the T-cell intracellular signaling domain is the ITAM of CD3 eta (CD3), CD3 theta (CD3) or CD3.
[0180] In one embodiment, the intracellular signaling domain comprises an CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13.
[0181] A deletion relative to the CD3 ITAM3 sequence can be performed using techniques well known in the art, for example, CRISPR, TALEN or ZFN technology. Methods of engineering nucleases to achieve a desired sequence specificity are known in the art and are described, e.g., in Kim (2014); Kim (2012); Belhaj et al. (2013); Urnov et al. (2010); Bogdanove et al. (2011); Jinek et al. (2012) Silva et al. (2011); Ran et al. (2013); Carlson et al. (2012); Guerts et al. (2009); Taksu et al. (2010); and Watanabe et al. (2012); each of which is incorporated by reference herein in its entirety. In alternate embodiments of any aspect, a deletion relative to the ITAM3 sequence can be done via inhibitory nucleic acid. As used herein, inhibitory nucleic acid refers to a nucleic acid molecule which can inhibit the expression of a target, e.g., double-stranded RNAs (dsRNAs), inhibitory RNAs (iRNAs), and the like. Inhibitory nucleic acid technology is more fully described in Wilson, R C, and Doudna, J A. (2103) Annual Review of Biophysics 42(217-239) and reference cited therein.
[0182] Experimental data provided herein show that variants of the intracellular signaling domain described herein results in a more efficient CAR T cell. It is expected that replacing the intracellular signaling domain of any CAR T cell with any intracellular signaling domain variant described herein would improve the efficacy of the CAR T cell.
[0183] A more detailed description of CARs and CAR T cells can be found in Maus et al. Blood 2014 123:2624-35; Reardon et al. Neuro-Oncology 2014 16:1441-1458; Hoyos et al. Haematologica 2012 97:1622; Byrd et al. J Clin Oncol 2014 32:3039-47; Maher et al. Cancer Res 2009 69:4559-4562; and Tamada et al. Clin Cancer Res 2012 18:6436-6445; each of which is incorporated by reference herein in its entirety.
[0184] In one embodiment, the CAR further comprises a linker domain. As used herein linker domain refers to an oligo- or polypeptide region from about 2 to 100 amino acids in length, which links together any of the domains/regions of the CAR as described herein. In some embodiment, linkers can include or be composed of flexible residues such as glycine and serine so that the adjacent protein domains are free to move relative to one another. Longer linkers may be used when it is desirable to ensure that two adjacent domains do not sterically interfere with one another. Linkers may be cleavable or non-cleavable. Examples of cleavable linkers include 2A linkers (for example T2A), 2A-like linkers or functional equivalents thereof and combinations thereof. In one embodiment, the linker region is T2A derived from Thosea asigna virus. Non-limiting examples of linkers that can be used in this technology include P2A and F2A.
[0185] In one embodiment, a CAR as described herein further comprises a reporter molecule, e.g., to permit for non-invasive imaging (e.g., positron-emission tomography PET scan). In a bispecific CAR that includes a reporter molecule, the first extracellular binding domain and the second extracellular binding domain can include different or the same reporter molecule. In a bispecific CAR T cell, the first CAR and the second CAR can express different or the same reporter molecule. In another embodiment, a CAR as described herein further comprises a reporter molecule (for example hygromycin phosphotransferase (hph)) that can be imaged alone or in combination with a substrate or chemical (for example 9-[4-[.sup.18F]fluoro-3-(hydroxymethyl)butyl]guanine ([.sup.18F]FHBG)). In another embodiment, a CAR as described herein further comprises nanoparticles at can be readily imaged using non-invasive techniques (e.g., gold nanoparticles (GNP) functionalized with .sup.64Cu.sup.2+). Labeling of CAR T cells for non-invasive imaging is reviewed, for example in Bhatnagar P, et al. Integr Biol. (Camb). 2013 January; 5(1): 231-238, and Keu K V, et al. Sdci Transl Med. 2017 Jan. 18; 9(373), which are incorporated herein by reference in their entireties.
[0186] GFP and mCherry are demonstrated herein as fluorescent tags useful for imaging a CAR expressed on a T cell (e.g., a CAR T cell). It is expected that essentially any fluorescent protein known in the art can be used as a fluorescent tag for this purpose. For clinical applications, the CAR need not include a fluorescent tag or fluorescent protein.
[0187] In one embodiment, the CAR polypeptide comprises a BCMA binding domain, CD8 transmembrane domain, 4-1 BB costimulatory domain, a CD3 signaling domain, a T2A linker, and an mCherry protein. In another embodiment, the CD3 domain can be replaced with CD3, CD3, and/or other ITAM-containing variants of CD3-related signaling domains.
[0188] In one embodiment, the CAR polypeptide sequence corresponds to, or comprises, or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity of a sequence selected from SEQ ID NO: 15 or 35-40.
[0189] In one embodiment, the CAR polypeptide comprises a CD37 binding domain, CD8 transmembrane domain, 4-1 BB co-stimulatory domain, a CD3 signaling domain, a T2A linker, and an mCherry protein. In another embodiment, the CD3 domain can be replaced with CD3, CD3, and/or other ITAM-containing variants of CD3-related signaling domains.
[0190] In one embodiment, the CAR polypeptide sequence corresponds to, or comprises, or comprises a sequence with at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or greater sequence identity of a sequence selected from SEQ ID NO: 21 or 27.
[0191] One aspect of the technology described herein relates to a mammalian cell comprising any of the CAR polypeptides described herein; or a nucleic acid encoding any of the CAR polypeptides described herein. In one embodiment, the mammalian cell comprises an antibody, antibody reagent, antigen-binding portion thereof, or any of the CARs described herein, or a nucleic acid encoding such an antibody, antibody reagent, antigen-binding portion thereof, or any of the CARs described herein. The mammalian cell or tissue can be of human, primate, hamster, rabbit, rodent, cow, pig, sheep, horse, goat, dog or cat origin, but any other mammalian cell may be used. In a preferred embodiment of any aspect, the mammalian cell is human.
[0192] In one embodiment, the cell is a T cell. In alternate embodiments of any aspect, the cell is an immune cell. As used herein, immune cell refers to a cell that plays a role in the immune response. Immune cells are of hematopoietic origin, and include lymphocytes, such as B cells and T cells; natural killer cells; myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes. In some embodiments, the cell is a T cell; a NK cell; a NKT cell; lymphocytes, such as B cells and T cells; and myeloid cells, such as monocytes, macrophages, eosinophils, mast cells, basophils, and granulocytes.
[0193] In one embodiment, the cell is obtained from an individual having or diagnosed as having cancer, a plasma cell disorder, or autoimmune disease.
[0194] Cancer as used herein can refer to a hyperproliferation of cells whose unique traitloss of normal cellular controlresults in unregulated growth, lack of differentiation, local tissue invasion, and metastasis, and can be leukemia, lymphoma, multiple myeloma, or a solid tumor. Non-limiting examples of leukemia include acute myeloid leukemia (AML), Chronic myeloid leukemia (CML), Acute lymphocytic leukemia (ALL), and Chronic lymphocytic leukemia (CLL). In one embodiment, the cancer is ALL or CLL. Non-limiting examples of lymphoma include Diffuse large B-cell lymphoma (DLBCL), Follicular lymphoma, Chronic lymphocytic leukemia (CLL), Small lymphocytic lymphoma (SLL), Mantle cell lymphoma (MCL), Marginal zone lymphomas, Burkitt lymphoma, hairy cell leukemia (HCL), and T cell lymphoma (e.g., peripheral T cell lymphoma (PTCL), including cutaneous T cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL)). In one embodiment, the cancer is DLBCL or Follicular lymphoma. Non-limiting examples of solid tumors include Adrenocortical Tumor, Alveolar Soft Part Sarcoma, Carcinoma, Chondrosarcoma, Colorectal Carcinoma, Desmoid Tumors, Desmoplastic Small Round Cell Tumor, Endocrine Tumors, Endodermal Sinus Tumor, Epithelioid Hemangioendothelioma, Ewing Sarcoma, Germ Cell Tumors (Solid Tumor), Giant Cell Tumor of Bone and Soft Tissue, Hepatoblastoma, Hepatocellular Carcinoma, Melanoma, Nephroma, Neuroblastoma, Non-Rhabdomyosarcoma Soft Tissue Sarcoma (NRSTS), Osteosarcoma, Paraspinal Sarcoma, Renal Cell Carcinoma, Retinoblastoma, Rhabdomyosarcoma, Synovial Sarcoma, and Wilms Tumor. Solid tumors can be found in bones, muscles, or organs, and can be sarcomas or carcinomas. It is contemplated that any aspect of the technology described herein can be used to treat all types of cancers, including cancers not listed in the instant application. As used herein, the term tumor refers to an abnormal growth of cells or tissues, e.g., of malignant type or benign type.
[0195] As used herein, an autoimmune disease or disorder is characterized by the inability of one's immune system to distinguish between a foreign cell and a healthy cell. This results in one's immune system targeting one's healthy cells for programmed cell death. Non-limiting examples of an autoimmune disease or disorder include inflammatory arthritis, type 1 diabetes mellitus, multiples sclerosis, psoriasis, inflammatory bowel diseases, SLE, and vasculitis, allergic inflammation, such as allergic asthma, atopic dermatitis, and contact hypersensitivity. Other examples of auto-immune-related disease or disorder, but should not be construed to be limited to, include rheumatoid arthritis, multiple sclerosis (MS), systemic lupus erythematosus, Graves' disease (overactive thyroid), Hashimoto's thyroiditis (underactive thyroid), celiac disease, Crohn's disease and ulcerative colitis, Guillain-Barre syndrome, primary biliary sclerosis/cirrhosis, sclerosing cholangitis, autoimmune hepatitis, Raynaud's phenomenon, scleroderma, Sjogren's syndrome, Goodpasture's syndrome, Wegener's granulomatosis, polymyalgia rheumatica, temporal arteritis/giant cell arteritis, chronic fatigue syndrome CFS), psoriasis, autoimmune Addison's Disease, ankylosing spondylitis, Acute disseminated encephalomyelitis, antiphospholipid antibody syndrome, aplastic anemia, idiopathic thrombocytopenic purpura, Myasthenia gravis, opsoclonus myoclonus syndrome, optic neuritis, Ord's thyroiditis, pemphigus, pernicious anaemia, polyarthritis in dogs, Reiter's syndrome, Takayasu's arteritis, warm autoimmune hemolytic anemia, Wegener's granulomatosis and fibromyalgia (FM).
[0196] In one embodiment, the mammalian cell is obtained for a patient having an immune system disorder that results in abnormally low activity of the immune system, or immune deficiency disorders, which hinders one's ability to fight a foreign cell, (i.e., a virus or bacterial cell).
[0197] A plasma cell is a white blood cell produces from B lymphocytes which function to generate and release antibodies needed to fight infections. As used herein, a plasma cell disorder or disease is characterized by abnormal multiplication of a plasma cell. Abnormal plasma cells are capable of crowding out healthy plasma cells, which results in a decreased capacity to fight a foreign object, such as a virus or bacterial cell. Non-limiting examples of plasma cell disorders include amyloidosis, Waldenstrom's macroglobulinemia, osteosclerotic myeloma (POEMS syndrome), Monoclonal gammopathy of unknown significance (MGUS), and plasma cell myeloma.
[0198] T cells can be obtained from a subject using standard techniques known in the field. For example, T cells can be isolated from peripheral blood taken from a donor or patient. T cells can be isolated from a mammal. Preferably, T cells are isolated from a human.
[0199] A cell, for example a T cell, can be engineered to comprise any of the CAR polypeptides described herein; or a nucleic acid encoding any of the CAR polypeptides described herein. In one embodiment, the any of the CAR polypeptides described herein are comprised in a lentiviral vector. The lentiviral vector is used to express the CAR polypeptide in a cell using infection standard techniques.
[0200] Retroviruses, such as lentiviruses, provide a convenient platform for delivery of nucleic acid sequences encoding a gene, or chimeric gene of interest. A selected nucleic acid sequence can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells, e.g. in vitro or ex vivo. Retroviral systems are well known in the art and are described in, for example, U.S. Pat. No. 5,219,740; Kurth and Bannert (2010) Retroviruses: Molecular Biology, Genomics and Pathogenesis Calster Academic Press (ISBN:978-1-90455-55-4); and Hu and Pathak Pharmacological Reviews 2000 52:493-512; which are incorporated by reference herein in their entirety. Lentiviral system for efficient DNA delivery can be purchased from OriGene; Rockville, Md. In alternative embodiments, the CAR polypeptide of any of the CARS described herein are expressed in the mammalian cell via transfection or electroporation of an expression vector comprising nucleic acid encoding the CAR. Transfection or electroporation methods are known in the art.
[0201] Efficient expression of the CAR polypeptide of any of the CAR polypeptides described herein can be assessed using standard assays that detect the mRNA, DNA, or gene product of the nucleic acid encoding the CAR. For example, RT-PCR, FACS, northern blotting, western blotting, ELISA, or immunohistochemistry.
[0202] In one embodiment, the CAR polypeptide described herein is constitutively expressed. In one embodiment, the CAR polypeptide described herein is encoded by recombinant nucleic acid sequence.
[0203] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: engineering a T cell to comprise any of the CAR polypeptides described herein on the T cell surface; and administering the engineered T cell to the subject.
[0204] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: administering the cell of any of the mammalian cells comprising the any of the CAR polypeptides described herein.
[0205] Cluster differentiation (CD) molecules are cell surface markers present on leukocytes. As a leukocyte differentiates and matures its CD profile changes. In the case that a leukocytes turns into a cancer cell, (i.e., a lymphoma), its CD profile is important in diagnosing the disease. The treatment and prognosis of certain types of cancers is reliant on determining the CD profile of the cancer cell. CDX+, wherein X is a CD marker, indicates the CD marker is present in the cancer cell, while CDX indicates the marker is not present. One skilled in the art will be capable of assessing the CD molecules present on a cancer cell using standard techniques, for example using immunofluorescence to detect commercially available antibodies bound to the CD molecules.
[0206] In one embodiment, the cancer expresses a CD and tumor antigen. In one embodiment, the cancer is a CD37+ or BCMA+ cancer. In one embodiment, the CD37+ cancer is lymphoma or leukemia. In one embodiment, lymphoma is B-cell Non-Hodgkin Lymphoma (NHL), mantle cell lymphoma, Burkitt's lymphoma, B cell lymphoblastic lymphoma or T cell lymphoma (e.g., peripheral T cell lymphoma (PTCL), including cutaneous T-cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL)).
[0207] One aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: engineering a T cell to comprise any of the CAR polypeptides described herein on the T cell surface; administering the engineered T cell to the subject; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
[0208] Cancer cells can evolve in response to treatment to alter its CD profile in order to evade said treatment. For example, a patient with CD19+ leukemia can be treated with an anti-CD19 therapy. Following treatment, the cancer cell can relapse, or come back after treatment, and no longer express the CD19 marker, resulting in CD19 leukemia. This cancer cell will no longer be targetable by an anti-CD19 therapy. In one embodiment, the subject is non-responsive, or refractory to anti-CD19 and/or anti-CD20 therapy. In one embodiment, the subject has a cancer that is CD19 and/or CD20. In one embodiment, the subject has a cancer that is relapsed and no longer expresses CD19 or CD20.
[0209] Another aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising administering any of the mammalian cells comprising the any of the CAR polypeptides described herein to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
[0210] Another aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: selecting a subject who is non-responsive to anti-CD19 and/or anti-CD20 therapy; engineering a T cell to comprise any of the CAR polypeptides described herein on the T cell surface; administering the engineered CAR T cell to the subject; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
[0211] Another aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: selecting a subject who is non-responsive to anti-CD19 and/or anti-CD20 therapy; administering any of the mammalian cells comprising the any of the CAR polypeptides described herein to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy.
[0212] Another aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: engineering a T cell to comprise any of the CAR polypeptides described herein on the T cell surface; administering the engineered CAR T cell to the subject; wherein the subject is concurrently administered an anti-CD19 and/or anti-CD20 therapy.
[0213] Another aspect of the technology described herein relates to a method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising administering any of the mammalian cells comprising the any of the CAR polypeptides described herein to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; wherein the subject is concurrently administered an anti-CD19 and/or anti-CD20 therapy.
[0214] In some embodiments of any of the aspect, the engineered CAR-T cell is stimulated and/or activated prior to administration to the subject.
[0215] Administration
[0216] In some embodiments, the methods described herein relate to treating a subject having or diagnosed as having cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder with a mammalian cell comprising any of the CAR polypeptides described herein, or a nucleic acid encoding any of the CAR polypeptides described herein. As used herein, a CAR T cells as described herein refers to a mammalian cell comprising any of the CAR polypeptides described herein, or a nucleic acid encoding any of the CAR polypeptides described herein. As used herein, a condition refers to a cancer, a plasma cell disease or disorder, or an autoimmune disease or disorder. Subjects having a condition can be identified by a physician using current methods of diagnosing the condition. Symptoms and/or complications of the condition, which characterize these conditions and aid in diagnosis are well known in the art and include but are not limited to, fatigue, persistent infections, and persistent bleeding. Tests that may aid in a diagnosis of, e.g. the condition, but are not limited to, blood screening and bone marrow testing, and are known in the art for a given condition. A family history for a condition, or exposure to risk factors for a condition can also aid in determining if a subject is likely to have the condition or in making a diagnosis of the condition.
[0217] The compositions described herein can be administered to a subject having or diagnosed as having a condition. In some embodiments, the methods described herein comprise administering an effective amount of activated CAR T cells described herein to a subject in order to alleviate a symptom of the condition. As used herein, alleviating a symptom of the condition is ameliorating any condition or symptom associated with the condition. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. In one embodiment, the compositions described herein are administered systemically or locally. In a preferred embodiment, the compositions described herein are administered intravenously. In another embodiment, the compositions described herein are administered at the site of a tumor.
[0218] The term effective amount as used herein refers to the amount of activated CAR T cells needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of the cell preparation or composition to provide the desired effect. The term therapeutically effective amount therefore refers to an amount of activated CAR T cells that is sufficient to provide a particular anti-condition effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a condition), or reverse a symptom of the condition. Thus, it is not generally practicable to specify an exact effective amount. However, for any given case, an appropriate effective amount can be determined by one of ordinary skill in the art using only routine experimentation.
[0219] Effective amounts, toxicity, and therapeutic efficacy can be evaluated by standard pharmaceutical procedures in cell cultures or experimental animals. The dosage can vary depending upon the dosage form employed and the route of administration utilized. The dose ratio between toxic and therapeutic effects is the therapeutic index and can be expressed as the ratio LD50/ED50. Compositions and methods that exhibit large therapeutic indices are preferred. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i.e., the concentration of activated CAR T cells, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay, e.g., assay for bone marrow testing, among others. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.
[0220] In one aspect of the technology, the technology described herein relates to a pharmaceutical composition comprising activated CAR T cells as described herein, and optionally a pharmaceutically acceptable carrier. The active ingredients of the pharmaceutical composition at a minimum comprise activated CAR T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of activated CAR T cells as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of activated CAR T cells as described herein. Pharmaceutically acceptable carriers for cell-based therapeutic formulation include saline and aqueous buffer solutions, Ringer's solution, and serum component, such as serum albumin, HDL and LDL. The terms such as excipient, carrier, pharmaceutically acceptable carrier or the like are used interchangeably herein.
[0221] In some embodiments, the pharmaceutical composition comprising activated CAR T cells as described herein can be a parenteral dose form. Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, the components apart from the CAR T cells themselves are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions. Any of these can be added to the activated CAR T cells preparation prior to administration.
[0222] Suitable vehicles that can be used to provide parenteral dosage forms of activated CAR T cells as disclosed within are well known to those skilled in the art. Examples include, without limitation: saline solution; glucose solution; aqueous vehicles including but not limited to, sodium chloride injection, Ringer's injection, dextrose Injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water-miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
[0223] Dosage
[0224] Unit dosage form as the term is used herein refers to a dosage for suitable one administration. By way of example a unit dosage form can be an amount of therapeutic disposed in a delivery device, e.g., a syringe or intravenous drip bag. In one embodiment, a unit dosage form is administered in a single administration. In another, embodiment more than one unit dosage form can be administered simultaneously.
[0225] In some embodiments, the activated CAR T cells described herein are administered as a monotherapy, i.e., another treatment for the condition is not concurrently administered to the subject.
[0226] A pharmaceutical composition comprising the T cells described herein can generally be administered at a dosage of 10.sup.4 to 10.sup.9 cells/kg body weight, in some instances 10.sup.5 to 10.sup.6 cells/kg body weight, including all integer values within those ranges. If necessary, T cell compositions can also be administered multiple times at these dosages. The cells can be administered by using infusion techniques that are commonly known in immunotherapy (see, e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988).
[0227] In certain aspects, it may be desired to administer activated CAR T cells to a subject and then subsequently redraw blood (or have an apheresis performed), activate T cells therefrom as described herein, and reinfuse the patient with these activated and expanded T cells. This process can be carried out multiple times every few weeks. In certain aspects, T cells can be activated from blood draws of from 10 cc to 400 cc. In certain aspects, T cells are activated from blood draws of 20 cc, 30 cc, 40 cc, 50 cc, 60 cc, 70 cc, 80 cc, 90 cc, or 100 cc.
[0228] Modes of administration can include, for example intravenous (i.v.) injection or infusion. The compositions described herein can be administered to a patient transarterially, intratumorally, intranodally, or intramedullary. In some embodiments, the compositions of T cells may be injected directly into a tumor, lymph node, or site of infection. In one embodiment, the compositions described herein are administered into a body cavity or body fluid (e.g., ascites, pleural fluid, peritoneal fluid, or cerebrospinal fluid).
[0229] In a particular exemplary aspect, subjects may undergo leukapheresis, wherein leukocytes are collected, enriched, or depleted ex vivo to select and/or isolate the cells of interest, e.g., T cells. These T cell isolates can be expanded by contact with an aAPC as described herein, e.g., an aAPC expressing anti-CD28 and anti-CD3 CDRs as described herein and treated such that one or more CAR constructs of the technology may be introduced, thereby creating a CAR T cell. Subjects in need thereof can subsequently undergo standard treatment with high dose chemotherapy followed by peripheral blood stem cell transplantation. Following or concurrent with the transplant, subjects can receive an infusion of the expanded CAR T cells. In one embodiment, expanded cells are administered before or following surgery.
[0230] In some embodiments, lymphodepletion is performed on a subject prior to administering one or more CAR T cell as described herein. In such embodiments, the lymphodepletion can comprise administering one or more of melphalan, Cytoxan, cyclophosphamide, and fludarabine.
[0231] The dosage of the above treatments to be administered to a patient will vary with the precise nature of the condition being treated and the recipient of the treatment. The scaling of dosages for human administration can be performed according to art-accepted practices.
[0232] In some embodiments, a single treatment regimen is required. In others, administration of one or more subsequent doses or treatment regimens can be performed. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer. In some embodiments, no additional treatments are administered following the initial treatment.
[0233] The dosage of a composition as described herein can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment. With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and to determine whether to administer further cells, discontinue treatment, resume treatment, or make other alterations to the treatment regimen. The dosage should not be so large as to cause adverse side effects, such as cytokine release syndrome. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.
[0234] Combinational Therapy
[0235] The activated CAR T cells described herein can be used in combination with other known agents and therapies. In one embodiment, the subject is further administered an anti-BCMA therapy. In one embodiment, the subject is resistant to anti-BCMA therapies. Administered in combination, as used herein, means that two (or more) different treatments are delivered to the subject during the course of the subject's affliction with the disorder, e.g., the two or more treatments are delivered after the subject has been diagnosed with the disorder and before the disorder has been cured or eliminated or treatment has ceased for other reasons. In some embodiments, the delivery of one treatment is still occurring when the delivery of the second begins, so that there is overlap in terms of administration. This is sometimes referred to herein as simultaneous or concurrent delivery. In other embodiments, the delivery of one treatment ends before the delivery of the other treatment begins. In some embodiments of either case, the treatment is more effective because of combined administration. For example, the second treatment is more effective, e.g., an equivalent effect is seen with less of the second treatment, or the second treatment reduces symptoms to a greater extent, than would be seen if the second treatment were administered in the absence of the first treatment, or the analogous situation is seen with the first treatment. In some embodiments, delivery is such that the reduction in a symptom, or other parameter related to the disorder is greater than what would be observed with one treatment delivered in the absence of the other. The effect of the two treatments can be partially additive, wholly additive, or greater than additive. The delivery can be such that an effect of the first treatment delivered is still detectable when the second is delivered. The activated CAR T cells described herein and the at least one additional therapeutic agent can be administered simultaneously, in the same or in separate compositions, or sequentially. For sequential administration, the CAR-expressing cell described herein can be administered first, and the additional agent can be administered second, or the order of administration can be reversed. The CAR T therapy and/or other therapeutic agents, procedures or modalities can be administered during periods of active disorder, or during a period of remission or less active disease. The CAR T therapy can be administered before another treatment, concurrently with the treatment, post-treatment, or during remission of the disorder.
[0236] When administered in combination, the activated CAR T cells and the additional agent (e.g., second or third agent), or all, can be administered in an amount or dose that is higher, lower or the same as the amount or dosage of each agent used individually, e.g., as a monotherapy. In certain embodiments, the administered amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50%) than the amount or dosage of each agent used individually. In other embodiments, the amount or dosage of the activated CAR T cells, the additional agent (e.g., second or third agent), or all, that results in a desired effect (e.g., treatment of cancer) is lower (e.g., at least 20%, at least 30%, at least 40%, or at least 50% lower) than the amount or dosage of each agent individually required to achieve the same therapeutic effect. In further embodiments, the activated CAR T cells described herein can be used in a treatment regimen in combination with surgery, chemotherapy, radiation, an mTOR pathway inhibitor, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies or other antibody therapies, cytoxin, fludarabine, rapamycin, mycophenolic acid, steroids, FR901228, cytokines, or a peptide vaccine, such as that described in Izumoto et al. 2008 J Neurosurg 108:963-971.
[0237] In one embodiment, the activated CAR T cells described herein can be used in combination with a checkpoint inhibitor. Exemplary checkpoint inhibitors include anti-PD-1 inhibitors (Nivolumab, MK-3475, Pembrolizumab, Pidilizumab, AMP-224, AMP-514), anti-CTLA4 inhibitors (Ipilimumab and Tremelimumab), anti-PDL1 inhibitors (Atezolizumab, Avelomab, MSB0010718C, MEDI4736, and MPDL3280A), and anti-TIM3 inhibitors.
[0238] In one embodiment, the activated CAR T cells described herein can be used in combination with a chemotherapeutic agent. Exemplary chemotherapeutic agents include an anthracycline (e.g., doxorubicin (e.g., liposomal doxorubicin)), a vinca alkaloid (e.g., vinblastine, vincristine, vindesine, vinorelbine), an alkylating agent (e.g., cyclophosphamide, decarbazine, melphalan, ifosfamide, temozolomide), an immune cell antibody (e.g., alemtuzamab, gemtuzumab, rituximab, tositumomab), an antimetabolite (including, e.g., folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors (e.g., fludarabine)), an mTOR inhibitor, a TNFR glucocorticoid induced TNFR related protein (GITR) agonist, a proteasome inhibitor (e.g., aclacinomycin A, gliotoxin or bortezomib), an immunomodulator such as thalidomide or a thalidomide derivative (e.g., lenalidomide). General chemotherapeutic agents considered for use in combination therapies include anastrozole (Arimidex), bicalutamide (Casodex), bleomycin sulfate (Blenoxane), busulfan (Myleran), busulfan injection (Busulfex), capecitabine (Xeloda), N4-pentoxycarbonyl-5-deoxy-5-fluorocytidine, carboplatin (Paraplatin), carmustine (BiCNU), chlorambucil (Leukeran), cisplatin (Platinol), cladribine (Leustatin), cyclophosphamide (Cytoxan or Neosar), cytarabine, cytosine arabinoside (Cytosar-U), cytarabine liposome injection (DepoCyt), dacarbazine (DTIC-Dome), dactinomycin (Actinomycin D, Cosmegan), daunorubicin hydrochloride (Cerubidine), daunorubicin citrate liposome injection (DaunoXome), dexamethasone, docetaxel (Taxotere), doxorubicin hydrochloride (Adriamycin, Rubex), etoposide (Vepesid), fludarabine phosphate (Fludara), 5-fluorouracil (Adrucil, Efudex), flutamide (Eulexin), tezacitibine, Gemcitabine (difluorodeoxycitidine), hydroxyurea (Hydrea), Idarubicin (Idamycin), ifosfamide (IFEX), irinotecan (Camptosar), L-asparaginase (ELSPAR), leucovorin calcium, melphalan (Alkeran), 6-mercaptopurine (Purinethol), methotrexate (Folex), mitoxantrone (Novantrone), mylotarg, paclitaxel (Taxol), phoenix (Yttrium90/MX-DTPA), pentostatin, polifeprosan 20 with carmustine implant (Gliadel), tamoxifen citrate (Nolvadex), teniposide (Vumon), 6-thioguanine, thiotepa, tirapazamine (Tirazone), topotecan hydrochloride for injection (Hycamptin), vinblastine (Velban), vincristine (Oncovin), and vinorelbine (Navelbine). Exemplary alkylating agents include, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes): uracil mustard (Aminouracil Mustard, Chlorethaminacil, Demethyldopan, Desmethyldopan, Haemanthamine, Nordopan, Uracil nitrogen Mustard, Uracillost, Uracilmostaza, Uramustin, Uramustine), chlormethine (Mustargen), cyclophosphamide (Cytoxan, Neosar, Clafen, Endoxan, Procytox, Revimmune), ifosfamide (Mitoxana), melphalan (Alkeran), Chlorambucil (Leukeran), pipobroman (Amedel, Vercyte), triethylenemelamine (Hemel, Hexalen, Hexastat), triethylenethiophosphoramine, Temozolomide (Temodar), thiotepa (Thioplex), busulfan (Busilvex, Myleran), carmustine (BiCNU), lomustine (CeeNU), streptozocin (Zanosar), and Dacarbazine (DTIC-Dome). Additional exemplary alkylating agents include, without limitation, Oxaliplatin (Eloxatin); Temozolomide (Temodar and Temodal); Dactinomycin (also known as actinomycin-D, Cosmegen); Melphalan (also known as L-PAM, L-sarcolysin, and phenylalanine mustard, Alkeran); Altretamine (also known as hexamethylmelamine (HMM), Hexalen); Carmustine (BiCNU); Bendamustine (Treanda); Busulfan (Busulfex and Myleran); Carboplatin (Paraplatin); Lomustine (also known as CCNU, CeeNU); Cisplatin (also known as CDDP, Platinol and Platinol-AQ); Chlorambucil (Leukeran); Cyclophosphamide (Cytoxan and Neosar); Dacarbazine (also known as DTIC, DIC and imidazole carboxamide, DTIC-Dome); Altretamine (also known as hexamethylmelamine (HMM), Hexalen); Ifosfamide (Ifex); Prednumustine; Procarbazine (Matulane); Mechlorethamine (also known as nitrogen mustard, mustine and mechloroethamine hydrochloride, Mustargen); Streptozocin (Zanosar); Thiotepa (also known as thiophosphoamide, TESPA and TSPA, Thioplex); Cyclophosphamide (Endoxan, Cytoxan, Neosar, Procytox, Revimmune); and Bendamustine HCl (Treanda). Exemplary mTOR inhibitors include, e.g., temsirolimus; ridaforolimus (formally known as deferolimus, (1R,2R,45)-4-[(2R)-2 [(1R,95,125,15R,16E,18R,19R,21R,235,24E,26E,28Z,305,325,35R)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.049] hexatriaconta-16,24,26,28-tetraen-12-yl]propyl]-2-methoxycyclohexyl dimethylphosphinate, also known as AP23573 and MK8669, and described in PCT Publication No. WO 03/064383); everolimus (Afinitor or RADOO1); rapamycin (AY22989, Sirolimus); simapimod (CAS 164301-51-3); emsirolimus, (5-12,4-Bis[(35)-3-methylmorpholin-4-yl]pyrido[2,3-(i]pyrimidin-7-yl1-2-methoxyphenyl)methanol (AZD8055); 2-Amino-8-[iraw5,-4-(2-hydroxyethoxy)cyclohexyl]-6-(6-methoxy-3-pyridinyl)-4-methyl-pyrido[2,3-Mpyrimidin-7(8H)-one (PF04691502, CAS 1013101-36-4); and N2-[1,4-dioxo-4-[[4-(4-oxo-8-phenyl-4H-1-benzopyran-2-yl)morpholinium-4-yl]methoxy]butyl]-L-arginylglycyl-L-a-aspartylL-serine-(SEQ ID NO: 41), inner salt (SF1126, CAS 936487-67-1), and XL765. Exemplary immunomodulators include, e.g., afutuzumab (available from Roche); pegfilgrastim (Neulasta); lenalidomide (CC-5013, Revlimid); thalidomide (Thalomid), actimid (CC4047); and IRX-2 (mixture of human cytokines including interleukin 1, interleukin 2, and interferon , CAS 951209-71-5, available from IRX Therapeutics). Exemplary anthracyclines include, e.g., doxorubicin (Adriamycin and Rubex); bleomycin (Lenoxane); daunorubicin (dauorubicin hydrochloride, daunomycin, and rubidomycin hydrochloride, Cerubidine); daunorubicin liposomal (daunorubicin citrate liposome, DaunoXome); mitoxantrone (DHAD, Novantrone); epirubicin (Ellence); idarubicin (Idamycin, Idamycin PFS); mitomycin C (Mutamycin); geldanamycin; herbimycin; ravidomycin; and desacetylravidomycin. Exemplary vinca alkaloids include, e.g., vinorelbine tartrate (Navelbine), Vincristine (Oncovin), and Vindesine (Eldisine)); vinblastine (also known as vinblastine sulfate, vincaleukoblastine and VLB, Alkaban-AQ and Velban); and vinorelbine (Navelbine). Exemplary proteosome inhibitors include bortezomib (Velcade); carfilzomib (PX-171-007, (5)-4-Methyl-N-((5)-1-(((5)-4-methyl-1-((R)-2-methyloxiran-2-yl)-1-oxopentan-2-yl)amino)-1-oxo-3-phenylpropan-2-yl)-2-((5)-2-(2-morpholinoacetamido)-4-phenylbutanamido)-pentanamide); marizomib (NPT0052); ixazomib citrate (MLN-9708); delanzomib (CEP-18770); and O-Methyl-N-[(2-methyl-5-thiazolyl)carbonyl]-L-seryl-O-methyl-N-[(11S)-2-[(2R)-2-methyl-2-oxiranyl]-2-oxo-1-(phenylmethyl)ethyl]-L-serinamide (ONX-0912).
[0239] One of skill in the art can readily identify a chemotherapeutic agent of use (e.g. see Physicians' Cancer Chemotherapy Drug Manual 2014, Edward Chu, Vincent T. DeVita Jr., Jones & Bartlett Learning; Principles of Cancer Therapy, Chapter 85 in Harrison's Principles of Internal Medicine, 18th edition; Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology, Chs. 28-29 in Abeloff's Clinical Oncology, 2013 Elsevier; and Fischer D S (ed): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 2003).
[0240] In an embodiment, activated CAR T cells described herein are administered to a subject in combination with a molecule that decreases the level and/or activity of a molecule targeting GITR and/or modulating GITR functions, a molecule that decreases the Treg cell population, an mTOR inhibitor, a GITR agonist, a kinase inhibitor, a non-receptor tyrosine kinase inhibitor, a CDK4 inhibitor, and/or a BTK inhibitor.
[0241] Efficacy
[0242] The efficacy of activated CAR T cells in, e.g. the treatment of a condition described herein, or to induce a response as described herein (e.g. a reduction in cancer cells) can be determined by the skilled clinician. However, a treatment is considered effective treatment, as the term is used herein, if one or more of the signs or symptoms of a condition described herein is altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and/or the incidence of a condition treated according to the methods described herein or any other measurable parameter appropriate. Treatment according to the methods described herein can reduce levels of a marker or symptom of a condition, e.g. by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80% or at least 90% or more.
[0243] Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the disease is halted). Methods of measuring these indicators are known to those of skill in the art and/or are described herein.
[0244] Treatment includes any treatment of a disease in an individual or an animal (some non-limiting examples include a human or an animal) and includes: (1) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g. pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms. An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, for that disease. Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response. It is well within the ability of one skilled in the art to monitor efficacy of administration and/or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy of a given approach can be assessed in animal models of a condition described herein, for example treatment of ALL. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.
[0245] All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior technology or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.
[0246] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.
[0247] Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.
[0248] The technology described herein is further illustrated by the following examples which in no way should be construed as being further limiting.
[0249] Some embodiments of the technology described herein can be defined according to any of the following numbered paragraphs: [0250] 1. A chimeric antigen receptor (CAR) polypeptide comprising: [0251] a. an extracellular domain comprising a target-binding sequence; [0252] b. a transmembrane domain; [0253] c. a co-stimulatory domain; and [0254] d. a T cell intracellular signaling domain that lacks a functional ITAM3 sequence. [0255] 2. The CAR polypeptide of paragraph 1, wherein the transmembrane domain is the transmembrane domain from is CD8 or 4-1BB. [0256] 3. The CAR polypeptide of paragraph 1, wherein the co-stimulatory domain is the co-stimulatory domain of 4-1BB. [0257] 4. The CAR polypeptide of any of paragraphs 1-3, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34. [0258] 5. The CAR polypeptide of any of paragraphs 1-4, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13. [0259] 6. The CAR polypeptide of any of paragraphs 1-5, wherein the T-cell intracellular signaling domain is the intracellular signaling domain of CD3 or CD3. [0260] 7. The CAR polypeptide of any of paragraphs 1-6, wherein the target-binding sequence comprises a ligand of the target or an antibody reagent that specifically binds the target. [0261] 8. The CAR polypeptide of any of paragraphs 1-7, wherein the target is B cell maturation antigen (BCMA). [0262] 9. The CAR polypeptide of any of paragraphs 1-8, wherein the target is CD37. [0263] 10. The CAR polypeptide of any of paragraphs 1-9, wherein the antibody reagent comprises an scFv. [0264] 11. The CAR polypeptide of any of paragraphs 1-10, wherein the antibody reagent has the sequence selected from SEQ ID NO: 1, 5, or 9. [0265] 12. A chimeric antigen receptor (CAR) polypeptide comprising: [0266] a. an extracellular domain comprising a BCMA-binding sequence; [0267] b. a transmembrane domain of CD8; [0268] c. a co-stimulatory domain of a 4-1BB; and [0269] d. a T cell intracellular signaling domain that lacks a functional ITAM3 sequence. [0270] 13. The CAR polypeptide of paragraph 12, wherein the BCMA-binding sequence comprises a ligand of BCMA or an antibody reagent that specifically binds BCMA. [0271] 14. The CAR polypeptide of any of paragraphs 12-13, wherein the antibody reagent comprises a scFv. [0272] 15. The CAR polypeptide of any of paragraphs 12-14, wherein the antibody reagent the sequence of SEQ ID NO: 1 [0273] 16. The CAR polypeptide of any of paragraphs 12-15, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34. [0274] 17. The CAR polypeptide of any of paragraphs 12-16, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13. [0275] 18. A chimeric antigen receptor (CAR) polypeptide comprising: [0276] a. an extracellular domain comprising a CD37-binding sequence; [0277] b. a transmembrane domain of CD8; [0278] c. a co-stimulatory domain of a 4-1BB; and [0279] d. a T cell intracellular signaling domain that lacks a functional ITAM3 sequence. [0280] 19. The CAR polypeptide of paragraph 18, wherein the CD37-binding sequence comprises a ligand of CD37 or an antibody reagent that specifically binds BCMA. [0281] 20. The CAR polypeptide of any of paragraphs 18-19, wherein the antibody reagent comprises a scFv. [0282] 21. The CAR polypeptide of any of paragraphs 18-20, wherein the scFv has a sequence selected from SEQ ID NO: 5 or 9. [0283] 22. The CAR polypeptide of any of paragraphs 18-21, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence selected from SEQ ID NOs: 13, 14, 33, or 34. [0284] 23. The CAR polypeptide of any of paragraphs 18-22, wherein the intracellular signaling domain comprises a CD3 ITAM3 sequence comprising a deletion relative to the CD3 ITAM3 sequence of SEQ ID NO: 13. [0285] 24. A mammalian cell comprising: [0286] a. the CAR polypeptide of any of paragraphs 1-23; or [0287] b. a nucleic acid encoding any of the CAR polypeptides of any of paragraphs 1-23. [0288] 25. The cell of paragraph 24, wherein the cell is a T cell. [0289] 26. The cell of any of paragraphs 24-25, wherein the cell is a human cell. [0290] 27. The cell of any of paragraphs 24-26, wherein the cell is obtained from an individual having or diagnosed as having cancer, a plasma cell disorder, or autoimmune disease. [0291] 28. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: [0292] a. engineering a T cell to comprise a CAR polypeptide of any of paragraphs 1-22 on the T cell surface; [0293] b. administering the engineered T cell to the subject. [0294] 29. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: [0295] a. administering the cell of any of paragraphs 24-28 to the subject. [0296] 30. The method of any of paragraphs 28-29, wherein the cancer is a CD37+ or BCMA+ cancer. [0297] 31. The method of any of paragraphs 28-30, wherein the CD37+ cancer is lymphoma or leukemia. [0298] 32. The method of paragraph 31, wherein the lymphoma is B-cell Non-Hodgkin Lymphoma (NHL), mantle cell lymphoma, Burkitt's lymphoma, B cell lymphoblastic lymphoma or T cell lymphoma (e.g., peripheral T cell lymphoma (PTCL), including cutaneous T-cell lymphoma (CTCL) and anaplastic large cell lymphoma (ALCL)). [0299] 33. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: [0300] a. engineering a T cell to comprise a CAR polypeptide of paragraph 18 on the T cell surface; [0301] b. administering the engineered T cell to the subject; [0302] wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy. [0303] 34. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising administering a cell of any of paragraphs 24-27 to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; [0304] wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy. [0305] 35. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: [0306] a. selecting a subject who is non-responsive to anti-CD19 and/or anti-CD20 therapy; [0307] b. engineering a T cell to comprise a CAR polypeptide of paragraph 18 on the T cell surface; [0308] c. administering the engineered T cell to the subject; [0309] wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy. [0310] 36. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: [0311] a. selecting a subject who is non-responsive to anti-CD19 and/or anti-CD20 therapy; [0312] b. administering a cell of any of paragraphs 24-27 to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; [0313] wherein the subject is non-responsive to anti-CD19 and/or anti-CD20 therapy. [0314] 37. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising: [0315] a. engineering a T cell to comprise a CAR polypeptide of paragraph 18 on the T cell surface; [0316] b. administering the engineered T cell to the subject; [0317] wherein the subject is concurrently administered an anti-CD19 and/or anti-CD20 therapy. [0318] 38. A method of treating cancer, a plasma cell disorder, or an autoimmune disease in a subject in need thereof, the method comprising administering a cell of any of paragraphs 24-27 to the subject, wherein the cell comprises CAR comprising an extracellular domain comprising a CD37-binding sequence; [0319] wherein the subject is concurrently administered an anti-CD19 and/or anti-CD20 therapy. [0320] 39. A composition comprising the CAR T cells of paragraphs 1-27 formulated for the treatment of cancer. [0321] 40. The composition of paragraph 39, further comprising a pharmaceutically acceptable carrier. [0322] 41. The method of paragraph 31, wherein the leukemia is acute myeloid leukemia (AML).
EXAMPLES
Example 1
[0323] Described herein are methods and compositions relating to alternative signal 1 domains based on alternatives to CD3 zeta, including mutated ITAMs from CD3 (which contains 3 ITAM motifs), truncations of CD3 zeta, and alternative splice variants known as CD3 eta, CD3, and artificial constructs engineered to express fusions between CD3 eta or theta and zeta. Thus, described herein are alternative signal 1 transducers to form optimally signaling CARs. The resulting alternative CARs decouple the cytotoxic signal from the activation-induced cell death signal which is mediated by engagement of the CAR and activation of CD3 zeta, thus resulting in more potent CAR-alternative T cells compared to CAR-original T cells. These CAR T cells are contemplated for use in the treatment of cancer, infectious diseases, and transplantation indications.
Example 2
[0324] Development and Optimization of a Genetically-Engineered T Cell Therapy for Advanced Multiple Myeloma.
[0325] It is contemplated herein that T cells can be genetically engineered to target the B cell maturation antigen (BCMA), a transmembrane receptor constitutively expressed on multiple myeloma cells, for use as adoptive immunotherapy for advanced multiple myeloma.
[0326] The use of T cells engineered with a chimeric antigen receptor (CAR) in the clinic has achieved unprecedented results in the treatment of leukemias and lymphomas in the past five years. CAR T cells targeting CD19, a molecule expressed on leukemic B cells, induce complete remission in 95% of patients suffering from relapsed or refractory (r/r) acute lymphoblastic leukemia (ALL). The remarkable effects of this novel therapy have also been observed in patients with (r/r) follicular lymphoma, diffuse large B cell lymphoma, and chronic lymphocytic leukemia (3,5,6,9).
[0327] B-cell maturation antigen (BCMA) is a member of the tumor necrosis receptor family (TNRF) which is constitutively expressed as a transmembrane protein in terminally differentiated B cells. Binding of BCMA with its cognate ligands results in the generation of pro-survival and proliferative cues to mature B cells, plasma cells, and multiple myeloma cells (10). Described herein is the development of a CAR based on the single-chain variable region (scFv) of a monoclonal antibody (mAb) specific for human BCMA(11). In addition, multiple versions of this CAR are examined for decoupling of T-cell intrinsic functions such as cellular expansion and cytokine production. The approach examines modification of signaling capacity of CAR T cells to dampen cytokine release without affecting their proliferative potential, as the major CAR T-cell-associated toxicity has been associated with the production of cytokines (clinically defined as cytokine release syndrome, CRS). Finally, these modified CARs can be utilized in pre-clinical studies and in a dose-escalating phase I clinical trial to treat patients suffering from advanced multiple myeloma. The generic configuration of the proposed BCMA-targeted CAR is shown in
[0328] Described herein is the characterization and validation of a BCMA-targeted chimeric antigenic receptor (CAR) to treat advanced multiple myeloma, e.g., a BCMA-specific CAR is described herein. Preliminary data indicate that primary human T cells transduced with this CAR (
[0329] To validate BCMA-directed CAR T cells using xenogeneic models of multiple myeloma. Immunodeficient NSG mice grafted with human tumors and human T cells have emerged as the standard pre-clinical animal model in which to test CAR T cell functions. A xenograft model of multiple myeloma (
[0330] Statistical Analysis
[0331] Since most of these experiments are performed simultaneously in comparison to a single control dataset, the majority of the results are analyzed by unpaired Student's t-tests. p-values less than 0.05 as statistically significant. All experiments will be repeated with T cells from at least 3 healthy donors.
REFERENCES
[0332] 1. Melenhorst J J, Lacey S., Bedoya F. Chimeric antigen receptor T cells: Self-replicating drugs for cancer. Curr Drug Targets (2015). [0333] 2. Maus, M. V., Grupp, S. A., Porter, D. L. & June, C. H. Antibody modified T cells: CARs take the front seat for hematologic malignancies. Blood (2014). [0334] 3. Maus, M. V., et al. Adoptive immunotherapy for cancer or viruses. Annual review of immunology 32, 189-225 (2014). [0335] 4. Sadelain, M., Riviere, I. & Brentjens, R. Targeting tumours with genetically enhanced T lymphocytes. Nature reviews. Cancer 3, 35-45 (2003). [0336] 5. Grupp, S. A., et al. Chimeric antigen receptor-modified T cells for acute lymphoid leukemia. New England Journal of Medicine 368, 1509-1518 (2013). [0337] 6. Maude, S. L., Teachey, D. T., Porter, D. L. & Grupp, S. A. CD19-targeted chimeric antigen receptor T-cell therapy for acute lymphoblastic leukemia. Blood 125, 4017-4023 (2015). [0338] 7. Ledford, H. Immunotherapy's cancer remit widens. Nature 497, 544 (2013). Combadiere, B., et al. Qualitative and quantitative contributions of the T cell receptor zeta chain to mature T cell apoptosis. The Journal of experimental medicine 183, 2109-2117 (1996). [0339] 8. Kochenderfer, J. N., Yu, Z., Frasheri, D., Restifo, N. P. & Rosenberg, S. A. Adoptive transfer of syngeneic T cells transduced with a chimeric antigen receptor that recognizes murine CD19 can eradicate lymphoma and normal B cells. Blood 116, 3875-3886 (2010). [0340] 9. Carpenter, R. O., et al. B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma. Clinical cancer research: an official journal of the American Association for Cancer Research 19, 2048-2060 (2013). [0341] 10. Tai, Y. T., et al. Novel anti-B-cell maturation antigen antibody-drug conjugate (GSK2857916) selectively induces killing of multiple myeloma. Blood 123, 3128-3138 (2014).
Example 3
[0342] scFv from a humanized anti-BCMA mAb was used to construct anti-BCMA CAR construct cloned into a lentivirus vector (
[0343] CARs with alternative intracellular signaling domains were constructed (
[0344] CAR-specific cytokine production was examined and no statistically significant difference was found using 3 normal donors and one-way ANOVA (
[0345] Expression of the early activation marker CD69 was examined after CAR stimulation (
[0346] CD107a degranulation was tested. ND29 degranulation was measured 5 hr after CAR stimulation with K562-BCMA.sup.+ cells (
[0347] CD3 KO T cells were constructed and stained for CD3epsilon (also, CD3zeta, TCR alpha and beta). The cells were stimulated with K562-BCMA+ cells (
[0348] In in vivo assays, anti-BCMA CAR T Cells with mutITAM3 have better killing capacity and persistence (
[0349] CAR-T lacking ITAM3 were analyzed and found to differentiate into cells associated with better survival capacity such as nave-like (stem cell memory) and central memory T cells (
[0350] Described herein are CAR T cells targeting BCMA that can efficiently lyse multiple myeloma cells. All the BCMA-CARs tested (CD3 mutants and isoforms) have similar tumoricidal capacity as CAR T cells bearing a wild-type C CD3 domain. CARs with an inactive ITAM3 have better persistence in vivo, possibly due to higher percentage of stem cell memory T cells (Tscm).
Example 4
[0351] A number of alternative CARs were designed (
[0352] To determine if the CD3 domain was necessary for CAR function, 4-1BBSTOP CAR was constructed (
[0353] The tested constructs demonstrated tumor killing activity (
[0354] In vivo cytotoxicity was tested using 20 NSG mice (4 mice/condition) (
Example 5
[0355] Described herein is the use of genetically modified T cells expressing anti-CD37 chimeric antigen receptor (CAR) to treat CD37 positive malignancies including B cell-NHL. The CAR comprises CD37 binding domain, CD8 transmembrane domain, 4-1 BB costimulatory signaling region, and a CD3 signaling domain. In another embodiment, the CD3 domain can be replaced with CD3 eta, CD3 theta, and/or other ITAM-containing variants of CD3-related signaling domains. CAR T cells are generated by introducing a lentiviral vector comprising CD37-CAR in primary human T cells. In vitro data demonstrated specific activation, proliferation, and killing of CD37 positive cancer cells by anti-CD37 CAR T cells. CD37 is detectable in certain cancer-related cell lines (
[0356] Anti-CD37 CAR Ts can be administered to mice to demonstrate tumor clearance in vivo (
Example 6
[0357] Anti-CD37 Chimeric Antigen Receptor T Cells: A New Potential Therapeutic Option for B-Cell Malignancies.
[0358] CD37 is a tetraspanin expressed on mature B cells but absent on early progenitors or terminally differentiated plasma cells. CD37 is highly expressed on malignant B cells in non-Hodgkin lymphomas (NHL), including mantle cell lymphoma (MCL), diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL), Burkitt lymphoma and B-cell chronic lymphocytic leukemia (CLL); thus, CD37 represents a promising target for B-cell malignancies, particularly for variants that escape existing therapies targeting the common B cell antigens CD19 and CD20.
[0359] Described herein is an anti-CD37 CAR (CAR-37) for the treatment of B-cell malignancies. Specifically, described herein is a second-generation CAR, encoded by a lentiviral vector and bearing a 4-1BB costimulatory domain. Two different orientations of a humanized murine antibody-derived single-chain variable fragment (V.sub.L-V.sub.H or V.sub.H-V.sub.L) were tested and a and pre-clinical data panel is provided herein.
[0360] Results
[0361] In vitro cytotoxic activity of CAR T-37 cells was evaluated by co-culturing CAR T-37 cells with CD37-expressing human tumor cell lines (RAJI, OSU-CLL and JEKO-1) at different effector to target ratios. CD37-directed CAR T cells demonstrated antigen-specific activation, proliferation, cytokine production, and cytotoxic activity in vitro in multiple models of B cell malignancy. Next, the anti-lymphoma efficacy was assessed in vivo in a mantle cell lymphoma model. CAR-37 treatment eliminated the tumor cells within 2 weeks, and mice maintained durable remissions. CAR T cells were detectable in the blood of mice after 7 days of injection. Ongoing studies are evaluating the long term persistence of CAR T cells in mice.
[0362] Discussion
[0363] Taken together these results demonstrate that T cells expressing anti-CD37 CAR have substantial activity in vitro and in vivo against B cell malignancies. These findings indicated that CD37-CAR T cells are a novel potential therapeutic agent for the treatment of patients with CD37 expressing tumors.
Example 7
[0364] CD37 is highly expressed in B cell malignancies (
[0365] The anti-CD37 CAR T cells were demonstrated to expand upon stimulation (
[0366] The anti-CD37 CAR Ts were demonstrated to lyse tumor cells in vitro (
Example 8
[0367] scFv Sequences
[0368] BCMA scFv (SEQ ID NO: 1) comprises a VH chain (amino acids 1-121 (SEQ ID NO: 2)), a linker region (amino acids 122-141 (SEQ ID NO: 3)), and a VL chain (amino acids 142-249 (SEQ ID NO: 4)).
TABLE-US-00001 (SEQIDNO:1) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYWMHWVRQAPGQGLEW MGATYRGHSDTYYNQKFKGRVTITADKSTSTAYMELSSLRSEDTAVY YCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGS DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKLL IYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYRKL PWTFGQGTKLEIKR
[0369] VH chain (SEQ ID NO: 2 (amino acids 1-121 of SEQ ID NO: 1))
TABLE-US-00002 (SEQIDNO:2) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYWMHWVRQAPGQGLEW MGATYRGHSDTYYNQKFKGRVTITADKSTSTAYMELSSLRSEDTAVY YCARGAIYNGYDVLDNWGQGTLVTVSS
[0370] Linker region (SEQ ID NO: 3 (amino acids 122-141 of SEQ ID NO: 1))
TABLE-US-00003 (SEQIDNO:3) GGGGSGGGGSGGGGSGGGGS
[0371] VL chain (SEQ ID NO: 4 (amino acids 142-249 SEQ ID NO: 1))
TABLE-US-00004 (SEQIDNO:4) DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKLL IYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYRKL PWTFGQGTKLEIKR
[0372] CD37 scFv VH-VL (SEQ ID NO: 5) comprises a VH chain (amino acids 1-116 (SEQ ID NO: 6)), a linker region (amino acids 117-136 (SEQ ID NO: 7)), and a VL chain (amino acids 137-244 (SEQ ID NO: 8)).
TABLE-US-00005 (SEQIDNO:5) AVQLVQSGAEVKKPGSSVKVSCKASGYSFTGYNMNWVRQAPGQGLEW MGNIDPYYGGTTYNRKFKGRVTLTVDKSSSTAYMELSSLRSEDTAVY YCARSVGPMDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMT QSPSSLSASVGDRVTITCRTSENVYSYLAWYQQKPGKAPKLLVSSAK TLAEFVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQHHSDNPWTFG QGTKVEIKR
[0373] VH chain (SEQ ID NO: 6 (amino acids 1-116 of SEQ ID NO: 5)
TABLE-US-00006 (SEQIDNO:6) AVQLVQSGAEVKKPGSSVKVSCKASGYSFTGYNMNWVRQAPGQGLEW MGNIDPYYGGTTYNRKFKGRVTLTVDKSSSTAYMELSSLRSEDTAVY YCARSVGPMDYWGQGTLVTVSS
[0374] Linker region (SEQ ID NO: 7 (amino acids 117-136 of SEQ ID NO: 5)
TABLE-US-00007 (SEQIDNO:7) GGGGSGGGGSGGGGSGGGGS
[0375] VL chain (SEQ ID NO: 8 (amino acids 137-244 SEQ ID NO: 5)
TABLE-US-00008 (SEQIDNO:8) DIQMTQSPSSLSASVGDRVTITCRTSENVYSYLAWYQQKPGKAPKLL VSSAKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQHHSDN PWTFGQGTKVEIKR
[0376] CD37 scFv VL-VH (SEQ ID NO: 9) comprises a VL chain (amino acids 1-108 (SEQ ID NO: 10)), a linker region (amino acids 109-128 (SEQ ID NO: 11)), and a VH chain (amino acids 129-244 (SEQ ID NO: 12)).
TABLE-US-00009 (SEQIDNO:9) DIQMTQSPSSLSASVGDRVTITCRTSENVYSYLAWYQQKPGKAPKLL VSSAKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQHHSDN PWTFGQGTKVEIKRGGGGSGGGGSGGGGSGGGGSAVQLVQSGAEVKK PGSSVKVSCKASGYSFTGYNMNWVRQAPGQGLEWMGNIDPYYGGTTY NRKFKGRVTLTVDKSSSTAYMELSSLRSEDTAVYYCARSVGPMDYWG QGTLVTVSS
[0377] VL chain (SEQ ID NO: 10 (amino acids 1-108 of SEQ ID NO: 9))
TABLE-US-00010 (SEQIDNO:10) DIQMTQSPSSLSASVGDRVTITCRTSENVYSYLAWYQQKPGKAPKLL VSSAKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQHHSDN PWTFGQGTKVEIKR
[0378] Linker region (SEQ ID NO: 11 (amino acids 109-128 of SEQ ID NO: 9))
TABLE-US-00011 (SEQIDNO:11) GGGGSGGGGSGGGGSGGGGS
[0379] VH chain (SEQ ID NO: 12 (amino acids 129-244 SEQ ID NO: 9))
TABLE-US-00012 (SEQIDNO:12) AVQLVQSGAEVKKPGSSVKVSCKASGYSFTGYNMNWVRQAPGQGLEWMGN IDPYYGGTTYNRKFKGRVTLTVDKSSSTAYMELSSLRSEDTAVYYCARSV GPMDYWGQGTLVTVSS
Example 9
[0380] ITAM Sequences
[0381] CD3-ITAM 3 (SEQ ID NO: 13)
TABLE-US-00013 (SEQIDNO:13) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0382] CD3-mutITAM 1 (SEQ ID NO: 14). As described herein, certain residues are mutated in CD3-ITAM 3 to inhibit the function of CD3-ITAM 3, namely: Y21 and Y32. The locations of these residues are depicted below with bold type.
TABLE-US-00014 (SEQIDNO:14) RVKFSRSADAPAYQQGQNQLFNELNLGRREEFDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0383] CD3-mutITAM1 and mutITAM2 (SEQ ID NO: 33). As described herein, certain residues are mutated in CD3-ITAM 3 to inhibit the function of CD3-ITAM 3, namely: Y21, Y32, Y59 and Y71. The locations of these residues are depicted below with bold type.
TABLE-US-00015 (SEQIDNO:33) RVKFSRSADAPAYQQGQNQLFNELNLGRREEFDVLDKRRGRDPEMGGKPR RKNPQEGLFNELQKDKMAEAFSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0384] CD3-mutITAM1 and mutITAM3 (SEQ ID NO: 34). As described herein, certain residues are mutated in CD3-ITAM 3 to inhibit the function of CD3-ITAM 3, namely: Y21, Y32, Y90 and Y100. The locations of these residues are depicted below with bold type.
TABLE-US-00016 (SEQIDNO:34) RVKFSRSADAPAYQQGQNQLFNELNLGRREEFDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLFQGLSTATKDT FDALHMQALPPR
Example 10
[0385] CAR Sequences
[0386] pMGH8-CD8Leader/anti-BCMA/CD8hinge+TM/4-1BB/CD3 (SEQ ID NO: 15) comprising CD8 leader sequence (amino acids 1-21 (SEQ ID NO: 16)); anti-BCMA (amino acids 22-270 (SEQ ID NO: 17)); CD8 hinge and TM domain (amino acids 271-339 (SEQ ID NO: 18)); 4-1BB (amino acids 340-381 (SEQ ID NO: 19)); and CD3 (amino acids 382-493 (SEQ ID NO: 20)).
TABLE-US-00017 (SEQIDNO:15) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
[0387] CD8 leader sequence (SEQ ID NO: 16 (amino acids 1-21 of SEQ ID NO: 15))
TABLE-US-00018 (SEQIDNO:16) MALPVTALLLPLALLLHAARP
[0388] anti-BCMA (SEQ ID NO: 17 (amino acids 22-270 of SEQ ID NO: 15))
TABLE-US-00019 (SEQIDNO:17) QVQLVQSGAEVKKPGSSVKVSCKASGGTFSNYWMHWVRQAPGQGLEWMGA TYRGHSDTYYNQKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARGA IYNGYDVLDNWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPS SLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKLLIYYTSNLHSGVP SRFSGSGSGTDFTLTISSLQPEDFATYYCQQYRKLPWTFGQGTKLEIKR
[0389] CD8 hinge and TM domain (SEQ ID NO: 18 (amino acids 271-339 of SEQ ID NO: 15))
TABLE-US-00020 (SEQIDNO:18) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
[0390] 4-1BB (SEQ ID NO: 19 (amino acids 340-381 of SEQ ID NO: 15))
TABLE-US-00021 (SEQIDNO:19) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
[0391] CD3 (SEQ ID NO: 20 (amino acids 382-493 of SEQ ID NO: 15))
TABLE-US-00022 (SEQIDNO:20) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0392] pMGH8-CD8Leader/anti-CD37 H-L/CD8hinge+TM/4-1BB/CD3 (SEQ ID NO: 21) comprising CD8 leader sequence (amino acids 1-21 (SEQ ID NO: 22)); anti-CD37 H-L (amino acids 22-265 (SEQ ID NO: 23)); CD8 hinge and TM domain (amino acids 266-334 (SEQ ID NO: 24)); 4-1BB (amino acids 335-376 (SEQ ID NO: 25)); and CD3 (amino acids 377-488 (SEQ ID NO: 26)).
TABLE-US-00023 (SEQIDNO:21) MALPVTALLLPLALLLHAARPDIQMTQSPSSLSASVGDRVTITCRTSENV YSYLAWYQQKPGKAPKLLVSSAKTLAEGVPSRFSGSGSGTDFTLTISSLQ PEDFATYFCQHHSDNPWTFGQGTKVEIKRGGGGSGGGGSGGGGSGGGGSA VQLVQSGAEVKKPGSSVKVSCKASGYSFTGYNMNWVRQAPGQGLEWMGNI DPYYGGTTYNRKFKGRVTLTVDKSSSTAYMELSSLRSEDTAVYYCARSVG PMDYWGQGTLVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAV HTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFM RPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
[0393] CD8 leader sequence (SEQ ID NO: 22 (amino acids 1-21 of SEQ ID NO: 21))
TABLE-US-00024 (SEQIDNO:22) MALPVTALLLPLALLLHAARP
[0394] anti-CD37 H-L (SEQ ID NO: 23 (amino acids 22-265 of SEQ ID NO: 21))
TABLE-US-00025 (SEQIDNO:23) DIQMTQSPSSLSASVGDRVTITCRTSENVYSYLAWYQQKPGKAPKLLVSS AKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQHHSDNPWTFGQ GTKVEIKRGGGGSGGGGSGGGGSGGGGSAVQLVQSGAEVKKPGSSVKVSC KASGYSFTGYNMNWVRQAPGQGLEWMGNIDPYYGGTTYNRKFKGRVTLTV DKSSSTAYMELSSLRSEDTAVYYCARSVGPMDYWGQGTLVTVSS
[0395] CD8 hinge and TM domain SEQ ID NO: 24 ((amino acids 266-334 of SEQ ID NO: 21))
TABLE-US-00026 (SEQIDNO:24) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
[0396] 4-1BB (SEQ ID NO: 25 (amino acids 335-376 of SEQ ID NO: 21))
TABLE-US-00027 (SEQIDNO:25) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
[0397] CD3 (SEQ ID NO: 26 (amino acids 377-488 of SEQ ID NO: 21))
TABLE-US-00028 (SEQIDNO:26) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0398] pMGH8-CD8Leader/anti-CD37 L-H/CD8hinge+TM/4-1BB/CD3 (SEQ ID NO: 27) comprising CD8 leader sequence (amino acids 1-21 (SEQ ID NO: 28)); anti-CD37 L-H (amino acids 22-265 (SEQ ID NO: 29)); CD8 hinge and TM domain (amino acids 266-334 (SEQ ID NO: 30)); 4-1BB (amino acids 335-376 (SEQ ID NO: 31)); and CD3 (amino acids 377-488 (SEQ ID NO: 32)).
TABLE-US-00029 (SEQIDNO:27) MALPVTALLLPLALLLHAARPAVQLVQSGAEVKKPGSSVKVSCKASGYSF TGYNMNWVRQAPGQGLEWMGNIDPYYGGTTYNRKFKGRVTLTVDKSSSTA YMELSSLRSEDTAVYYCARSVGPMDYWGQGTLVTVSSGGGGSGGGGSGGG GSGGGGSDIQMTQSPSSLSASVGDRVTITCRTSENVYSYLAWYQQKPGKA PKLLVSSAKTLAEGVPSRFSGSGSGTDFTLTISSLQPEDFATYFCQHHSD NPWTFGQGTKVEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAV HTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIFKQPFM RPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEI GMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
[0399] CD8 leader sequence (SEQ ID NO: 28 (amino acids 1-21 of SEQ ID NO: 27))
TABLE-US-00030 (SEQIDNO:28) MALPVTALLLPLALLLHAARP
[0400] anti-CD37 L-H (SEQ ID NO: 29 (amino acids 22-265 of SEQ ID NO: 27))
TABLE-US-00031 (SEQIDNO:29) AVQLVQSGAEVKKPGSSVKVSCKASGYSFTGYNMNWVRQAPGQGLEWMGN IDPYYGGTTYNRKFKGRVTLTVDKSSSTAYMELSSLRSEDTAVYYCARSV GPMDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGGGSDIQMTQSPSSLSAS VGDRVTITCRTSENVYSYLAWYQQKPGKAPKLLVSSAKTLAEGVPSRFSG SGSGTDFTLTISSLQPEDFATYFCQHHSDNPWTFGQGTKVEIKR
[0401] CD8 hinge and TM domain SEQ ID NO: 30 ((amino acids 266-334 of SEQ ID NO: 27))
TABLE-US-00032 (SEQIDNO:30) TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWA PLAGTCGVLLLSLVITLYC
[0402] 4-1BB (SEQ ID NO: 31 (amino acids 335-376 of SEQ ID NO: 27))
TABLE-US-00033 (SEQIDNO:31) KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL
[0403] CD3 (SEQ ID NO: 32 (amino acids 377-488 of SEQ ID NO: 27))
TABLE-US-00034 (SEQIDNO:32) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPR RKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDT YDALHMQALPPR
[0404] anti-BCMA CAR-mutITAM1 (SEQ ID NO: 35). As described herein, certain residues are mutated in this anti-BCMA CAR to inhibit the function of CD3-ITAM, namely: Y402 and Y413 of SEQ ID NO: 35. The locations of these residues are depicted below with bold type.
TABLE-US-00035 (SEQIDNO:35) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LFNELNLGRREEFDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
[0405] anti-BCMA CAR-mutITAM2 (SEQ ID NO: 36). As described herein, certain residues are mutated in this anti-BCMA CAR to inhibit the function of CD3-ITAM, namely: Y440 and Y452 of SEQ ID NO: 36. The locations of these residues are depicted below with bold type.
TABLE-US-00036 (SEQIDNO:36) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLFNELQKDKMAE AFSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
[0406] anti-BCMA CAR-mutITAM3 (SEQ ID NO: 37). As described herein, certain residues are mutated in this anti-BCMA CAR to inhibit the function of CD3-ITAM, namely: Y471 and Y482 of SEQ ID NO: 37. The locations of these residues are depicted below with bold type.
TABLE-US-00037 (SEQIDNO:37) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLFQGLSTATKDTFDALHMQALPPR
[0407] anti-BCMA CAR-mutITAM1 and mutITAM3 (SEQ ID NO: 38). As described herein, certain residues are mutated in this anti-BCMA CAR to inhibit the function of CD3-ITAM, namely: Y402, Y413, Y471 and Y482 of SEQ ID NO: 38. The locations of these residues are depicted below with bold type.
TABLE-US-00038 (SEQIDNO:38) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LFNELNLGRREEFDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLFQGLSTATKDTFDALHMQALPPR
[0408] CD3 eta CAR (SEQ ID NO: 39)
TABLE-US-00039 (SEQIDNO:39) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQDSHFQAVPVQEKKKRLRRAPWRAFAQPQ RLKHPAEQPIVRQCLQRPPLCGVLGPVQQQLPPSLGPVLSPHSDPGWCRV DDGGDGVFSGGGGEGRGSLLTCGDVEENPGPRMVSKGEEDNMAIIKEFMR FKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSP QFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSL QDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQ RLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQ YERAEGRHSTGGMDELYK
[0409] CD3 theta CAR (SEQ ID NO: 40)
TABLE-US-00040 (SEQIDNO:40) MALPVTALLLPLALLLHAARPQVQLVQSGAEVKKPGSSVKVSCKASGGTF SNYWMHWVRQAPGQGLEWMGATYRGHSDTYYNQKFKGRVTITADKSTSTA YMELSSLRSEDTAVYYCARGAIYNGYDVLDNWGQGTLVTVSSGGGGSGGG GSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQ KPGKAPKLLIYYTSNLHSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYRKLPWTFGQGTKLEIKRTTTPAPRPPTPAPTIASQPLSLRPEACRPA AGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLYIF KQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQ LYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAE AYSEIGMKGERRRGKGHDGLYQDSHFQAVPVQEKKKRLRRAPWRAFAQPQ RLKHRNNELPDSLEPIYKNIWNKTFIGESGGGGEGRGSLLTCGDVEENPG PRMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQT AKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGW EASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAY NVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Example 11
Anti-CD37 CAR-T Cells Effective Against B Cell Malignancies
[0410] CD37 is a tetraspanin expressed on mature B cells but absent on early progenitors or terminally differentiated plasma cells. It is highly expressed on malignant B cells and it represents a promising target for B-cell malignancies, particularly for variants that escape existing therapies targeting the common B-cell antigens CD19 and CD20. We designed the first anti-CD37 CAR (CAR-37) for the treatment of B-cell malignancies. In vitro cytotoxic activity of CART-37 cells was evaluated by co-culturing CART-37 cells with CD 37-expressing human tumor cell lines at different effector to target ratios. CD37-directed CAR T cells demonstrated antigen-specific proliferation, cytokine production, and cytotoxic activity in vitro in multiple models of B-cell malignancy. We assessed the anti-lymphoma efficacy in vivo in a mantle cell lymphoma model. CAR-37 treatment eliminated the tumor cells within 2 weeks, and mice maintained durable remissions. Together these results show that T cells expressing anti-CD37 CAR have substantial activity in vitro and in vivo against B-cell malignancies. These findings indicated that CD37-CAR T cells are a novel potential therapeutic agent for the treatment of patients with CD37-expressing tumors.
[0411] In normal tissues, CD37 expression is restricted to lymphoid organs (
[0412] CAR-37 T cells are able to proliferate and expand ex-vivo (
[0413] T cells expressing anti-CD37 CAR have substantial in vitro activity against mantle cell lymphoma, Burkitt lymphoma and B-cell lymphoblastic leukemia tumor cells (
[0414] T cells expressing anti-CD37 CAR have a strong anti-tumor activity in a mantle cell lymphoma model in vivo (
Example 12
CD37 and CD19 Expression in Human Tumor Cell Lines
[0415] The expression of CD37 and CD19 in human tumor cell lines was evaluated (
Example 13
Anti-CD37 CAR-T Cells are Effective Against MCL PDX Tumors
[0416] The efficacy of anti-CD37 CAR-T cells against MCL PDX cells was evaluated in vivo.
Example 14
CD37 Expression in Peripheral T Cell Lymphoma (PTCL)
[0417] The expression of CD37 was evaluated in PTCL cell lines, including HUT78 (cutaneous T-cell lymphoma (CTCL)) and FEPD (anaplastic large cell lymphoma (ALCL)) (
Example 15
[0418] Anti-CD37 CAR-T Cells have In Vitro Cytotoxic Activity Against PTCL Cell Lines
[0419] The in vitro cytotoxic activity of anti-CD37 CAR-T cells against PTCL lines was evaluated (
Example 16
CD37 Expression in AML
[0420] CD37 expression has been detected in AML samples (Pereira et al. Mol. Cancer Ther. 14(7):1650-1660, 2015). The expression of CD37 in AML cell lines was evaluated in the AML cell lines TF1, MOLM13, and THP by flow cytometry (